1LNMA

Anticalin diga16 in complex with digitoxigenin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
167
structure length
160
Chain Sequence
b'DGACPEVKPVDNFDWSQYHGKWWQVAAYPDHITKYGKCGWAEYTPEGKSVKVSRYSVIHGKEYFSEGTAYPVGDSKIGKIYHSYTIGGVTQEGVFNVLSTDNKNYIIGYFCSYKGHMDLVWVLSRSMVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSCK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DigA16
publication title Structural mechanism of specific ligand recognition by a lipocalin tailored for the complexation of digoxigenin.
pubmed doi rcsb
source organism Pieris brassicae
molecule tags Ligand binding protein
total genus 34
structure length 160
sequence length 167
ec nomenclature
pdb deposition date 2002-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1lnmA00
4GKCA 4NP1A 2AT5X 4QYNA 2X45A 3C78X 1DZPA 2QM9A 5FAZA 2RCTA 3EBKA 3KQ0A 4YGGA 3WJDA 5H9LA 3WVMA 4OMWA 2L9CA 1QWDA 2L67A 1LNMA 1T0VA 2ASNX 2WSJA 5B27A 4XMDA 5HZ5A 3P6DA 5D47A 4TJZA 1EIIA 3B2HA 4ES7A 5IO5A 3VG4A 1DFVA 2GTFX 1B0OA 4PSQA 3BU9A 1S7DA 4QZTA 4YH0A 3SAOA 2FRSA 4OMXA 1LPJA 4EXZA 3UEWA 1PBOA 1H91A 4ZR2A 3VG7A 4WFVA 3L4RA 5D8JA 3CQNA 4AYHA 3RSWA 2Q2MA 3VG5A 5B29A 5KHPA 4YGZA 1CBSA 2K62A 3IA8A 4A8ZA 1DV9A 4M6SA 5F58A 4EEJA 4YBUA 4D6BA 4ODDA 4XMEA 4YMYA 3AKMA 3ZUIA 4HPCA 5KICA 5H8TA 3B2JA 5DG4A 4RUUA 4Y0SA 1KQXA 4IB6A 3U9PC 1CJ5A 2L5PA 3NX2A 5LJBA 3MVFA 1MDCA 5EEDA 4ZHFA 1CBQA 3WJGA 2FR2A 5IO6A 5F6ZA 2WQ9A 5L8OA 3BX7A 1BWYA 4HFOA 2CBRA 2OVDA 2CBSA 1SXWA 1AQBA 1GT3A 1XCAA 3MBTA 1KXOA 4YCEA 1T68X 5F6BA 3WBGA 2A3FX 4OS3A 4MVKA 1TOWA 4MVIA 4QGVA 3TZSA 5KIDA 2NNQA 4I3CA 5HCDC 1BM5A 2FS7A 2FS6A 4NLIA 4A60A 1ZNHA 1IFCA 4DQ3A 1A57A 1AVGI 1KGLA 3TGAA 1KT6A 3WXQA 1JZUA 2G79A 5BVQA 3C76X 2HNXA 1GT5A 1DZKA 1X89A 1QY0A 4YFRA 1GT1A 1O8VA 2FR3A 3BRNA 1SY1A 3BY0A 2LBAA 3G7XA 3EMMA 1U0XA 5LJKA 1NP4A 3DTQA 4K19A 4AZOA 2W2FA 1L6MA 3HWEA 3KFHA 1EALA 1OBUA 1YWCA 4ALOA 3ZUOA 2AT6X 2ACOA 3EM0A 5CE4A 4YDAA 1SA8A 2OFRX 1FDQA 2FLJA 2WWPA 2YG2A 4IMOA 3EBWA 1B56A 2WEXA 4NYQA 3VG2A 4TLJA 2N93A 3APWA 2OVEA 2OZQA 5JR8A 1IFBA 1X8UA 4ZH6A 4CK4A 4IBAA 1EW3A 5IO7A 1BRQA 4ZJ0A 3B2LA 4ORUA 1RLBE 3FA8A 5HTEA 1G5WA 5HCEC 1PM1X 1YWAA 2AL0X 2HZQA 4NLJA 2QOSC 4MVLA 1CRBA 2FWVA 2KT4B 1KZXA 4ORRA 2A0AA 2QO5A 3FLLA 2LFOA 1TW4A 3APVA 4YCHA 5D4AA 4AW8A 1EXSA 4AZNA 1BEBA 1ERXA 5HA1A 4IB9A 4QZUA 1QQSA 1AB0A 5D45A 1EPBA 2RD7C 3D97A 2Q9SA 1QY1A 4WFUA 4XMHA 2Q2PA 1YUPA 1YWDA 1TXLA 5LJDA 4M7MA 4O9SA 1NP1A 3NX1A 1EQDA 2LB6A 2HZRA 2A13A 2WQAE 5FENA 5H9KA 3HWDA 2AT3X 1BBPA 1JJXA 1TVQA 4XMCA 2MO5A 1ICMA 4TKHA 4AZPA 3FENA 1VPRA 4OS0A 1ZNLA 1ZNEA 3BSZE 2L68A 1DZMA 5BVSA 3CBCA 4YGHA 1FE3A 1YIVA 3CMPA 3NADA 3FEKA 3KFIA 1JJJA 5LKEA 2NP1A 1O1VA 1Z24A 4EFGA 1JYDA 1OEKA 4ALBA 3EYCA 1UZ2X 4IMNA 1U18A 4QYPA 4ZHCA 1D3SA 4A1YA 1DZJA 1G74A 5HWZA 5HZ6A 4LKTA 2F73A 1BSOA 2NNDA 2R56A 1EIOA 2OFMX 4BOEA 5FFHA 3U03A 1PEEA 4ORWA 4WBKA 1I06A 1IKEA 4ORYA 4TQ2A 4RUNA 5HA0A 1BJ7A 5AQ6A 4LZUA 2R73A 3C77X 3B2IA 1E02A 4YDBA 4XMFA 4YKMA 3P6HA 5HZ9A 1OPBA 2W2AA 3FR4A 3O22A 3TGCA 5HTDA 1XKIA 4ORXA 4I3BA 5BVTA 4UU2A 1P6PA 1BSYA 4IAXA 4HPDA 1HMTA 1D2UA 4AZQA 4ZHHA 2P8GA 5H9AA 1X8NA 1LKEA 1LIFA 4ORSA 1GX8A 3PH6A 1ICNA 3DSZA 3APXA 2AH7X 3P6GA 4HPBA 1SY2A 5D48A 3APUA 4ARHA 5L8NA 2JU8A 2X46A 4ZHGA 1LICA 2W2BA 1OBPA 2XKLA 1EPAA 2MM3A 2AMMX 5EDBA 3TF6A 1YWBA 3HWGA 3PECA 5HBSA 5EDCA 2Q39A 1QFTA 3ZQ3A 4TKBA 1E00A 4IB8A 4GNWA 3PEDA 1BRPA 2FT9A 2HMBA 1O1UA 1B8EA 1I05A 1HN2A 1LF7A 2JOZA 1GKAB 3NPOA 3QKGA 1BSQA 2FTBA 3JSQA 3AKNA 4I9RA 5EEEA 3STNA 2CM4A 1U17A 1X8QA 1IIUA 3KFGA 4TNNA 5C0NA 2JU3A 3CR6A 3RZYA 1LFOA 1E06A 1ZNDA 3FELA 1MUPA 1E5PA 3VG3A 4UU3A 2BLGA 3K3LA 3UEXA 2Q4NA 2QO6A 4AZRA 5F7GA 1S2PA 3B2KA 1KT3A 4Y0PA 1G7NA 3WJCA 3JS1A 5EZ2A 1A2DA 4QGWA 1OEEA 4NNSA 1HBPA 2O62A 5EPQA 1ML7A 1IW2A 4I9SA 4ZCBA 2JN3A 3CQRA 3WJEA 1A18A 4ZGUA 1I4UA 2LBVA 5HAEA 1MX8A 4GH7A 3WJFA 3BLGA 3FMZA 4N7CA 1NGLA 4IB7A 3KZAA 1CBIA 1A3YA 4NYRA 3IFBA 1FELA 1GM6A 3FW4A 3FA7A 1ZRYA 4QGXA 1QFVA 2RCQA 2A2UA 3S26A 4D6AA 4R0BA 4EDEA 1DC9A 2GJ5A 1QABE 3FA6A 3D96A 4HPAA 1QG5A 1KOIA 1JV4A 2RA6A 3PPTA 1X8PA 1MVGA 2HLVA 1B4MA 3BDRA 4LKPA 1JBHA 1ALBA 1FTPA 1OBQA 1UREA 1OEJA 1GX9A 1GGLA 4BVMA 1VYFA 2QO4A 3BS2A 1OPAA 1MX7A 1GXAA 2K23A 3U0DA 3CBSA 3O19A 3FA9A 3OJYC 1PMPA 5LJGA 3STKA 1T8VA 2CZTA 1HBQA 1ADLA 5HZ8A 2JU7A 1ERBA 2AT0X 4GETA 2MJIA 1BLRA 1GT4A 3F8AA 3VG6A 1S44A 1TOUA 3ELXA 3FR2A 4GRJA 2AKQA 3I0AA 3FW5A 1AELA 4DQ4A 2E4JA 1LIEA 1X71A 1KT4A 2POAA 2LKKA 2WEWA 4GNYA 5LJCA 3BU1A 4YFPA 1SY0A 4I3DA 2PY1A 3NQ3A 3CWKA 3NR3A 3WJBA 2WUTA 3HK1A 1SXYA 3GAQA 3D95A 3FR5A 2CZUA 4Y0QA 4A1HA 2AT8X 2IFBA 3FEPA 1KT5A 1ZNKA 2ALLX 1KZWA 3NQ9A 1HMSA 3FIQA 4YFQA 2RQ0A 4LZVA 2KTDA 3UEVA 5HCCC 1RBPA 2G7BA 3STMX 5DPQA 3T1DA 3O2YA 1YP7A 3PP6A 2ANSA 2OVAA 5F1EA 3TGBA 4YKOA 4GE1A 2G78A 4TKJA 3HWFA 1LIBA 4NNTA 1GKAA 2WR6A 1FENA 3PH5A 1KQWA 3P6FA 3KFFA 2ACPX 2EU7X 2DM5A 4IAWA 1HQPA 1SY3A 5LJHA 1VYGA 1KT7A 5H9NA 3Q6LA 1HMRA 1DF3A 1IKJA 2R74A 4QAEA 1I04A 1ACDA 4XMGA 1CBRA 5L8IA 1N0SA 4AZMA 2NNEA 3ELZA 3BX8A 3F9DA 3NP1A 1JYJA 1SXUA 4BQUA 3UEUA 1EUOA 1YP6A 1ZNGA 2HYSA 2XSTA 4ZFXA 1G85A 5HZQA 4YBPA 1R0UA 4ZHDA 3P6EA 2A2GA 1SXXA 2CM9A 2GC9A 1X8OA 4N7DA 4KIIA 1FEMA 5LKFA 3I17A 4Y0RA 4ZH9A 5LJEA 4OS8A 1LIDA 5K06A 1QY2A 3P6CA
chains in the Genus database with same CATH superfamily
5B11O 1SWGA 1KL4A 2AT5X 4GKCA 1RXJA 4NP1A 2X45A 4OKAA 4QYNA 3C78X 1DZPA 2QM9A 2IZAA 5FAZA 2RCTA 3EBKA 3KQ0A 4YGGA 3WJDA 2AF5A 1SWDA 4ON1A 5H9LA 3WVMA 4OMWA 2L9CA 1QWDA 2L67A 2RTJA 1LNMA 1T0VA 2ASNX 2WSJA 5B27A 4XMDA 5HZ5A 2C1QA 3P6DA 5D47A 1KL5A 2I5ZO 4TJZA 3PK2A 4I95A 1EIIA 3B2HA 3SZIA 4ES7A 5IO5A 4BJ8A 3VG4A 1DFVA 2GTFX 1B0OA 4OS8A 3JQOA 3BU9A 1S7DA 4PSQA 4QZTA 3VGWA 4YH0A 3SAOA 4BX7A 2BS6A 4FGIB 2FRSA 4OMXA 1LPJA 4EXZA 3UEWA 3RWXA 3WYQA 1PBOA 4FBVA 1H91A 4ZR2A 3VG7A 3CKGA 3WZNA 5AEOA 4Z6JA 4WFVA 3L4RA 3VHMA 2RTBB 5D8JA 3CQNA 4AYHA 3RSWA 2MWHA 2Q2MA 4GGRA 3VG5A 5B29A 2LA7A 3QQ2A 5KHPA 4ID2A 4YGZA 1CBSA 2JW1A 2K62A 3IA8A 4I60A 4A8ZA 5IRAA 1DV9A 4M6SA 5F58A 4EEJA 4YBUA 4D6BA 1E2TA 1LCZA 1SWOA 4ODDA 4U8UM 4XMEA 4YMYA 3AKMA 4KH8A 3ZUIA 2F01A 4HPCA 3SOTA 3SZJA 5KICA 5H8TA 5B5FA 3WOVA 3B2JA 5DG4A 2Z4IA 4RUUA 4Y5DA 4Y0SA 4MVEA 1KQXA 1VWRB 4IB6A 3U9PC 1CJ5A 2L5PA 3NX2A 2OYBO 2KW1A 4ML7B 5LJBA 4QRLA 3WZOA 3MVFA 1MDCA 5EEDA 4ZHFA 1CBQA 2IZDB 3WJGA 2FR2A 5IO6A 4JO6A 5F6ZA 2WQ9A 5L8OA 3BX7A 5IRUA 1RSTB 3KVNA 4HFOA 4JHQA 1BWYA 2CBRA 2OVDA 2CBSA 3HOEA 1SXWA 3RDXA 1AQBA 1GT3A 1SWHA 1XCAA 3VPJE 3MBTA 1KXOA 3CKFA 4YCEA 1SWSA 1T68X 4Y59A 5F6BA 3WBGA 2A3FX 2DJGA 3LHNA 4MVKA 4OS3A 4U8UN 1TOWA 4MVIA 4QGVA 3TZSA 2IZHB 1HY2A 4LQZA 5KIDA 2NNQA 4I3CA 1W5RA 5HCDC 1BM5A 4GD9A 1SLGB 2FS7A 2FS6A 4KT5A 4NLIA 1ZNHA 1IFCA 2OY8A 4A60A 3SLJA 1AVGI 1OSPO 3T6LA 3TGAA 4FBRA 1A57A 1KT6A 2X56A 1KGLA 3WXQA 4BGFA 4NV7A 1JZUA 1VWQB 2G79A 2ZAIA 3F6ZB 5BVQA 3C76X 3S60A 5IXGA 1SWPA 2HNXA 1GT5A 3WZPA 1KL3A 2GTLN 1W6FA 1DZKA 1X89A 1SWRA 1QY0A 1SRHA 1STSB 4YFRA 4MIRA 4KC7A 1GT1A 1O8VA 2FR3A 2WPUA 3BRNA 1SY1A 3BY0A 2LBAA 1VWLB 3G7XA 3EMMA 1U0XA 5LJKA 3HPEA 4QQ1A 1NP4A 1STRB 3DTQA 4K19A 2W2FA 1L6MA 1LUQA 3HWEA 2KTSA 4AZOA 5K67A 4GJVA 1SWCA 3KFHA 5B10O 1EALA 1OBUA 1YWCA 2VFCA 4ALOA 1SRJA 2FKJA 3ZUOA 2AT6X 2ACOA 3EM0A 4HWMA 4FBOA 4CSBA 4EKVA 5CE4A 4YDAA 2Y3EA 1SA8A 2OFRX 1FDQA 1LCWA 2A8GA 2ZSCA 1N43A 2FLJA 2WWPA 2YG2A 4IMOA 3EBWA 1B56A 4O3YA 2WEXA 4NYQA 3VG2A 1JMXA 4IABA 4TLJA 1VWFB 2N93A 4L3RA 3APWA 2OVEA 2OZQA 5JR8A 2OL6O 1IFBA 1X8UA 2QCBA 4ZH6A 4CK4A 3SZHA 1N9MA 4IBAA 1EW3A 5IO7A 1BRQA 4ZJ0A 1AVDA 3B2LA 4ORUA 4CPHA 1RLBE 4CPHB 1SMPI 3FA8A 5HTEA 1G5WA 5HCEC 1PM1X 2RTPB 1KFFA 1YWAA 2AL0X 2HZQA 3FIDA 4NLJA 4CPIA 4O4UA 2QOSC 3LV4A 4MVLA 3T6FA 1CRBA 2FWVA 1LDQA 2KT4B 5FQ6E 1KZXA 2QMIA 4ORRA 2A0AA 2QO5A 3FLLA 2IZGB 2LFOA 4Z2OA 1TW4A 3APVA 4YCHA 5D4AA 4AW8A 1EXSA 4BCSA 4AZNA 1BEBA 5FQ7E 1ERXA 5HA1A 3E3CA 2FKGA 4IB9A 4QZUA 3OD9A 1QQSA 1AB0A 5D45A 1EPBA 2RD7C 4O3WA 3D97A 2Q9SA 1QY1A 1IJ8A 4WFUA 4XMHA 5K68A 2Q2PA 1YUPA 1YWDA 1VWBB 4O49A 1VWIB 5IRWA 1TXLA 1VWKB 5LJDA 2GH7A 4M7MA 4O9SA 3RE6A 1UYNX 2M4LA 4O4XA 1NP1A 2VFBA 3D4RA 3NX1A 1EQDA 2LB6A 2HZRA 1LELA 2A13A 2WQAE 5FENA 5H9KA 3HWDA 2AT3X 1BBPA 1JJXA 1GX3A 1TVQA 4XMCA 2MO5A 3EW1A 1ICMA 4TKHA 4AZPA 1SWKA 1VPRA 3FENA 4OS0A 3V8UA 1SRIA 1ZNLA 3HOLA 1ZNEA 3BSZE 2L68A 1DZMA 3AEHA 1VWDB 5BVSA 3CBCA 4YGHA 1FE3A 1HXZA 1YIVA 1W4TA 3HTYA 1JJUA 2FHLA 2RTOB 3CMPA 3S5VA 1RXHA 3FEKA 3NADA 3KFIA 2G8CO 1SLEB 1JJJA 5LKEA 2NP1A 1O1VA 2RTEB 2RTNB 1Z24A 4EFGA 1JYDA 5B5GA 2RTDB 1OEKA 2FGSA 4ALBA 1JQPA 3EYCA 1UZ2X 4IMNA 1U18A 4QYPA 4GGZA 3MG5A 3RDMA 4ZHCA 1D3SA 4A1YA 1DZJA 1G74A 4U9CA 5HWZA 4LKTA 2F73A 5HZ6A 3ZW2A 1BSOA 2NNDA 4GZVA 2GTLM 2R56A 1EIOA 1Y9TA 1VWHB 5CYBA 2OFMX 4JNJA 5FFHA 3RDQA 4BOEA 3U03A 1PEEA 4ORWA 4WBKA 1Y52X 1I06A 1IKEA 4ORYA 4TQ2A 3ZW0B 4RUNA 5HA0A 2RTQB 4WHIA 1BJ7A 5AQ6A 4LZUA 2R73A 3C77X 3B2IA 1SWFA 2BT9A 1VWMB 1E02A 1SWAA 3NBXX 1RSUB 2OY1O 4YDBA 4Z27A 4XMFA 4YKMA 3P6HA 5HZ9A 2A5BA 1OPBA 2W2AA 4MEEA 3FR4A 3O22A 3TGCA 3P24A 4CDEA 5HTDA 1XKIA 4ORXA 4I3BA 5BVTA 4U3QA 4UU2A 1P6PA 1BSYA 1NQMA 4IAXA 3SLTA 4HPDA 3VE2A 1HMTA 1D2UA 3Q34A 4AZQA 4ZHHA 2P8GA 1WUBA 5H9AA 1X8NA 1LKEA 4DNEA 1LIFA 4ORSA 1GX8A 5CSEA 3PH6A 1ICNA 3DSZA 1MEPA 4PJ2A 3VHHA 3APXA 1NC9A 2AH7X 3P6GA 4HPBA 4O4OA 1SY2A 5D48A 3APUA 4NV8A 3WZQA 4ARHA 5L8NA 2JU8A 2X46A 2YMSA 1I9HA 4ZHGA 1LICA 2W2BA 1OBPA 2XKLA 1EPAA 1MK5A 2AMMX 2MM3A 5EDBA 3WYPA 3TF6A 1YWBA 3HWGA 3PECA 5HBSA 5EDCA 4CPEA 2F09A 2Q39A 1QFTA 4U8UO 2RTFB 1FJ1E 2IZEB 1E00A 3ZQ3A 4TKBA 1RXKA 4FQBB 3LTWA 4IB8A 2OF8A 4U46A 4GNWA 4C5PA 4O4SA 3PEDA 3VU1A 1BRPA 2FT9A 2HMBA 1O1UA 1VWCB 1B8EA 1I05A 1HN2A 1LF7A 2JOZA 1GKAB 3NPOA 3QKGA 4GDZA 1BSQA 2FTBA 3JSQA 3AKNA 4I9RA 5EEEA 3STNA 3X00A 2CM4A 1U17A 2X32A 1X8QA 1IIUA 1SREA 3KFGA 4TNNA 5C0NA 2JU3A 1VWAB 3CR6A 2RTAA 1N7YA 2RTIB 3RZYA 1LFOA 1SWEA 1E06A 1VWOB 1ZNDA 3FELA 1MUPA 3NQKA 3PQUA 3ZI8A 1E5PA 2RTKA 4UU3A 3VG3A 4GUZA 2BLGA 3K3LA 3UEXA 4BBOA 2RTLA 2Q4NA 1SWNA 2QO6A 1HQQA 4AZRA 5F7GA 1S2PA 3VE1A 3B2KA 1STPA 1KT3A 3ZZVA 4MISA 4QNIA 4Y0PA 1DF8A 1G7NA 1NBXA 3WJCA 4DCBA 3RDSA 2G5LA 3JS1A 5EZ2A 2RTGB 1A2DA 3EC5A 4QGWA 1OEEA 4CDCA 4NNSA 4Z2PA 1AVEA 1HBPA 2O62A 5EPQA 1ML7A 1IW2A 4I9SA 3VHIA 5B3MO 4ZCBA 2JN3A 3CQRA 1EI5A 2BS5A 1A18A 4O3ZA 3WJEA 4EQAC 1I4UA 4ZGUA 3MM0A 2LBVA 3ZW1B 5HAEA 1MX8A 4GH7A 4BX5A 1PTSA 3WJFA 4OELA 4BX5B 1HXLA 3BLGA 3RBYA 3RDOA 1SRFA 3EW2A 3FMZA 4N7CA 4KC8A 1NGLA 1SRGA 4IB7A 3KZAA 2OVSA 1CBIA 1A3YA 1SWJA 2UYWA 4NYRA 2ZAGA 4Z2VA 3IFBA 1FELA 1GM6A 2X8FA 3FW4A 4JGLA 3FA7A 1NDJA 1ZRYA 2X34A 4CV7A 4QGXA 1NQNA 1QFVA 4COTA 3T2XA 2RCQA 1N4JA 1LDOA 2A2UA 2Z4HA 3S26A 4D6AA 4R0BA 2BC3A 1DC9A 2GJ5A 3H3IA 1QABE 3FA6A 4IRWA 3D96A 4OEMA 3N91A 3ZWEA 4HPAA 2RTRB 1QG5A 1KOIA 1JV4A 3RE5A 2X55A 2RA6A 3PPTA 4BX7B 1X8PA 3SLOA 3MX7A 1MVGA 2HLVA 1B4MA 3BDRA 4LKPA 1JBHA 1ALBA 1FTPA 3OBLA 1OBQA 4YVBA 1UREA 4CDDA 1OEJA 1MM9A 1WBIA 1GX9A 1GGLA 4BVMA 1VYFA 2QO4A 2DJFA 3BS2A 1OPAA 1MX7A 1GXAA 2PI3O 2K23A 3AUMO 3PDFA 3U0DA 3CBSA 3O19A 3FA9A 3OJYC 3RDUA 1PMPA 2Y32A 5LJGA 3STKA 5CHKA 4I6SA 1T8VA 2CZTA 1HBQA 2OFBA 1ADLA 3ZW0A 5HZ8A 2JU7A 1ERBA 2AT0X 2IZIA 2MF6A 2OFAA 4GETA 2MJIA 1BLRA 2JMBA 1GT4A 2UZ2A 3F8AA 2IZCB 1VWGB 1Y53X 4INNA 3RY1A 2OY7A 3VG6A 1S44A 1TOUA 2X8SA 3ELXA 3FR2A 4GRJA 2IZKA 2RTMA 2AKQA 2VDFA 3I0AA 2C4IA 3FW5A 1AELA 4DQ4A 4GJSA 2A5CA 1LIEA 2E4JA 1X71A 4L1NA 1KT4A 2IZLB 3RKGA 2POAA 2LKKA 2WEWA 4GNYA 5FQ8E 5LJCA 4Z28A 2OF9A 3BU1A 4YFPA 1SY0A 4I3DA 2PY1A 3NQ3A 3CWKA 1VWNB 3NR3A 4GU8A 1K3BA 3WJBA 2IZJA 3D9WA 2I5VO 2WUTA 3HK1A 1VWPB 1SXYA 2IZBA 3GAQA 3D95A 3PQSA 3S5XA 4CDFA 3FR5A 2BHVA 2CZUA 4Y0QA 5AJCA 2AT8X 2RN4A 2IFBA 4A1HA 4DQ3A 5BYPA 1SLFB 5F2BA 3FEPA 1SWUA 1KT5A 1ZNKA 2ALLX 4GDAA 3NQ9A 1HMSA 3FIQA 4O3XB 4ZGFA 4YFQA 1KZWA 1MOYA 2RQ0A 4LZVA 2X4MA 2KTDA 4NW4A 3UAQA 1SWLA 3FYFA 3RY2A 3UEVA 5HCCC 1JIWI 1RBPA 2RTCB 2G7BA 1K24A 4GK9A 5DPQA 3STMX 3T1DA 1RAVA 1YP7A 3O2YA 3PP6A 2ANSA 2OVAA 5F1EA 3TGBA 4YKOA 4GE1A 2G78A 4TKJA 3HWFA 1SWQA 1Y9LA 1LIBA 4NNTA 1GKAA 2WR6A 1VWEB 1FENA 3PH5A 2JGSA 1KQWA 4CPFA 2MHDA 3P6FA 2OL7A 2X8TA 3KFFA 2ACPX 2EU7X 4EDEA 2DM5A 4IAWA 1HQPA 1Y0GA 2GTLO 1LCVA 1Y55X 1SY3A 5L3YA 5LJHA 1VYGA 1KT7A 5H9NA 2OY5O 3Q6LA 1HMRA 1DF3A 1IKJA 2R74A 4QAEA 2FHNX 2IZFB 1I04A 3T2WA 1ACDA 5B2AO 2OL8O 4XMGA 1CBRA 3FDCA 4BX6A 4BX6B 5L8IA 1UYOX 1VYOA 1N0SA 1PBYA 1SWBA 4AZMA 2NNEA 3ELZA 3BX8A 4KCAA 1VWJB 3F9DA 2BSZA 3NP1A 1JYJA 1SXUA 2HKDA 1JMZA 4BQUA 3UEUA 1EUOA 1YP6A 1ZNGA 2HYSA 2XSTA 1SLDB 2CAMA 1G85A 2KD2A 3P02A 5HZQA 4YBPA 2RTHB 1R0UA 4B55A 4ZHDA 3P6EA 2A2GA 1SXXA 2CM9A 2GC9A 1X8OA 3GE2A 1I78A 4GGTA 4N7DA 4ZFXA 4KIIA 1FEMA 5AJBA 5LKFA 2C1SA 2AVIA 5JD2A 3OE3A 2QOMA 3I17A 1N9YA 4Y0RA 4ZH9A 3ZW1A 1SWTA 5LJEA 1LIDA 5K06A 1QY2A 2Y3FA 3P6CA
chains in the Genus database with same CATH topology
4GKCA 4NP1A 2AT5X 3ZZVA 4QYNA 2X45A 3C78X 1DZPA 2QM9A 5FAZA 2RCTA 3EBKA 3KQ0A 4YGGA 3WJDA 5H9LA 3WVMA 4ON1A 4OMWA 2L9CA 1QWDA 2L67A 1LNMA 1T0VA 2ASNX 2WSJA 5B27A 4XMDA 5HZ5A 3P6DA 5D47A 4TJZA 4I95A 1EIIA 3B2HA 4ES7A 5IO5A 3VG4A 1DFVA 2GTFX 1B0OA 3JQOA 3BU9A 1S7DA 4PSQA 4QZTA 4YH0A 3SAOA 2BS6A 4FGIB 2FRSA 4OMXA 1LPJA 4EXZA 3UEWA 3RWXA 1PBOA 4FBVA 1H91A 4ZR2A 3VG7A 5AEOA 4WFVA 3L4RA 5D8JA 3CQNA 4AYHA 3RSWA 2MWHA 2Q2MA 3VG5A 5B29A 5KHPA 2LA7A 4ID2A 4YGZA 1CBSA 2JW1A 2K62A 3IA8A 4A8ZA 1DV9A 4M6SA 5F58A 4EEJA 4YBUA 4D6BA 4ODDA 4XMEA 4U8UM 4YMYA 3AKMA 4KH8A 3ZUIA 4HPCA 3SOTA 5KICA 5H8TA 3WOVA 3B2JA 5DG4A 2Z4IA 4RUUA 4Y0SA 4MVEA 1KQXA 4IB6A 3U9PC 1CJ5A 2L5PA 3NX2A 2KW1A 4ML7B 5LJBA 4QRLA 3MVFA 1MDCA 5EEDA 4ZHFA 1CBQA 3WJGA 2FR2A 5IO6A 5F6ZA 2WQ9A 5L8OA 3BX7A 1BWYA 4HFOA 2CBRA 2OVDA 2CBSA 3HOEA 1SXWA 1AQBA 1GT3A 3VPJE 1XCAA 3MBTA 1KXOA 4YCEA 1T68X 5F6BA 3WBGA 2A3FX 4OS3A 3LHNA 4MVKA 4U8UN 1TOWA 4MVIA 4QGVA 3TZSA 5KIDA 4LQZA 2NNQA 4I3CA 5HCDC 1BM5A 2FS7A 2FS6A 4KT5A 4NLIA 1ZNHA 1IFCA 4A60A 4DQ3A 1A57A 1AVGI 4FBRA 1KGLA 3TGAA 1KT6A 3WXQA 1JZUA 3F6ZB 2G79A 2ZAIA 5BVQA 3S60A 3C76X 2HNXA 1GT5A 2GTLN 1DZKA 1X89A 1QY0A 4YFRA 4MIRA 4KC7A 1GT1A 1O8VA 2FR3A 3BRNA 1SY1A 3BY0A 2LBAA 3G7XA 3EMMA 1U0XA 5LJKA 4QQ1A 1NP4A 3DTQA 4K19A 4AZOA 2W2FA 1L6MA 3HWEA 2KTSA 3KFHA 1EALA 1OBUA 1YWCA 4ALOA 3ZUOA 2AT6X 2ACOA 3EM0A 4HWMA 4FBOA 4CSBA 5CE4A 4YDAA 1SA8A 2OFRX 1FDQA 2FLJA 2WWPA 2YG2A 4IMOA 3EBWA 1B56A 4O3YA 2WEXA 4NYQA 3VG2A 4IABA 4TLJA 2N93A 4L3RA 3APWA 2OVEA 2OZQA 5JR8A 1IFBA 1X8UA 4ZH6A 4CK4A 4IBAA 1EW3A 5IO7A 1BRQA 4ZJ0A 3B2LA 4ORUA 1RLBE 1SMPI 3FA8A 5HTEA 1G5WA 5HCEC 1PM1X 1YWAA 2AL0X 2HZQA 4NLJA 4O4UA 2QOSC 3LV4A 4MVLA 1CRBA 2FWVA 2KT4B 5FQ6E 1KZXA 2QMIA 4ORRA 2A0AA 2QO5A 3FLLA 2LFOA 1TW4A 3APVA 4YCHA 5D4AA 4AW8A 1EXSA 4AZNA 1BEBA 5FQ7E 1ERXA 5HA1A 3E3CA 4IB9A 4QZUA 3OD9A 1QQSA 1AB0A 5D45A 1EPBA 2RD7C 4O3WA 3D97A 2Q9SA 1QY1A 4WFUA 4XMHA 2Q2PA 1YUPA 1YWDA 4O49A 1TXLA 5LJDA 4M7MA 4O9SA 2M4LA 4O4XA 1NP1A 3D4RA 3NX1A 1EQDA 2LB6A 2HZRA 2A13A 2WQAE 5FENA 5H9KA 3HWDA 2AT3X 1BBPA 1JJXA 1TVQA 4XMCA 2MO5A 1ICMA 4TKHA 4AZPA 3FENA 1VPRA 4OS0A 3V8UA 1ZNLA 3HOLA 1ZNEA 3BSZE 2L68A 1DZMA 5BVSA 3CBCA 4YGHA 1FE3A 1YIVA 3HTYA 3CMPA 3S5VA 3NADA 3FEKA 3KFIA 1JJJA 5LKEA 2NP1A 1O1VA 1Z24A 4EFGA 1JYDA 1OEKA 4ALBA 3EYCA 1UZ2X 4IMNA 1U18A 4QYPA 4ZHCA 1D3SA 4A1YA 1DZJA 1G74A 4U9CA 5HWZA 4LKTA 2F73A 5HZ6A 3ZW2A 1BSOA 2NNDA 4GZVA 2GTLM 2R56A 1EIOA 1Y9TA 5CYBA 2OFMX 4BOEA 5FFHA 3U03A 1PEEA 4ORWA 4WBKA 1I06A 1IKEA 4ORYA 4TQ2A 3ZW0B 4RUNA 5HA0A 4WHIA 1BJ7A 5AQ6A 4LZUA 2R73A 3C77X 3B2IA 2BT9A 1E02A 3NBXX 4YDBA 4XMFA 4YKMA 3P6HA 5HZ9A 1OPBA 2W2AA 3FR4A 3O22A 3TGCA 3P24A 5HTDA 1XKIA 4ORXA 4I3BA 5BVTA 4U3QA 4UU2A 1P6PA 1BSYA 4IAXA 4HPDA 3VE2A 1HMTA 1D2UA 4AZQA 4ZHHA 2P8GA 5H9AA 1X8NA 1LKEA 1LIFA 4ORSA 1GX8A 3PH6A 1ICNA 3DSZA 4PJ2A 3APXA 2AH7X 3P6GA 4HPBA 4O4OA 1SY2A 5D48A 3APUA 4ARHA 5L8NA 2JU8A 2X46A 2YMSA 4ZHGA 1LICA 2W2BA 1OBPA 2XKLA 1EPAA 2MM3A 2AMMX 5EDBA 3TF6A 1YWBA 3HWGA 3PECA 5HBSA 5EDCA 2F09A 2Q39A 1QFTA 4U8UO 3ZQ3A 4TKBA 1E00A 4FQBB 4IB8A 4GNWA 4O4SA 3PEDA 3VU1A 1BRPA 2FT9A 2HMBA 1O1UA 1B8EA 1I05A 1HN2A 1LF7A 2JOZA 1GKAB 3NPOA 3QKGA 4GDZA 1BSQA 2FTBA 3JSQA 3AKNA 4I9RA 5EEEA 3STNA 2CM4A 1U17A 1X8QA 1IIUA 3KFGA 4TNNA 5C0NA 2JU3A 3CR6A 3RZYA 1LFOA 3PQUA 1E06A 1ZNDA 3FELA 3ZI8A 1MUPA 3NQKA 1E5PA 3VG3A 4UU3A 2BLGA 3K3LA 3UEXA 2Q4NA 2QO6A 4AZRA 5F7GA 1S2PA 3VE1A 3B2KA 1KT3A 4MISA 4QNIA 4Y0PA 1G7NA 3WJCA 3JS1A 5EZ2A 1A2DA 4QGWA 1OEEA 4NNSA 2O62A 1HBPA 5EPQA 1ML7A 1IW2A 4I9SA 4ZCBA 2JN3A 3CQRA 1EI5A 2BS5A 1A18A 4O3ZA 3WJEA 4EQAC 1I4UA 4ZGUA 2LBVA 3ZW1B 5HAEA 1MX8A 4GH7A 3WJFA 3BLGA 3RBYA 3FMZA 4N7CA 4KC8A 1NGLA 4IB7A 3KZAA 2OVSA 1CBIA 1A3YA 4NYRA 2ZAGA 3IFBA 1FELA 1GM6A 2X8FA 3FW4A 4JGLA 3FA7A 4CV7A 1ZRYA 4QGXA 1QFVA 4COTA 2RCQA 2A2UA 2Z4HA 3S26A 4D6AA 4R0BA 3H3IA 1DC9A 2GJ5A 4EDEA 1QABE 3FA6A 3ZWEA 3D96A 3N91A 4HPAA 1QG5A 1KOIA 1JV4A 2RA6A 3PPTA 1X8PA 3MX7A 1MVGA 2HLVA 1B4MA 3BDRA 4LKPA 1JBHA 1ALBA 1FTPA 3OBLA 1OBQA 1UREA 1OEJA 1GX9A 1GGLA 4BVMA 1VYFA 2QO4A 3BS2A 1OPAA 1MX7A 1GXAA 2K23A 3U0DA 3CBSA 3O19A 3FA9A 3OJYC 1PMPA 5LJGA 3STKA 4I6SA 1T8VA 2CZTA 1HBQA 1ADLA 3ZW0A 5HZ8A 2JU7A 1ERBA 2AT0X 4GETA 2MJIA 1BLRA 2JMBA 1GT4A 3F8AA 4INNA 3VG6A 1S44A 1TOUA 2X8SA 3ELXA 3FR2A 4GRJA 2AKQA 3I0AA 3FW5A 1AELA 4DQ4A 2E4JA 1LIEA 1X71A 4L1NA 1KT4A 3RKGA 2POAA 2LKKA 2WEWA 4GNYA 5FQ8E 5LJCA 3BU1A 4YFPA 1SY0A 4I3DA 2PY1A 3NQ3A 3CWKA 3NR3A 4GU8A 3WJBA 2WUTA 3HK1A 1SXYA 3GAQA 3D95A 3PQSA 3S5XA 3FR5A 2BHVA 2CZUA 4Y0QA 5AJCA 2AT8X 2RN4A 2IFBA 4A1HA 5BYPA 3FEPA 1KT5A 1ZNKA 2ALLX 1KZWA 3NQ9A 1HMSA 3FIQA 4O3XB 4ZGFA 4YFQA 2RQ0A 4LZVA 2KTDA 4NW4A 3UAQA 3FYFA 3UEVA 5HCCC 1JIWI 1RBPA 2G7BA 4GK9A 3STMX 5DPQA 3T1DA 3O2YA 1YP7A 3PP6A 2ANSA 2OVAA 5F1EA 3TGBA 4YKOA 4GE1A 2G78A 4TKJA 3HWFA 1Y9LA 1LIBA 4NNTA 1GKAA 2WR6A 1FENA 3PH5A 1KQWA 2MHDA 3P6FA 2X8TA 3KFFA 2ACPX 2EU7X 2DM5A 4IAWA 1HQPA 2GTLO 1SY3A 5LJHA 1VYGA 1KT7A 5H9NA 3Q6LA 1HMRA 1DF3A 1IKJA 2R74A 4QAEA 1I04A 1ACDA 4XMGA 1CBRA 5L8IA 1N0SA 4AZMA 2NNEA 3ELZA 3BX8A 4KCAA 3F9DA 3NP1A 1JYJA 1SXUA 4BQUA 3UEUA 1EUOA 1YP6A 1ZNGA 2HYSA 2XSTA 3P02A 2KD2A 1G85A 4ZFXA 5HZQA 4YBPA 1R0UA 4ZHDA 3P6EA 2A2GA 1SXXA 2CM9A 2GC9A 1X8OA 3GE2A 4N7DA 4KIIA 1FEMA 5AJBA 5LKFA 3OE3A 3I17A 4Y0RA 4ZH9A 3ZW1A 4OS8A 5LJEA 1LIDA 5K06A 1QY2A 3P6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKC A;  4NP1 A;  2AT5 X;  4QYN A;  2X45 A;  3C78 X;  1DZP A;  2QM9 A;  5FAZ A;  2RCT A;  3EBK A;  3KQ0 A;  4YGG A;  3WJD A;  5H9L A;  3WVM A;  4OMW A;  2L9C A;  1QWD A;  2L67 A;  1LNM A;  1T0V A;  2ASN X;  2WSJ A;  5B27 A;  4XMD A;  5HZ5 A;  3P6D A;  5D47 A;  4TJZ A;  1EII A;  3B2H A;  4ES7 A;  5IO5 A;  3VG4 A;  1DFV A;  2GTF X;  1B0O A;  4PSQ A;  3BU9 A;  1S7D A;  4QZT A;  4YH0 A;  3SAO A;  2FRS A;  4OMX A;  1LPJ A;  4EXZ A;  3UEW A;  1PBO A;  1H91 A;  4ZR2 A;  3VG7 A;  4WFV A;  3L4R A;  5D8J A;  3CQN A;  4AYH A;  3RSW A;  2Q2M A;  3VG5 A;  5B29 A;  5KHP A;  4YGZ A;  1CBS A;  2K62 A;  3IA8 A;  4A8Z A;  1DV9 A;  4M6S A;  5F58 A;  4EEJ A;  4YBU A;  4D6B A;  4ODD A;  4XME A;  4YMY A;  3AKM A;  3ZUI A;  4HPC A;  5KIC A;  5H8T A;  3B2J A;  5DG4 A;  4RUU A;  4Y0S A;  1KQX A;  4IB6 A;  3U9P C;  1CJ5 A;  2L5P A;  3NX2 A;  5LJB A;  3MVF A;  1MDC A;  5EED A;  4ZHF A;  1CBQ A;  3WJG A;  2FR2 A;  5IO6 A;  5F6Z A;  2WQ9 A;  5L8O A;  3BX7 A;  1BWY A;  4HFO A;  2CBR A;  2OVD A;  2CBS A;  1SXW A;  1AQB A;  1GT3 A;  1XCA A;  3MBT A;  1KXO A;  4YCE A;  1T68 X;  5F6B A;  3WBG A;  2A3F X;  4OS3 A;  4MVK A;  1TOW A;  4MVI A;  4QGV A;  3TZS A;  5KID A;  2NNQ A;  4I3C A;  5HCD C;  1BM5 A;  2FS7 A;  2FS6 A;  4NLI A;  4A60 A;  1ZNH A;  1IFC A;  4DQ3 A;  1A57 A;  1AVG I;  1KGL A;  3TGA A;  1KT6 A;  3WXQ A;  1JZU A;  2G79 A;  5BVQ A;  3C76 X;  2HNX A;  1GT5 A;  1DZK A;  1X89 A;  1QY0 A;  4YFR A;  1GT1 A;  1O8V A;  2FR3 A;  3BRN A;  1SY1 A;  3BY0 A;  2LBA A;  3G7X A;  3EMM A;  1U0X A;  5LJK A;  1NP4 A;  3DTQ A;  4K19 A;  4AZO A;  2W2F A;  1L6M A;  3HWE A;  3KFH A;  1EAL A;  1OBU A;  1YWC A;  4ALO A;  3ZUO A;  2AT6 X;  2ACO A;  3EM0 A;  5CE4 A;  4YDA A;  1SA8 A;  2OFR X;  1FDQ A;  2FLJ A;  2WWP A;  2YG2 A;  4IMO A;  3EBW A;  1B56 A;  2WEX A;  4NYQ A;  3VG2 A;  4TLJ A;  2N93 A;  3APW A;  2OVE A;  2OZQ A;  5JR8 A;  1IFB A;  1X8U A;  4ZH6 A;  4CK4 A;  4IBA A;  1EW3 A;  5IO7 A;  1BRQ A;  4ZJ0 A;  3B2L A;  4ORU A;  1RLB E;  3FA8 A;  5HTE A;  1G5W A;  5HCE C;  1PM1 X;  1YWA A;  2AL0 X;  2HZQ A;  4NLJ A;  2QOS C;  4MVL A;  1CRB A;  2FWV A;  2KT4 B;  1KZX A;  4ORR A;  2A0A A;  2QO5 A;  3FLL A;  2LFO A;  1TW4 A;  3APV A;  4YCH A;  5D4A A;  4AW8 A;  1EXS A;  4AZN A;  1BEB A;  1ERX A;  5HA1 A;  4IB9 A;  4QZU A;  1QQS A;  1AB0 A;  5D45 A;  1EPB A;  2RD7 C;  3D97 A;  2Q9S A;  1QY1 A;  4WFU A;  4XMH A;  2Q2P A;  1YUP A;  1YWD A;  1TXL A;  5LJD A;  4M7M A;  4O9S A;  1NP1 A;  3NX1 A;  1EQD A;  2LB6 A;  2HZR A;  2A13 A;  2WQA E;  5FEN A;  5H9K A;  3HWD A;  2AT3 X;  1BBP A;  1JJX A;  1TVQ A;  4XMC A;  2MO5 A;  1ICM A;  4TKH A;  4AZP A;  3FEN A;  1VPR A;  4OS0 A;  1ZNL A;  1ZNE A;  3BSZ E;  2L68 A;  1DZM A;  5BVS A;  3CBC A;  4YGH A;  1FE3 A;  1YIV A;  3CMP A;  3NAD A;  3FEK A;  3KFI A;  1JJJ A;  5LKE A;  2NP1 A;  1O1V A;  1Z24 A;  4EFG A;  1JYD A;  1OEK A;  4ALB A;  3EYC A;  1UZ2 X;  4IMN A;  1U18 A;  4QYP A;  4ZHC A;  1D3S A;  4A1Y A;  1DZJ A;  1G74 A;  5HWZ A;  5HZ6 A;  4LKT A;  2F73 A;  1BSO A;  2NND A;  2R56 A;  1EIO A;  2OFM X;  4BOE A;  5FFH A;  3U03 A;  1PEE A;  4ORW A;  4WBK A;  1I06 A;  1IKE A;  4ORY A;  4TQ2 A;  4RUN A;  5HA0 A;  1BJ7 A;  5AQ6 A;  4LZU A;  2R73 A;  3C77 X;  3B2I A;  1E02 A;  4YDB A;  4XMF A;  4YKM A;  3P6H A;  5HZ9 A;  1OPB A;  2W2A A;  3FR4 A;  3O22 A;  3TGC A;  5HTD A;  1XKI A;  4ORX A;  4I3B A;  5BVT A;  4UU2 A;  1P6P A;  1BSY A;  4IAX A;  4HPD A;  1HMT A;  1D2U A;  4AZQ A;  4ZHH A;  2P8G A;  5H9A A;  1X8N A;  1LKE A;  1LIF A;  4ORS A;  1GX8 A;  3PH6 A;  1ICN A;  3DSZ A;  3APX A;  2AH7 X;  3P6G A;  4HPB A;  1SY2 A;  5D48 A;  3APU A;  4ARH A;  5L8N A;  2JU8 A;  2X46 A;  4ZHG A;  1LIC A;  2W2B A;  1OBP A;  2XKL A;  1EPA A;  2MM3 A;  2AMM X;  5EDB A;  3TF6 A;  1YWB A;  3HWG A;  3PEC A;  5HBS A;  5EDC A;  2Q39 A;  1QFT A;  3ZQ3 A;  4TKB A;  1E00 A;  4IB8 A;  4GNW A;  3PED A;  1BRP A;  2FT9 A;  2HMB A;  1O1U A;  1B8E A;  1I05 A;  1HN2 A;  1LF7 A;  2JOZ A;  1GKA B;  3NPO A;  3QKG A;  1BSQ A;  2FTB A;  3JSQ A;  3AKN A;  4I9R A;  5EEE A;  3STN A;  2CM4 A;  1U17 A;  1X8Q A;  1IIU A;  3KFG A;  4TNN A;  5C0N A;  2JU3 A;  3CR6 A;  3RZY A;  1LFO A;  1E06 A;  1ZND A;  3FEL A;  1MUP A;  1E5P A;  3VG3 A;  4UU3 A;  2BLG A;  3K3L A;  3UEX A;  2Q4N A;  2QO6 A;  4AZR A;  5F7G A;  1S2P A;  3B2K A;  1KT3 A;  4Y0P A;  1G7N A;  3WJC A;  3JS1 A;  5EZ2 A;  1A2D A;  4QGW A;  1OEE A;  4NNS A;  1HBP A;  2O62 A;  5EPQ A;  1ML7 A;  1IW2 A;  4I9S A;  4ZCB A;  2JN3 A;  3CQR A;  3WJE A;  1A18 A;  4ZGU A;  1I4U A;  2LBV A;  5HAE A;  1MX8 A;  4GH7 A;  3WJF A;  3BLG A;  3FMZ A;  4N7C A;  1NGL A;  4IB7 A;  3KZA A;  1CBI A;  1A3Y A;  4NYR A;  3IFB A;  1FEL A;  1GM6 A;  3FW4 A;  3FA7 A;  1ZRY A;  4QGX A;  1QFV A;  2RCQ A;  2A2U A;  3S26 A;  4D6A A;  4R0B A;  4EDE A;  1DC9 A;  2GJ5 A;  1QAB E;  3FA6 A;  3D96 A;  4HPA A;  1QG5 A;  1KOI A;  1JV4 A;  2RA6 A;  3PPT A;  1X8P A;  1MVG A;  2HLV A;  1B4M A;  3BDR A;  4LKP A;  1JBH A;  1ALB A;  1FTP A;  1OBQ A;  1URE A;  1OEJ A;  1GX9 A;  1GGL A;  4BVM A;  1VYF A;  2QO4 A;  3BS2 A;  1OPA A;  1MX7 A;  1GXA A;  2K23 A;  3U0D A;  3CBS A;  3O19 A;  3FA9 A;  3OJY C;  1PMP A;  5LJG A;  3STK A;  1T8V A;  2CZT A;  1HBQ A;  1ADL A;  5HZ8 A;  2JU7 A;  1ERB A;  2AT0 X;  4GET A;  2MJI A;  1BLR A;  1GT4 A;  3F8A A;  3VG6 A;  1S44 A;  1TOU A;  3ELX A;  3FR2 A;  4GRJ A;  2AKQ A;  3I0A A;  3FW5 A;  1AEL A;  4DQ4 A;  2E4J A;  1LIE A;  1X71 A;  1KT4 A;  2POA A;  2LKK A;  2WEW A;  4GNY A;  5LJC A;  3BU1 A;  4YFP A;  1SY0 A;  4I3D A;  2PY1 A;  3NQ3 A;  3CWK A;  3NR3 A;  3WJB A;  2WUT A;  3HK1 A;  1SXY A;  3GAQ A;  3D95 A;  3FR5 A;  2CZU A;  4Y0Q A;  4A1H A;  2AT8 X;  2IFB A;  3FEP A;  1KT5 A;  1ZNK A;  2ALL X;  1KZW A;  3NQ9 A;  1HMS A;  3FIQ A;  4YFQ A;  2RQ0 A;  4LZV A;  2KTD A;  3UEV A;  5HCC C;  1RBP A;  2G7B A;  3STM X;  5DPQ A;  3T1D A;  3O2Y A;  1YP7 A;  3PP6 A;  2ANS A;  2OVA A;  5F1E A;  3TGB A;  4YKO A;  4GE1 A;  2G78 A;  4TKJ A;  3HWF A;  1LIB A;  4NNT A;  1GKA A;  2WR6 A;  1FEN A;  3PH5 A;  1KQW A;  3P6F A;  3KFF A;  2ACP X;  2EU7 X;  2DM5 A;  4IAW A;  1HQP A;  1SY3 A;  5LJH A;  1VYG A;  1KT7 A;  5H9N A;  3Q6L A;  1HMR A;  1DF3 A;  1IKJ A;  2R74 A;  4QAE A;  1I04 A;  1ACD A;  4XMG A;  1CBR A;  5L8I A;  1N0S A;  4AZM A;  2NNE A;  3ELZ A;  3BX8 A;  3F9D A;  3NP1 A;  1JYJ A;  1SXU A;  4BQU A;  3UEU A;  1EUO A;  1YP6 A;  1ZNG A;  2HYS A;  2XST A;  4ZFX A;  1G85 A;  5HZQ A;  4YBP A;  1R0U A;  4ZHD A;  3P6E A;  2A2G A;  1SXX A;  2CM9 A;  2GC9 A;  1X8O A;  4N7D A;  4KII A;  1FEM A;  5LKF A;  3I17 A;  4Y0R A;  4ZH9 A;  5LJE A;  4OS8 A;  1LID A;  5K06 A;  1QY2 A;  3P6C A; 
#chains in the Genus database with same CATH topology
 5B11 O;  1SWG A;  1KL4 A;  2AT5 X;  4GKC A;  1RXJ A;  4NP1 A;  2X45 A;  4OKA A;  4QYN A;  3C78 X;  1DZP A;  2QM9 A;  2IZA A;  5FAZ A;  2RCT A;  3EBK A;  3KQ0 A;  4YGG A;  3WJD A;  2AF5 A;  1SWD A;  4ON1 A;  5H9L A;  3WVM A;  4OMW A;  2L9C A;  1QWD A;  2L67 A;  2RTJ A;  1LNM A;  1T0V A;  2ASN X;  2WSJ A;  5B27 A;  4XMD A;  5HZ5 A;  2C1Q A;  3P6D A;  5D47 A;  1KL5 A;  2I5Z O;  4TJZ A;  3PK2 A;  4I95 A;  1EII A;  3B2H A;  3SZI A;  4ES7 A;  5IO5 A;  4BJ8 A;  3VG4 A;  1DFV A;  2GTF X;  1B0O A;  4OS8 A;  3JQO A;  3BU9 A;  1S7D A;  4PSQ A;  4QZT A;  3VGW A;  4YH0 A;  3SAO A;  4BX7 A;  2BS6 A;  4FGI B;  2FRS A;  4OMX A;  1LPJ A;  4EXZ A;  3UEW A;  3RWX A;  3WYQ A;  1PBO A;  4FBV A;  1H91 A;  4ZR2 A;  3VG7 A;  3CKG A;  3WZN A;  5AEO A;  4Z6J A;  4WFV A;  3L4R A;  3VHM A;  2RTB B;  5D8J A;  3CQN A;  4AYH A;  3RSW A;  2MWH A;  2Q2M A;  4GGR A;  3VG5 A;  5B29 A;  2LA7 A;  3QQ2 A;  5KHP A;  4ID2 A;  4YGZ A;  1CBS A;  2JW1 A;  2K62 A;  3IA8 A;  4I60 A;  4A8Z A;  5IRA A;  1DV9 A;  4M6S A;  5F58 A;  4EEJ A;  4YBU A;  4D6B A;  1E2T A;  1LCZ A;  1SWO A;  4ODD A;  4U8U M;  4XME A;  4YMY A;  3AKM A;  4KH8 A;  3ZUI A;  2F01 A;  4HPC A;  3SOT A;  3SZJ A;  5KIC A;  5H8T A;  5B5F A;  3WOV A;  3B2J A;  5DG4 A;  2Z4I A;  4RUU A;  4Y5D A;  4Y0S A;  4MVE A;  1KQX A;  1VWR B;  4IB6 A;  3U9P C;  1CJ5 A;  2L5P A;  3NX2 A;  2OYB O;  2KW1 A;  4ML7 B;  5LJB A;  4QRL A;  3WZO A;  3MVF A;  1MDC A;  5EED A;  4ZHF A;  1CBQ A;  2IZD B;  3WJG A;  2FR2 A;  5IO6 A;  4JO6 A;  5F6Z A;  2WQ9 A;  5L8O A;  3BX7 A;  5IRU A;  1RST B;  3KVN A;  4HFO A;  4JHQ A;  1BWY A;  2CBR A;  2OVD A;  2CBS A;  3HOE A;  1SXW A;  3RDX A;  1AQB A;  1GT3 A;  1SWH A;  1XCA A;  3VPJ E;  3MBT A;  1KXO A;  3CKF A;  4YCE A;  1SWS A;  1T68 X;  4Y59 A;  5F6B A;  3WBG A;  2A3F X;  2DJG A;  3LHN A;  4MVK A;  4OS3 A;  4U8U N;  1TOW A;  4MVI A;  4QGV A;  3TZS A;  2IZH B;  1HY2 A;  4LQZ A;  5KID A;  2NNQ A;  4I3C A;  1W5R A;  5HCD C;  1BM5 A;  4GD9 A;  1SLG B;  2FS7 A;  2FS6 A;  4KT5 A;  4NLI A;  1ZNH A;  1IFC A;  2OY8 A;  4A60 A;  3SLJ A;  1AVG I;  1OSP O;  3T6L A;  3TGA A;  4FBR A;  1A57 A;  1KT6 A;  2X56 A;  1KGL A;  3WXQ A;  4BGF A;  4NV7 A;  1JZU A;  1VWQ B;  2G79 A;  2ZAI A;  3F6Z B;  5BVQ A;  3C76 X;  3S60 A;  5IXG A;  1SWP A;  2HNX A;  1GT5 A;  3WZP A;  1KL3 A;  2GTL N;  1W6F A;  1DZK A;  1X89 A;  1SWR A;  1QY0 A;  1SRH A;  1STS B;  4YFR A;  4MIR A;  4KC7 A;  1GT1 A;  1O8V A;  2FR3 A;  2WPU A;  3BRN A;  1SY1 A;  3BY0 A;  2LBA A;  1VWL B;  3G7X A;  3EMM A;  1U0X A;  5LJK A;  3HPE A;  4QQ1 A;  1NP4 A;  1STR B;  3DTQ A;  4K19 A;  2W2F A;  1L6M A;  1LUQ A;  3HWE A;  2KTS A;  4AZO A;  5K67 A;  4GJV A;  1SWC A;  3KFH A;  5B10 O;  1EAL A;  1OBU A;  1YWC A;  2VFC A;  4ALO A;  1SRJ A;  2FKJ A;  3ZUO A;  2AT6 X;  2ACO A;  3EM0 A;  4HWM A;  4FBO A;  4CSB A;  4EKV A;  5CE4 A;  4YDA A;  2Y3E A;  1SA8 A;  2OFR X;  1FDQ A;  1LCW A;  2A8G A;  2ZSC A;  1N43 A;  2FLJ A;  2WWP A;  2YG2 A;  4IMO A;  3EBW A;  1B56 A;  4O3Y A;  2WEX A;  4NYQ A;  3VG2 A;  1JMX A;  4IAB A;  4TLJ A;  1VWF B;  2N93 A;  4L3R A;  3APW A;  2OVE A;  2OZQ A;  5JR8 A;  2OL6 O;  1IFB A;  1X8U A;  2QCB A;  4ZH6 A;  4CK4 A;  3SZH A;  1N9M A;  4IBA A;  1EW3 A;  5IO7 A;  1BRQ A;  4ZJ0 A;  1AVD A;  3B2L A;  4ORU A;  4CPH A;  1RLB E;  4CPH B;  1SMP I;  3FA8 A;  5HTE A;  1G5W A;  5HCE C;  1PM1 X;  2RTP B;  1KFF A;  1YWA A;  2AL0 X;  2HZQ A;  3FID A;  4NLJ A;  4CPI A;  4O4U A;  2QOS C;  3LV4 A;  4MVL A;  3T6F A;  1CRB A;  2FWV A;  1LDQ A;  2KT4 B;  5FQ6 E;  1KZX A;  2QMI A;  4ORR A;  2A0A A;  2QO5 A;  3FLL A;  2IZG B;  2LFO A;  4Z2O A;  1TW4 A;  3APV A;  4YCH A;  5D4A A;  4AW8 A;  1EXS A;  4BCS A;  4AZN A;  1BEB A;  5FQ7 E;  1ERX A;  5HA1 A;  3E3C A;  2FKG A;  4IB9 A;  4QZU A;  3OD9 A;  1QQS A;  1AB0 A;  5D45 A;  1EPB A;  2RD7 C;  4O3W A;  3D97 A;  2Q9S A;  1QY1 A;  1IJ8 A;  4WFU A;  4XMH A;  5K68 A;  2Q2P A;  1YUP A;  1YWD A;  1VWB B;  4O49 A;  1VWI B;  5IRW A;  1TXL A;  1VWK B;  5LJD A;  2GH7 A;  4M7M A;  4O9S A;  3RE6 A;  1UYN X;  2M4L A;  4O4X A;  1NP1 A;  2VFB A;  3D4R A;  3NX1 A;  1EQD A;  2LB6 A;  2HZR A;  1LEL A;  2A13 A;  2WQA E;  5FEN A;  5H9K A;  3HWD A;  2AT3 X;  1BBP A;  1JJX A;  1GX3 A;  1TVQ A;  4XMC A;  2MO5 A;  3EW1 A;  1ICM A;  4TKH A;  4AZP A;  1SWK A;  1VPR A;  3FEN A;  4OS0 A;  3V8U A;  1SRI A;  1ZNL A;  3HOL A;  1ZNE A;  3BSZ E;  2L68 A;  1DZM A;  3AEH A;  1VWD B;  5BVS A;  3CBC A;  4YGH A;  1FE3 A;  1HXZ A;  1YIV A;  1W4T A;  3HTY A;  1JJU A;  2FHL A;  2RTO B;  3CMP A;  3S5V A;  1RXH A;  3FEK A;  3NAD A;  3KFI A;  2G8C O;  1SLE B;  1JJJ A;  5LKE A;  2NP1 A;  1O1V A;  2RTE B;  2RTN B;  1Z24 A;  4EFG A;  1JYD A;  5B5G A;  2RTD B;  1OEK A;  2FGS A;  4ALB A;  1JQP A;  3EYC A;  1UZ2 X;  4IMN A;  1U18 A;  4QYP A;  4GGZ A;  3MG5 A;  3RDM A;  4ZHC A;  1D3S A;  4A1Y A;  1DZJ A;  1G74 A;  4U9C A;  5HWZ A;  4LKT A;  2F73 A;  5HZ6 A;  3ZW2 A;  1BSO A;  2NND A;  4GZV A;  2GTL M;  2R56 A;  1EIO A;  1Y9T A;  1VWH B;  5CYB A;  2OFM X;  4JNJ A;  5FFH A;  3RDQ A;  4BOE A;  3U03 A;  1PEE A;  4ORW A;  4WBK A;  1Y52 X;  1I06 A;  1IKE A;  4ORY A;  4TQ2 A;  3ZW0 B;  4RUN A;  5HA0 A;  2RTQ B;  4WHI A;  1BJ7 A;  5AQ6 A;  4LZU A;  2R73 A;  3C77 X;  3B2I A;  1SWF A;  2BT9 A;  1VWM B;  1E02 A;  1SWA A;  3NBX X;  1RSU B;  2OY1 O;  4YDB A;  4Z27 A;  4XMF A;  4YKM A;  3P6H A;  5HZ9 A;  2A5B A;  1OPB A;  2W2A A;  4MEE A;  3FR4 A;  3O22 A;  3TGC A;  3P24 A;  4CDE A;  5HTD A;  1XKI A;  4ORX A;  4I3B A;  5BVT A;  4U3Q A;  4UU2 A;  1P6P A;  1BSY A;  1NQM A;  4IAX A;  3SLT A;  4HPD A;  3VE2 A;  1HMT A;  1D2U A;  3Q34 A;  4AZQ A;  4ZHH A;  2P8G A;  1WUB A;  5H9A A;  1X8N A;  1LKE A;  4DNE A;  1LIF A;  4ORS A;  1GX8 A;  5CSE A;  3PH6 A;  1ICN A;  3DSZ A;  1MEP A;  4PJ2 A;  3VHH A;  3APX A;  1NC9 A;  2AH7 X;  3P6G A;  4HPB A;  4O4O A;  1SY2 A;  5D48 A;  3APU A;  4NV8 A;  3WZQ A;  4ARH A;  5L8N A;  2JU8 A;  2X46 A;  2YMS A;  1I9H A;  4ZHG A;  1LIC A;  2W2B A;  1OBP A;  2XKL A;  1EPA A;  1MK5 A;  2AMM X;  2MM3 A;  5EDB A;  3WYP A;  3TF6 A;  1YWB A;  3HWG A;  3PEC A;  5HBS A;  5EDC A;  4CPE A;  2F09 A;  2Q39 A;  1QFT A;  4U8U O;  2RTF B;  1FJ1 E;  2IZE B;  1E00 A;  3ZQ3 A;  4TKB A;  1RXK A;  4FQB B;  3LTW A;  4IB8 A;  2OF8 A;  4U46 A;  4GNW A;  4C5P A;  4O4S A;  3PED A;  3VU1 A;  1BRP A;  2FT9 A;  2HMB A;  1O1U A;  1VWC B;  1B8E A;  1I05 A;  1HN2 A;  1LF7 A;  2JOZ A;  1GKA B;  3NPO A;  3QKG A;  4GDZ A;  1BSQ A;  2FTB A;  3JSQ A;  3AKN A;  4I9R A;  5EEE A;  3STN A;  3X00 A;  2CM4 A;  1U17 A;  2X32 A;  1X8Q A;  1IIU A;  1SRE A;  3KFG A;  4TNN A;  5C0N A;  2JU3 A;  1VWA B;  3CR6 A;  2RTA A;  1N7Y A;  2RTI B;  3RZY A;  1LFO A;  1SWE A;  1E06 A;  1VWO B;  1ZND A;  3FEL A;  1MUP A;  3NQK A;  3PQU A;  3ZI8 A;  1E5P A;  2RTK A;  4UU3 A;  3VG3 A;  4GUZ A;  2BLG A;  3K3L A;  3UEX A;  4BBO A;  2RTL A;  2Q4N A;  1SWN A;  2QO6 A;  1HQQ A;  4AZR A;  5F7G A;  1S2P A;  3VE1 A;  3B2K A;  1STP A;  1KT3 A;  3ZZV A;  4MIS A;  4QNI A;  4Y0P A;  1DF8 A;  1G7N A;  1NBX A;  3WJC A;  4DCB A;  3RDS A;  2G5L A;  3JS1 A;  5EZ2 A;  2RTG B;  1A2D A;  3EC5 A;  4QGW A;  1OEE A;  4CDC A;  4NNS A;  4Z2P A;  1AVE A;  1HBP A;  2O62 A;  5EPQ A;  1ML7 A;  1IW2 A;  4I9S A;  3VHI A;  5B3M O;  4ZCB A;  2JN3 A;  3CQR A;  1EI5 A;  2BS5 A;  1A18 A;  4O3Z A;  3WJE A;  4EQA C;  1I4U A;  4ZGU A;  3MM0 A;  2LBV A;  3ZW1 B;  5HAE A;  1MX8 A;  4GH7 A;  4BX5 A;  1PTS A;  3WJF A;  4OEL A;  4BX5 B;  1HXL A;  3BLG A;  3RBY A;  3RDO A;  1SRF A;  3EW2 A;  3FMZ A;  4N7C A;  4KC8 A;  1NGL A;  1SRG A;  4IB7 A;  3KZA A;  2OVS A;  1CBI A;  1A3Y A;  1SWJ A;  2UYW A;  4NYR A;  2ZAG A;  4Z2V A;  3IFB A;  1FEL A;  1GM6 A;  2X8F A;  3FW4 A;  4JGL A;  3FA7 A;  1NDJ A;  1ZRY A;  2X34 A;  4CV7 A;  4QGX A;  1NQN A;  1QFV A;  4COT A;  3T2X A;  2RCQ A;  1N4J A;  1LDO A;  2A2U A;  2Z4H A;  3S26 A;  4D6A A;  4R0B A;  2BC3 A;  1DC9 A;  2GJ5 A;  3H3I A;  1QAB E;  3FA6 A;  4IRW A;  3D96 A;  4OEM A;  3N91 A;  3ZWE A;  4HPA A;  2RTR B;  1QG5 A;  1KOI A;  1JV4 A;  3RE5 A;  2X55 A;  2RA6 A;  3PPT A;  4BX7 B;  1X8P A;  3SLO A;  3MX7 A;  1MVG A;  2HLV A;  1B4M A;  3BDR A;  4LKP A;  1JBH A;  1ALB A;  1FTP A;  3OBL A;  1OBQ A;  4YVB A;  1URE A;  4CDD A;  1OEJ A;  1MM9 A;  1WBI A;  1GX9 A;  1GGL A;  4BVM A;  1VYF A;  2QO4 A;  2DJF A;  3BS2 A;  1OPA A;  1MX7 A;  1GXA A;  2PI3 O;  2K23 A;  3AUM O;  3PDF A;  3U0D A;  3CBS A;  3O19 A;  3FA9 A;  3OJY C;  3RDU A;  1PMP A;  2Y32 A;  5LJG A;  3STK A;  5CHK A;  4I6S A;  1T8V A;  2CZT A;  1HBQ A;  2OFB A;  1ADL A;  3ZW0 A;  5HZ8 A;  2JU7 A;  1ERB A;  2AT0 X;  2IZI A;  2MF6 A;  2OFA A;  4GET A;  2MJI A;  1BLR A;  2JMB A;  1GT4 A;  2UZ2 A;  3F8A A;  2IZC B;  1VWG B;  1Y53 X;  4INN A;  3RY1 A;  2OY7 A;  3VG6 A;  1S44 A;  1TOU A;  2X8S A;  3ELX A;  3FR2 A;  4GRJ A;  2IZK A;  2RTM A;  2AKQ A;  2VDF A;  3I0A A;  2C4I A;  3FW5 A;  1AEL A;  4DQ4 A;  4GJS A;  2A5C A;  1LIE A;  2E4J A;  1X71 A;  4L1N A;  1KT4 A;  2IZL B;  3RKG A;  2POA A;  2LKK A;  2WEW A;  4GNY A;  5FQ8 E;  5LJC A;  4Z28 A;  2OF9 A;  3BU1 A;  4YFP A;  1SY0 A;  4I3D A;  2PY1 A;  3NQ3 A;  3CWK A;  1VWN B;  3NR3 A;  4GU8 A;  1K3B A;  3WJB A;  2IZJ A;  3D9W A;  2I5V O;  2WUT A;  3HK1 A;  1VWP B;  1SXY A;  2IZB A;  3GAQ A;  3D95 A;  3PQS A;  3S5X A;  4CDF A;  3FR5 A;  2BHV A;  2CZU A;  4Y0Q A;  5AJC A;  2AT8 X;  2RN4 A;  2IFB A;  4A1H A;  4DQ3 A;  5BYP A;  1SLF B;  5F2B A;  3FEP A;  1SWU A;  1KT5 A;  1ZNK A;  2ALL X;  4GDA A;  3NQ9 A;  1HMS A;  3FIQ A;  4O3X B;  4ZGF A;  4YFQ A;  1KZW A;  1MOY A;  2RQ0 A;  4LZV A;  2X4M A;  2KTD A;  4NW4 A;  3UAQ A;  1SWL A;  3FYF A;  3RY2 A;  3UEV A;  5HCC C;  1JIW I;  1RBP A;  2RTC B;  2G7B A;  1K24 A;  4GK9 A;  5DPQ A;  3STM X;  3T1D A;  1RAV A;  1YP7 A;  3O2Y A;  3PP6 A;  2ANS A;  2OVA A;  5F1E A;  3TGB A;  4YKO A;  4GE1 A;  2G78 A;  4TKJ A;  3HWF A;  1SWQ A;  1Y9L A;  1LIB A;  4NNT A;  1GKA A;  2WR6 A;  1VWE B;  1FEN A;  3PH5 A;  2JGS A;  1KQW A;  4CPF A;  2MHD A;  3P6F A;  2OL7 A;  2X8T A;  3KFF A;  2ACP X;  2EU7 X;  4EDE A;  2DM5 A;  4IAW A;  1HQP A;  1Y0G A;  2GTL O;  1LCV A;  1Y55 X;  1SY3 A;  5L3Y A;  5LJH A;  1VYG A;  1KT7 A;  5H9N A;  2OY5 O;  3Q6L A;  1HMR A;  1DF3 A;  1IKJ A;  2R74 A;  4QAE A;  2FHN X;  2IZF B;  1I04 A;  3T2W A;  1ACD A;  5B2A O;  2OL8 O;  4XMG A;  1CBR A;  3FDC A;  4BX6 A;  4BX6 B;  5L8I A;  1UYO X;  1VYO A;  1N0S A;  1PBY A;  1SWB A;  4AZM A;  2NNE A;  3ELZ A;  3BX8 A;  4KCA A;  1VWJ B;  3F9D A;  2BSZ A;  3NP1 A;  1JYJ A;  1SXU A;  2HKD A;  1JMZ A;  4BQU A;  3UEU A;  1EUO A;  1YP6 A;  1ZNG A;  2HYS A;  2XST A;  1SLD B;  2CAM A;  1G85 A;  2KD2 A;  3P02 A;  5HZQ A;  4YBP A;  2RTH B;  1R0U A;  4B55 A;  4ZHD A;  3P6E A;  2A2G A;  1SXX A;  2CM9 A;  2GC9 A;  1X8O A;  3GE2 A;  1I78 A;  4GGT A;  4N7D A;  4ZFX A;  4KII A;  1FEM A;  5AJB A;  5LKF A;  2C1S A;  2AVI A;  5JD2 A;  3OE3 A;  2QOM A;  3I17 A;  1N9Y A;  4Y0R A;  4ZH9 A;  3ZW1 A;  1SWT A;  5LJE A;  1LID A;  5K06 A;  1QY2 A;  2Y3F A;  3P6C A; 
#chains in the Genus database with same CATH homology
 4GKC A;  4NP1 A;  2AT5 X;  3ZZV A;  4QYN A;  2X45 A;  3C78 X;  1DZP A;  2QM9 A;  5FAZ A;  2RCT A;  3EBK A;  3KQ0 A;  4YGG A;  3WJD A;  5H9L A;  3WVM A;  4ON1 A;  4OMW A;  2L9C A;  1QWD A;  2L67 A;  1LNM A;  1T0V A;  2ASN X;  2WSJ A;  5B27 A;  4XMD A;  5HZ5 A;  3P6D A;  5D47 A;  4TJZ A;  4I95 A;  1EII A;  3B2H A;  4ES7 A;  5IO5 A;  3VG4 A;  1DFV A;  2GTF X;  1B0O A;  3JQO A;  3BU9 A;  1S7D A;  4PSQ A;  4QZT A;  4YH0 A;  3SAO A;  2BS6 A;  4FGI B;  2FRS A;  4OMX A;  1LPJ A;  4EXZ A;  3UEW A;  3RWX A;  1PBO A;  4FBV A;  1H91 A;  4ZR2 A;  3VG7 A;  5AEO A;  4WFV A;  3L4R A;  5D8J A;  3CQN A;  4AYH A;  3RSW A;  2MWH A;  2Q2M A;  3VG5 A;  5B29 A;  5KHP A;  2LA7 A;  4ID2 A;  4YGZ A;  1CBS A;  2JW1 A;  2K62 A;  3IA8 A;  4A8Z A;  1DV9 A;  4M6S A;  5F58 A;  4EEJ A;  4YBU A;  4D6B A;  4ODD A;  4XME A;  4U8U M;  4YMY A;  3AKM A;  4KH8 A;  3ZUI A;  4HPC A;  3SOT A;  5KIC A;  5H8T A;  3WOV A;  3B2J A;  5DG4 A;  2Z4I A;  4RUU A;  4Y0S A;  4MVE A;  1KQX A;  4IB6 A;  3U9P C;  1CJ5 A;  2L5P A;  3NX2 A;  2KW1 A;  4ML7 B;  5LJB A;  4QRL A;  3MVF A;  1MDC A;  5EED A;  4ZHF A;  1CBQ A;  3WJG A;  2FR2 A;  5IO6 A;  5F6Z A;  2WQ9 A;  5L8O A;  3BX7 A;  1BWY A;  4HFO A;  2CBR A;  2OVD A;  2CBS A;  3HOE A;  1SXW A;  1AQB A;  1GT3 A;  3VPJ E;  1XCA A;  3MBT A;  1KXO A;  4YCE A;  1T68 X;  5F6B A;  3WBG A;  2A3F X;  4OS3 A;  3LHN A;  4MVK A;  4U8U N;  1TOW A;  4MVI A;  4QGV A;  3TZS A;  5KID A;  4LQZ A;  2NNQ A;  4I3C A;  5HCD C;  1BM5 A;  2FS7 A;  2FS6 A;  4KT5 A;  4NLI A;  1ZNH A;  1IFC A;  4A60 A;  4DQ3 A;  1A57 A;  1AVG I;  4FBR A;  1KGL A;  3TGA A;  1KT6 A;  3WXQ A;  1JZU A;  3F6Z B;  2G79 A;  2ZAI A;  5BVQ A;  3S60 A;  3C76 X;  2HNX A;  1GT5 A;  2GTL N;  1DZK A;  1X89 A;  1QY0 A;  4YFR A;  4MIR A;  4KC7 A;  1GT1 A;  1O8V A;  2FR3 A;  3BRN A;  1SY1 A;  3BY0 A;  2LBA A;  3G7X A;  3EMM A;  1U0X A;  5LJK A;  4QQ1 A;  1NP4 A;  3DTQ A;  4K19 A;  4AZO A;  2W2F A;  1L6M A;  3HWE A;  2KTS A;  3KFH A;  1EAL A;  1OBU A;  1YWC A;  4ALO A;  3ZUO A;  2AT6 X;  2ACO A;  3EM0 A;  4HWM A;  4FBO A;  4CSB A;  5CE4 A;  4YDA A;  1SA8 A;  2OFR X;  1FDQ A;  2FLJ A;  2WWP A;  2YG2 A;  4IMO A;  3EBW A;  1B56 A;  4O3Y A;  2WEX A;  4NYQ A;  3VG2 A;  4IAB A;  4TLJ A;  2N93 A;  4L3R A;  3APW A;  2OVE A;  2OZQ A;  5JR8 A;  1IFB A;  1X8U A;  4ZH6 A;  4CK4 A;  4IBA A;  1EW3 A;  5IO7 A;  1BRQ A;  4ZJ0 A;  3B2L A;  4ORU A;  1RLB E;  1SMP I;  3FA8 A;  5HTE A;  1G5W A;  5HCE C;  1PM1 X;  1YWA A;  2AL0 X;  2HZQ A;  4NLJ A;  4O4U A;  2QOS C;  3LV4 A;  4MVL A;  1CRB A;  2FWV A;  2KT4 B;  5FQ6 E;  1KZX A;  2QMI A;  4ORR A;  2A0A A;  2QO5 A;  3FLL A;  2LFO A;  1TW4 A;  3APV A;  4YCH A;  5D4A A;  4AW8 A;  1EXS A;  4AZN A;  1BEB A;  5FQ7 E;  1ERX A;  5HA1 A;  3E3C A;  4IB9 A;  4QZU A;  3OD9 A;  1QQS A;  1AB0 A;  5D45 A;  1EPB A;  2RD7 C;  4O3W A;  3D97 A;  2Q9S A;  1QY1 A;  4WFU A;  4XMH A;  2Q2P A;  1YUP A;  1YWD A;  4O49 A;  1TXL A;  5LJD A;  4M7M A;  4O9S A;  2M4L A;  4O4X A;  1NP1 A;  3D4R A;  3NX1 A;  1EQD A;  2LB6 A;  2HZR A;  2A13 A;  2WQA E;  5FEN A;  5H9K A;  3HWD A;  2AT3 X;  1BBP A;  1JJX A;  1TVQ A;  4XMC A;  2MO5 A;  1ICM A;  4TKH A;  4AZP A;  3FEN A;  1VPR A;  4OS0 A;  3V8U A;  1ZNL A;  3HOL A;  1ZNE A;  3BSZ E;  2L68 A;  1DZM A;  5BVS A;  3CBC A;  4YGH A;  1FE3 A;  1YIV A;  3HTY A;  3CMP A;  3S5V A;  3NAD A;  3FEK A;  3KFI A;  1JJJ A;  5LKE A;  2NP1 A;  1O1V A;  1Z24 A;  4EFG A;  1JYD A;  1OEK A;  4ALB A;  3EYC A;  1UZ2 X;  4IMN A;  1U18 A;  4QYP A;  4ZHC A;  1D3S A;  4A1Y A;  1DZJ A;  1G74 A;  4U9C A;  5HWZ A;  4LKT A;  2F73 A;  5HZ6 A;  3ZW2 A;  1BSO A;  2NND A;  4GZV A;  2GTL M;  2R56 A;  1EIO A;  1Y9T A;  5CYB A;  2OFM X;  4BOE A;  5FFH A;  3U03 A;  1PEE A;  4ORW A;  4WBK A;  1I06 A;  1IKE A;  4ORY A;  4TQ2 A;  3ZW0 B;  4RUN A;  5HA0 A;  4WHI A;  1BJ7 A;  5AQ6 A;  4LZU A;  2R73 A;  3C77 X;  3B2I A;  2BT9 A;  1E02 A;  3NBX X;  4YDB A;  4XMF A;  4YKM A;  3P6H A;  5HZ9 A;  1OPB A;  2W2A A;  3FR4 A;  3O22 A;  3TGC A;  3P24 A;  5HTD A;  1XKI A;  4ORX A;  4I3B A;  5BVT A;  4U3Q A;  4UU2 A;  1P6P A;  1BSY A;  4IAX A;  4HPD A;  3VE2 A;  1HMT A;  1D2U A;  4AZQ A;  4ZHH A;  2P8G A;  5H9A A;  1X8N A;  1LKE A;  1LIF A;  4ORS A;  1GX8 A;  3PH6 A;  1ICN A;  3DSZ A;  4PJ2 A;  3APX A;  2AH7 X;  3P6G A;  4HPB A;  4O4O A;  1SY2 A;  5D48 A;  3APU A;  4ARH A;  5L8N A;  2JU8 A;  2X46 A;  2YMS A;  4ZHG A;  1LIC A;  2W2B A;  1OBP A;  2XKL A;  1EPA A;  2MM3 A;  2AMM X;  5EDB A;  3TF6 A;  1YWB A;  3HWG A;  3PEC A;  5HBS A;  5EDC A;  2F09 A;  2Q39 A;  1QFT A;  4U8U O;  3ZQ3 A;  4TKB A;  1E00 A;  4FQB B;  4IB8 A;  4GNW A;  4O4S A;  3PED A;  3VU1 A;  1BRP A;  2FT9 A;  2HMB A;  1O1U A;  1B8E A;  1I05 A;  1HN2 A;  1LF7 A;  2JOZ A;  1GKA B;  3NPO A;  3QKG A;  4GDZ A;  1BSQ A;  2FTB A;  3JSQ A;  3AKN A;  4I9R A;  5EEE A;  3STN A;  2CM4 A;  1U17 A;  1X8Q A;  1IIU A;  3KFG A;  4TNN A;  5C0N A;  2JU3 A;  3CR6 A;  3RZY A;  1LFO A;  3PQU A;  1E06 A;  1ZND A;  3FEL A;  3ZI8 A;  1MUP A;  3NQK A;  1E5P A;  3VG3 A;  4UU3 A;  2BLG A;  3K3L A;  3UEX A;  2Q4N A;  2QO6 A;  4AZR A;  5F7G A;  1S2P A;  3VE1 A;  3B2K A;  1KT3 A;  4MIS A;  4QNI A;  4Y0P A;  1G7N A;  3WJC A;  3JS1 A;  5EZ2 A;  1A2D A;  4QGW A;  1OEE A;  4NNS A;  2O62 A;  1HBP A;  5EPQ A;  1ML7 A;  1IW2 A;  4I9S A;  4ZCB A;  2JN3 A;  3CQR A;  1EI5 A;  2BS5 A;  1A18 A;  4O3Z A;  3WJE A;  4EQA C;  1I4U A;  4ZGU A;  2LBV A;  3ZW1 B;  5HAE A;  1MX8 A;  4GH7 A;  3WJF A;  3BLG A;  3RBY A;  3FMZ A;  4N7C A;  4KC8 A;  1NGL A;  4IB7 A;  3KZA A;  2OVS A;  1CBI A;  1A3Y A;  4NYR A;  2ZAG A;  3IFB A;  1FEL A;  1GM6 A;  2X8F A;  3FW4 A;  4JGL A;  3FA7 A;  4CV7 A;  1ZRY A;  4QGX A;  1QFV A;  4COT A;  2RCQ A;  2A2U A;  2Z4H A;  3S26 A;  4D6A A;  4R0B A;  3H3I A;  1DC9 A;  2GJ5 A;  4EDE A;  1QAB E;  3FA6 A;  3ZWE A;  3D96 A;  3N91 A;  4HPA A;  1QG5 A;  1KOI A;  1JV4 A;  2RA6 A;  3PPT A;  1X8P A;  3MX7 A;  1MVG A;  2HLV A;  1B4M A;  3BDR A;  4LKP A;  1JBH A;  1ALB A;  1FTP A;  3OBL A;  1OBQ A;  1URE A;  1OEJ A;  1GX9 A;  1GGL A;  4BVM A;  1VYF A;  2QO4 A;  3BS2 A;  1OPA A;  1MX7 A;  1GXA A;  2K23 A;  3U0D A;  3CBS A;  3O19 A;  3FA9 A;  3OJY C;  1PMP A;  5LJG A;  3STK A;  4I6S A;  1T8V A;  2CZT A;  1HBQ A;  1ADL A;  3ZW0 A;  5HZ8 A;  2JU7 A;  1ERB A;  2AT0 X;  4GET A;  2MJI A;  1BLR A;  2JMB A;  1GT4 A;  3F8A A;  4INN A;  3VG6 A;  1S44 A;  1TOU A;  2X8S A;  3ELX A;  3FR2 A;  4GRJ A;  2AKQ A;  3I0A A;  3FW5 A;  1AEL A;  4DQ4 A;  2E4J A;  1LIE A;  1X71 A;  4L1N A;  1KT4 A;  3RKG A;  2POA A;  2LKK A;  2WEW A;  4GNY A;  5FQ8 E;  5LJC A;  3BU1 A;  4YFP A;  1SY0 A;  4I3D A;  2PY1 A;  3NQ3 A;  3CWK A;  3NR3 A;  4GU8 A;  3WJB A;  2WUT A;  3HK1 A;  1SXY A;  3GAQ A;  3D95 A;  3PQS A;  3S5X A;  3FR5 A;  2BHV A;  2CZU A;  4Y0Q A;  5AJC A;  2AT8 X;  2RN4 A;  2IFB A;  4A1H A;  5BYP A;  3FEP A;  1KT5 A;  1ZNK A;  2ALL X;  1KZW A;  3NQ9 A;  1HMS A;  3FIQ A;  4O3X B;  4ZGF A;  4YFQ A;  2RQ0 A;  4LZV A;  2KTD A;  4NW4 A;  3UAQ A;  3FYF A;  3UEV A;  5HCC C;  1JIW I;  1RBP A;  2G7B A;  4GK9 A;  3STM X;  5DPQ A;  3T1D A;  3O2Y A;  1YP7 A;  3PP6 A;  2ANS A;  2OVA A;  5F1E A;  3TGB A;  4YKO A;  4GE1 A;  2G78 A;  4TKJ A;  3HWF A;  1Y9L A;  1LIB A;  4NNT A;  1GKA A;  2WR6 A;  1FEN A;  3PH5 A;  1KQW A;  2MHD A;  3P6F A;  2X8T A;  3KFF A;  2ACP X;  2EU7 X;  2DM5 A;  4IAW A;  1HQP A;  2GTL O;  1SY3 A;  5LJH A;  1VYG A;  1KT7 A;  5H9N A;  3Q6L A;  1HMR A;  1DF3 A;  1IKJ A;  2R74 A;  4QAE A;  1I04 A;  1ACD A;  4XMG A;  1CBR A;  5L8I A;  1N0S A;  4AZM A;  2NNE A;  3ELZ A;  3BX8 A;  4KCA A;  3F9D A;  3NP1 A;  1JYJ A;  1SXU A;  4BQU A;  3UEU A;  1EUO A;  1YP6 A;  1ZNG A;  2HYS A;  2XST A;  3P02 A;  2KD2 A;  1G85 A;  4ZFX A;  5HZQ A;  4YBP A;  1R0U A;  4ZHD A;  3P6E A;  2A2G A;  1SXX A;  2CM9 A;  2GC9 A;  1X8O A;  3GE2 A;  4N7D A;  4KII A;  1FEM A;  5AJB A;  5LKF A;  3OE3 A;  3I17 A;  4Y0R A;  4ZH9 A;  3ZW1 A;  4OS8 A;  5LJE A;  1LID A;  5K06 A;  1QY2 A;  3P6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...