1LNXA

Crystal structure of the p.aerophilum smap1 heptamer in a new crystal form (c2221)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
molecule tags Rna binding protein, transcription
source organism Pyrobaculum aerophilum
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
total genus 13
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lnxA00
4JRKA 4M7DC 3QHSA 1Y96B 3RKWA 3JCMc 3JCMb 2YLCA 4M77F 4F7UF 5LJ5g 4M75D 4JUVA 4MMLA 3INZA 3JCMg 5GAOn 3QUIA 4JRIA 3RESA 2E41A 4QVDA 5GAN4 4A53A 4F7UA 5LJ3g 5GMKi 5DY9A 5GAN7 3FJPA 4M7DF 4M7DG 4RCCA 5GMKh 4PJOF 5LJ3j 4M78G 2DVEA 4C92D 3HSBA 4M7AD 3JCMP 3L2ZA 4M77G 3V7SA 1M8VA 5GANf 5GAOm 3FB9A 4N0AA 4Y91A 4QVCA 5GAMh 4XTWA 5GMKe 4M7DE 1U1TA 4C8QE 3HFNA 2RA2A 2JN0A 3JB9H 2DKGA 1YCYA 3JB9F 4PJOC 1D3BA 1WPYA 5GANg 4M77B 5LJ3d 3V8KA 4M7AB 4WF2A 4XTUA 4C92B 3JCMe 4M75A 4M75G 3GIBA 5GAN3 4PJOE 4RCBA 4XQ3A 3JCMQ 3JB9D 1LJOA 5GAOp 1WQWA 2K57A 5LJ5h 5GAOl 1M5Q1 2CGHA 4HA8A 1N9SA 3FIFA 3M4GA 5LJ5f 3JCMW 1LNXA 3JCMh 4C8QD 2DJZA 4J6YA 4XTYA 3AHUA 5GAMj 2RM4A 4OP0A 2DZ9A 1U1SA 4M77A 4XU2A 2YHTA 4N0AC 3RIRA 1I4K1 3JCMf 4C8QA 4C92A 4F7UE 1HXDA 3JB9I 4M7AA 4PJOD 4M77D 4PNOA 3RKXA 3VU3C 4M75E 3SB2A 4PJOA 1KQ1A 5LJ3h 5GANj 4EMKA 5GANe 1Y96A 2VC8A 5CAIA 5GAMd 4C8QF 2RD1A 3BW1A 2EJGA 1MGQA 3V8LA 4C8QB 5GAOq 3V8JA 3L1AA 4EMKB 5GAMg 4M77E 3JB9G 2E1HA 4C92E 5GANh 4M7AE 4PJOB 4M78E 3SWNA 4HT8A 4J6XA 5GANd 4C92C 4M7AC 4C8QC 4XTXA 4EMKC 3BDUA 2FB7A 2EAYA 4XTZA 4JLIA 4XU0A 3JCMX 3QSUA 5GMKl 2ZGWA 4PJOG 3HFOA 5GAN5 1D3BB 3EFRA 5LJ3f 3JCMJ 3QO3A 4F7UB 1LOJA 4C92F 4C8QG 4M7AF 4NL2A 4V2SA 4XU3A 5I21A 1HK9A 2FYKA 2DXUA 3PGGA 4M75B 2RB6A 1KQ2A 2DTHA 4J6WA 3BFMA 1BIBA 4F7UG 4M7DD 1TH7A 1B34B 2DTIA 5GAMe 3RUXA 4XTVA 3JCMd 4EMGA 5GAN6 2I2LA 1I5LA 3RKYA 1H641 4J5YA 4M75C 2DTOA 2EWNA 4MMKA 3RERA 4X9DA 4A54A 4HT9A 5GAN2 1WQ7A 2E64A 3JCMV 5GAN8 2E65A 1WNLA 2E10A 4NOYA 3BY7A 4M78B 1N9RA 2YLBA 3V7RA 5LJ5e 5LJ5j 5GAMf 3SWNC 5GAOr 3EFSA 4M75F 4XU1A 1I8FA 2VXFA 2Y90A 2HNIA 2EJ9A 4DQ2A 4EMHA 4M78A 2DEQA 4M78C 4X9CA 5LJ3e 2VXEA 1B34A 3JB9J 1JRIA 4M78D 4C92G 4M7AG 4M7DA 3SWNB 4M7DB 4M77C 2QTXA 5LJ5d 1BIAA 2EJFA 1X01A 2DXTA 3V7CA 5GMKj 5GMKm 1I81A 2DZCA 4M78F 4NL3A 1JBMA
chains in the Genus database with same CATH superfamily
2D9TA 4AT1B 2O9VA 3JCMb 2YLCA 3LYIA 2CT4A 1K9AA 4E7LA 1D0YA 5LJ3g 3OYFA 2M02A 2YUPA 2F2XA 3A1PA 4A4FA 5LJ3j 1XNIA 3CCUT 5GAMh 3PE0A 1MUZA 2JN0A 1XJWB 3EGXB 2H3JA 2GF7A 3V8KA 4XTUA 1M2OA 2RI2A 4M75G 5FU7C 5KYXA 1H92A 2ED1A 2DA9A 2QQ9A 1UJYA 2GQIA 3JCMh 3CC4A 3M9QA 2OTJA 2YWWA 2CSIA 2HCKA 2KXCA 4M75E 3VYHB 3CCJA 1WXBA 4PFZA 2KQWA 3JRZA 5GANj 4K11A 1UHFA 2E4HA 5GAMd 4IUTA 2XMFA 4AFZC 1N8RC 3V8JA 3HRUA 1AZGB 3JB9G 2X4YA 3OYGA 5DLQE 2EQIA 1VQMA 3RNJA 1VQ6Q 3QYHB 4EIKA 3G4ST 2LVMA 4RTTA 3CBMA 1D3BB 3M5AA 1MHNA 2LT1A 2FHDA 2EYQA 1YHQT 1C0MA 3PGGA 2DD4A 4O5VA 1OOTA 1IRXA 2PQWA 1NZ9A 4E7JA 1PHTA 1YNZA 1N8RR 1VQ8T 2RHUA 3M56A 1PG5B 3QJYA 3JCMV 4E2FB 3V7RA 3EH1A 1VQ6T 2MAMA 2X35A 4J9IA 1M3BA 2H3EB 2JVVA 4F17A 1JRIA 4C92G 1RI0A 4LDUA 2QEXQ 1SEMA 2LP5A 4IUPA 3CMAT 4M78F 3QHSA 5I11A 4M7DC 2JS0A 2VKNA 9ATCB 1IHVA 4MMLA 1UGQB 4ELZC 3OW2S 4LDWA 2KROA 2EGAA 1V1CA 4KT0E 1X75C 1S72A 1K73C 4PJOF 3RBBB 4M7AD 2MIOA 2RI3A 4Y91A 4QVCA 1N6AA 5FU7B 3OYKA 2XK0A 1VQMQ 4FT2A 1UE9A 2D0QB 3PIPA 4WF2A 1IGUA 1NEGA 5GAN3 3E1SA 5FU6B 4FSXA 3CBPA 1RABB 4MZPA 2VVKA 3OBYA 2DZ9A 3WVEB 2JTFA 3A5ZB 2L3QA 1WJRA 2QASA 1ZBXA 1SHFA 4AFQC 1BCMA 3CPWS 2K3BA 5HK0A 1U8RA 2GTOA 1OX9A 1WHGA 1TU0B 4J6XA 4TVRA 3CPWP 4XTXA 3CCST 2MCNA 5GAN5 3MJXA 3JCMJ 4IUQA 3S3OA 4XU3A 1KD1C 1I5OB 1BKBA 2HEQA 1YJNQ 3KBGA 2XD0A 4BE1A 3RKYA 1AT1B 3WVDB 1ZA1B 3LGLA 4A63B 1QKWA 2ZPEB 1TUCA 4FYVB 4M4ZA 5GAOr 4M75F 2Y90A 1UGVA 1K9MU 1V76A 2XI9A 1QP3A 2KRSA 1Q7YU 3HKSA 5CO7A 4J9CA 3SWNB 5IXFA 5KE2A 2XDBA 2C0IA 1I81A 3TQ7P 1Q81R 2FRYA 3A8OB 3NMZC 3H41A 4CC2A 2F5KA 2RK2A 5KYUA 1UG1A 1YJWQ 1YJ9Q 1WHKA 4JPBW 3QUIA 2XU8A 4A53A 4F7UA 1G3WA 4M7DF 5KYWB 3S6WA 1PWTA 3L2VA 3JCMP 3V7SA 3R6OA 4BY6B 1ZSZC 3OS2A 2YRCA 2DKGA 1M1KC 4PJOC 2QTVA 1K8AU 4IKFA 3JSCA 2AKLA 2JJ9A 3JB9D 1LJOA 1WFWA 5FRNA 1QQJA 3I5SA 3FJ5A 3RKXA 1Y71A 3OS5A 1G8XA 2VWFA 2VUBA 1TWBA 2QDLA 3OB9A 4ZGJB 2J6OA 2VC8A 3NTKA 4C5EA 3QYGB 4KH0B 3CCLQ 5A0LA 1NLOC 1W2BS 4L59A 5CKEA 1VQ7T 2KRNA 1MNDA 4J7FA 4OGCA 2BZYA 4NS5A 5KCOA 1LOJA 2DF6A 1FMWA 2J7IA 2ZPFB 3UA7A 2M9UA 2P4TA 4FW2A 3CC7T 4PL6A 2OTJT 2K4YA 1B7TA 2HQXA 2AKKA 2K5FA 5GAN8 1PNJA 3ER0A 1CKAA 1U5SA 3P8HA 1BBZA 3OQ5A 5LJ5e 2A08A 3URGA 2O01E 1YFNA 3SWNC 1X6OA 1QVFP 1GL5A 5CIUA 3TVTA 3ZBDA 1D1AA 2JTEA 4QT7A 4JRPA 5GJVB 4E7IA 4HXJA 1CSKA 5GMKm 1PD1A 1GFDA 1WGSA 2KAFA 3RESA 3UATA 2JMCA 2EQMA 3A8MB 4F7UF 1R0BG 2E12A 4CRIA 1BYMA 5GAN4 2M51A 1M1KU 1K76A 3LH5A 3CCMQ 3G4SA 2W10A 3MPUB 2YXYA 1ACMB 2CH4A 1U1TA 2X51A 1KD1R 1UTIA 2LRQA 2HBWA 3QZ5B 2QQRA 1WJSA 2QYZA 4RCBA 1NG2A 3DB4A 2KXDA 3CMAA 4JDSA 3M0UA 2DO3A 4C8QD 1KIKA 4C8QA 1PRMC 1JEGA 1ABOA 3LX7A 3G71T 3VU3C 3MEVA 1KQ1A 2QQAA 3UT1A 5FW9A 4BDZA 1TXQA 1UEBA 5CAIA 4FYXB 1YJNT 2RJEA 2LMJA 2E6NA 1WJQA 4N4GA 4OMQA 1X69A 3I9QA 3C4SA 3CC2Q 5KYUB 4ZGEB 1C1AA 5KH6A 4A4EA 2XG8D 4JLIA 2EQUA 3M0QA 1Y57A 1SPKA 4ZN1A 3C94A 2W0ZA 1AHJB 1QWFA 1KQSP 2O88A 3VS3A 4EMGA 1K8AC 4PFPA 3NFCA 2EWNA 2LCLA 4HT9A 4HCZA 4II1A 2HQHA 1SKUB 4IUVA 4MZTA 1Y7XA 3CBOA 2RQVA 4JS4A 4FYWB 1YJWA 1YJ9A 3CD6A 1QMCA 2KEAA 2HAXA 2LCSA 3TSZA 2VYTA 3CCEA 2DLPA 5I2SA 1BB9A 3MKDA 1SSHA 2ROLA 3TU4K 5CQXA 4LD6A 1ARKA 5CVIA 1UHCA 4YTLA 2XDDA 4HKEA 4FL6A 2FG0A 2OTLQ 4M75D 1BI3A 3MEAA 3RDVA 1P92A 2RJCA 1DJ7B 1C6VX 3REBB 1O9SA 1UGSB 5KCHA 4OMPA 3FJPA 1M1GA 4C5HA 2E5KA 3UWNA 4C92D 4XTWA 4AFUC 5CKDA 5J39A 2V8KA 2QA4Q 1M4ZA 3CC2A 1LPLA 5CCAA 2ENMA 3CCLA 4AG1C 3OY9A 3FIFA 4XAXB 1LNXA 3VS2A 3AHUA 3LW5E 2ZZDA 3RIRA 4RTVA 2KNBB 3JCMf 2E70A 1HXDA 3PIOA 2MPXC 3NTIA 4J9BA 5LJ3h 4KULA 5CKFA 4OMMA 4EMKA 3MEUA 4RKUE 2QAZA 2F2WA 5AT1B 2JXBA 2RF0A 4D6WA 1NJIU 3PMTA 2LC4A 2C06A 4CC7A 2LJ1A 3CC4Q 5HKCA 2FB7A 2V26A 4XTZA 2CZ6B 4GBQA 1N27A 5CKHA 4C0DC 2QDYB 3D7SB 4DA4A 1BK2A 4E7ZA 3EGXA 2D0NA 1D1CA 1WNLA 3EFOB 5L8RE 1I1JA 1VQKT 4KUDK 1CKBA 2JOYA 3QZ9B 2O4XB 2YUQA 5C0MA 2EKHA 1H3HA 4M78D 3CPWA 1B3QA 2P0PA 3CCMA 4FT4A 2P0QA 2MF2A 1GCQA 3ZEHA 2NUTB 1NBEB 3FEOA 4PLLA 4PJNA 4VUBA 1QCNA 4LUEA 2Y4XA 2BE9B 4N4HA 2EGCA 2HZYA 3J80E 4GY5A 4E7SA 2XICA 2DVEA 1KFZA 3H0FA 3META 4DOWA 4FCYA 2K6DA 3DB3A 2DYBA 5AYFA 2E3IA 3SDZA 4EPCA 6AT1B 1KQSS 1D3BA 2PUOB 1YWOA 1VQLT 3M53A 2WSCE 4DEXA 2RHYA 3CCVA 3T9NA 1KHCA 3M4GA 1LVKA 1KC8R 2MK5A 1VQNA 2CKKA 3QKJA 1Q95G 1HD3A 1JXOA 3E9FA 3VS0A 1IZ6A 1Z9ZA 2ATCB 1RLQC 1WXTA 1MGQA 2O31A 2E3HA 2RMOA 1WI7A 1RUWA 3QJ6A 4GLKA 5GANh 5D7UA 2DERA 2LNHB 3PVLA 4C92C 2DFUA 1JQQA 4HVUA 5A0DA 3OYEA 2MYSA 4LUDA 2K7AA 4F7UB 4F04B 3CCEQ 4C8QG 4NL2A 4OB3B 1KQ2A 2LDMA 1VYVA 1JJ2S 1WHHA 2FPDA 3UPUA 1W1FA 2LX7A 3J81E 3GOXA 1I5LA 3MHXA 2KSSA 4X9DA 1JJ2P 1N9RA 2DX1A 4BDYA 3M54A 2HBPA 5FWBA 4E6RA 2JM9A 7AT1B 2DIQA 2AHJB 4LDYA 1I8FA 2PVGB 3EG9A 2VGMA 1VQ4T 3CCET 5HK3A 1IGQA 2EJFA 3OYBA 4DBRA 3C95A 5IAYA 2DL5A 2ABLA 1RI9A 3PT9A 2E41A 3M0PA 1UECA 2K9GA 4J83A 4X1VA 2CZ1B 1YJWT 1BCOA 5EC7A 2SRCA 1YIJQ 3CCRT 3FRNA 2NUZA 3JCMQ 2RPNA 1RAAB 5KYXB 4B6MA 2CGHA 2CREA 1WIEA 1X27A 3H0IA 1Q86U 5GAOq 2EIFA 1Y07A 1U1SA 2MI6A 4BB7A 3HHTB 3CCJT 3VS1A 4PNOA 3X26B 1Q81U 3E2UA 1U06A 1IB8A 5IN1A 3QDFA 1T0HA 1VQMT 1RAGB 1QVGA 4OMNA 2M1HA 4C92E 3SWNA 4OMFB 3ZL7C 1YITQ 2KY9A 3I56Q 3UA6A 3BDUA 4R0KA 4BD3A 2LQWA 1YP5A 2NLUA 1AWJA 4C92F 1HK9A 4P5NA 3VYGA 5A0GA 4ZTJA 4ZTFA 4IURA 3LWHA 1UUEA 4A54A 3PFSA 1WQ7A 2E64A 2QI2A 2E10A 1AOJA 3KFVA 4BI8B 3L42A 1WX6A 1JJ2A 1VUBA 4HVWA 1ZSGA 2PZ1A 4JJDA 3MO8A 2DMOA 2K5IA 2RJDA 4M77C 3CXCP 2OAUA 1BIAA 1X01A 5I21A 4BE0A 1MMDA 2DL4A 2HKNA 2CUBA 2EQKA 1ZHIA 1VQ8Q 5LJ5g 5L23A 3CCVQ 2OTJQ 4HCBA 1NE8A 5GAN7 1HSQA 2KVQG 1NLPC 4QQ6A 2WSFE 4IIOA 1IXDA 4LNPA 1M90R 3TEEA 1YCYA 2KRMA 2FO0A 1WPYA 3JCMe 2O9SA 4DBHA 2QK0A 2FZGB 4FSSA 2CS7A 1WQWA 2D1XA 5LJ5h 3CXCA 3VS4A 4D8DA 1OX8A 2DJZA 5A2QE 1WDXA 4XU2A 4M77D 2RQRA 4ELYC 2QGFB 2LQNA 2YT6A 3G6EA 4C8QF 1VQOT 2PVDB 3X24B 4Z89A 1M90C 1JO8A 3VUZA 2B86A 4C0ZA 3OYJA 3QSUA 1SF9A 4XU0A 2GQVA 3AT1B 3M57A 1VQ4Q 3LH0A 4BUGA 2DYIA 2M16A 3EGUA 3BFMA 3UDCA 1VQ8A 5FRMA 1KSWA 1WHMA 4C0DB 1RAIB 4KUIA 2I2LA 3MP6A 2LQ8A 1B07A 2DNUA 1PD0A 1S1NA 5D6YA 1OV3A 1SRMA 4RG2A 5GAMf 1N8RU 3H8ZA 3EFSA 2DEQA 3CCRQ 2MOXA 2EYYA 5CQYA 1B34A 3I5RA 2K3YA 4M7DA 1GFCA 1TG0A 4J9DA 4Q5WA 3VS7A 2JMAA 2DZCA 3N5BB 2GTJA 3Q1JA 3JCMc 2ED0A 4J9GA 4M77F 2X9HA 1A0NB 1FWZA 3EHRA 2XIDA 2BZ8A 4DBQA 4JS5A 4BACA 4J8OA 4L6V5 1WYXA 2F5TX 4B9XA 3HSBA 1KD1U 4M77G 3MP1A 5GMKe 3HFNA 4C5IA 4N4IA 3JB9F 5IHKA 1ZUKA 5GANg 5LJ3d 4JJBA 3A8HB 2ZPIB 1Q86R 5KYNA 1PC0A 3GPLA 1G3YA 5I2MA 2QA4T 3MP8A 4XTYA 3E19A 4OP0A 4F7UE 2KI7A 1K9MC 2KYMA 5J3BA 4AMCA 2KE9A 3CMEQ 5FLXE 1YWPA 3CXCS 3I56T 5LL6S 4LDXA 2J06A 2PU9B 3QIIA 2HL3A 3M59A 1VQ9A 3CQTA 3EFOA 4M7AC 4C8QC 3CCRA 2A37A 4JZ4A 2BKDN 1D0ZA 2K5LA 4J9FA 1E7OA 2EPDA 1F1BB 3HPWA 2GGRA 2R57A 3GNGA 2YDLA 4M7DD 1VYTA 2F2VA 1TH7A 3RUXA 3SEMA 4R56A 1OPLA 2G3RA 1H641 3RERA 1TS9A 2CT3A 2CYZB 3MCAB 4LE9A 3QWXX 1Y0MA 2L5QA 1R77A 2VXFA 5LJ3e 4E47A 2WACA 1FXXA 3PVQA 3NGPA 1M9SA 2OAWA 1SG5A 1QKXA 4ANJA 4MDXA 4JRKA 2RQTA 3H6ZA 3RKWA 1K0XA 1MV0B 1FMVA 4JRIA 4C0GA 2DXBA 1YI2A 5GMKi 1VOMA 2DETA 4M78G 2F69A 3CMET 1U3OA 2RHZA 4AG2C 3I35A 4N0AA 5GAOm 1YCSB 2RQUA 4C8QE 1OU9A 2QGGA 3G6EQ 1QVFS 4C92B 2X4XA 2AIRB 3GP8A 1M5Q1 3M0TA 5J26A 2DL3A 1I07A 1KC8C 1IO6A 1RADB 2I0NA 2ECZA 4PJOD 4J9EA 4DBFA 4PJOA 4BI4A 1T3SA 2IPOB 2DE0X 4C8QB 1M2VB 3I55T 1VQOA 1TUGB 4M7AE 2EYWA 3QG1A 4KGXB 4KGZB 1WLPB 1HYOA 3EG9B 2ZGWA 5LJ3f 3OMGA 2R58A 3OYYA 3QO3A 1KG1A 3CC7A 4M7AF 3P8DA 1EFNA 3G71Q 4OMOA 2RB6A 1JU5C 5DLOA 2F1LA 2KDSA 5GAN6 4R55A 1QLYA 2DL8A 4E7HA 1Q82C 2OJ2A 3EAEA 3BY7A 3QDRB 1NYFA 1GBRA 2XKOC 2X4JA 3M55A 3O8VA 3UF4A 2JNGA 1XOVA 4A4KA 3OYCA 1FX7A 3JB9J 2GCXA 3H0HA 1T3LA 5LJ5d 1QVGS 1X2QA 3L2UA 1NEBA 3JB9H 1VQPA 1X43A 2COYA 4CC3A 1M90U 1AZEA 4IIMA 4LD9K 2DRKA 3DLLA 2EW3A 1NPRA 1RAEB 4OB2B 1OZ3A 1RL2A 2SEMA 1G5VA 4Y28E 3QXEB 4C5GA 4QVZA 4Z88A 4A4GA 2O2OA 2CP5A 2G6FX 4C0FA 2EKOA 4HVVA 3FB9A 4KGVB 1K1ZA 4HCKA 1QW1A 3CCLT 3X28B 4JRQA 3DLMA 2RJFA 1M8MA 2QEXA 1Z9QA 4OGEA 1Q82R 4WCIA 2RK1A 2Y4YA 1N9SA 1QCOA 5CK9A 8ATCB 3G71A 2RM4A 2P84A 1I4K1 5D6XA 2QG9B 4L5GA 2D8HA 1QVFA 5IXBA 1FYNA 3S3MA 1KJWA 3JV3A 1Q82U 1Y96A 2KGTA 5CKBA 3OW2P 4J7IA 1TOVA 4BY6C 1ZSZB 1ZX6A 3CD6Q 4ZNXA 4BE2A 4HT8A 1VYUA 2ZAEA 2DAQA 4EMKC 1G83A 2DVJA 3JCMX 1RAHB 3X25B 2ZCFB 1I0CA 2V1QA 1VQ5Q 1W6XA 3GNFB 3KUFA 4D8KA 3M0SA 4F7UG 4XTVA 4J9HA 3FLGA 2PNIA 2ZPBB 2E65A 3I56A 4NOYA 2KBTA 4ZN3A 1VIFA 1QWEA 3ASKA 2LX9A 1G3TA 4EMHA 2EJ9A 2FPEA 2PVOB 4X9CA 2QA4A 3NHNA 2ROTA 3CC4T 1K8AR 4DOVA 2KK4A 3CCQQ 3V7CA 2X4WA 1OYXA 2RH2A 1LCKA 2DK3A 4FM4B 2RI5A 3E9GA 4JLGA 2K3XA 1J3TA 2BIVA 3JCMg 3WXMB 4EDUA 5GAOn 4ORZA 5DY9A 4ME7A 3DKMA 2LQKA 1S72T 5GJWB 2HKQB 3VUBA 3OYDA 5I22A 1WHJA 2K2VA 3HRSA 8AT1B 4RTYA 3EG3A 2LJ3A 4RTZA 4Y92A 1R8OB 3KXTA 1KHIA 1E6GA 3OYHA 3HRTA 5LJ5f 1AWWA 2KT1A 3OYLA 3L2RA 3HL8A 1M30A 2GFAA 2QQSA 4M7AA 4RG8A 3F70A 3VV0A 3CC7Q 3PMIA 1YI2T 5IHNA 2J6KA 4MDWA 3MEWA 3BW1A 2EJGA 4CI0C 2R5MA 4EMKB 2A28A 4RMOA 3A8GB 1ZA2B 2EAYA 2ZPHB 2C0TA 1YN8A 3GLXA 4OB0B 2EGEA 3CCSA 4B9WA 2XHCA 2KYBA 3OBWA 4BI3A 1YBYA 2DXUA 2RNAA 2WSEE 1FMKA 2DTHA 3ME9A 1UGRB 3J7AF 1B34B 2DTIA 1RAFB 2P4RA 5GAMe 3CPFA 3JCMd 3OMCA 4OF1A 4J5YA 2QXFA 2NYSA 2AZVA 2DD5A 1M27C 2CP7A 2JM8A 1W4SA 2V8IA 1K73U 1VQ4A 3CCMT 4DQ2A 2VXEA 3TSWA 1GCQC 3EG2A 4A4HA 1QVGP 3QPHA 2P0KA 2YRVA 5FWCA 1AWOA 1ZBJA 4HCCA 2CH4W 4KRTA 1W2BP 2AT1B 3INZA 3GF5A 4Z02A 3I55A 1OULA 2DL7A 1VIEA 4E7KA 1TTHB 3PTAA 3OSSC 1XQHA 1AWXA 4KBMB 1VQ7Q 3OS0A 4Z8AA 2RHIA 3EHQA 4M7AB 5GAOl 4HA8A 2LCCA 2E6ZA 4J6YA 2K79A 4N0AC 3NPFA 1G2BA 2BZXA 2LJ0A 1GRIA 1ZLMA 4PFOA 4FYYB 2DJQA 5GANe 2FZCB 1PRLC 2DBKA 4LN2A 3G4SQ 2COZA 3V8LA 3OYMA 2FEIA 4ESRA 2X3WD 5FROA 2M0YA 5GAMg 2XDPA 3EG0A 3RR6A 1VQPT 3VRZA 4ZGDB 2CP0A 5GMKl 3CCQT 2NUPB 1W2BA 3CMAQ 5IH2A 1GXIE 2FRWA 3R6NA 1JB0E 1K0SA 3M0RA 1AD5A 3TCJA 1BIBA 4CC4B 1D09B 1VQ9Q 2L89A 1X2KA 2A36A 3RMQA 4M75C 4MMKA 1UB4A 2L0AA 3OSVA 3JAME 4M78B 4ATOA 2QEXT 1QVPA 3M58A 2RQWA 2MWPA 2MWOA 1GBQA 1MMAA 4KH1B 2J05A 2L3PA 2OI3A 4M78A 1S72Q 2KR3A 1BI0A 2RHXA 2VGNA 4JZ3A 1VQ7A 4AFSC 3VRYA 3ZFJA 5GMKj 2YRDA 5D6WA 1SRLA 1Y96B 1KC8U 2DEUA 3PNWC 1NM7A 4OMLA 2YUNA 1M2VA 4RCCA 3G6ET 1RACB 3BE3A 3SHWA 2VASA 2L3RA 5GANf 2Z0WA 4PJJA 2D6FA 3S3NA 1GCPA 4FIBA 2EQJA 4X34A 5DM7R 1YITA 4PJLA 2OX7A 1BI1A 2ESWA 2JT4A 3QWYA 5GAOp 2K57A 2HSEB 4OVAA 1QCFA 1OU8A 2D8JA 3JCMW 2LTOA 2OTLA 2JTMA 2FVUA 4XK8E 3SFMA 3SB2A 1TSFA 2CP6A 1NYGA 1Q7YR 1PSEA 2FZKB 3NTHA 1YIJT 2PTKA 1YJNA 2DXCA 2E1HA 3C0CA 1AVZC 1HJDA 1D1BA 4F16A 1IHWA 1SHGA 1MMGA 2A7YA 1WXUA 4RTXA 2NUTA 4DEYA 3OW2A 2CP3A 4LXCA 3EFRA 1UGPB 2HL5C 3A8LB 4V2SA 1W70A 2BUDA 1M3AA 3G7ZA 2FYKA 4M75B 1X6GA 3EH2A 1MMNA 3THKA 2CSQA 4RUGA 1KK7A 1EX4A 1TUDA 2JS2A 1VQOQ 3QBYA 2GBQA 2HSPA 1R0CB 2YLBA 2L3SA 3I55Q 1PKSA 3LGFA 1AEYA 2HNIA 3H9NA 1OI1A 1VQKA 4M7AG 3L2WA 4M7DB 3EGDA 4OB1B 2K2MA 2DXTA 5CR2A 5KYYB 4NL3A 3OYIA 2B8AA 2DIGA 2PUKB 2GFUA 2X3XD 4QVDA 1X6BA 2YSQA 1K9MR 4M7DG 2EYZA 2NUPA 1YHQA 3VS6A 1E6HA 1ZUUA 3CCUA 2HMAA 3VKIA 5C6SA 1M8VA 3VS5A 3CD6T 5FU6C 2DBMA 4M7DE 1VQPQ 1QP2A 1H8KA 2LNVA 1XTDA 5ECAA 2CUDA 2DM1A 1PM3A 4PJOE 3GIBA 3CC2T 4RTUA 2KT8A 5HCKA 3OYNA 3G1JA 2DPPB 4PK4A 5HY6A 1Q86C 2YHTA 1N5ZA 1UFFA 4C92A 2JZ2A 2ZPGB 3ULRB 1YJ9T 3VJPA 2HD0A 2EYXA 4UC4A 2VB6A 2A3LA 1VQ9T 1Q81C 2FL7A 3HP9A 3C12A 2MMPA 4PJOB 2LZ6B 1V29B 5GANd 2A0FB 2LT4A 1WZOA 2V8JA 2C0OA 5IT9E 1VQKQ 2IG0A 3BDLA 1OZ2A 3CCJQ 2EVRA 2IVWA 2CP2A 2M0OA 4QQDA 1VQNQ 3EG1A 4J6WA 2RN8A 3REAB 2HQEA 2YUOA 1VQ6A 2FPFA 1YHQQ 2KMTA 1IREB 2EFIA 2O4XA 3O5ZA 5LJ5j 2DILA 4JJNK 1PKTA 4JJCA 5KYYA 4QQGA 5M9OA 1VQ5A 4QKUA 3TREA 2DRMA 1MV3A 2QTXA 5IHIA 3OS1A 1H3ZA 2AK5A 1ABQA 2COWA 2AZSA 3EGDB 1OPKA 1VA7A 3X20B 1M1KR 3U23A 3A98A 4JUVA 1SSFA 1MNEA 4GLMA 5GMKh 3CMEA 1KQSA 3GBQA 4O6JA 1T0JA 3L2ZA 1Q7YC 3CCQA 1ZSZA 5EG2A 2RA2A 4M77B 4LDVA 4M75A 3OYAA 4XQ3A 2L2PA 1NJIC 1YITT 1UJ0A 1VQLA 4IUUA 3CCVT 1M1FA 1RLPC 1K73R 3L2QA 5GAMj 2GNCA 1OQKA 4M77A 3M4YA 2CZ7B 3JB9I 1G3SA 1WHLA 2RO0A 1NPPA 5KE3A 2VV5A 1VQNT 3RMSA 1PSFA 1JXMA 1BI2A 2L8DA 2J6FA 1EZZB 3SD4A 2RD1A 3IQLA 3L1AA 1PCXA 2CDTA 1ZQ1A 4M77E 4M78E 1YIJA 1WA7A 2IIMA 2EBPA 2JW4A 1BU1A 1NJIR 2BTTA 4PJOG 3HTRA 3HFOA 4FW1A 1UDLA 1O75A 4WTOB 4PKCC 4PJMA 2JUFA 4F14A 2OTLT 2BE7D 1OEBA 2QQBA 5KYWA 3CEYA 3LLRA 2CZ0B 2DTOA 1YI2Q 2H8HA 2NWMA 5GAN2 4FU6A 2R5AA 1ZUYA 1D0XA 3LWIA 3CCSQ 4XU1A 2E5QA 3OA6A 1M3CA 2V1RA 4M78C 1K4US 1EIFA 3FC3A 4QW2A 3CCUQ 1VQ5T 3P8BB 3FDRA 1VQLQ 2HDAA 4PLIA 4MZMA 4RTWA 1JBMA
chains in the Genus database with same CATH topology
2D9TA 4YTLA 2XDDA 4HCCA 4HKEA 4FL6A 3JCMb 3Q1JA 3JCMc 2YLCA 4M77F 3LYIA 4M75D 1BI3A 3MEAA 3INZA 3GF5A 1FWZA 4Z02A 1P92A 4E7LA 2RJCA 1DJ7B 3I55A 2XIDA 1O9SA 5LJ3g 3OYFA 1UGSB 5KCHA 1VIEA 3FJPA 1M1GA 4JS5A 4BACA 4E7KA 4J8OA 4C5HA 4L6V5 2F5TX 3UWNA 4A4FA 1XNIA 5LJ3j 4B9XA 3PTAA 3OSSC 4C92D 3HSBA 1KD1U 4M77G 3MP1A 5GAMh 3CCUT 1XQHA 4XTWA 5CKDA 5J39A 5GMKe 2V8KA 3HFNA 4C5IA 4KBMB 2JN0A 4N4IA 1M4ZA 3CC2A 3JB9F 5CCAA 3OS0A 2H3JA 5GANg 2GF7A 5LJ3d 3V8KA 2RHIA 4M7AB 4XTUA 3CCLA 2RI2A 4M75G 3A8HB 2ZPIB 5FU7C 3OY9A 5GAOl 3GPLA 4HA8A 1G3YA 2QQ9A 2LCCA 3FIFA 3MP8A 5I2MA 2QA4T 4XAXB 1LNXA 3JCMh 2E6ZA 4J6YA 4XTYA 3E19A 3LW5E 3AHUA 2ZZDA 3M9QA 4OP0A 3RIRA 4F7UE 4N0AC 3JCMf 2E70A 1K9MC 3CC4A 2OTJA 1HXDA 3PIOA 4M75E 3NTIA 3VYHB 3CCJA 5J3BA 5LJ3h 2KQWA 4KULA 5CKFA 3JRZA 5GANj 4EMKA 5GANe 3MEUA 5FLXE 3CXCS 5GAMd 4IUTA 3I56T 4RKUE 5LL6S 4LDXA 3V8LA 2PU9B 3OYMA 3QIIA 3V8JA 1N8RC 3HRUA 3M59A 5FROA 1VQ9A 5GAMg 3JB9G 2XDPA 2X4YA 3OYGA 5DLQE 4D6WA 1VQMA 1NJIU 1VQPT 3PMTA 4M7AC 2LC4A 4C8QC 3QYHB 3CCRA 2C06A 4ZGDB 3G4ST 2LVMA 2FB7A 4XTZA 5HKCA 2CZ6B 2BKDN 5GMKl 3CCQT 3CBMA 1D3BB 3M5AA 1W2BA 1N27A 2K5LA 1MHNA 5CKHA 4C0DC 2LT1A 1GXIE 3HPWA 2FHDA 2EYQA 2QDYB 2R57A 1JB0E 3GNGA 3PGGA 2DD4A 4O5VA 4DA4A 1YHQT 3TCJA 4M7DD 1BIBA 2PQWA 1TH7A 1NZ9A 3RUXA 2L89A 4R56A 4E7JA 2G3RA 1H641 3RMQA 4M75C 2RHUA 3M56A 4MMKA 1VQ8T 3RERA 1UB4A 2CYZB 3MCAB 3QJYA 3JCMV 3OSVA 1WNLA 3JAME 4M78B 4ATOA 3V7RA 2L5QA 5L8RE 2QEXT 1VQ6T 1QVPA 2MAMA 2X35A 3M58A 2MWPA 2MWOA 2VXFA 1VQKT 4KUDK 2JOYA 4M78A 5LJ3e 1BI0A 2RHXA 2O4XB 3QZ9B 2JVVA 2VGNA 5C0MA 4E47A 1JRIA 2WACA 4M78D 1FXXA 4C92G 3CPWA 1RI0A 2P0PA 4LDUA 3ZFJA 3CCMA 4IUPA 5GMKj 1M9SA 4FT4A 3CMAT 2P0QA 4M78F 5D6WA 3QHSA 4MDXA 2MF2A 4JRKA 4M7DC 3ZEHA 1Y96B 3H6ZA 3RKWA 3FEOA 4PLLA 4MMLA 1UGQB 1KC8U 4ELZC 3OW2S 3PNWC 4JRIA 4LDWA 4VUBA 4C0GA 2DXBA 1YI2A 5GMKi 4KT0E 1X75C 1S72A 4RCCA 2Y4XA 3G6ET 1K73C 3J80E 4N4HA 4PJOF 4M78G 2F69A 4GY5A 2XICA 2DVEA 4M7AD 3CMET 2RI3A 2L3RA 3META 2RHZA 4DOWA 4N0AA 5GANf 4Y91A 4QVCA 5GAOm 1N6AA 3DB3A 2D6FA 3S3NA 5FU7B 3OYKA 4FIBA 4C8QE 2EQJA 5AYFA 2XK0A 4X34A 5DM7R 3SDZA 4FT2A 4EPCA 1KQSS 1D3BA 2D0QB 3PIPA 2PUOB 1YITA 1VQLT 4C92B 4WF2A 3M53A 2WSCE 1QVFS 2RHYA 5GAN3 3E1SA 3CCVA 1BI1A 5FU6B 2X4XA 4FSXA 3GP8A 5GAOp 2K57A 1M5Q1 4OVAA 3CBPA 3T9NA 1KHCA 5J26A 3M4GA 3JCMW 2LTOA 1KC8C 4MZPA 2OTLA 3OBYA 2DZ9A 2JTMA 3WVEB 4PJOD 1VQNA 2FVUA 2CKKA 3QKJA 4XK8E 2JTFA 3A5ZB 3SFMA 1WJRA 3E9FA 3SB2A 4PJOA 1IZ6A 1ZBXA 4PLIA 4BI4A 3CPWS 5HK0A 4C8QB 1MGQA 1U8RA 1PSEA 3NTHA 1YIJT 3I55T 3QJ6A 1VQOA 4GLKA 2DXCA 1YJNA 2E1HA 5GANh 4M7AE 3QG1A 4J6XA 4C92C 2A7YA 4TVRA 4XTXA 5A0DA 3OYEA 3CCST 3OW2A 2ZGWA 5GAN5 3JCMJ 3EFRA 5LJ3f 3OMGA 2R58A 3OYYA 3QO3A 4IUQA 1UGPB 4F7UB 3A8LB 1KG1A 3CC7A 4M7AF 3P8DA 4C8QG 4NL2A 3S3OA 4XU3A 2BUDA 4OB3B 1KD1C 4V2SA 3G7ZA 2FYKA 1BKBA 4M75B 2RB6A 1KQ2A 5DLOA 2LDMA 1JJ2S 3UPUA 2KDSA 5GAN6 3KBGA 3J81E 3QBYA 3GOXA 3RKYA 3MHXA 4R55A 4BE1A 1I5LA 1Q86C 2KSSA 3WVDB 4X9DA 4E7HA 3LGLA 1Q82C 3EAEA 2ZPEB 3BY7A 3QDRB 1N9RA 2YLBA 2X4JA 2XKOC 3M55A 3M54A 3O8VA 2HBPA 4BDYA 2JNGA 5GAOr 1XOVA 4M75F 2DIQA 4A4KA 2AHJB 3LGFA 1I8FA 2PVGB 2Y90A 2HNIA 4LDYA 1K9MU 2XI9A 3OYCA 1FX7A 1QP3A 2VGMA 1VQ4T 1Q7YU 3HKSA 3JB9J 2GCXA 3CCET 5HK3A 1OI1A 1VQKA 5CO7A 3L2WA 3SWNB 4M7AG 4M7DB 4OB1B 5LJ5d 5KE2A 2EJFA 2DXTA 1QVGS 2XDBA 3L2UA 3OYBA 5CR2A 1I81A 3JB9H 3C95A 5IAYA 1VQPA 4NL3A 1M90U 3A8OB 3OYIA 2B8AA 2F5KA 2DIGA 4LD9K 2RK2A 3DLLA 2PUKB 1NPRA 2GFUA 3QUIA 3PT9A 4QVDA 2E41A 2XU8A 1OZ3A 4OB2B 1RL2A 4A53A 4F7UA 1G5VA 1G3WA 4M7DG 4Y28E 3QXEB 4M7DF 1YHQA 4C5GA 4QVZA 4A4GA 3S6WA 4J83A 3CCUA 2CZ1B 3L2VA 3VKIA 4C0FA 5C6SA 2EKOA 3V7SA 3JCMP 1YJWT 3CD6T 3R6OA 1M8VA 3FB9A 4BY6B 5FU6C 4M7DE 1QW1A 3OS2A 3CCLT 3X28B 2DKGA 4JRQA 1M1KC 1QP2A 2LNVA 3DLMA 1XTDA 2RJFA 3CCRT 4PJOC 1K8AU 3FRNA 2QEXA 3JSCA 4IKFA 4PJOE 3GIBA 3CC2T 4OGEA 3JCMQ 3JB9D 1LJOA 2XD0A 2RK1A 2CGHA 2Y4YA 1N9SA 5CK9A 1Q86U 3OYNA 3G71A 5FRNA 2DPPB 2EIFA 2RM4A 1Y07A 1U1SA 2MI6A 5HY6A 2YHTA 3HHTB 4BB7A 1I4K1 5D6XA 4C92A 2JZ2A 3CCJT 4PNOA 3RKXA 4L5GA 1Y71A 2ZPGB 3OS5A 3X26B 1YJ9T 1QVFA 3VJPA 2VUBA 3S3MA 1Q81U 2HD0A 3OB9A 4ZGJB 4UC4A 1Q82U 1Y96A 2A3LA 2VC8A 3NTKA 5CKBA 4C5EA 1VQ9T 1Q81C 3QYGB 4J7IA 5IN1A 4BY6C 2FL7A 3HP9A 1VQMT 3C12A 1QVGA 5A0LA 2M1HA 4C92E 4BE2A 1W2BS 2MMPA 4PJOB 3SWNA 4HT8A 4OMFB 1V29B 5GANd 4L59A 2LT4A 2KY9A 5CKEA 1VQ7T 2DAQA 2V8JA 4EMKC 3BDUA 5IT9E 3JCMX 2IG0A 4J7FA 4BD3A 3X25B 2ZCFB 1OZ2A 3BDLA 4NS5A 2NLUA 4OGCA 5KCOA 1LOJA 4C92F 3GNFB 1HK9A 2IVWA 3KUFA 2ZPFB 2M0OA 2M9UA 2P4TA 4P5NA 4QQDA 3VYGA 5A0GA 3CC7T 4PL6A 4J6WA 2OTJT 4F7UG 4ZTJA 2K4YA 4XTVA 4IURA 2HQXA 4ZTFA 2HQEA 3LWHA 3FLGA 4A54A 3PFSA 2ZPBB 1VQ6A 1WQ7A 2E64A 2K5FA 5GAN8 2E65A 2QI2A 3ER0A 2E10A 3I56A 4NOYA 2KMTA 1IREB 3P8HA 2EFIA 2O4XA 3OQ5A 4ZN3A 5LJ5e 3URGA 5LJ5j 2O01E 4BI8B 3L42A 3SWNC 1VIFA 1X6OA 4JJNK 3ASKA 5CIUA 5M9OA 1VUBA 1G3TA 2LX9A 4QQGA 3ZBDA 2EJ9A 4EMHA 1JJ2A 2PVOB 1VQ5A 4X9CA 2QA4A 3TREA 3MO8A 4JRPA 3CC4T 4E7IA 2K5IA 2RJDA 4M77C 2QTXA 4DOVA 2KK4A 2OAUA 3OS1A 1BIAA 1X01A 3V7CA 1H3ZA 5GMKm 2X4WA 1WGSA 1OYXA 2KAFA 5I21A 3RESA 4BE0A 2RH2A 1VQ7A 2DK3A 2RI5A 4FM4B 3E9GA 1YJNT 2EQKA 1ZHIA 2EQMA 2K3XA 4JLGA 3X20B 3A8MB 4F7UF 5LJ5g 2BIVA 4JUVA 3JCMg 3WXMB 4HCBA 4EDUA 5GAOn 2E12A 4CRIA 1BYMA 1NE8A 5GAN4 1SSFA 5DY9A 5GAN7 4ME7A 3DKMA 1M1KU 2KVQG 5GMKh 3CMEA 1KQSA 2LQKA 4O6JA 4QQ6A 2WSFE 1S72T 3G4SA 3L2ZA 3VUBA 3OYDA 1Q7YC 2K2VA 3HRSA 3CCQA 5EG2A 1U1TA 3TEEA 2RA2A 1YCYA 2LRQA 3QZ5B 1WPYA 2QQRA 4M77B 4LDVA 3JCMe 4M75A 1WJSA 3OYAA 4RCBA 4XQ3A 1NJIC 1YITT 1VQLA 1R8OB 1WQWA 2CS7A 3DB4A 4IUUA 5LJ5h 3KXTA 3CXCA 3CMAA 3CCVT 1KHIA 1M1FA 4JDSA 3OYHA 3HRTA 5LJ5f 2DO3A 3OYLA 3L2QA 3L2RA 3HL8A 4C8QD 2DJZA 5A2QE 2GFAA 5GAMj 2QQSA 4M77A 4XU2A 3M4YA 4C8QA 2CZ7B 4M7AA 3JB9I 4RG8A 1G3SA 4M77D 3LX7A 2RO0A 3G71T 1NPPA 3VU3C 4ELYC 5KE3A 3MEVA 2VV5A 1KQ1A 2QQAA 3F70A 3UT1A 3PMIA 3VV0A 4BDZA 1YI2T 1VQNT 1UEBA 3RMSA 1PSFA 4MDWA 1BI2A 3G6EA 5CAIA 2L8DA 3MEWA 4C8QF 1VQOT 2PVDB 2RD1A 2RJEA 2EJGA 3BW1A 3SD4A 3X24B 4CI0C 2E6NA 1WJQA 5GAOq 2R5MA 4N4GA 3L1AA 4EMKB 1M90C 4RMOA 1ZQ1A 4M77E 3A8GB 4M78E 3C4SA 1YIJA 3VUZA 4ZGEB 5KH6A 4C0ZA 4A4EA 3OYJA 2EAYA 2XG8D 2ZPHB 4JLIA 2GQVA 4XU0A 3QSUA 4PJOG 3HFOA 3GLXA 2EQUA 4OB0B 3CCSA 4B9WA 1O75A 3M57A 4PKCC 2XHCA 3LH0A 3OBWA 4BI3A 4BUGA 2JUFA 1YBYA 2DXUA 2M16A 4ZN1A 2OTLT 2WSEE 2DTHA 3ME9A 3C94A 1UGRB 3BFMA 3UDCA 1AHJB 1VQ8A 5FRMA 1B34B 2DTIA 5GAMe 3J7AF 2QQBA 4C0DB 3CPFA 3JCMd 3CEYA 3OMCA 4KUIA 4OF1A 2I2LA 2CZ0B 3LLRA 4EMGA 1K8AC 4J5YA 3MP6A 2DTOA 2EWNA 2LQ8A 2QXFA 3NFCA 2LCLA 4HT9A 4HCZA 4II1A 5GAN2 4FU6A 4IUVA 4MZTA 2R5AA 1Y7XA 2DD5A 5D6YA 3CBOA 4JS4A 1W4SA 2V8IA 1YJWA 3LWIA 1YJ9A 4RG2A 5GAMf 1N8RU 3H8ZA 3CD6A 3EFSA 2HAXA 1K73U 4XU1A 2E5QA 3OA6A 1VQ4A 2VYTA 3CCEA 3CCMT 4DQ2A 2DEQA 4M78C 1EIFA 5I2SA 2VXEA 5CQYA 1B34A 3FC3A 4QW2A 1VQ5T 2K3YA 4M7DA 3P8BB 3TU4K 4A4HA 3QPHA 3FDRA 4Q5WA 5CQXA 2P0KA 4LD6A 2YRVA 5CVIA 2DZCA 4MZMA 3N5BB 1JBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRK A;  4M7D C;  3QHS A;  1Y96 B;  3RKW A;  3JCM c;  3JCM b;  2YLC A;  4M77 F;  4F7U F;  5LJ5 g;  4M75 D;  4JUV A;  4MML A;  3INZ A;  3JCM g;  5GAO n;  3QUI A;  4JRI A;  3RES A;  2E41 A;  4QVD A;  5GAN 4;  4A53 A;  4F7U A;  5LJ3 g;  5GMK i;  5DY9 A;  5GAN 7;  3FJP A;  4M7D F;  4M7D G;  4RCC A;  5GMK h;  4PJO F;  5LJ3 j;  4M78 G;  2DVE A;  4C92 D;  3HSB A;  4M7A D;  3JCM P;  3L2Z A;  4M77 G;  3V7S A;  1M8V A;  5GAN f;  5GAO m;  3FB9 A;  4N0A A;  4Y91 A;  4QVC A;  5GAM h;  4XTW A;  5GMK e;  4M7D E;  1U1T A;  4C8Q E;  3HFN A;  2RA2 A;  2JN0 A;  3JB9 H;  2DKG A;  1YCY A;  3JB9 F;  4PJO C;  1D3B A;  1WPY A;  5GAN g;  4M77 B;  5LJ3 d;  3V8K A;  4M7A B;  4WF2 A;  4XTU A;  4C92 B;  3JCM e;  4M75 A;  4M75 G;  3GIB A;  5GAN 3;  4PJO E;  4RCB A;  4XQ3 A;  3JCM Q;  3JB9 D;  1LJO A;  5GAO p;  1WQW A;  2K57 A;  5LJ5 h;  5GAO l;  1M5Q 1;  2CGH A;  4HA8 A;  1N9S A;  3FIF A;  3M4G A;  5LJ5 f;  3JCM W;  1LNX A;  3JCM h;  4C8Q D;  2DJZ A;  4J6Y A;  4XTY A;  3AHU A;  5GAM j;  2RM4 A;  4OP0 A;  2DZ9 A;  1U1S A;  4M77 A;  4XU2 A;  2YHT A;  4N0A C;  3RIR A;  1I4K 1;  3JCM f;  4C8Q A;  4C92 A;  4F7U E;  1HXD A;  3JB9 I;  4M7A A;  4PJO D;  4M77 D;  4PNO A;  3RKX A;  3VU3 C;  4M75 E;  3SB2 A;  4PJO A;  1KQ1 A;  5LJ3 h;  5GAN j;  4EMK A;  5GAN e;  1Y96 A;  2VC8 A;  5CAI A;  5GAM d;  4C8Q F;  2RD1 A;  3BW1 A;  2EJG A;  1MGQ A;  3V8L A;  4C8Q B;  5GAO q;  3V8J A;  3L1A A;  4EMK B;  5GAM g;  4M77 E;  3JB9 G;  2E1H A;  4C92 E;  5GAN h;  4M7A E;  4PJO B;  4M78 E;  3SWN A;  4HT8 A;  4J6X A;  5GAN d;  4C92 C;  4M7A C;  4C8Q C;  4XTX A;  4EMK C;  3BDU A;  2FB7 A;  2EAY A;  4XTZ A;  4JLI A;  4XU0 A;  3JCM X;  3QSU A;  5GMK l;  2ZGW A;  4PJO G;  3HFO A;  5GAN 5;  1D3B B;  3EFR A;  5LJ3 f;  3JCM J;  3QO3 A;  4F7U B;  1LOJ A;  4C92 F;  4C8Q G;  4M7A F;  4NL2 A;  4V2S A;  4XU3 A;  5I21 A;  1HK9 A;  2FYK A;  2DXU A;  3PGG A;  4M75 B;  2RB6 A;  1KQ2 A;  2DTH A;  4J6W A;  3BFM A;  1BIB A;  4F7U G;  4M7D D;  1TH7 A;  1B34 B;  2DTI A;  5GAM e;  3RUX A;  4XTV A;  3JCM d;  4EMG A;  5GAN 6;  2I2L A;  1I5L A;  3RKY A;  1H64 1;  4J5Y A;  4M75 C;  2DTO A;  2EWN A;  4MMK A;  3RER A;  4X9D A;  4A54 A;  4HT9 A;  5GAN 2;  1WQ7 A;  2E64 A;  3JCM V;  5GAN 8;  2E65 A;  1WNL A;  2E10 A;  4NOY A;  3BY7 A;  4M78 B;  1N9R A;  2YLB A;  3V7R A;  5LJ5 e;  5LJ5 j;  5GAM f;  3SWN C;  5GAO r;  3EFS A;  4M75 F;  4XU1 A;  1I8F A;  2VXF A;  2Y90 A;  2HNI A;  2EJ9 A;  4DQ2 A;  4EMH A;  4M78 A;  2DEQ A;  4M78 C;  4X9C A;  5LJ3 e;  2VXE A;  1B34 A;  3JB9 J;  1JRI A;  4M78 D;  4C92 G;  4M7A G;  4M7D A;  3SWN B;  4M7D B;  4M77 C;  2QTX A;  5LJ5 d;  1BIA A;  2EJF A;  1X01 A;  2DXT A;  3V7C A;  5GMK j;  5GMK m;  1I81 A;  2DZC A;  4M78 F;  4NL3 A;  1JBM A; 
#chains in the Genus database with same CATH topology
 2D9T A;  4AT1 B;  2O9V A;  3JCM b;  2YLC A;  3LYI A;  2CT4 A;  1K9A A;  4E7L A;  1D0Y A;  5LJ3 g;  3OYF A;  2M02 A;  2YUP A;  2F2X A;  3A1P A;  4A4F A;  5LJ3 j;  1XNI A;  3CCU T;  5GAM h;  3PE0 A;  1MUZ A;  2JN0 A;  1XJW B;  3EGX B;  2H3J A;  2GF7 A;  3V8K A;  4XTU A;  1M2O A;  2RI2 A;  4M75 G;  5FU7 C;  5KYX A;  1H92 A;  2ED1 A;  2DA9 A;  2QQ9 A;  1UJY A;  2GQI A;  3JCM h;  3CC4 A;  3M9Q A;  2OTJ A;  2YWW A;  2CSI A;  2HCK A;  2KXC A;  4M75 E;  3VYH B;  3CCJ A;  1WXB A;  4PFZ A;  2KQW A;  3JRZ A;  5GAN j;  4K11 A;  1UHF A;  2E4H A;  5GAM d;  4IUT A;  2XMF A;  4AFZ C;  1N8R C;  3V8J A;  3HRU A;  1AZG B;  3JB9 G;  2X4Y A;  3OYG A;  5DLQ E;  2EQI A;  1VQM A;  3RNJ A;  1VQ6 Q;  3QYH B;  4EIK A;  3G4S T;  2LVM A;  4RTT A;  3CBM A;  1D3B B;  3M5A A;  1MHN A;  2LT1 A;  2FHD A;  2EYQ A;  1YHQ T;  1C0M A;  3PGG A;  2DD4 A;  4O5V A;  1OOT A;  1IRX A;  2PQW A;  1NZ9 A;  4E7J A;  1PHT A;  1YNZ A;  1N8R R;  1VQ8 T;  2RHU A;  3M56 A;  1PG5 B;  3QJY A;  3JCM V;  4E2F B;  3V7R A;  3EH1 A;  1VQ6 T;  2MAM A;  2X35 A;  4J9I A;  1M3B A;  2H3E B;  2JVV A;  4F17 A;  1JRI A;  4C92 G;  1RI0 A;  4LDU A;  2QEX Q;  1SEM A;  2LP5 A;  4IUP A;  3CMA T;  4M78 F;  3QHS A;  5I11 A;  4M7D C;  2JS0 A;  2VKN A;  9ATC B;  1IHV A;  4MML A;  1UGQ B;  4ELZ C;  3OW2 S;  4LDW A;  2KRO A;  2EGA A;  1V1C A;  4KT0 E;  1X75 C;  1S72 A;  1K73 C;  4PJO F;  3RBB B;  4M7A D;  2MIO A;  2RI3 A;  4Y91 A;  4QVC A;  1N6A A;  5FU7 B;  3OYK A;  2XK0 A;  1VQM Q;  4FT2 A;  1UE9 A;  2D0Q B;  3PIP A;  4WF2 A;  1IGU A;  1NEG A;  5GAN 3;  3E1S A;  5FU6 B;  4FSX A;  3CBP A;  1RAB B;  4MZP A;  2VVK A;  3OBY A;  2DZ9 A;  3WVE B;  2JTF A;  3A5Z B;  2L3Q A;  1WJR A;  2QAS A;  1ZBX A;  1SHF A;  4AFQ C;  1BCM A;  3CPW S;  2K3B A;  5HK0 A;  1U8R A;  2GTO A;  1OX9 A;  1WHG A;  1TU0 B;  4J6X A;  4TVR A;  3CPW P;  4XTX A;  3CCS T;  2MCN A;  5GAN 5;  3MJX A;  3JCM J;  4IUQ A;  3S3O A;  4XU3 A;  1KD1 C;  1I5O B;  1BKB A;  2HEQ A;  1YJN Q;  3KBG A;  2XD0 A;  4BE1 A;  3RKY A;  1AT1 B;  3WVD B;  1ZA1 B;  3LGL A;  4A63 B;  1QKW A;  2ZPE B;  1TUC A;  4FYV B;  4M4Z A;  5GAO r;  4M75 F;  2Y90 A;  1UGV A;  1K9M U;  1V76 A;  2XI9 A;  1QP3 A;  2KRS A;  1Q7Y U;  3HKS A;  5CO7 A;  4J9C A;  3SWN B;  5IXF A;  5KE2 A;  2XDB A;  2C0I A;  1I81 A;  3TQ7 P;  1Q81 R;  2FRY A;  3A8O B;  3NMZ C;  3H41 A;  4CC2 A;  2F5K A;  2RK2 A;  5KYU A;  1UG1 A;  1YJW Q;  1YJ9 Q;  1WHK A;  4JPB W;  3QUI A;  2XU8 A;  4A53 A;  4F7U A;  1G3W A;  4M7D F;  5KYW B;  3S6W A;  1PWT A;  3L2V A;  3JCM P;  3V7S A;  3R6O A;  4BY6 B;  1ZSZ C;  3OS2 A;  2YRC A;  2DKG A;  1M1K C;  4PJO C;  2QTV A;  1K8A U;  4IKF A;  3JSC A;  2AKL A;  2JJ9 A;  3JB9 D;  1LJO A;  1WFW A;  5FRN A;  1QQJ A;  3I5S A;  3FJ5 A;  3RKX A;  1Y71 A;  3OS5 A;  1G8X A;  2VWF A;  2VUB A;  1TWB A;  2QDL A;  3OB9 A;  4ZGJ B;  2J6O A;  2VC8 A;  3NTK A;  4C5E A;  3QYG B;  4KH0 B;  3CCL Q;  5A0L A;  1NLO C;  1W2B S;  4L59 A;  5CKE A;  1VQ7 T;  2KRN A;  1MND A;  4J7F A;  4OGC A;  2BZY A;  4NS5 A;  5KCO A;  1LOJ A;  2DF6 A;  1FMW A;  2J7I A;  2ZPF B;  3UA7 A;  2M9U A;  2P4T A;  4FW2 A;  3CC7 T;  4PL6 A;  2OTJ T;  2K4Y A;  1B7T A;  2HQX A;  2AKK A;  2K5F A;  5GAN 8;  1PNJ A;  3ER0 A;  1CKA A;  1U5S A;  3P8H A;  1BBZ A;  3OQ5 A;  5LJ5 e;  2A08 A;  3URG A;  2O01 E;  1YFN A;  3SWN C;  1X6O A;  1QVF P;  1GL5 A;  5CIU A;  3TVT A;  3ZBD A;  1D1A A;  2JTE A;  4QT7 A;  4JRP A;  5GJV B;  4E7I A;  4HXJ A;  1CSK A;  5GMK m;  1PD1 A;  1GFD A;  1WGS A;  2KAF A;  3RES A;  3UAT A;  2JMC A;  2EQM A;  3A8M B;  4F7U F;  1R0B G;  2E12 A;  4CRI A;  1BYM A;  5GAN 4;  2M51 A;  1M1K U;  1K76 A;  3LH5 A;  3CCM Q;  3G4S A;  2W10 A;  3MPU B;  2YXY A;  1ACM B;  2CH4 A;  1U1T A;  2X51 A;  1KD1 R;  1UTI A;  2LRQ A;  2HBW A;  3QZ5 B;  2QQR A;  1WJS A;  2QYZ A;  4RCB A;  1NG2 A;  3DB4 A;  2KXD A;  3CMA A;  4JDS A;  3M0U A;  2DO3 A;  4C8Q D;  1KIK A;  4C8Q A;  1PRM C;  1JEG A;  1ABO A;  3LX7 A;  3G71 T;  3VU3 C;  3MEV A;  1KQ1 A;  2QQA A;  3UT1 A;  5FW9 A;  4BDZ A;  1TXQ A;  1UEB A;  5CAI A;  4FYX B;  1YJN T;  2RJE A;  2LMJ A;  2E6N A;  1WJQ A;  4N4G A;  4OMQ A;  1X69 A;  3I9Q A;  3C4S A;  3CC2 Q;  5KYU B;  4ZGE B;  1C1A A;  5KH6 A;  4A4E A;  2XG8 D;  4JLI A;  2EQU A;  3M0Q A;  1Y57 A;  1SPK A;  4ZN1 A;  3C94 A;  2W0Z A;  1AHJ B;  1QWF A;  1KQS P;  2O88 A;  3VS3 A;  4EMG A;  1K8A C;  4PFP A;  3NFC A;  2EWN A;  2LCL A;  4HT9 A;  4HCZ A;  4II1 A;  2HQH A;  1SKU B;  4IUV A;  4MZT A;  1Y7X A;  3CBO A;  2RQV A;  4JS4 A;  4FYW B;  1YJW A;  1YJ9 A;  3CD6 A;  1QMC A;  2KEA A;  2HAX A;  2LCS A;  3TSZ A;  2VYT A;  3CCE A;  2DLP A;  5I2S A;  1BB9 A;  3MKD A;  1SSH A;  2ROL A;  3TU4 K;  5CQX A;  4LD6 A;  1ARK A;  5CVI A;  1UHC A;  4YTL A;  2XDD A;  4HKE A;  4FL6 A;  2FG0 A;  2OTL Q;  4M75 D;  1BI3 A;  3MEA A;  3RDV A;  1P92 A;  2RJC A;  1DJ7 B;  1C6V X;  3REB B;  1O9S A;  1UGS B;  5KCH A;  4OMP A;  3FJP A;  1M1G A;  4C5H A;  2E5K A;  3UWN A;  4C92 D;  4XTW A;  4AFU C;  5CKD A;  5J39 A;  2V8K A;  2QA4 Q;  1M4Z A;  3CC2 A;  1LPL A;  5CCA A;  2ENM A;  3CCL A;  4AG1 C;  3OY9 A;  3FIF A;  4XAX B;  1LNX A;  3VS2 A;  3AHU A;  3LW5 E;  2ZZD A;  3RIR A;  4RTV A;  2KNB B;  3JCM f;  2E70 A;  1HXD A;  3PIO A;  2MPX C;  3NTI A;  4J9B A;  5LJ3 h;  4KUL A;  5CKF A;  4OMM A;  4EMK A;  3MEU A;  4RKU E;  2QAZ A;  2F2W A;  5AT1 B;  2JXB A;  2RF0 A;  4D6W A;  1NJI U;  3PMT A;  2LC4 A;  2C06 A;  4CC7 A;  2LJ1 A;  3CC4 Q;  5HKC A;  2FB7 A;  2V26 A;  4XTZ A;  2CZ6 B;  4GBQ A;  1N27 A;  5CKH A;  4C0D C;  2QDY B;  3D7S B;  4DA4 A;  1BK2 A;  4E7Z A;  3EGX A;  2D0N A;  1D1C A;  1WNL A;  3EFO B;  5L8R E;  1I1J A;  1VQK T;  4KUD K;  1CKB A;  2JOY A;  3QZ9 B;  2O4X B;  2YUQ A;  5C0M A;  2EKH A;  1H3H A;  4M78 D;  3CPW A;  1B3Q A;  2P0P A;  3CCM A;  4FT4 A;  2P0Q A;  2MF2 A;  1GCQ A;  3ZEH A;  2NUT B;  1NBE B;  3FEO A;  4PLL A;  4PJN A;  4VUB A;  1QCN A;  4LUE A;  2Y4X A;  2BE9 B;  4N4H A;  2EGC A;  2HZY A;  3J80 E;  4GY5 A;  4E7S A;  2XIC A;  2DVE A;  1KFZ A;  3H0F A;  3MET A;  4DOW A;  4FCY A;  2K6D A;  3DB3 A;  2DYB A;  5AYF A;  2E3I A;  3SDZ A;  4EPC A;  6AT1 B;  1KQS S;  1D3B A;  2PUO B;  1YWO A;  1VQL T;  3M53 A;  2WSC E;  4DEX A;  2RHY A;  3CCV A;  3T9N A;  1KHC A;  3M4G A;  1LVK A;  1KC8 R;  2MK5 A;  1VQN A;  2CKK A;  3QKJ A;  1Q95 G;  1HD3 A;  1JXO A;  3E9F A;  3VS0 A;  1IZ6 A;  1Z9Z A;  2ATC B;  1RLQ C;  1WXT A;  1MGQ A;  2O31 A;  2E3H A;  2RMO A;  1WI7 A;  1RUW A;  3QJ6 A;  4GLK A;  5GAN h;  5D7U A;  2DER A;  2LNH B;  3PVL A;  4C92 C;  2DFU A;  1JQQ A;  4HVU A;  5A0D A;  3OYE A;  2MYS A;  4LUD A;  2K7A A;  4F7U B;  4F04 B;  3CCE Q;  4C8Q G;  4NL2 A;  4OB3 B;  1KQ2 A;  2LDM A;  1VYV A;  1JJ2 S;  1WHH A;  2FPD A;  3UPU A;  1W1F A;  2LX7 A;  3J81 E;  3GOX A;  1I5L A;  3MHX A;  2KSS A;  4X9D A;  1JJ2 P;  1N9R A;  2DX1 A;  4BDY A;  3M54 A;  2HBP A;  5FWB A;  4E6R A;  2JM9 A;  7AT1 B;  2DIQ A;  2AHJ B;  4LDY A;  1I8F A;  2PVG B;  3EG9 A;  2VGM A;  1VQ4 T;  3CCE T;  5HK3 A;  1IGQ A;  2EJF A;  3OYB A;  4DBR A;  3C95 A;  5IAY A;  2DL5 A;  2ABL A;  1RI9 A;  3PT9 A;  2E41 A;  3M0P A;  1UEC A;  2K9G A;  4J83 A;  4X1V A;  2CZ1 B;  1YJW T;  1BCO A;  5EC7 A;  2SRC A;  1YIJ Q;  3CCR T;  3FRN A;  2NUZ A;  3JCM Q;  2RPN A;  1RAA B;  5KYX B;  4B6M A;  2CGH A;  2CRE A;  1WIE A;  1X27 A;  3H0I A;  1Q86 U;  5GAO q;  2EIF A;  1Y07 A;  1U1S A;  2MI6 A;  4BB7 A;  3HHT B;  3CCJ T;  3VS1 A;  4PNO A;  3X26 B;  1Q81 U;  3E2U A;  1U06 A;  1IB8 A;  5IN1 A;  3QDF A;  1T0H A;  1VQM T;  1RAG B;  1QVG A;  4OMN A;  2M1H A;  4C92 E;  3SWN A;  4OMF B;  3ZL7 C;  1YIT Q;  2KY9 A;  3I56 Q;  3UA6 A;  3BDU A;  4R0K A;  4BD3 A;  2LQW A;  1YP5 A;  2NLU A;  1AWJ A;  4C92 F;  1HK9 A;  4P5N A;  3VYG A;  5A0G A;  4ZTJ A;  4ZTF A;  4IUR A;  3LWH A;  1UUE A;  4A54 A;  3PFS A;  1WQ7 A;  2E64 A;  2QI2 A;  2E10 A;  1AOJ A;  3KFV A;  4BI8 B;  3L42 A;  1WX6 A;  1JJ2 A;  1VUB A;  4HVW A;  1ZSG A;  2PZ1 A;  4JJD A;  3MO8 A;  2DMO A;  2K5I A;  2RJD A;  4M77 C;  3CXC P;  2OAU A;  1BIA A;  1X01 A;  5I21 A;  4BE0 A;  1MMD A;  2DL4 A;  2HKN A;  2CUB A;  2EQK A;  1ZHI A;  1VQ8 Q;  5LJ5 g;  5L23 A;  3CCV Q;  2OTJ Q;  4HCB A;  1NE8 A;  5GAN 7;  1HSQ A;  2KVQ G;  1NLP C;  4QQ6 A;  2WSF E;  4IIO A;  1IXD A;  4LNP A;  1M90 R;  3TEE A;  1YCY A;  2KRM A;  2FO0 A;  1WPY A;  3JCM e;  2O9S A;  4DBH A;  2QK0 A;  2FZG B;  4FSS A;  2CS7 A;  1WQW A;  2D1X A;  5LJ5 h;  3CXC A;  3VS4 A;  4D8D A;  1OX8 A;  2DJZ A;  5A2Q E;  1WDX A;  4XU2 A;  4M77 D;  2RQR A;  4ELY C;  2QGF B;  2LQN A;  2YT6 A;  3G6E A;  4C8Q F;  1VQO T;  2PVD B;  3X24 B;  4Z89 A;  1M90 C;  1JO8 A;  3VUZ A;  2B86 A;  4C0Z A;  3OYJ A;  3QSU A;  1SF9 A;  4XU0 A;  2GQV A;  3AT1 B;  3M57 A;  1VQ4 Q;  3LH0 A;  4BUG A;  2DYI A;  2M16 A;  3EGU A;  3BFM A;  3UDC A;  1VQ8 A;  5FRM A;  1KSW A;  1WHM A;  4C0D B;  1RAI B;  4KUI A;  2I2L A;  3MP6 A;  2LQ8 A;  1B07 A;  2DNU A;  1PD0 A;  1S1N A;  5D6Y A;  1OV3 A;  1SRM A;  4RG2 A;  5GAM f;  1N8R U;  3H8Z A;  3EFS A;  2DEQ A;  3CCR Q;  2MOX A;  2EYY A;  5CQY A;  1B34 A;  3I5R A;  2K3Y A;  4M7D A;  1GFC A;  1TG0 A;  4J9D A;  4Q5W A;  3VS7 A;  2JMA A;  2DZC A;  3N5B B;  2GTJ A;  3Q1J A;  3JCM c;  2ED0 A;  4J9G A;  4M77 F;  2X9H A;  1A0N B;  1FWZ A;  3EHR A;  2XID A;  2BZ8 A;  4DBQ A;  4JS5 A;  4BAC A;  4J8O A;  4L6V 5;  1WYX A;  2F5T X;  4B9X A;  3HSB A;  1KD1 U;  4M77 G;  3MP1 A;  5GMK e;  3HFN A;  4C5I A;  4N4I A;  3JB9 F;  5IHK A;  1ZUK A;  5GAN g;  5LJ3 d;  4JJB A;  3A8H B;  2ZPI B;  1Q86 R;  5KYN A;  1PC0 A;  3GPL A;  1G3Y A;  5I2M A;  2QA4 T;  3MP8 A;  4XTY A;  3E19 A;  4OP0 A;  4F7U E;  2KI7 A;  1K9M C;  2KYM A;  5J3B A;  4AMC A;  2KE9 A;  3CME Q;  5FLX E;  1YWP A;  3CXC S;  3I56 T;  5LL6 S;  4LDX A;  2J06 A;  2PU9 B;  3QII A;  2HL3 A;  3M59 A;  1VQ9 A;  3CQT A;  3EFO A;  4M7A C;  4C8Q C;  3CCR A;  2A37 A;  4JZ4 A;  2BKD N;  1D0Z A;  2K5L A;  4J9F A;  1E7O A;  2EPD A;  1F1B B;  3HPW A;  2GGR A;  2R57 A;  3GNG A;  2YDL A;  4M7D D;  1VYT A;  2F2V A;  1TH7 A;  3RUX A;  3SEM A;  4R56 A;  1OPL A;  2G3R A;  1H64 1;  3RER A;  1TS9 A;  2CT3 A;  2CYZ B;  3MCA B;  4LE9 A;  3QWX X;  1Y0M A;  2L5Q A;  1R77 A;  2VXF A;  5LJ3 e;  4E47 A;  2WAC A;  1FXX A;  3PVQ A;  3NGP A;  1M9S A;  2OAW A;  1SG5 A;  1QKX A;  4ANJ A;  4MDX A;  4JRK A;  2RQT A;  3H6Z A;  3RKW A;  1K0X A;  1MV0 B;  1FMV A;  4JRI A;  4C0G A;  2DXB A;  1YI2 A;  5GMK i;  1VOM A;  2DET A;  4M78 G;  2F69 A;  3CME T;  1U3O A;  2RHZ A;  4AG2 C;  3I35 A;  4N0A A;  5GAO m;  1YCS B;  2RQU A;  4C8Q E;  1OU9 A;  2QGG A;  3G6E Q;  1QVF S;  4C92 B;  2X4X A;  2AIR B;  3GP8 A;  1M5Q 1;  3M0T A;  5J26 A;  2DL3 A;  1I07 A;  1KC8 C;  1IO6 A;  1RAD B;  2I0N A;  2ECZ A;  4PJO D;  4J9E A;  4DBF A;  4PJO A;  4BI4 A;  1T3S A;  2IPO B;  2DE0 X;  4C8Q B;  1M2V B;  3I55 T;  1VQO A;  1TUG B;  4M7A E;  2EYW A;  3QG1 A;  4KGX B;  4KGZ B;  1WLP B;  1HYO A;  3EG9 B;  2ZGW A;  5LJ3 f;  3OMG A;  2R58 A;  3OYY A;  3QO3 A;  1KG1 A;  3CC7 A;  4M7A F;  3P8D A;  1EFN A;  3G71 Q;  4OMO A;  2RB6 A;  1JU5 C;  5DLO A;  2F1L A;  2KDS A;  5GAN 6;  4R55 A;  1QLY A;  2DL8 A;  4E7H A;  1Q82 C;  2OJ2 A;  3EAE A;  3BY7 A;  3QDR B;  1NYF A;  1GBR A;  2XKO C;  2X4J A;  3M55 A;  3O8V A;  3UF4 A;  2JNG A;  1XOV A;  4A4K A;  3OYC A;  1FX7 A;  3JB9 J;  2GCX A;  3H0H A;  1T3L A;  5LJ5 d;  1QVG S;  1X2Q A;  3L2U A;  1NEB A;  3JB9 H;  1VQP A;  1X43 A;  2COY A;  4CC3 A;  1M90 U;  1AZE A;  4IIM A;  4LD9 K;  2DRK A;  3DLL A;  2EW3 A;  1NPR A;  1RAE B;  4OB2 B;  1OZ3 A;  1RL2 A;  2SEM A;  1G5V A;  4Y28 E;  3QXE B;  4C5G A;  4QVZ A;  4Z88 A;  4A4G A;  2O2O A;  2CP5 A;  2G6F X;  4C0F A;  2EKO A;  4HVV A;  3FB9 A;  4KGV B;  1K1Z A;  4HCK A;  1QW1 A;  3CCL T;  3X28 B;  4JRQ A;  3DLM A;  2RJF A;  1M8M A;  2QEX A;  1Z9Q A;  4OGE A;  1Q82 R;  4WCI A;  2RK1 A;  2Y4Y A;  1N9S A;  1QCO A;  5CK9 A;  8ATC B;  3G71 A;  2RM4 A;  2P84 A;  1I4K 1;  5D6X A;  2QG9 B;  4L5G A;  2D8H A;  1QVF A;  5IXB A;  1FYN A;  3S3M A;  1KJW A;  3JV3 A;  1Q82 U;  1Y96 A;  2KGT A;  5CKB A;  3OW2 P;  4J7I A;  1TOV A;  4BY6 C;  1ZSZ B;  1ZX6 A;  3CD6 Q;  4ZNX A;  4BE2 A;  4HT8 A;  1VYU A;  2ZAE A;  2DAQ A;  4EMK C;  1G83 A;  2DVJ A;  3JCM X;  1RAH B;  3X25 B;  2ZCF B;  1I0C A;  2V1Q A;  1VQ5 Q;  1W6X A;  3GNF B;  3KUF A;  4D8K A;  3M0S A;  4F7U G;  4XTV A;  4J9H A;  3FLG A;  2PNI A;  2ZPB B;  2E65 A;  3I56 A;  4NOY A;  2KBT A;  4ZN3 A;  1VIF A;  1QWE A;  3ASK A;  2LX9 A;  1G3T A;  4EMH A;  2EJ9 A;  2FPE A;  2PVO B;  4X9C A;  2QA4 A;  3NHN A;  2ROT A;  3CC4 T;  1K8A R;  4DOV A;  2KK4 A;  3CCQ Q;  3V7C A;  2X4W A;  1OYX A;  2RH2 A;  1LCK A;  2DK3 A;  4FM4 B;  2RI5 A;  3E9G A;  4JLG A;  2K3X A;  1J3T A;  2BIV A;  3JCM g;  3WXM B;  4EDU A;  5GAO n;  4ORZ A;  5DY9 A;  4ME7 A;  3DKM A;  2LQK A;  1S72 T;  5GJW B;  2HKQ B;  3VUB A;  3OYD A;  5I22 A;  1WHJ A;  2K2V A;  3HRS A;  8AT1 B;  4RTY A;  3EG3 A;  2LJ3 A;  4RTZ A;  4Y92 A;  1R8O B;  3KXT A;  1KHI A;  1E6G A;  3OYH A;  3HRT A;  5LJ5 f;  1AWW A;  2KT1 A;  3OYL A;  3L2R A;  3HL8 A;  1M30 A;  2GFA A;  2QQS A;  4M7A A;  4RG8 A;  3F70 A;  3VV0 A;  3CC7 Q;  3PMI A;  1YI2 T;  5IHN A;  2J6K A;  4MDW A;  3MEW A;  3BW1 A;  2EJG A;  4CI0 C;  2R5M A;  4EMK B;  2A28 A;  4RMO A;  3A8G B;  1ZA2 B;  2EAY A;  2ZPH B;  2C0T A;  1YN8 A;  3GLX A;  4OB0 B;  2EGE A;  3CCS A;  4B9W A;  2XHC A;  2KYB A;  3OBW A;  4BI3 A;  1YBY A;  2DXU A;  2RNA A;  2WSE E;  1FMK A;  2DTH A;  3ME9 A;  1UGR B;  3J7A F;  1B34 B;  2DTI A;  1RAF B;  2P4R A;  5GAM e;  3CPF A;  3JCM d;  3OMC A;  4OF1 A;  4J5Y A;  2QXF A;  2NYS A;  2AZV A;  2DD5 A;  1M27 C;  2CP7 A;  2JM8 A;  1W4S A;  2V8I A;  1K73 U;  1VQ4 A;  3CCM T;  4DQ2 A;  2VXE A;  3TSW A;  1GCQ C;  3EG2 A;  4A4H A;  1QVG P;  3QPH A;  2P0K A;  2YRV A;  5FWC A;  1AWO A;  1ZBJ A;  4HCC A;  2CH4 W;  4KRT A;  1W2B P;  2AT1 B;  3INZ A;  3GF5 A;  4Z02 A;  3I55 A;  1OUL A;  2DL7 A;  1VIE A;  4E7K A;  1TTH B;  3PTA A;  3OSS C;  1XQH A;  1AWX A;  4KBM B;  1VQ7 Q;  3OS0 A;  4Z8A A;  2RHI A;  3EHQ A;  4M7A B;  5GAO l;  4HA8 A;  2LCC A;  2E6Z A;  4J6Y A;  2K79 A;  4N0A C;  3NPF A;  1G2B A;  2BZX A;  2LJ0 A;  1GRI A;  1ZLM A;  4PFO A;  4FYY B;  2DJQ A;  5GAN e;  2FZC B;  1PRL C;  2DBK A;  4LN2 A;  3G4S Q;  2COZ A;  3V8L A;  3OYM A;  2FEI A;  4ESR A;  2X3W D;  5FRO A;  2M0Y A;  5GAM g;  2XDP A;  3EG0 A;  3RR6 A;  1VQP T;  3VRZ A;  4ZGD B;  2CP0 A;  5GMK l;  3CCQ T;  2NUP B;  1W2B A;  3CMA Q;  5IH2 A;  1GXI E;  2FRW A;  3R6N A;  1JB0 E;  1K0S A;  3M0R A;  1AD5 A;  3TCJ A;  1BIB A;  4CC4 B;  1D09 B;  1VQ9 Q;  2L89 A;  1X2K A;  2A36 A;  3RMQ A;  4M75 C;  4MMK A;  1UB4 A;  2L0A A;  3OSV A;  3JAM E;  4M78 B;  4ATO A;  2QEX T;  1QVP A;  3M58 A;  2RQW A;  2MWP A;  2MWO A;  1GBQ A;  1MMA A;  4KH1 B;  2J05 A;  2L3P A;  2OI3 A;  4M78 A;  1S72 Q;  2KR3 A;  1BI0 A;  2RHX A;  2VGN A;  4JZ3 A;  1VQ7 A;  4AFS C;  3VRY A;  3ZFJ A;  5GMK j;  2YRD A;  5D6W A;  1SRL A;  1Y96 B;  1KC8 U;  2DEU A;  3PNW C;  1NM7 A;  4OML A;  2YUN A;  1M2V A;  4RCC A;  3G6E T;  1RAC B;  3BE3 A;  3SHW A;  2VAS A;  2L3R A;  5GAN f;  2Z0W A;  4PJJ A;  2D6F A;  3S3N A;  1GCP A;  4FIB A;  2EQJ A;  4X34 A;  5DM7 R;  1YIT A;  4PJL A;  2OX7 A;  1BI1 A;  2ESW A;  2JT4 A;  3QWY A;  5GAO p;  2K57 A;  2HSE B;  4OVA A;  1QCF A;  1OU8 A;  2D8J A;  3JCM W;  2LTO A;  2OTL A;  2JTM A;  2FVU A;  4XK8 E;  3SFM A;  3SB2 A;  1TSF A;  2CP6 A;  1NYG A;  1Q7Y R;  1PSE A;  2FZK B;  3NTH A;  1YIJ T;  2PTK A;  1YJN A;  2DXC A;  2E1H A;  3C0C A;  1AVZ C;  1HJD A;  1D1B A;  4F16 A;  1IHW A;  1SHG A;  1MMG A;  2A7Y A;  1WXU A;  4RTX A;  2NUT A;  4DEY A;  3OW2 A;  2CP3 A;  4LXC A;  3EFR A;  1UGP B;  2HL5 C;  3A8L B;  4V2S A;  1W70 A;  2BUD A;  1M3A A;  3G7Z A;  2FYK A;  4M75 B;  1X6G A;  3EH2 A;  1MMN A;  3THK A;  2CSQ A;  4RUG A;  1KK7 A;  1EX4 A;  1TUD A;  2JS2 A;  1VQO Q;  3QBY A;  2GBQ A;  2HSP A;  1R0C B;  2YLB A;  2L3S A;  3I55 Q;  1PKS A;  3LGF A;  1AEY A;  2HNI A;  3H9N A;  1OI1 A;  1VQK A;  4M7A G;  3L2W A;  4M7D B;  3EGD A;  4OB1 B;  2K2M A;  2DXT A;  5CR2 A;  5KYY B;  4NL3 A;  3OYI A;  2B8A A;  2DIG A;  2PUK B;  2GFU A;  2X3X D;  4QVD A;  1X6B A;  2YSQ A;  1K9M R;  4M7D G;  2EYZ A;  2NUP A;  1YHQ A;  3VS6 A;  1E6H A;  1ZUU A;  3CCU A;  2HMA A;  3VKI A;  5C6S A;  1M8V A;  3VS5 A;  3CD6 T;  5FU6 C;  2DBM A;  4M7D E;  1VQP Q;  1QP2 A;  1H8K A;  2LNV A;  1XTD A;  5ECA A;  2CUD A;  2DM1 A;  1PM3 A;  4PJO E;  3GIB A;  3CC2 T;  4RTU A;  2KT8 A;  5HCK A;  3OYN A;  3G1J A;  2DPP B;  4PK4 A;  5HY6 A;  1Q86 C;  2YHT A;  1N5Z A;  1UFF A;  4C92 A;  2JZ2 A;  2ZPG B;  3ULR B;  1YJ9 T;  3VJP A;  2HD0 A;  2EYX A;  4UC4 A;  2VB6 A;  2A3L A;  1VQ9 T;  1Q81 C;  2FL7 A;  3HP9 A;  3C12 A;  2MMP A;  4PJO B;  2LZ6 B;  1V29 B;  5GAN d;  2A0F B;  2LT4 A;  1WZO A;  2V8J A;  2C0O A;  5IT9 E;  1VQK Q;  2IG0 A;  3BDL A;  1OZ2 A;  3CCJ Q;  2EVR A;  2IVW A;  2CP2 A;  2M0O A;  4QQD A;  1VQN Q;  3EG1 A;  4J6W A;  2RN8 A;  3REA B;  2HQE A;  2YUO A;  1VQ6 A;  2FPF A;  1YHQ Q;  2KMT A;  1IRE B;  2EFI A;  2O4X A;  3O5Z A;  5LJ5 j;  2DIL A;  4JJN K;  1PKT A;  4JJC A;  5KYY A;  4QQG A;  5M9O A;  1VQ5 A;  4QKU A;  3TRE A;  2DRM A;  1MV3 A;  2QTX A;  5IHI A;  3OS1 A;  1H3Z A;  2AK5 A;  1ABQ A;  2COW A;  2AZS A;  3EGD B;  1OPK A;  1VA7 A;  3X20 B;  1M1K R;  3U23 A;  3A98 A;  4JUV A;  1SSF A;  1MNE A;  4GLM A;  5GMK h;  3CME A;  1KQS A;  3GBQ A;  4O6J A;  1T0J A;  3L2Z A;  1Q7Y C;  3CCQ A;  1ZSZ A;  5EG2 A;  2RA2 A;  4M77 B;  4LDV A;  4M75 A;  3OYA A;  4XQ3 A;  2L2P A;  1NJI C;  1YIT T;  1UJ0 A;  1VQL A;  4IUU A;  3CCV T;  1M1F A;  1RLP C;  1K73 R;  3L2Q A;  5GAM j;  2GNC A;  1OQK A;  4M77 A;  3M4Y A;  2CZ7 B;  3JB9 I;  1G3S A;  1WHL A;  2RO0 A;  1NPP A;  5KE3 A;  2VV5 A;  1VQN T;  3RMS A;  1PSF A;  1JXM A;  1BI2 A;  2L8D A;  2J6F A;  1EZZ B;  3SD4 A;  2RD1 A;  3IQL A;  3L1A A;  1PCX A;  2CDT A;  1ZQ1 A;  4M77 E;  4M78 E;  1YIJ A;  1WA7 A;  2IIM A;  2EBP A;  2JW4 A;  1BU1 A;  1NJI R;  2BTT A;  4PJO G;  3HTR A;  3HFO A;  4FW1 A;  1UDL A;  1O75 A;  4WTO B;  4PKC C;  4PJM A;  2JUF A;  4F14 A;  2OTL T;  2BE7 D;  1OEB A;  2QQB A;  5KYW A;  3CEY A;  3LLR A;  2CZ0 B;  2DTO A;  1YI2 Q;  2H8H A;  2NWM A;  5GAN 2;  4FU6 A;  2R5A A;  1ZUY A;  1D0X A;  3LWI A;  3CCS Q;  4XU1 A;  2E5Q A;  3OA6 A;  1M3C A;  2V1R A;  4M78 C;  1K4U S;  1EIF A;  3FC3 A;  4QW2 A;  3CCU Q;  1VQ5 T;  3P8B B;  3FDR A;  1VQL Q;  2HDA A;  4PLI A;  4MZM A;  4RTW A;  1JBM A; 
#chains in the Genus database with same CATH homology
 2D9T A;  4YTL A;  2XDD A;  4HCC A;  4HKE A;  4FL6 A;  3JCM b;  3Q1J A;  3JCM c;  2YLC A;  4M77 F;  3LYI A;  4M75 D;  1BI3 A;  3MEA A;  3INZ A;  3GF5 A;  1FWZ A;  4Z02 A;  1P92 A;  4E7L A;  2RJC A;  1DJ7 B;  3I55 A;  2XID A;  1O9S A;  5LJ3 g;  3OYF A;  1UGS B;  5KCH A;  1VIE A;  3FJP A;  1M1G A;  4JS5 A;  4BAC A;  4E7K A;  4J8O A;  4C5H A;  4L6V 5;  2F5T X;  3UWN A;  4A4F A;  1XNI A;  5LJ3 j;  4B9X A;  3PTA A;  3OSS C;  4C92 D;  3HSB A;  1KD1 U;  4M77 G;  3MP1 A;  5GAM h;  3CCU T;  1XQH A;  4XTW A;  5CKD A;  5J39 A;  5GMK e;  2V8K A;  3HFN A;  4C5I A;  4KBM B;  2JN0 A;  4N4I A;  1M4Z A;  3CC2 A;  3JB9 F;  5CCA A;  3OS0 A;  2H3J A;  5GAN g;  2GF7 A;  5LJ3 d;  3V8K A;  2RHI A;  4M7A B;  4XTU A;  3CCL A;  2RI2 A;  4M75 G;  3A8H B;  2ZPI B;  5FU7 C;  3OY9 A;  5GAO l;  3GPL A;  4HA8 A;  1G3Y A;  2QQ9 A;  2LCC A;  3FIF A;  3MP8 A;  5I2M A;  2QA4 T;  4XAX B;  1LNX A;  3JCM h;  2E6Z A;  4J6Y A;  4XTY A;  3E19 A;  3LW5 E;  3AHU A;  2ZZD A;  3M9Q A;  4OP0 A;  3RIR A;  4F7U E;  4N0A C;  3JCM f;  2E70 A;  1K9M C;  3CC4 A;  2OTJ A;  1HXD A;  3PIO A;  4M75 E;  3NTI A;  3VYH B;  3CCJ A;  5J3B A;  5LJ3 h;  2KQW A;  4KUL A;  5CKF A;  3JRZ A;  5GAN j;  4EMK A;  5GAN e;  3MEU A;  5FLX E;  3CXC S;  5GAM d;  4IUT A;  3I56 T;  4RKU E;  5LL6 S;  4LDX A;  3V8L A;  2PU9 B;  3OYM A;  3QII A;  3V8J A;  1N8R C;  3HRU A;  3M59 A;  5FRO A;  1VQ9 A;  5GAM g;  3JB9 G;  2XDP A;  2X4Y A;  3OYG A;  5DLQ E;  4D6W A;  1VQM A;  1NJI U;  1VQP T;  3PMT A;  4M7A C;  2LC4 A;  4C8Q C;  3QYH B;  3CCR A;  2C06 A;  4ZGD B;  3G4S T;  2LVM A;  2FB7 A;  4XTZ A;  5HKC A;  2CZ6 B;  2BKD N;  5GMK l;  3CCQ T;  3CBM A;  1D3B B;  3M5A A;  1W2B A;  1N27 A;  2K5L A;  1MHN A;  5CKH A;  4C0D C;  2LT1 A;  1GXI E;  3HPW A;  2FHD A;  2EYQ A;  2QDY B;  2R57 A;  1JB0 E;  3GNG A;  3PGG A;  2DD4 A;  4O5V A;  4DA4 A;  1YHQ T;  3TCJ A;  4M7D D;  1BIB A;  2PQW A;  1TH7 A;  1NZ9 A;  3RUX A;  2L89 A;  4R56 A;  4E7J A;  2G3R A;  1H64 1;  3RMQ A;  4M75 C;  2RHU A;  3M56 A;  4MMK A;  1VQ8 T;  3RER A;  1UB4 A;  2CYZ B;  3MCA B;  3QJY A;  3JCM V;  3OSV A;  1WNL A;  3JAM E;  4M78 B;  4ATO A;  3V7R A;  2L5Q A;  5L8R E;  2QEX T;  1VQ6 T;  1QVP A;  2MAM A;  2X35 A;  3M58 A;  2MWP A;  2MWO A;  2VXF A;  1VQK T;  4KUD K;  2JOY A;  4M78 A;  5LJ3 e;  1BI0 A;  2RHX A;  2O4X B;  3QZ9 B;  2JVV A;  2VGN A;  5C0M A;  4E47 A;  1JRI A;  2WAC A;  4M78 D;  1FXX A;  4C92 G;  3CPW A;  1RI0 A;  2P0P A;  4LDU A;  3ZFJ A;  3CCM A;  4IUP A;  5GMK j;  1M9S A;  4FT4 A;  3CMA T;  2P0Q A;  4M78 F;  5D6W A;  3QHS A;  4MDX A;  2MF2 A;  4JRK A;  4M7D C;  3ZEH A;  1Y96 B;  3H6Z A;  3RKW A;  3FEO A;  4PLL A;  4MML A;  1UGQ B;  1KC8 U;  4ELZ C;  3OW2 S;  3PNW C;  4JRI A;  4LDW A;  4VUB A;  4C0G A;  2DXB A;  1YI2 A;  5GMK i;  4KT0 E;  1X75 C;  1S72 A;  4RCC A;  2Y4X A;  3G6E T;  1K73 C;  3J80 E;  4N4H A;  4PJO F;  4M78 G;  2F69 A;  4GY5 A;  2XIC A;  2DVE A;  4M7A D;  3CME T;  2RI3 A;  2L3R A;  3MET A;  2RHZ A;  4DOW A;  4N0A A;  5GAN f;  4Y91 A;  4QVC A;  5GAO m;  1N6A A;  3DB3 A;  2D6F A;  3S3N A;  5FU7 B;  3OYK A;  4FIB A;  4C8Q E;  2EQJ A;  5AYF A;  2XK0 A;  4X34 A;  5DM7 R;  3SDZ A;  4FT2 A;  4EPC A;  1KQS S;  1D3B A;  2D0Q B;  3PIP A;  2PUO B;  1YIT A;  1VQL T;  4C92 B;  4WF2 A;  3M53 A;  2WSC E;  1QVF S;  2RHY A;  5GAN 3;  3E1S A;  3CCV A;  1BI1 A;  5FU6 B;  2X4X A;  4FSX A;  3GP8 A;  5GAO p;  2K57 A;  1M5Q 1;  4OVA A;  3CBP A;  3T9N A;  1KHC A;  5J26 A;  3M4G A;  3JCM W;  2LTO A;  1KC8 C;  4MZP A;  2OTL A;  3OBY A;  2DZ9 A;  2JTM A;  3WVE B;  4PJO D;  1VQN A;  2FVU A;  2CKK A;  3QKJ A;  4XK8 E;  2JTF A;  3A5Z B;  3SFM A;  1WJR A;  3E9F A;  3SB2 A;  4PJO A;  1IZ6 A;  1ZBX A;  4PLI A;  4BI4 A;  3CPW S;  5HK0 A;  4C8Q B;  1MGQ A;  1U8R A;  1PSE A;  3NTH A;  1YIJ T;  3I55 T;  3QJ6 A;  1VQO A;  4GLK A;  2DXC A;  1YJN A;  2E1H A;  5GAN h;  4M7A E;  3QG1 A;  4J6X A;  4C92 C;  2A7Y A;  4TVR A;  4XTX A;  5A0D A;  3OYE A;  3CCS T;  3OW2 A;  2ZGW A;  5GAN 5;  3JCM J;  3EFR A;  5LJ3 f;  3OMG A;  2R58 A;  3OYY A;  3QO3 A;  4IUQ A;  1UGP B;  4F7U B;  3A8L B;  1KG1 A;  3CC7 A;  4M7A F;  3P8D A;  4C8Q G;  4NL2 A;  3S3O A;  4XU3 A;  2BUD A;  4OB3 B;  1KD1 C;  4V2S A;  3G7Z A;  2FYK A;  1BKB A;  4M75 B;  2RB6 A;  1KQ2 A;  5DLO A;  2LDM A;  1JJ2 S;  3UPU A;  2KDS A;  5GAN 6;  3KBG A;  3J81 E;  3QBY A;  3GOX A;  3RKY A;  3MHX A;  4R55 A;  4BE1 A;  1I5L A;  1Q86 C;  2KSS A;  3WVD B;  4X9D A;  4E7H A;  3LGL A;  1Q82 C;  3EAE A;  2ZPE B;  3BY7 A;  3QDR B;  1N9R A;  2YLB A;  2X4J A;  2XKO C;  3M55 A;  3M54 A;  3O8V A;  2HBP A;  4BDY A;  2JNG A;  5GAO r;  1XOV A;  4M75 F;  2DIQ A;  4A4K A;  2AHJ B;  3LGF A;  1I8F A;  2PVG B;  2Y90 A;  2HNI A;  4LDY A;  1K9M U;  2XI9 A;  3OYC A;  1FX7 A;  1QP3 A;  2VGM A;  1VQ4 T;  1Q7Y U;  3HKS A;  3JB9 J;  2GCX A;  3CCE T;  5HK3 A;  1OI1 A;  1VQK A;  5CO7 A;  3L2W A;  3SWN B;  4M7A G;  4M7D B;  4OB1 B;  5LJ5 d;  5KE2 A;  2EJF A;  2DXT A;  1QVG S;  2XDB A;  3L2U A;  3OYB A;  5CR2 A;  1I81 A;  3JB9 H;  3C95 A;  5IAY A;  1VQP A;  4NL3 A;  1M90 U;  3A8O B;  3OYI A;  2B8A A;  2F5K A;  2DIG A;  4LD9 K;  2RK2 A;  3DLL A;  2PUK B;  1NPR A;  2GFU A;  3QUI A;  3PT9 A;  4QVD A;  2E41 A;  2XU8 A;  1OZ3 A;  4OB2 B;  1RL2 A;  4A53 A;  4F7U A;  1G5V A;  1G3W A;  4M7D G;  4Y28 E;  3QXE B;  4M7D F;  1YHQ A;  4C5G A;  4QVZ A;  4A4G A;  3S6W A;  4J83 A;  3CCU A;  2CZ1 B;  3L2V A;  3VKI A;  4C0F A;  5C6S A;  2EKO A;  3V7S A;  3JCM P;  1YJW T;  3CD6 T;  3R6O A;  1M8V A;  3FB9 A;  4BY6 B;  5FU6 C;  4M7D E;  1QW1 A;  3OS2 A;  3CCL T;  3X28 B;  2DKG A;  4JRQ A;  1M1K C;  1QP2 A;  2LNV A;  3DLM A;  1XTD A;  2RJF A;  3CCR T;  4PJO C;  1K8A U;  3FRN A;  2QEX A;  3JSC A;  4IKF A;  4PJO E;  3GIB A;  3CC2 T;  4OGE A;  3JCM Q;  3JB9 D;  1LJO A;  2XD0 A;  2RK1 A;  2CGH A;  2Y4Y A;  1N9S A;  5CK9 A;  1Q86 U;  3OYN A;  3G71 A;  5FRN A;  2DPP B;  2EIF A;  2RM4 A;  1Y07 A;  1U1S A;  2MI6 A;  5HY6 A;  2YHT A;  3HHT B;  4BB7 A;  1I4K 1;  5D6X A;  4C92 A;  2JZ2 A;  3CCJ T;  4PNO A;  3RKX A;  4L5G A;  1Y71 A;  2ZPG B;  3OS5 A;  3X26 B;  1YJ9 T;  1QVF A;  3VJP A;  2VUB A;  3S3M A;  1Q81 U;  2HD0 A;  3OB9 A;  4ZGJ B;  4UC4 A;  1Q82 U;  1Y96 A;  2A3L A;  2VC8 A;  3NTK A;  5CKB A;  4C5E A;  1VQ9 T;  1Q81 C;  3QYG B;  4J7I A;  5IN1 A;  4BY6 C;  2FL7 A;  3HP9 A;  1VQM T;  3C12 A;  1QVG A;  5A0L A;  2M1H A;  4C92 E;  4BE2 A;  1W2B S;  2MMP A;  4PJO B;  3SWN A;  4HT8 A;  4OMF B;  1V29 B;  5GAN d;  4L59 A;  2LT4 A;  2KY9 A;  5CKE A;  1VQ7 T;  2DAQ A;  2V8J A;  4EMK C;  3BDU A;  5IT9 E;  3JCM X;  2IG0 A;  4J7F A;  4BD3 A;  3X25 B;  2ZCF B;  1OZ2 A;  3BDL A;  4NS5 A;  2NLU A;  4OGC A;  5KCO A;  1LOJ A;  4C92 F;  3GNF B;  1HK9 A;  2IVW A;  3KUF A;  2ZPF B;  2M0O A;  2M9U A;  2P4T A;  4P5N A;  4QQD A;  3VYG A;  5A0G A;  3CC7 T;  4PL6 A;  4J6W A;  2OTJ T;  4F7U G;  4ZTJ A;  2K4Y A;  4XTV A;  4IUR A;  2HQX A;  4ZTF A;  2HQE A;  3LWH A;  3FLG A;  4A54 A;  3PFS A;  2ZPB B;  1VQ6 A;  1WQ7 A;  2E64 A;  2K5F A;  5GAN 8;  2E65 A;  2QI2 A;  3ER0 A;  2E10 A;  3I56 A;  4NOY A;  2KMT A;  1IRE B;  3P8H A;  2EFI A;  2O4X A;  3OQ5 A;  4ZN3 A;  5LJ5 e;  3URG A;  5LJ5 j;  2O01 E;  4BI8 B;  3L42 A;  3SWN C;  1VIF A;  1X6O A;  4JJN K;  3ASK A;  5CIU A;  5M9O A;  1VUB A;  1G3T A;  2LX9 A;  4QQG A;  3ZBD A;  2EJ9 A;  4EMH A;  1JJ2 A;  2PVO B;  1VQ5 A;  4X9C A;  2QA4 A;  3TRE A;  3MO8 A;  4JRP A;  3CC4 T;  4E7I A;  2K5I A;  2RJD A;  4M77 C;  2QTX A;  4DOV A;  2KK4 A;  2OAU A;  3OS1 A;  1BIA A;  1X01 A;  3V7C A;  1H3Z A;  5GMK m;  2X4W A;  1WGS A;  1OYX A;  2KAF A;  5I21 A;  3RES A;  4BE0 A;  2RH2 A;  1VQ7 A;  2DK3 A;  2RI5 A;  4FM4 B;  3E9G A;  1YJN T;  2EQK A;  1ZHI A;  2EQM A;  2K3X A;  4JLG A;  3X20 B;  3A8M B;  4F7U F;  5LJ5 g;  2BIV A;  4JUV A;  3JCM g;  3WXM B;  4HCB A;  4EDU A;  5GAO n;  2E12 A;  4CRI A;  1BYM A;  1NE8 A;  5GAN 4;  1SSF A;  5DY9 A;  5GAN 7;  4ME7 A;  3DKM A;  1M1K U;  2KVQ G;  5GMK h;  3CME A;  1KQS A;  2LQK A;  4O6J A;  4QQ6 A;  2WSF E;  1S72 T;  3G4S A;  3L2Z A;  3VUB A;  3OYD A;  1Q7Y C;  2K2V A;  3HRS A;  3CCQ A;  5EG2 A;  1U1T A;  3TEE A;  2RA2 A;  1YCY A;  2LRQ A;  3QZ5 B;  1WPY A;  2QQR A;  4M77 B;  4LDV A;  3JCM e;  4M75 A;  1WJS A;  3OYA A;  4RCB A;  4XQ3 A;  1NJI C;  1YIT T;  1VQL A;  1R8O B;  1WQW A;  2CS7 A;  3DB4 A;  4IUU A;  5LJ5 h;  3KXT A;  3CXC A;  3CMA A;  3CCV T;  1KHI A;  1M1F A;  4JDS A;  3OYH A;  3HRT A;  5LJ5 f;  2DO3 A;  3OYL A;  3L2Q A;  3L2R A;  3HL8 A;  4C8Q D;  2DJZ A;  5A2Q E;  2GFA A;  5GAM j;  2QQS A;  4M77 A;  4XU2 A;  3M4Y A;  4C8Q A;  2CZ7 B;  4M7A A;  3JB9 I;  4RG8 A;  1G3S A;  4M77 D;  3LX7 A;  2RO0 A;  3G71 T;  1NPP A;  3VU3 C;  4ELY C;  5KE3 A;  3MEV A;  2VV5 A;  1KQ1 A;  2QQA A;  3F70 A;  3UT1 A;  3PMI A;  3VV0 A;  4BDZ A;  1YI2 T;  1VQN T;  1UEB A;  3RMS A;  1PSF A;  4MDW A;  1BI2 A;  3G6E A;  5CAI A;  2L8D A;  3MEW A;  4C8Q F;  1VQO T;  2PVD B;  2RD1 A;  2RJE A;  2EJG A;  3BW1 A;  3SD4 A;  3X24 B;  4CI0 C;  2E6N A;  1WJQ A;  5GAO q;  2R5M A;  4N4G A;  3L1A A;  4EMK B;  1M90 C;  4RMO A;  1ZQ1 A;  4M77 E;  3A8G B;  4M78 E;  3C4S A;  1YIJ A;  3VUZ A;  4ZGE B;  5KH6 A;  4C0Z A;  4A4E A;  3OYJ A;  2EAY A;  2XG8 D;  2ZPH B;  4JLI A;  2GQV A;  4XU0 A;  3QSU A;  4PJO G;  3HFO A;  3GLX A;  2EQU A;  4OB0 B;  3CCS A;  4B9W A;  1O75 A;  3M57 A;  4PKC C;  2XHC A;  3LH0 A;  3OBW A;  4BI3 A;  4BUG A;  2JUF A;  1YBY A;  2DXU A;  2M16 A;  4ZN1 A;  2OTL T;  2WSE E;  2DTH A;  3ME9 A;  3C94 A;  1UGR B;  3BFM A;  3UDC A;  1AHJ B;  1VQ8 A;  5FRM A;  1B34 B;  2DTI A;  5GAM e;  3J7A F;  2QQB A;  4C0D B;  3CPF A;  3JCM d;  3CEY A;  3OMC A;  4KUI A;  4OF1 A;  2I2L A;  2CZ0 B;  3LLR A;  4EMG A;  1K8A C;  4J5Y A;  3MP6 A;  2DTO A;  2EWN A;  2LQ8 A;  2QXF A;  3NFC A;  2LCL A;  4HT9 A;  4HCZ A;  4II1 A;  5GAN 2;  4FU6 A;  4IUV A;  4MZT A;  2R5A A;  1Y7X A;  2DD5 A;  5D6Y A;  3CBO A;  4JS4 A;  1W4S A;  2V8I A;  1YJW A;  3LWI A;  1YJ9 A;  4RG2 A;  5GAM f;  1N8R U;  3H8Z A;  3CD6 A;  3EFS A;  2HAX A;  1K73 U;  4XU1 A;  2E5Q A;  3OA6 A;  1VQ4 A;  2VYT A;  3CCE A;  3CCM T;  4DQ2 A;  2DEQ A;  4M78 C;  1EIF A;  5I2S A;  2VXE A;  5CQY A;  1B34 A;  3FC3 A;  4QW2 A;  1VQ5 T;  2K3Y A;  4M7D A;  3P8B B;  3TU4 K;  4A4H A;  3QPH A;  3FDR A;  4Q5W A;  5CQX A;  2P0K A;  4LD6 A;  2YRV A;  5CVI A;  2DZC A;  4MZM A;  3N5B B;  1JBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...