1LNXA

Crystal structure of the p.aerophilum smap1 heptamer in a new crystal form (c2221)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Rna binding protein, transcription
total genus 13
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lnxA00
4J6WA 4M7DA 3SB2A 2FYKA 3SWNA 1HK9A 1I8FA 3V7RA 1LOJA 3INZA 4X9DA 4M7DE 5GAN2 4M77B 4PJOA 2DZ9A 4XTXA 2E64A 3JB9G 4HA8A 5GAN6 4M7AA 2EAYA 4PJOE 1BIBA 2YLBA 4EMHA 4M75G 5GMKj 4RCCA 2RD1A 3SWNB 2EJ9A 5GAN5 3PGGA 1JRIA 4M78E 3JCMV 4M78C 2DEQA 2HNIA 2RA2A 3EFRA 4OP0A 4XQ3A 2DVEA 4M7AB 5LJ3h 1I4K1 5GAOl 4C92C 1H641 4J6YA 3V8KA 4N0AA 5LJ3j 3HSBA 5GANe 4M75B 2EJFA 1LJOA 5GAMe 2FB7A 3JB9D 4M77E 3AHUA 1Y96B 4M77C 3RESA 3JCMJ 3FIFA 3QUIA 2DTOA 2VXEA 4M75D 3V7SA 2DXUA 1U1SA 4M7DC 4QVCA 2E41A 5GAN7 4M7AD 2EJGA 4Y91A 4F7UF 5LJ3e 5GANh 5LJ5e 5GANj 5GAMh 2DJZA 3RKXA 4PJOC 3JCMg 4C8QF 5GAOq 4V2SA 5GAMj 5GAOm 4RCBA 4PNOA 4C8QG 4M7AE 4M75A 4M7AC 5GMKm 4M7AG 3JCMd 2DTIA 3RKWA 3JCMf 3GIBA 1M8VA 1Y96A 4M75E 2CGHA 3FB9A 5DY9A 4NL3A 1BIAA 3L2ZA 1M5Q1 1YCYA 5LJ5h 5GAN4 4QVDA 5I21A 1KQ2A 2ZGWA 4PJOF 3RIRA 5LJ5j 2DXTA 1JBMA 4X9CA 3RKYA 2K57A 3QSUA 4M78F 4N0AC 5CAIA 4M78G 1WQ7A 2I2LA 3RERA 4A54A 1D3BA 3JB9I 3L1AA 4XU1A 4C92F 3JCMP 1WQWA 3QHSA 4J5YA 4XTZA 2Y90A 4C8QD 2DZCA 3SWNC 3BDUA 4C92G 3JCMX 5GAOr 4F7UG 5GAMf 4HT9A 3FJPA 4M77F 4EMKA 1D3BB 5LJ3g 4M77G 4XU0A 4J6XA 3JCMQ 1N9SA 4C8QA 1WNLA 2E10A 2QTXA 3HFOA 4M7DF 1LNXA 1B34A 2DKGA 4M75C 5LJ3f 5LJ3d 3JB9J 3JCMc 4C92B 4XTVA 4M7DG 4DQ2A 1TH7A 2YHTA 4M78D 5LJ5f 1U1TA 3BFMA 4MMLA 4F7UB 4EMKB 1WPYA 4A53A 4HT8A 2EWNA 4PJOG 2E1HA 2VXFA 1I5LA 3JCMW 3RUXA 4XTYA 4C8QB 4XU3A 3JB9F 4C92D 4MMKA 3JCMe 2YLCA 5GAOp 1KQ1A 3EFSA 4JLIA 1B34B 5GAN8 2VC8A 3BY7A 4JRIA 5GANg 2DTHA 5GMKi 4M75F 5GMKh 1MGQA 3QO3A 4M78A 5GAMg 4M7AF 4M7DB 1X01A 5GANd 4M77D 5GANf 4XTUA 4EMGA 5GAN3 3HFNA 3V7CA 2RM4A 4JUVA 5GAMd 4C92A 4PJOB 2RB6A 3JCMh 3JB9H 4WF2A 4F7UA 1HXDA 4M7DD 2E65A 3V8JA 4JRKA 4M78B 4C92E 3M4GA 5LJ5g 1N9RA 2JN0A 3JCMb 4F7UE 4M77A 4PJOD 5GMKl 4EMKC 5GAOn 4XU2A 4NOYA 3BW1A 5GMKe 1I81A 3VU3C 4XTWA 4NL2A 3V8LA 4C8QE 5LJ5d 4C8QC
chains in the Genus database with same CATH superfamily
2RQTA 1G3WA 3C94A 3PNWC 2V1QA 4JRQA 3CMAT 3PVQA 2KBTA 2GQIA 4M7AA 1YN8A 2ZPIB 2RD1A 2QA4A 1JO8A 2P4TA 3H0HA 4BY6C 1BKBA 2HNIA 3I55A 3EFRA 2EKOA 1E6GA 2E12A 1WA7A 2VKNA 1H641 4N0AA 4GBQA 4PFPA 4FYVB 1YJWT 4J83A 1GCQC 1Y96B 2DAQA 5KE2A 2JT4A 2L3SA 1R8OB 2V1RA 2DXCA 2J6FA 2D9TA 2QEXT 2YUOA 2CSQA 5LJ5e 2CZ1B 5GAOq 2RK2A 3CC7A 1WJQA 1YCSB 3OW2A 2RO0A 1VQ4Q 3M57A 4IKFA 1VQ5T 3A8HB 1JXOA 3EGXA 3CCQQ 3ZFJA 3CC2Q 4J9CA 4KRTA 2AT1B 2EQKA 1OZ3A 2QDYB 1H92A 1S72A 5IHIA 1KC8C 4KUDK 1HSQA 1W4SA 1N8RC 3CC4A 2YHTA 2C0OA 4F7UB 1VQ8T 4PJOG 1K9AA 3JCMW 2A7YA 2WACA 4JLIA 1Q7YR 4JRIA 3A8GB 2O9SA 1YJNT 2MI6A 2K3YA 4LE9A 3TEEA 1YITQ 1WHHA 1Q82U 4WF2A 2KXCA 4M78B 2HQXA 4EMKC 1OYXA 1VIEA 3HRUA 4C8QE 4C8QC 1W6XA 5CR2A 3WXMB 3SB2A 1GFDA 4F17A 3PE0A 2RN8A 3V7RA 1QP2A 2HD0A 2KQWA 4LD6A 2FHDA 4HA8A 3UPUA 1FXXA 3CCUA 1YI2T 3CMEA 2KI7A 3OS5A 3CCLQ 2MMPA 1JRIA 2BTTA 2DFUA 2NUTB 4PLIA 1GBRA 2I0NA 4PJNA 3OYNA 1VQOA 1K73U 3L2VA 4LXCA 3JB9D 3CXCA 2X3XD 2OTLT 3E9GA 2VYTA 2C06A 1NEBA 1R77A 1MNEA 4WCIA 3H41A 4JPBW 4JJCA 4BI8B 4C5EA 2MOXA 1IZ6A 5CIUA 1RLQC 5GAOm 3G7ZA 4EIKA 1M8VA 3OS0A 1FMVA 2RMOA 2ZPFB 5DY9A 1OU9A 1PC0A 3VS3A 1AZGB 2KAFA 2K57A 3Q1JA 3G4SA 3VV0A 5CAIA 1VQLT 3OQ5A 2DL5A 1OQKA 2EBPA 2JTFA 2PUOB 4J5YA 4HCBA 2SEMA 3EH2A 4M77F 1BI1A 1JJ2P 1M90U 4M77G 4E7LA 4XU0A 4OB0B 4YTLA 4PFZA 1R0BG 3EGDA 5FLXE 8AT1B 3QYGB 4MMLA 1GFCA 2LC4A 5KCOA 4A63B 1PD0A 3JCMe 4MMKA 2K4YA 5L8RE 5GAMg 1FMKA 1RAIB 1AVZC 4HCCA 1WIEA 4JUVA 2E5KA 2MYSA 2RB6A 3A8OB 1VQMA 4M7DD 4AFUC 4JRKA 1N9RA 2KE9A 3MJXA 1VQNA 2Z0WA 4BE0A 2ZPHB 1UDLA 2QXFA 2PQWA 4HVVA 5KE3A 1TXQA 1VOMA 1NJIC 5D6YA 2J6OA 4PJOA 1M2OA 2DZ9A 4XTXA 1U8RA 2M1HA 2ROLA 2EAYA 1VA7A 4HVUA 3H0FA 4IUTA 4DEXA 1WLPB 2LT1A 5LJ3h 1TUDA 2FG0A 3MEAA 3D7SB 1X2KA 2KRMA 3META 1WFWA 2MWOA 4J9HA 3OSVA 2CH4W 1KQSS 5KCHA 1MMGA 3VRZA 2LVMA 4Y91A 1RAEB 3J81E 2PVOB 2GBQA 3RKWA 6AT1B 2OTJA 2ZCFB 3VYHB 3I56Q 1V76A 3M0UA 1XQHA 5I21A 5CK9A 3MP1A 2YWWA 2KK4A 3M0RA 4BB7A 1OX8A 4A4EA 3R6OA 1NLOC 4OMQA 5J26A 4LNPA 3RDVA 2YRVA 2H3JA 1AWOA 3JCMP 2P84A 5KYYA 3L2QA 3CCEA 3LX7A 1D1CA 2RI2A 3QJYA 3J80E 1B34A 4FYWB 4Z89A 3LYIA 1RLPC 2HL3A 1Q81U 1JQQA 1KJWA 2K9GA 4CC4B 3QPHA 3NGPA 3ER0A 5GANf 4XTUA 4JJDA 2M9UA 4PJOB 1BI2A 2KYBA 3JB9H 4JJBA 2X3WD 4QQDA 1UTIA 4DBFA 4F7UE 4M77A 2PTKA 2YDLA 5GAOn 2H8HA 4PKCC 5I22A 2ZPGB 2V8IA 5CKFA 3JB9G 2RJEA 3OYEA 2A36A 3PIOA 1N8RR 4RCCA 4M78E 2QA4Q 4M78C 2XG8D 4Q5WA 2KSSA 3ASKA 1G3YA 4LDXA 4XQ3A 1FMWA 5IN1A 5FU7B 4C0DB 3M0PA 3CD6T 2EQJA 4OMPA 3G6EA 2ECZA 1WHJA 4ZTJA 3V7SA 4ESRA 2D8HA 1K73C 4OMFB 2BZXA 4C5IA 5GANj 3OBWA 3CCLA 4HVWA 2G6FX 3HPWA 5IHKA 3VS0A 2EGAA 3H8ZA 4QT7A 1K9MU 2EYXA 3DB4A 2LCCA 5J39A 3CC7Q 5EG2A 3TU4K 5LJ5h 2VWFA 2HBWA 2XI9A 3HL8A 2I2LA 4RTXA 1QVFA 1PCXA 4A54A 3VS5A 1GL5A 2KDSA 4Z02A 2P0PA 7AT1B 1KK7A 2HSPA 3LGFA 1ZSGA 1AWXA 1UHFA 1S72Q 2DL3A 1WNLA 3PVLA 3PT9A 2QTXA 3HFOA 4M7DF 1VQ7A 1BYMA 4J9IA 4J9EA 4M7DG 4XTVA 3CPWS 2OI3A 1M90C 2QG9B 2L8DA 3SFMA 3EFOB 4DBHA 3C95A 1ZA1B 2R57A 3L42A 1ZBJA 2M02A 2QEXA 1OI1A 2RJFA 4RG2A 4OGEA 3CCRT 4OB3B 2E70A 2LQKA 2XICA 2KT8A 1JU5C 2JTMA 1QVGA 1W2BS 2DL4A 1IO6A 1RL2A 2DD5A 3OYHA 2NUZA 1VQ5A 2YRCA 3OYCA 3JSCA 1OZ2A 1TU0B 4A4KA 2MK5A 3CCUQ 3SWNB 4Y92A 1ZSZB 4J9DA 2F5TX 1C0MA 3PGGA 4LN2A 2D1XA 3CMEQ 2DMOA 1YIJT 2KMTA 2KROA 1NE8A 3C0CA 2DVJA 1NYFA 3HSBA 4BDZA 1TUCA 1VQOQ 2EJFA 2JW4A 1G3SA 3RESA 5CQXA 2VXEA 1ABQA 1Q86C 2KVQG 1VQ8A 2J7IA 1KQSP 5LJ3e 2QQBA 4FT4A 4OB1B 1NJIR 1RAHB 4TVRA 2DXBA 5GAN4 2Y4XA 2R5MA 2LQ8A 2LNHB 3AT1B 1U5SA 4LD9K 2A08A 2F2XA 3G4SQ 3OBYA 4K11A 3CCMA 4R56A 3FLGA 1VQ4T 3VS2A 1P92A 4J9FA 2RHYA 1CSKA 1YI2A 1WJRA 1RI0A 5EC7A 3CCQT 2R5AA 1MV3A 3CC2T 5DLOA 4M75C 1WHLA 1U1TA 2A3LA 2XU8A 4QQGA 3FDRA 1I5LA 4RTTA 4E7IA 2IPOB 5GAOp 2X4YA 5I11A 1YHQT 1YNZA 2DTHA 1M30A 1B3QA 4B9WA 1OU8A 1V29B 2MCNA 2BKDN 3JCMh 4IURA 5HKCA 1MMDA 3QWXX 4E7JA 1VQMQ 4JS4A 2JN0A 2OAUA 3JCMb 3O8VA 3G71Q 3CBMA 5CKBA 4BI3A 4IUUA 1VQNQ 1OPLA 4M7DA 1B07A 1YITT 2KRNA 2ED0A 2EYWA 2RK1A 5D7UA 4PJOE 4EMHA 1OX9A 2GQVA 2KGTA 2LQWA 3LWHA 3QDFA 2EQMA 3M58A 4LDWA 4C92C 3HP9A 1B7TA 5GAMe 1SHGA 1UHCA 5KYUA 2BUDA 2L3RA 4DA4A 1RABB 3OW2S 2CUBA 1MNDA 2EJGA 2ATCB 2JJ9A 3TVTA 1NM7A 3TSZA 4QQ6A 5HY6A 4RCBA 4OGCA 3CCSA 1TTHB 2E3IA 1AHJB 2V8JA 2KEAA 4C0DC 3GNGA 2OTJQ 3DLLA 1V1CA 2SRCA 3UA6A 4GLKA 2B8AA 1K9MC 3EHQA 1YJ9Q 4RUGA 2K3BA 1RI9A 4IUQA 1WQWA 1BCOA 4C8QD 3BDUA 1YP5A 3A8LB 5GJVB 1ZUUA 2LNVA 1HD3A 3NTKA 4HCZA 1QWEA 3CCEQ 2H3EB 3P8BB 3A98A 4O6JA 1JXMA 2DRKA 3UATA 2XD0A 5LJ3d 4LUDA 1G3TA 1TH7A 1KD1U 2C0IA 3JAME 3CPWP 3RUXA 2FZCB 5GANg 3EH1A 5KYXA 4M75F 5AT1B 4A4FA 2ESWA 2EVRA 1UGVA 2RHXA 2XHCA 4M7DB 2RQUA 5M9OA 1J3TA 2K7AA 2F5KA 2NWMA 3M4GA 4LDUA 1M8MA 1T3LA 2L3PA 5AYFA 1ZUYA 2DNUA 1I81A 3VU3C 2V26A 2VVKA 2K2MA 2WSCE 5D6XA 1PWTA 2CKKA 1W2BP 2E6NA 4ANJA 3QYHB 2DYBA 1YFNA 2HKNA 2YXYA 4OVAA 1X69A 3OB9A 2NUPA 5GMKj 1I07A 2DD4A 2XIDA 3CBOA 3CXCS 1OPKA 2RA2A 4OMMA 4M7AB 2EGCA 5GAOl 3LLRA 3OYLA 4F04B 4E7KA 1ZBXA 4CI0C 3G6EQ 5KYWA 2DXUA 2YUPA 1ZSZC 2KT1A 1D0ZA 4A4GA 4D6WA 2CP2A 3UA7A 2E4HA 4PNOA 1VQPA 3M0SA 2QK0A 1PHTA 1K8AC 4KGXB 1NG2A 4QVDA 4AG2C 3M59A 4AG1C 4QW2A 2MPXC 4IUVA 5HK0A 1UE9A 1VQ9T 1RAFB 1FYNA 3CEYA 3CCVA 1PSEA 4AT1B 2RHIA 3EGXB 3I56T 1IXDA 1K0SA 1TS9A 3LW5E 3NMZC 1K76A 1Q86R 2A0FB 5KH6A 2P4RA 1VQ7Q 4CC3A 1M3BA 2IVWA 5GAN8 2F69A 2KNBB 3CCJA 1Y57A 4FW2A 4O5VA 2QEXQ 1XOVA 4E47A 4XU2A 3OYBA 4NS5A 5LJ5d 4FL6A 4VUBA 2LJ1A 2FYKA 3NHNA 2A37A 4D8KA 3OSSC 2K5FA 2FL7A 4AFZC 1VQ5Q 2GCXA 1I1JA 3FC3A 3KUFA 5DM7R 2X9HA 1NPPA 4BACA 3E1SA 2DRMA 1H3ZA 1ZUKA 3GNFB 3G71A 3OS2A 2OAWA 3V8KA 4C0FA 3REBB 4MZTA 3QJ6A 3PMIA 3FIFA 2CP0A 3ULRB 2KR3A 4L59A 2DO3A 3I55T 4FIBA 3P8HA 2BE7D 2CS7A 4JDSA 1VQ8Q 1AEYA 3S3NA 3OW2P 2DJZA 1WHMA 4C8QF 4C8QG 3RBBB 1LVKA 4JZ3A 3GIBA 2WSEE 1YJNQ 4NL3A 3GBQA 2O88A 1O9SA 5C0MA 2YT6A 4J9GA 2KXDA 2O2OA 1KHCA 4BDYA 2O4XA 2B86A 1XTDA 3MEUA 2JUFA 1D3BA 3M5AA 3L1AA 3OYJA 3EG0A 2CREA 1VQKT 2Y90A 3CC7T 2EW3A 3CCMQ 1K0XA 2W0ZA 2YRDA 4HT9A 2LQNA 3HRSA 1YI2Q 3OMGA 1QWFA 1HJDA 1LNXA 2FPDA 1QKWA 4M78D 1IHWA 1YIJA 1RUWA 1YJ9A 1VQ6A 3MPUB 3EGDB 1FWZA 4IIMA 1IGUA 1O75A 4AFSC 1S72T 2FPFA 1PSFA 2PVGB 1SEMA 3MHXA 2RM4A 1PRMC 1K9MR 3MEWA 2C0TA 3CC4T 2Y4YA 1KIKA 1SF9A 4QVZA 2J06A 1GCQA 1X43A 2DA9A 2QQ9A 3OYDA 4E7HA 1WDXA 1H3HA 1MMNA 4ZTFA 2DL8A 4M7DE 4KULA 1CKBA 1BIBA 1UJYA 2GGRA 2EJ9A 2RI3A 2RQWA 2HSEB 2DVEA 3CXCP 2RH2A 5IXFA 3M56A 3UWNA 1NLPC 2BIVA 3QBYA 2YUQA 4HXJA 3THKA 1Q82C 2VV5A 3CMET 2BZYA 4MZPA 1KC8R 3L2UA 2QQSA 3IQLA 2CUDA 4EPCA 4PJMA 4WTOB 1BBZA 5GAMh 1YHQA 4OMOA 4M7AE 2CP6A 3C12A 1VQOT 4M7AC 3CCSQ 4CC7A 3M55A 2LDMA 3JCMd 5CO7A 3I5SA 1QVFS 2EKHA 3A5ZB 1BIAA 2QYZA 1AWJA 3A8MB 1M2VA 4ELZC 2FO0A 1ZX6A 2XK0A 4N0AC 3MO8A 4LUEA 2LJ3A 2NYSA 3JRZA 1M4ZA 3VS7A 3QZ9B 2K79A 5GAOr 2KRSA 4X34A 1PG5B 4EMKA 4QKUA 4BY6B 4J6XA 2XKOC 5KYYB 4C8QA 3G4ST 4F16A 5LJ3f 2L89A 2ENMA 3BFMA 9ATCB 4HT8A 2E1HA 2PVDB 1UJ0A 4XU3A 1B34B 3OYMA 1K8AR 5GMKi 3MP8A 2D6FA 1QVGS 3FEOA 3EG9A 3CMAA 3DB3A 1UFFA 1N27A 2K5IA 4ME7A 4Y28E 4KH1B 4FSXA 3CPFA 1PRLC 2P0QA 1WGSA 1HK9A 2G3RA 4M77B 1YJWA 4E2FB 1VQMT 3HKSA 4M4ZA 1PD1A 1E7OA 4D8DA 3U23A 1VQNT 1LCKA 2DBKA 5LJ3j 1N5ZA 1EIFA 3GF5A 5GANe 1QW1A 4MZMA 2PUKB 2FB7A 3O5ZA 3LWIA 4M75D 2RHUA 2X35A 4F7UF 1ZQ1A 1N8RU 3VS6A 3RKXA 4V2SA 4JZ4A 1MUZA 4ZN1A 4BUGA 2GTOA 4OMLA 2GFAA 1SSFA 2DTIA 1VQPQ 1VYUA 4CRIA 1M5Q1 2VASA 2ZGWA 3QDRB 4UC4A 3EG2A 2JM9A 2JMCA 1OV3A 4M78F 5A2QE 2CT4A 2CZ6B 4M78G 2GNCA 4OMNA 3CCVQ 4OF1A 4ELYC 2W10A 1BU1A 2O01E 2OTJT 5GAMf 2VB6A 3G1JA 2DIQA 2O31A 2XDBA 4PFOA 2EFIA 4EDUA 1YJNA 3OY9A 4RTYA 1SRMA 3EG9B 2AHJB 4JJNK 1PNJA 3WVEB 2VGNA 5IAYA 1K1ZA 2E5QA 3OYYA 3URGA 4J8OA 4C92D 1VYTA 3CCET 1KQ1A 1T3SA 2VC8A 1SPKA 1Y71A 5GMKh 1MGQA 3QO3A 1DJ7B 1IB8A 3CD6Q 1NBEB 1OULA 4II1A 3VKIA 1M1KU 3M0QA 4J7FA 1YWOA 5CKHA 3CCJQ 2COWA 2RJCA 2EYQA 4DOVA 2RQRA 4P5NA 1CKAA 4XTWA 5LJ5f 2DERA 2LRQA 2F2WA 2PZ1A 3ZL7C 5FU6B 4RMOA 2E64A 2RHZA 1NEGA 2K5LA 3SD4A 2ABLA 2OTLA 1Q81C 1QCNA 3M54A 1M1GA 3VRYA 2XMFA 5CKDA 4JS5A 1WXUA 1G8XA 2L0AA 3PIPA 3J7AF 3ZBDA 1ZA2B 2R58A 1AZEA 2LZ6B 2COZA 5J3BA 1M3CA 1U1SA 3S6WA 1VQLA 4PJOC 3R6NA 3EG1A 3HRTA 1SSHA 3L2WA 1D1BA 3CQTA 1D0XA 3OS1A 3GPLA 1QVFP 2M0YA 5LJ5j 3CCRQ 4J7IA 2V8KA 3QWYA 3CCLT 2QASA 4B6MA 1EFNA 1LPLA 1AD5A 3JCMX 2LCSA 1UGSB 1E6HA 1Q82R 4RTVA 2GF7A 4RTWA 2JM8A 3KXTA 2BE9B 4FSSA 4C0GA 5FU7C 2EGEA 2QGFB 1JJ2A 1YIJQ 3FRNA 4XK8E 2PNIA 1BI0A 1VQ6Q 3RMSA 4M78A 4FU6A 1WXTA 3BDLA 1MHNA 1X01A 1XNIA 4EMGA 4FT2A 1VQ7T 5IH2A 1OOTA 1KHIA 1QVGP 3V8JA 4C0ZA 1K73R 1IGQA 3TQ7P 2AK5A 3I35A 2MF2A 4J6WA 3BE3A 2OX7A 2JZ2A 3H6ZA 5HCKA 2OJ2A 2LX7A 1SHFA 2K3XA 2EYYA 2NUTA 5IHNA 5IXBA 3CBPA 2HCKA 1M9SA 2DE0X 4M75G 2EYZA 4PJLA 3JCMV 1UEBA 2M16A 1VQKA 1AWWA 2AKKA 3PMTA 4BE2A 2L2PA 2DILA 1AT1B 4M77E 2HQEA 1RAAB 4M77C 2XDPA 1D09B 1Z9QA 3TSWA 3QUIA 2DTOA 3RR6A 5GAN7 2DBMA 1G2BA 2ZPBB 2LT4A 1YHQQ 5KYUB 1M90R 3JCMf 4FCYA 5DLQE 1VYVA 2CGHA 3L2ZA 3C4SA 1YCYA 4PJOF 4HCKA 4X9CA 3RKYA 3QSUA 1RAGB 2E3HA 2JNGA 3E9FA 1IHVA 3MP6A 3REAB 1G83A 4C92F 1X6BA 2DZCA 3SWNC 4FYYB 1M27C 4C92G 2DLPA 5CCAA 4RTUA 5LJ3g 1M1FA 2HDAA 2E10A 2VGMA 3QIIA 3JCMc 4KT0E 2YUNA 3CCMT 2YLCA 1S1NA 2GTJA 5CQYA 1T0HA 1SRLA 1PM3A 3V7CA 5GAMd 2RF0A 3CMAQ 3EHRA 3WVDB 5KYXB 1UB4A 1UGQB 3HTRA 3MKDA 2DJQA 1M1KC 4DBQA 3PTAA 2XDDA 3DLMA 8ATCB 5GMKe 3H9NA 3FJ5A 4OB2B 1WJSA 5GAN2 4E6RA 1YJWQ 3CD6A 4Z88A 1UGPB 1MMAA 2QI2A 2HEQA 2DETA 5GAN5 5HK3A 2LMJA 2VUBA 1T0JA 2F1LA 1ZHIA 2NUPB 4J6YA 2DEUA 2QTVA 2RPNA 4DOWA 5FU6C 3JCMJ 1X2QA 3X28B 3N5BB 4QVCA 2E41A 1Q7YU 1TUGB 1QP3A 5GANh 1FX7A 1A0NB 4ORZA 2AZSA 4M75A 4A4HA 5FWBA 3VUZA 5KYWB 3S3OA 1QQJA 3PFSA 1WYXA 2LTOA 3X24B 1KQ2A 4LDYA 2ZZDA 2CP7A 1Q81R 3M53A 2QDLA 3OYFA 2KY9A 5C6SA 1WQ7A 2QA4T 3CCST 4RTZA 3JB9I 3OYKA 2O9VA 2QGGA 4KGVB 5D6WA 2ROTA 1BI3A 4BD3A 2DKGA 1GCPA 5CKEA 2LJ0A 1WPYA 4FYXB 2EWNA 2X4XA 3CCRA 2FZGB 2X4WA 4X1VA 1KG1A 3VS4A 5GAN3 4N4IA 3HFNA 1KSWA 4C92A 1AOJA 1R0CB 2EQUA 5LJ5g 1HYOA 1Q86U 3LH5A 2A28A 4NL2A 4M7AD 1VIFA 5FROA 4AMCA 1MV0B 1BB9A 2GFUA 2MWPA 2JOYA 3RNJA 5L23A 1Y07A 1KD1C 3S3MA 2YLBA 1RACB 1VQ9Q 4ZGEB 2OTLQ 4KH0B 2WSFE 2CH4A 2JMAA 2DF6A 1Y0MA 1K4US 2QQAA 3RMQA 1QMCA 2AKLA 4C5HA 4CC2A 2M0OA 4M75B 1RADB 2RQVA 2E6ZA 3NTHA 3AHUA 2D8JA 1U06A 4JLGA 4RG8A 4E7SA 3QG1A 4ZGDB 4M7DC 5GJWB 1IREB 1I0CA 2D0QB 1SG5A 1Q95G 3E19A 1VQLQ 4MDWA 2DIGA 5FW9A 1BCMA 2JS0A 1KQSA 3VYGA 1VQ4A 2X4JA 2CSIA 3X25B 4R55A 1YBYA 3RIRA 4B9XA 3T9NA 2BZ8A 3CCQA 2K6DA 3CCUT 3DKMA 3CC2A 3KFVA 3RERA 1UG1A 1ARKA 2IG0A 2YSQA 4BI4A 1VQPT 4XTZA 2CP3A 4MDXA 3ME9A 2O4XB 1TG0A 1WI7A 4IUPA 1D3BB 5LL6S 2X51A 3X26B 5IT9E 1N9SA 2L5QA 4C5GA 1QKXA 3EFOA 1F1BB 4C92B 4DQ2A 3CCVT 2CT3A 2P0KA 5KYNA 3MCAB 3QZ5B 3TREA 2VXFA 3JB9F 1XJWB 2AIRB 2HMAA 3X20B 3GP8A 2AZVA 3VS1A 1YITA 3OMCA 3GOXA 1WXBA 4FW1A 3VUBA 1ABOA 2LX9A 1HXDA 3I55Q 3QXEB 5FWCA 1WX6A 4KBMB 4NOYA 3BW1A 1NPRA 3SWNA 2RNAA 1I8FA 2CZ0B 1ZSZA 1LOJA 2CYZB 5A0GA 3CCJT 2IIMA 3SEMA 3SHWA 4LDVA 1WHKA 1M3AA 2HAXA 1Z9ZA 2LCLA 3LH0A 2DEQA 2FPEA 5A0DA 3NFCA 4OP0A 4ZN3A 1VQKQ 1PKTA 1I4K1 2ED1A 1NYGA 3P8DA 2F2VA 4J9BA 1WHGA 4L5GA 4XAXB 2DX1A 1LJOA 1EX4A 2EIFA 3QKJA 1QCFA 4PL6A 2NLUA 4KGZB 2ZPEB 1M1KR 3I5RA 1NZ9A 3G71T 1OEBA 2CP5A 4ZNXA 3JCMg 2MIOA 3NPFA 1TSFA 1Q7YC 2J05A 1N6AA 2FZKB 3JV3A 2PU9B 3FB9A 1WZOA 1GBQA 1W1FA 2DPPB 5I2MA 2FEIA 3I9QA 3CC4Q 2DXTA 1W70A 4HKEA 2CZ7B 2DM1A 1X6OA 3OYGA 4PJJA 3L2RA 1KC8U 4XU1A 3M0TA 5FRMA 2ZAEA 1M2VB 3OYIA 4F7UG 1D0YA 1U3OA 2EQIA 4FM4B 1H8KA 1PKSA 2MAMA 5I2SA 3JCMQ 3UF4A 2COYA 4GLMA 3VJPA 3KBGA 4JRPA 1IRXA 4EMKB 2HL5C 5A0LA 4M7AF 4XTYA 4C8QB 4M7AG 3EFSA 3A1PA 2M51A 3E2UA 3M9QA 1ZLMA 3CPWA 2L3QA 2HBPA 2HZYA 3EGUA 4DBRA 1YJ9T 2DL7A 4ZGJB 1EZZB 3LGLA 4PJOD 5GMKl 1VQ6T 1X6GA 1X27A 4E7ZA 2HKQB 3H0IA 3INZA 4X9DA 5FRNA 1UECA 5GAN6 1K8AU 4PLLA 2RJDA 1ACMB 4BE1A 1W2BA 1Y7XA 1GXIE 4N4HA 3ZEHA 4DEYA 3SDZA 1D1AA 3UT1A 2CDTA 1BK2A 1JEGA 1UUEA 1QVPA 1TWBA 2D0NA 2JXBA 4PK4A 1C6VX 1VQ9A 5GAMj 1TOVA 1SKUB 1I5OB 2QAZA 2KYMA 1QLYA 5GMKm 1VUBA 3HHTB 1Y96A 3OYAA 4M75E 3I56A 4N4GA 1GRIA 1KD1R 2DYIA 4ATOA 4IIOA 2RI5A 1JBMA 1KFZA 2JS2A 3GLXA 1UGRB 1QCOA 2FRWA 4RKUE 3OA6A 4Z8AA 3QHSA 3UDCA 3NTIA 3EG3A 5ECAA 3F70A 3TCJA 1JJ2S 2LP5A 2JVVA 3FJPA 2J6KA 2FRYA 4F14A 4L6V5 5CVIA 4GY5A 3JB9J 3G6ET 2QQRA 4A53A 1YWPA 1JB0E 2HQHA 2K2VA 3BY7A 3MEVA 4KUIA 2JTEA 4M77D 5GANd 1X75C 4R0KA 1G5VA 3EAEA 3M4YA 4AFQC 4F7UA 2E65A 4C92E 1NJIU 2DK3A 1C1AA 2FVUA 3V8LA 2EPDA
chains in the Genus database with same CATH topology
4OB2B 1RL2A 2DD5A 4ZTFA 1G3WA 3C94A 3PNWC 3OYHA 4JRQA 4M7DE 1WJSA 5GAN2 1VQ5A 3CMAT 4KULA 3OYCA 3CD6A 3JSCA 1OZ2A 4M7DF 1UGPB 4A4KA 2QI2A 4M7AA 1BIBA 2ZPIB 2RD1A 3SWNB 2QA4A 2EJ9A 2RI3A 5GAN5 2F5TX 2P4TA 3PGGA 4BY6C 1BKBA 2HNIA 3I55A 3EFRA 5HK3A 2EKOA 2VUBA 1YIJT 2DVEA 2E12A 1ZHIA 2KMTA 1H641 4J6YA 2RH2A 4N0AA 3M56A 1NE8A 3UWNA 3HSBA 1YJWT 4J83A 2BIVA 4BDZA 3QBYA 4DOWA 2EJFA 1G3SA 1Q82C 1Y96B 2DAQA 2VV5A 5FU6C 3RESA 5KE2A 3JCMJ 1R8OB 3CMET 5CQXA 3X28B 2VXEA 2DXCA 1Q86C 4MZPA 2KVQG 3N5BB 3L2UA 2D9TA 2QQSA 4QVCA 2E41A 2QEXT 1Q7YU 1VQ8A 4M7AD 4EPCA 1QP3A 5LJ3e 5GANh 5LJ5e 2CZ1B 2QQBA 1FX7A 5GAMh 1YHQA 5GAOq 4FT4A 4M7AE 4M75A 3C12A 2RK2A 4OB1B 3VUZA 4A4HA 3S3OA 1VQOT 4M7AC 3M55A 2LDMA 3JCMd 3CC7A 4TVRA 5CO7A 1WJQA 3PFSA 3OW2A 1QVFS 2DXBA 2LTOA 2RO0A 3A5ZB 1BIAA 3M57A 3X24B 5GAN4 4IKFA 2Y4XA 1KQ2A 4LDYA 3A8MB 2ZZDA 1VQ5T 4ELZC 2R5MA 2LQ8A 3A8HB 2XK0A 3M53A 4LD9K 4N0AC 3MO8A 3OYFA 3ZFJA 2KY9A 3OBYA 5C6SA 1WQ7A 2QA4T 3CCST 3JRZA 1M4ZA 3JB9I 3OYKA 3QZ9B 4R56A 3FLGA 5D6WA 3CCMA 5GAOr 1VQ4T 4X34A 2EQKA 1OZ3A 2QDYB 1P92A 2RHYA 1S72A 1BI3A 4EMKA 1YI2A 1WJRA 4BD3A 1RI0A 4BY6B 1KC8C 4J6XA 3CCQT 2XKOC 4KUDK 4C8QA 3G4ST 2R5AA 1W4SA 3CC2T 2DKGA 5DLOA 4M75C 2L89A 5LJ3f 1N8RC 5CKEA 3CC4A 2YHTA 1U1TA 3BFMA 4F7UB 2A3LA 1WPYA 2XU8A 1VQ8T 4HT8A 2EWNA 2X4XA 4PJOG 3CCRA 2E1HA 3FDRA 2PVDB 4QQGA 2A7YA 3JCMW 2WACA 4E7IA 4XU3A 1I5LA 5GAOp 2X4YA 2X4WA 4JLIA 1YHQT 1B34B 3OYMA 4JRIA 3A8GB 2DTHA 5GMKi 1KG1A 3MP8A 2D6FA 1YJNT 2MI6A 2K3YA 4B9WA 3TEEA 5GAN3 1QVGS 3FEOA 1V29B 3HFNA 4N4IA 4C92A 3CMAA 3DB3A 2BKDN 3JCMh 1Q82U 4IURA 4WF2A 5HKCA 1N27A 4M78B 2K5IA 4E7JA 2EQUA 4ME7A 5LJ5g 4JS4A 2JN0A 2OAUA 4Y28E 3O8VA 3JCMb 1Q86U 3CBMA 5CKBA 2HQXA 4EMKC 1OYXA 3CPFA 4FSXA 4BI3A 1VIEA 3HRUA 4IUUA 2P0QA 4NL2A 1WGSA 1VIFA 4C8QE 4C8QC 5FROA 5CR2A 3WXMB 4M7DA 3SB2A 1HK9A 2GFUA 2MWPA 1YITT 3V7RA 1QP2A 2JOYA 2HD0A 2G3RA 2KQWA 4M77B 4LD6A 1YJWA 2FHDA 4HA8A 3UPUA 1FXXA 1VQMT 3CCUA 2RK1A 3HKSA 1Y07A 1YI2T 1KD1C 3S3MA 2YLBA 4EMHA 4PJOE 2GQVA 3CMEA 3OS5A 2MMPA 4ZGEB 1JRIA 3LWHA 2WSFE 1VQNT 2EQMA 3M58A 4LDWA 4PLIA 2QQAA 3RMQA 4C92C 5LJ3j 4C5HA 3OYNA 1EIFA 3GF5A 3HP9A 2M0OA 5GANe 1VQOA 4M75B 1K73U 3L2VA 2E6ZA 1QW1A 4MZMA 3NTHA 2PUKB 2FB7A 5GAMe 3JB9D 3AHUA 3CXCA 4JLGA 2OTLT 4RG8A 3LWIA 2BUDA 2L3RA 2VYTA 3E9GA 4M75D 4DA4A 2RHUA 3OW2S 2C06A 3QG1A 4ZGDB 4M7DC 2X35A 2EJGA 1IREB 2D0QB 4F7UF 1ZQ1A 4BI8B 4C5EA 1N8RU 1IZ6A 3E19A 3RKXA 5CIUA 4V2SA 5GAOm 4QQ6A 5HY6A 4RCBA 4MDWA 2DIGA 3G7ZA 4OGCA 4ZN1A 3CCSA 4BUGA 1KQSA 2GFAA 3VYGA 1SSFA 2DTIA 1VQ4A 1M8VA 1AHJB 2V8JA 2X4JA 4CRIA 3OS0A 4C0DC 2ZPFB 5DY9A 3GNGA 3X25B 4R55A 1M5Q1 3DLLA 1YBYA 2ZGWA 3RIRA 4B9XA 2KAFA 3QDRB 3T9NA 2K57A 4UC4A 3CCQA 3Q1JA 2B8AA 4GLKA 3G4SA 3VV0A 5A2QE 3DKMA 4M78F 5CAIA 3CCUT 1K9MC 3CC2A 1VQLT 2CZ6B 4M78G 3OQ5A 3RERA 2IG0A 4BI4A 2JTFA 2PUOB 4IUQA 4OF1A 1VQPT 1WQWA 4J5YA 4XTZA 4C8QD 4ELYC 4HCBA 4MDXA 3BDUA 3ME9A 3A8LB 2O4XB 2OTJT 2O01E 2LNVA 5GAMf 3NTKA 4HCZA 4IUPA 2DIQA 4M77F 1BI1A 1D3BB 1M90U 2XDBA 5LL6S 4M77G 4E7LA 4XU0A 3X26B 3P8BB 4O6JA 4OB0B 2EFIA 5IT9E 1N9SA 4EDUA 2L5QA 4C5GA 1YJNA 4YTLA 3OY9A 2XD0A 5LJ3d 5FLXE 1G3TA 4C92B 2AHJB 4JJNK 3QYGB 1TH7A 4DQ2A 3WVEB 2VGNA 5IAYA 3CCVT 2E5QA 2P0KA 4MMLA 1KD1U 3MCAB 2LC4A 3QZ5B 3OYYA 3TREA 5KCOA 2VXFA 3JAME 3URGA 3RUXA 3JB9F 4J8OA 4MMKA 4C92D 3JCMe 3CCET 1KQ1A 2VC8A 5GANg 2K4YA 3X20B 1Y71A 4M75F 5GMKh 1MGQA 3QO3A 1DJ7B 5L8RE 4A4FA 5GAMg 3GP8A 2RHXA 2XHCA 4II1A 4M7DB 3VKIA 1YITA 1M1KU 3OMCA 3GOXA 4HCCA 4JUVA 4J7FA 5CKHA 3VUBA 2LX9A 3A8OB 2RB6A 5M9OA 2RJCA 1VQMA 4M7DD 1HXDA 3QXEB 2EYQA 4JRKA 3M4GA 2F5KA 4DOVA 1N9RA 4P5NA 4LDUA 4KBMB 5AYFA 4NOYA 3BW1A 1VQNA 1I81A 3VU3C 4XTWA 5LJ5f 1NPRA 4BE0A 2ZPHB 2WSCE 5D6XA 2QXFA 2CKKA 2PQWA 2LRQA 3SWNA 1I8FA 2CZ0B 5KE3A 2E6NA 1LOJA 2CYZB 3QYHB 5A0GA 3CCJT 5D6YA 1NJIC 4PJOA 5FU6B 2DZ9A 4XTXA 2E64A 4RMOA 1U8RA 2RHZA 2M1HA 4OVAA 2K5LA 3OB9A 3SD4A 2EAYA 4LDVA 5GMKj 2HAXA 2OTLA 2DD4A 2XIDA 1Q81C 2LCLA 3CBOA 3LH0A 2DEQA 3M54A 1M1GA 4IUTA 5A0DA 5CKDA 3CXCS 2RA2A 3NFCA 4OP0A 4ZN3A 4JS5A 2LT1A 4M7AB 5LJ3h 1I4K1 5GAOl 3P8DA 3MEAA 3PIPA 3J7AF 3LLRA 4L5GA 3OYLA 4XAXB 1LJOA 3META 3ZBDA 2EIFA 2MWOA 3QKJA 4E7KA 2R58A 3OSVA 4PL6A 1KQSS 1ZBXA 5J3BA 2NLUA 4CI0C 5KCHA 2DXUA 2LVMA 1U1SA 2ZPEB 4Y91A 3S6WA 1NZ9A 1VQLA 3J81E 4A4GA 2PVOB 3JCMg 3G71T 4D6WA 4PJOC 4PNOA 3HRTA 1VQPA 3L2WA 3RKWA 1Q7YC 1N6AA 1K8AC 2PU9B 2OTJA 2ZCFB 3FB9A 3VYHB 1XQHA 3OS1A 4QVDA 5I21A 3GPLA 2DPPB 5I2MA 3M59A 5CK9A 3MP1A 5LJ5j 2DXTA 4QW2A 4HKEA 2KK4A 4IUVA 2CZ7B 5HK0A 1X6OA 4J7IA 3OYGA 2V8KA 4BB7A 1VQ9T 4A4EA 3CCLT 3R6OA 5J26A 3CEYA 3CCVA 3L2RA 2YRVA 1PSEA 2H3JA 4XU1A 1KC8U 3JCMP 5FRMA 2RHIA 3OYIA 3JCMX 3L2QA 3I56T 4F7UG 3CCEA 1UGSB 3LX7A 3LW5E 2GF7A 4FM4B 2RI2A 2MAMA 3QJYA 5I2SA 3KXTA 3JCMQ 4C0GA 5FU7C 5KH6A 3J80E 1B34A 3VJPA 3KBGA 3LYIA 4JRPA 1JJ2A 4EMKB 1Q81U 5A0LA 4M7AF 4XTYA 2IVWA 4C8QB 3FRNA 4M7AG 4XK8E 3EFSA 5GAN8 1BI0A 3QPHA 2F69A 3RMSA 4M78A 4FU6A 3BDLA 3M9QA 3ER0A 1MHNA 1X01A 3CPWA 1XNIA 5GANf 4XTUA 4EMGA 3CCJA 4FT2A 1VQ7T 2M9UA 4PJOB 1BI2A 2HBPA 1KHIA 4O5VA 3JB9H 3V8JA 4QQDA 1XOVA 1YJ9T 4E47A 4ZGJB 3LGLA 4F7UE 4M77A 4PJOD 5GMKl 4C0ZA 1VQ6T 5GAOn 4XU2A 3OYBA 4NS5A 5LJ5d 4PKCC 4FL6A 4VUBA 2MF2A 4J6WA 2FYKA 2JZ2A 2ZPGB 2V8IA 3H6ZA 3INZA 4X9DA 5FRNA 3OSSC 2K5FA 2FL7A 5CKFA 2K3XA 3JB9G 5GAN6 2RJEA 2GCXA 3FC3A 1K8AU 4PLLA 3OYEA 3KUFA 5DM7R 3PIOA 2RJDA 3CBPA 4M75G 1M9SA 1NPPA 4RCCA 4BACA 1Y7XA 3E1SA 4BE1A 1W2BA 4M78E 3JCMV 1UEBA 2XG8D 4M78C 4Q5WA 2M16A 1VQKA 4N4HA 2KSSA 3ASKA 1H3ZA 1GXIE 1G3YA 3ZEHA 4LDXA 4XQ3A 3GNFB 5IN1A 3SDZA 3UT1A 3G71A 3OS2A 3V8KA 4C0FA 3PMTA 5FU7B 4BE2A 4C0DB 4MZTA 3CD6T 2EQJA 3QJ6A 4M77E 2HQEA 3PMIA 4M77C 2XDPA 3FIFA 3G6EA 4ZTJA 1QVPA 2DTOA 3QUIA 3V7SA 4L59A 2DO3A 5GAN7 4FIBA 3P8HA 3I55T 2CS7A 4JDSA 4OMFB 1K73C 3S3NA 4C5IA 5GANj 3OBWA 2ZPBB 2LT4A 2DJZA 1VQ9A 3CCLA 4C8QF 3HPWA 5GAMj 4C8QG 3H8ZA 5GMKm 1VUBA 3HHTB 1K9MU 3JCMf 3GIBA 2WSEE 1Y96A 5DLQE 3DB4A 3OYAA 2LCCA 4M75E 5J39A 3I56A 2CGHA 4NL3A 4N4GA 5EG2A 3TU4K 1O9SA 3L2ZA 3C4SA 1YCYA 5C0MA 5LJ5h 4PJOF 4ATOA 1KHCA 1JBMA 2RI5A 4X9CA 3RKYA 4BDYA 3QSUA 2XI9A 2O4XA 1XTDA 3MEUA 2JNGA 3E9FA 3GLXA 3HL8A 2I2LA 1QVFA 2JUFA 1UGRB 1D3BA 4A54A 4RKUE 3M5AA 3MP6A 3OA6A 3L1AA 3OYJA 4C92F 3QHSA 3UDCA 1VQKT 2Y90A 3CC7T 2DZCA 3NTIA 3SWNC 4C92G 2KDSA 4Z02A 3F70A 2P0PA 3TCJA 1JJ2S 2JVVA 5CCAA 3LGFA 4HT9A 3FJPA 5LJ3g 3HRSA 4L6V5 3OMGA 1M1FA 1WNLA 5CVIA 2E10A 2QTXA 3HFOA 2VGMA 1LNXA 3PT9A 4GY5A 3JB9J 3QIIA 3G6ET 1VQ7A 3JCMc 4M7DG 4KT0E 4XTVA 1BYMA 4M78D 3CPWS 2QQRA 1YIJA 4A53A 1M90C 1YJ9A 3CCMT 2L8DA 1JB0E 2K2VA 3SFMA 2YLCA 1VQ6A 3BY7A 1FWZA 3C95A 1O75A 1S72T 1PSFA 2PVGB 3MEVA 4KUIA 5CQYA 2R57A 3L42A 3MHXA 5GANd 4M77D 1X75C 3V7CA 2RM4A 5GAMd 2QEXA 1G5VA 3EAEA 3MEWA 1OI1A 3M4YA 3CC4T 2RJFA 2Y4YA 4F7UA 4RG2A 2E65A 3WVDB 1UB4A 4QVZA 1UGQB 4OGEA 4C92E 3CCRT 1NJIU 2DK3A 1M1KC 4OB3B 2E70A 2LQKA 3DLMA 2QQ9A 2FVUA 2XDDA 2XICA 3OYDA 3PTAA 4E7HA 5GMKe 2JTMA 3V8LA 1QVGA 1W2BS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6W A;  4M7D A;  3SB2 A;  2FYK A;  3SWN A;  1HK9 A;  1I8F A;  3V7R A;  1LOJ A;  3INZ A;  4X9D A;  4M7D E;  5GAN 2;  4M77 B;  4PJO A;  2DZ9 A;  4XTX A;  2E64 A;  3JB9 G;  4HA8 A;  5GAN 6;  4M7A A;  2EAY A;  4PJO E;  1BIB A;  2YLB A;  4EMH A;  4M75 G;  5GMK j;  4RCC A;  2RD1 A;  3SWN B;  2EJ9 A;  5GAN 5;  3PGG A;  1JRI A;  4M78 E;  3JCM V;  4M78 C;  2DEQ A;  2HNI A;  2RA2 A;  3EFR A;  4OP0 A;  4XQ3 A;  2DVE A;  4M7A B;  5LJ3 h;  1I4K 1;  5GAO l;  4C92 C;  1H64 1;  4J6Y A;  3V8K A;  4N0A A;  5LJ3 j;  3HSB A;  5GAN e;  4M75 B;  2EJF A;  1LJO A;  5GAM e;  2FB7 A;  3JB9 D;  4M77 E;  3AHU A;  1Y96 B;  4M77 C;  3RES A;  3JCM J;  3FIF A;  3QUI A;  2DTO A;  2VXE A;  4M75 D;  3V7S A;  2DXU A;  1U1S A;  4M7D C;  4QVC A;  2E41 A;  5GAN 7;  4M7A D;  2EJG A;  4Y91 A;  4F7U F;  5LJ3 e;  5GAN h;  5LJ5 e;  5GAN j;  5GAM h;  2DJZ A;  3RKX A;  4PJO C;  3JCM g;  4C8Q F;  5GAO q;  4V2S A;  5GAM j;  5GAO m;  4RCB A;  4PNO A;  4C8Q G;  4M7A E;  4M75 A;  4M7A C;  5GMK m;  4M7A G;  3JCM d;  2DTI A;  3RKW A;  3JCM f;  3GIB A;  1M8V A;  1Y96 A;  4M75 E;  2CGH A;  3FB9 A;  5DY9 A;  4NL3 A;  1BIA A;  3L2Z A;  1M5Q 1;  1YCY A;  5LJ5 h;  5GAN 4;  4QVD A;  5I21 A;  1KQ2 A;  2ZGW A;  4PJO F;  3RIR A;  5LJ5 j;  2DXT A;  1JBM A;  4X9C A;  3RKY A;  2K57 A;  3QSU A;  4M78 F;  4N0A C;  5CAI A;  4M78 G;  1WQ7 A;  2I2L A;  3RER A;  4A54 A;  1D3B A;  3JB9 I;  3L1A A;  4XU1 A;  4C92 F;  3JCM P;  1WQW A;  3QHS A;  4J5Y A;  4XTZ A;  2Y90 A;  4C8Q D;  2DZC A;  3SWN C;  3BDU A;  4C92 G;  3JCM X;  5GAO r;  4F7U G;  5GAM f;  4HT9 A;  3FJP A;  4M77 F;  4EMK A;  1D3B B;  5LJ3 g;  4M77 G;  4XU0 A;  4J6X A;  3JCM Q;  1N9S A;  4C8Q A;  1WNL A;  2E10 A;  2QTX A;  3HFO A;  4M7D F;  1LNX A;  1B34 A;  2DKG A;  4M75 C;  5LJ3 f;  5LJ3 d;  3JB9 J;  3JCM c;  4C92 B;  4XTV A;  4M7D G;  4DQ2 A;  1TH7 A;  2YHT A;  4M78 D;  5LJ5 f;  1U1T A;  3BFM A;  4MML A;  4F7U B;  4EMK B;  1WPY A;  4A53 A;  4HT8 A;  2EWN A;  4PJO G;  2E1H A;  2VXF A;  1I5L A;  3JCM W;  3RUX A;  4XTY A;  4C8Q B;  4XU3 A;  3JB9 F;  4C92 D;  4MMK A;  3JCM e;  2YLC A;  5GAO p;  1KQ1 A;  3EFS A;  4JLI A;  1B34 B;  5GAN 8;  2VC8 A;  3BY7 A;  4JRI A;  5GAN g;  2DTH A;  5GMK i;  4M75 F;  5GMK h;  1MGQ A;  3QO3 A;  4M78 A;  5GAM g;  4M7A F;  4M7D B;  1X01 A;  5GAN d;  4M77 D;  5GAN f;  4XTU A;  4EMG A;  5GAN 3;  3HFN A;  3V7C A;  2RM4 A;  4JUV A;  5GAM d;  4C92 A;  4PJO B;  2RB6 A;  3JCM h;  3JB9 H;  4WF2 A;  4F7U A;  1HXD A;  4M7D D;  2E65 A;  3V8J A;  4JRK A;  4M78 B;  4C92 E;  3M4G A;  5LJ5 g;  1N9R A;  2JN0 A;  3JCM b;  4F7U E;  4M77 A;  4PJO D;  5GMK l;  4EMK C;  5GAO n;  4XU2 A;  4NOY A;  3BW1 A;  5GMK e;  1I81 A;  3VU3 C;  4XTW A;  4NL2 A;  3V8L A;  4C8Q E;  5LJ5 d;  4C8Q C; 
#chains in the Genus database with same CATH topology
 2RQT A;  1G3W A;  3C94 A;  3PNW C;  2V1Q A;  4JRQ A;  3CMA T;  3PVQ A;  2KBT A;  2GQI A;  4M7A A;  1YN8 A;  2ZPI B;  2RD1 A;  2QA4 A;  1JO8 A;  2P4T A;  3H0H A;  4BY6 C;  1BKB A;  2HNI A;  3I55 A;  3EFR A;  2EKO A;  1E6G A;  2E12 A;  1WA7 A;  2VKN A;  1H64 1;  4N0A A;  4GBQ A;  4PFP A;  4FYV B;  1YJW T;  4J83 A;  1GCQ C;  1Y96 B;  2DAQ A;  5KE2 A;  2JT4 A;  2L3S A;  1R8O B;  2V1R A;  2DXC A;  2J6F A;  2D9T A;  2QEX T;  2YUO A;  2CSQ A;  5LJ5 e;  2CZ1 B;  5GAO q;  2RK2 A;  3CC7 A;  1WJQ A;  1YCS B;  3OW2 A;  2RO0 A;  1VQ4 Q;  3M57 A;  4IKF A;  1VQ5 T;  3A8H B;  1JXO A;  3EGX A;  3CCQ Q;  3ZFJ A;  3CC2 Q;  4J9C A;  4KRT A;  2AT1 B;  2EQK A;  1OZ3 A;  2QDY B;  1H92 A;  1S72 A;  5IHI A;  1KC8 C;  4KUD K;  1HSQ A;  1W4S A;  1N8R C;  3CC4 A;  2YHT A;  2C0O A;  4F7U B;  1VQ8 T;  4PJO G;  1K9A A;  3JCM W;  2A7Y A;  2WAC A;  4JLI A;  1Q7Y R;  4JRI A;  3A8G B;  2O9S A;  1YJN T;  2MI6 A;  2K3Y A;  4LE9 A;  3TEE A;  1YIT Q;  1WHH A;  1Q82 U;  4WF2 A;  2KXC A;  4M78 B;  2HQX A;  4EMK C;  1OYX A;  1VIE A;  3HRU A;  4C8Q E;  4C8Q C;  1W6X A;  5CR2 A;  3WXM B;  3SB2 A;  1GFD A;  4F17 A;  3PE0 A;  2RN8 A;  3V7R A;  1QP2 A;  2HD0 A;  2KQW A;  4LD6 A;  2FHD A;  4HA8 A;  3UPU A;  1FXX A;  3CCU A;  1YI2 T;  3CME A;  2KI7 A;  3OS5 A;  3CCL Q;  2MMP A;  1JRI A;  2BTT A;  2DFU A;  2NUT B;  4PLI A;  1GBR A;  2I0N A;  4PJN A;  3OYN A;  1VQO A;  1K73 U;  3L2V A;  4LXC A;  3JB9 D;  3CXC A;  2X3X D;  2OTL T;  3E9G A;  2VYT A;  2C06 A;  1NEB A;  1R77 A;  1MNE A;  4WCI A;  3H41 A;  4JPB W;  4JJC A;  4BI8 B;  4C5E A;  2MOX A;  1IZ6 A;  5CIU A;  1RLQ C;  5GAO m;  3G7Z A;  4EIK A;  1M8V A;  3OS0 A;  1FMV A;  2RMO A;  2ZPF B;  5DY9 A;  1OU9 A;  1PC0 A;  3VS3 A;  1AZG B;  2KAF A;  2K57 A;  3Q1J A;  3G4S A;  3VV0 A;  5CAI A;  1VQL T;  3OQ5 A;  2DL5 A;  1OQK A;  2EBP A;  2JTF A;  2PUO B;  4J5Y A;  4HCB A;  2SEM A;  3EH2 A;  4M77 F;  1BI1 A;  1JJ2 P;  1M90 U;  4M77 G;  4E7L A;  4XU0 A;  4OB0 B;  4YTL A;  4PFZ A;  1R0B G;  3EGD A;  5FLX E;  8AT1 B;  3QYG B;  4MML A;  1GFC A;  2LC4 A;  5KCO A;  4A63 B;  1PD0 A;  3JCM e;  4MMK A;  2K4Y A;  5L8R E;  5GAM g;  1FMK A;  1RAI B;  1AVZ C;  4HCC A;  1WIE A;  4JUV A;  2E5K A;  2MYS A;  2RB6 A;  3A8O B;  1VQM A;  4M7D D;  4AFU C;  4JRK A;  1N9R A;  2KE9 A;  3MJX A;  1VQN A;  2Z0W A;  4BE0 A;  2ZPH B;  1UDL A;  2QXF A;  2PQW A;  4HVV A;  5KE3 A;  1TXQ A;  1VOM A;  1NJI C;  5D6Y A;  2J6O A;  4PJO A;  1M2O A;  2DZ9 A;  4XTX A;  1U8R A;  2M1H A;  2ROL A;  2EAY A;  1VA7 A;  4HVU A;  3H0F A;  4IUT A;  4DEX A;  1WLP B;  2LT1 A;  5LJ3 h;  1TUD A;  2FG0 A;  3MEA A;  3D7S B;  1X2K A;  2KRM A;  3MET A;  1WFW A;  2MWO A;  4J9H A;  3OSV A;  2CH4 W;  1KQS S;  5KCH A;  1MMG A;  3VRZ A;  2LVM A;  4Y91 A;  1RAE B;  3J81 E;  2PVO B;  2GBQ A;  3RKW A;  6AT1 B;  2OTJ A;  2ZCF B;  3VYH B;  3I56 Q;  1V76 A;  3M0U A;  1XQH A;  5I21 A;  5CK9 A;  3MP1 A;  2YWW A;  2KK4 A;  3M0R A;  4BB7 A;  1OX8 A;  4A4E A;  3R6O A;  1NLO C;  4OMQ A;  5J26 A;  4LNP A;  3RDV A;  2YRV A;  2H3J A;  1AWO A;  3JCM P;  2P84 A;  5KYY A;  3L2Q A;  3CCE A;  3LX7 A;  1D1C A;  2RI2 A;  3QJY A;  3J80 E;  1B34 A;  4FYW B;  4Z89 A;  3LYI A;  1RLP C;  2HL3 A;  1Q81 U;  1JQQ A;  1KJW A;  2K9G A;  4CC4 B;  3QPH A;  3NGP A;  3ER0 A;  5GAN f;  4XTU A;  4JJD A;  2M9U A;  4PJO B;  1BI2 A;  2KYB A;  3JB9 H;  4JJB A;  2X3W D;  4QQD A;  1UTI A;  4DBF A;  4F7U E;  4M77 A;  2PTK A;  2YDL A;  5GAO n;  2H8H A;  4PKC C;  5I22 A;  2ZPG B;  2V8I A;  5CKF A;  3JB9 G;  2RJE A;  3OYE A;  2A36 A;  3PIO A;  1N8R R;  4RCC A;  4M78 E;  2QA4 Q;  4M78 C;  2XG8 D;  4Q5W A;  2KSS A;  3ASK A;  1G3Y A;  4LDX A;  4XQ3 A;  1FMW A;  5IN1 A;  5FU7 B;  4C0D B;  3M0P A;  3CD6 T;  2EQJ A;  4OMP A;  3G6E A;  2ECZ A;  1WHJ A;  4ZTJ A;  3V7S A;  4ESR A;  2D8H A;  1K73 C;  4OMF B;  2BZX A;  4C5I A;  5GAN j;  3OBW A;  3CCL A;  4HVW A;  2G6F X;  3HPW A;  5IHK A;  3VS0 A;  2EGA A;  3H8Z A;  4QT7 A;  1K9M U;  2EYX A;  3DB4 A;  2LCC A;  5J39 A;  3CC7 Q;  5EG2 A;  3TU4 K;  5LJ5 h;  2VWF A;  2HBW A;  2XI9 A;  3HL8 A;  2I2L A;  4RTX A;  1QVF A;  1PCX A;  4A54 A;  3VS5 A;  1GL5 A;  2KDS A;  4Z02 A;  2P0P A;  7AT1 B;  1KK7 A;  2HSP A;  3LGF A;  1ZSG A;  1AWX A;  1UHF A;  1S72 Q;  2DL3 A;  1WNL A;  3PVL A;  3PT9 A;  2QTX A;  3HFO A;  4M7D F;  1VQ7 A;  1BYM A;  4J9I A;  4J9E A;  4M7D G;  4XTV A;  3CPW S;  2OI3 A;  1M90 C;  2QG9 B;  2L8D A;  3SFM A;  3EFO B;  4DBH A;  3C95 A;  1ZA1 B;  2R57 A;  3L42 A;  1ZBJ A;  2M02 A;  2QEX A;  1OI1 A;  2RJF A;  4RG2 A;  4OGE A;  3CCR T;  4OB3 B;  2E70 A;  2LQK A;  2XIC A;  2KT8 A;  1JU5 C;  2JTM A;  1QVG A;  1W2B S;  2DL4 A;  1IO6 A;  1RL2 A;  2DD5 A;  3OYH A;  2NUZ A;  1VQ5 A;  2YRC A;  3OYC A;  3JSC A;  1OZ2 A;  1TU0 B;  4A4K A;  2MK5 A;  3CCU Q;  3SWN B;  4Y92 A;  1ZSZ B;  4J9D A;  2F5T X;  1C0M A;  3PGG A;  4LN2 A;  2D1X A;  3CME Q;  2DMO A;  1YIJ T;  2KMT A;  2KRO A;  1NE8 A;  3C0C A;  2DVJ A;  1NYF A;  3HSB A;  4BDZ A;  1TUC A;  1VQO Q;  2EJF A;  2JW4 A;  1G3S A;  3RES A;  5CQX A;  2VXE A;  1ABQ A;  1Q86 C;  2KVQ G;  1VQ8 A;  2J7I A;  1KQS P;  5LJ3 e;  2QQB A;  4FT4 A;  4OB1 B;  1NJI R;  1RAH B;  4TVR A;  2DXB A;  5GAN 4;  2Y4X A;  2R5M A;  2LQ8 A;  2LNH B;  3AT1 B;  1U5S A;  4LD9 K;  2A08 A;  2F2X A;  3G4S Q;  3OBY A;  4K11 A;  3CCM A;  4R56 A;  3FLG A;  1VQ4 T;  3VS2 A;  1P92 A;  4J9F A;  2RHY A;  1CSK A;  1YI2 A;  1WJR A;  1RI0 A;  5EC7 A;  3CCQ T;  2R5A A;  1MV3 A;  3CC2 T;  5DLO A;  4M75 C;  1WHL A;  1U1T A;  2A3L A;  2XU8 A;  4QQG A;  3FDR A;  1I5L A;  4RTT A;  4E7I A;  2IPO B;  5GAO p;  2X4Y A;  5I11 A;  1YHQ T;  1YNZ A;  2DTH A;  1M30 A;  1B3Q A;  4B9W A;  1OU8 A;  1V29 B;  2MCN A;  2BKD N;  3JCM h;  4IUR A;  5HKC A;  1MMD A;  3QWX X;  4E7J A;  1VQM Q;  4JS4 A;  2JN0 A;  2OAU A;  3JCM b;  3O8V A;  3G71 Q;  3CBM A;  5CKB A;  4BI3 A;  4IUU A;  1VQN Q;  1OPL A;  4M7D A;  1B07 A;  1YIT T;  2KRN A;  2ED0 A;  2EYW A;  2RK1 A;  5D7U A;  4PJO E;  4EMH A;  1OX9 A;  2GQV A;  2KGT A;  2LQW A;  3LWH A;  3QDF A;  2EQM A;  3M58 A;  4LDW A;  4C92 C;  3HP9 A;  1B7T A;  5GAM e;  1SHG A;  1UHC A;  5KYU A;  2BUD A;  2L3R A;  4DA4 A;  1RAB B;  3OW2 S;  2CUB A;  1MND A;  2EJG A;  2ATC B;  2JJ9 A;  3TVT A;  1NM7 A;  3TSZ A;  4QQ6 A;  5HY6 A;  4RCB A;  4OGC A;  3CCS A;  1TTH B;  2E3I A;  1AHJ B;  2V8J A;  2KEA A;  4C0D C;  3GNG A;  2OTJ Q;  3DLL A;  1V1C A;  2SRC A;  3UA6 A;  4GLK A;  2B8A A;  1K9M C;  3EHQ A;  1YJ9 Q;  4RUG A;  2K3B A;  1RI9 A;  4IUQ A;  1WQW A;  1BCO A;  4C8Q D;  3BDU A;  1YP5 A;  3A8L B;  5GJV B;  1ZUU A;  2LNV A;  1HD3 A;  3NTK A;  4HCZ A;  1QWE A;  3CCE Q;  2H3E B;  3P8B B;  3A98 A;  4O6J A;  1JXM A;  2DRK A;  3UAT A;  2XD0 A;  5LJ3 d;  4LUD A;  1G3T A;  1TH7 A;  1KD1 U;  2C0I A;  3JAM E;  3CPW P;  3RUX A;  2FZC B;  5GAN g;  3EH1 A;  5KYX A;  4M75 F;  5AT1 B;  4A4F A;  2ESW A;  2EVR A;  1UGV A;  2RHX A;  2XHC A;  4M7D B;  2RQU A;  5M9O A;  1J3T A;  2K7A A;  2F5K A;  2NWM A;  3M4G A;  4LDU A;  1M8M A;  1T3L A;  2L3P A;  5AYF A;  1ZUY A;  2DNU A;  1I81 A;  3VU3 C;  2V26 A;  2VVK A;  2K2M A;  2WSC E;  5D6X A;  1PWT A;  2CKK A;  1W2B P;  2E6N A;  4ANJ A;  3QYH B;  2DYB A;  1YFN A;  2HKN A;  2YXY A;  4OVA A;  1X69 A;  3OB9 A;  2NUP A;  5GMK j;  1I07 A;  2DD4 A;  2XID A;  3CBO A;  3CXC S;  1OPK A;  2RA2 A;  4OMM A;  4M7A B;  2EGC A;  5GAO l;  3LLR A;  3OYL A;  4F04 B;  4E7K A;  1ZBX A;  4CI0 C;  3G6E Q;  5KYW A;  2DXU A;  2YUP A;  1ZSZ C;  2KT1 A;  1D0Z A;  4A4G A;  4D6W A;  2CP2 A;  3UA7 A;  2E4H A;  4PNO A;  1VQP A;  3M0S A;  2QK0 A;  1PHT A;  1K8A C;  4KGX B;  1NG2 A;  4QVD A;  4AG2 C;  3M59 A;  4AG1 C;  4QW2 A;  2MPX C;  4IUV A;  5HK0 A;  1UE9 A;  1VQ9 T;  1RAF B;  1FYN A;  3CEY A;  3CCV A;  1PSE A;  4AT1 B;  2RHI A;  3EGX B;  3I56 T;  1IXD A;  1K0S A;  1TS9 A;  3LW5 E;  3NMZ C;  1K76 A;  1Q86 R;  2A0F B;  5KH6 A;  2P4R A;  1VQ7 Q;  4CC3 A;  1M3B A;  2IVW A;  5GAN 8;  2F69 A;  2KNB B;  3CCJ A;  1Y57 A;  4FW2 A;  4O5V A;  2QEX Q;  1XOV A;  4E47 A;  4XU2 A;  3OYB A;  4NS5 A;  5LJ5 d;  4FL6 A;  4VUB A;  2LJ1 A;  2FYK A;  3NHN A;  2A37 A;  4D8K A;  3OSS C;  2K5F A;  2FL7 A;  4AFZ C;  1VQ5 Q;  2GCX A;  1I1J A;  3FC3 A;  3KUF A;  5DM7 R;  2X9H A;  1NPP A;  4BAC A;  3E1S A;  2DRM A;  1H3Z A;  1ZUK A;  3GNF B;  3G71 A;  3OS2 A;  2OAW A;  3V8K A;  4C0F A;  3REB B;  4MZT A;  3QJ6 A;  3PMI A;  3FIF A;  2CP0 A;  3ULR B;  2KR3 A;  4L59 A;  2DO3 A;  3I55 T;  4FIB A;  3P8H A;  2BE7 D;  2CS7 A;  4JDS A;  1VQ8 Q;  1AEY A;  3S3N A;  3OW2 P;  2DJZ A;  1WHM A;  4C8Q F;  4C8Q G;  3RBB B;  1LVK A;  4JZ3 A;  3GIB A;  2WSE E;  1YJN Q;  4NL3 A;  3GBQ A;  2O88 A;  1O9S A;  5C0M A;  2YT6 A;  4J9G A;  2KXD A;  2O2O A;  1KHC A;  4BDY A;  2O4X A;  2B86 A;  1XTD A;  3MEU A;  2JUF A;  1D3B A;  3M5A A;  3L1A A;  3OYJ A;  3EG0 A;  2CRE A;  1VQK T;  2Y90 A;  3CC7 T;  2EW3 A;  3CCM Q;  1K0X A;  2W0Z A;  2YRD A;  4HT9 A;  2LQN A;  3HRS A;  1YI2 Q;  3OMG A;  1QWF A;  1HJD A;  1LNX A;  2FPD A;  1QKW A;  4M78 D;  1IHW A;  1YIJ A;  1RUW A;  1YJ9 A;  1VQ6 A;  3MPU B;  3EGD B;  1FWZ A;  4IIM A;  1IGU A;  1O75 A;  4AFS C;  1S72 T;  2FPF A;  1PSF A;  2PVG B;  1SEM A;  3MHX A;  2RM4 A;  1PRM C;  1K9M R;  3MEW A;  2C0T A;  3CC4 T;  2Y4Y A;  1KIK A;  1SF9 A;  4QVZ A;  2J06 A;  1GCQ A;  1X43 A;  2DA9 A;  2QQ9 A;  3OYD A;  4E7H A;  1WDX A;  1H3H A;  1MMN A;  4ZTF A;  2DL8 A;  4M7D E;  4KUL A;  1CKB A;  1BIB A;  1UJY A;  2GGR A;  2EJ9 A;  2RI3 A;  2RQW A;  2HSE B;  2DVE A;  3CXC P;  2RH2 A;  5IXF A;  3M56 A;  3UWN A;  1NLP C;  2BIV A;  3QBY A;  2YUQ A;  4HXJ A;  3THK A;  1Q82 C;  2VV5 A;  3CME T;  2BZY A;  4MZP A;  1KC8 R;  3L2U A;  2QQS A;  3IQL A;  2CUD A;  4EPC A;  4PJM A;  4WTO B;  1BBZ A;  5GAM h;  1YHQ A;  4OMO A;  4M7A E;  2CP6 A;  3C12 A;  1VQO T;  4M7A C;  3CCS Q;  4CC7 A;  3M55 A;  2LDM A;  3JCM d;  5CO7 A;  3I5S A;  1QVF S;  2EKH A;  3A5Z B;  1BIA A;  2QYZ A;  1AWJ A;  3A8M B;  1M2V A;  4ELZ C;  2FO0 A;  1ZX6 A;  2XK0 A;  4N0A C;  3MO8 A;  4LUE A;  2LJ3 A;  2NYS A;  3JRZ A;  1M4Z A;  3VS7 A;  3QZ9 B;  2K79 A;  5GAO r;  2KRS A;  4X34 A;  1PG5 B;  4EMK A;  4QKU A;  4BY6 B;  4J6X A;  2XKO C;  5KYY B;  4C8Q A;  3G4S T;  4F16 A;  5LJ3 f;  2L89 A;  2ENM A;  3BFM A;  9ATC B;  4HT8 A;  2E1H A;  2PVD B;  1UJ0 A;  4XU3 A;  1B34 B;  3OYM A;  1K8A R;  5GMK i;  3MP8 A;  2D6F A;  1QVG S;  3FEO A;  3EG9 A;  3CMA A;  3DB3 A;  1UFF A;  1N27 A;  2K5I A;  4ME7 A;  4Y28 E;  4KH1 B;  4FSX A;  3CPF A;  1PRL C;  2P0Q A;  1WGS A;  1HK9 A;  2G3R A;  4M77 B;  1YJW A;  4E2F B;  1VQM T;  3HKS A;  4M4Z A;  1PD1 A;  1E7O A;  4D8D A;  3U23 A;  1VQN T;  1LCK A;  2DBK A;  5LJ3 j;  1N5Z A;  1EIF A;  3GF5 A;  5GAN e;  1QW1 A;  4MZM A;  2PUK B;  2FB7 A;  3O5Z A;  3LWI A;  4M75 D;  2RHU A;  2X35 A;  4F7U F;  1ZQ1 A;  1N8R U;  3VS6 A;  3RKX A;  4V2S A;  4JZ4 A;  1MUZ A;  4ZN1 A;  4BUG A;  2GTO A;  4OML A;  2GFA A;  1SSF A;  2DTI A;  1VQP Q;  1VYU A;  4CRI A;  1M5Q 1;  2VAS A;  2ZGW A;  3QDR B;  4UC4 A;  3EG2 A;  2JM9 A;  2JMC A;  1OV3 A;  4M78 F;  5A2Q E;  2CT4 A;  2CZ6 B;  4M78 G;  2GNC A;  4OMN A;  3CCV Q;  4OF1 A;  4ELY C;  2W10 A;  1BU1 A;  2O01 E;  2OTJ T;  5GAM f;  2VB6 A;  3G1J A;  2DIQ A;  2O31 A;  2XDB A;  4PFO A;  2EFI A;  4EDU A;  1YJN A;  3OY9 A;  4RTY A;  1SRM A;  3EG9 B;  2AHJ B;  4JJN K;  1PNJ A;  3WVE B;  2VGN A;  5IAY A;  1K1Z A;  2E5Q A;  3OYY A;  3URG A;  4J8O A;  4C92 D;  1VYT A;  3CCE T;  1KQ1 A;  1T3S A;  2VC8 A;  1SPK A;  1Y71 A;  5GMK h;  1MGQ A;  3QO3 A;  1DJ7 B;  1IB8 A;  3CD6 Q;  1NBE B;  1OUL A;  4II1 A;  3VKI A;  1M1K U;  3M0Q A;  4J7F A;  1YWO A;  5CKH A;  3CCJ Q;  2COW A;  2RJC A;  2EYQ A;  4DOV A;  2RQR A;  4P5N A;  1CKA A;  4XTW A;  5LJ5 f;  2DER A;  2LRQ A;  2F2W A;  2PZ1 A;  3ZL7 C;  5FU6 B;  4RMO A;  2E64 A;  2RHZ A;  1NEG A;  2K5L A;  3SD4 A;  2ABL A;  2OTL A;  1Q81 C;  1QCN A;  3M54 A;  1M1G A;  3VRY A;  2XMF A;  5CKD A;  4JS5 A;  1WXU A;  1G8X A;  2L0A A;  3PIP A;  3J7A F;  3ZBD A;  1ZA2 B;  2R58 A;  1AZE A;  2LZ6 B;  2COZ A;  5J3B A;  1M3C A;  1U1S A;  3S6W A;  1VQL A;  4PJO C;  3R6N A;  3EG1 A;  3HRT A;  1SSH A;  3L2W A;  1D1B A;  3CQT A;  1D0X A;  3OS1 A;  3GPL A;  1QVF P;  2M0Y A;  5LJ5 j;  3CCR Q;  4J7I A;  2V8K A;  3QWY A;  3CCL T;  2QAS A;  4B6M A;  1EFN A;  1LPL A;  1AD5 A;  3JCM X;  2LCS A;  1UGS B;  1E6H A;  1Q82 R;  4RTV A;  2GF7 A;  4RTW A;  2JM8 A;  3KXT A;  2BE9 B;  4FSS A;  4C0G A;  5FU7 C;  2EGE A;  2QGF B;  1JJ2 A;  1YIJ Q;  3FRN A;  4XK8 E;  2PNI A;  1BI0 A;  1VQ6 Q;  3RMS A;  4M78 A;  4FU6 A;  1WXT A;  3BDL A;  1MHN A;  1X01 A;  1XNI A;  4EMG A;  4FT2 A;  1VQ7 T;  5IH2 A;  1OOT A;  1KHI A;  1QVG P;  3V8J A;  4C0Z A;  1K73 R;  1IGQ A;  3TQ7 P;  2AK5 A;  3I35 A;  2MF2 A;  4J6W A;  3BE3 A;  2OX7 A;  2JZ2 A;  3H6Z A;  5HCK A;  2OJ2 A;  2LX7 A;  1SHF A;  2K3X A;  2EYY A;  2NUT A;  5IHN A;  5IXB A;  3CBP A;  2HCK A;  1M9S A;  2DE0 X;  4M75 G;  2EYZ A;  4PJL A;  3JCM V;  1UEB A;  2M16 A;  1VQK A;  1AWW A;  2AKK A;  3PMT A;  4BE2 A;  2L2P A;  2DIL A;  1AT1 B;  4M77 E;  2HQE A;  1RAA B;  4M77 C;  2XDP A;  1D09 B;  1Z9Q A;  3TSW A;  3QUI A;  2DTO A;  3RR6 A;  5GAN 7;  2DBM A;  1G2B A;  2ZPB B;  2LT4 A;  1YHQ Q;  5KYU B;  1M90 R;  3JCM f;  4FCY A;  5DLQ E;  1VYV A;  2CGH A;  3L2Z A;  3C4S A;  1YCY A;  4PJO F;  4HCK A;  4X9C A;  3RKY A;  3QSU A;  1RAG B;  2E3H A;  2JNG A;  3E9F A;  1IHV A;  3MP6 A;  3REA B;  1G83 A;  4C92 F;  1X6B A;  2DZC A;  3SWN C;  4FYY B;  1M27 C;  4C92 G;  2DLP A;  5CCA A;  4RTU A;  5LJ3 g;  1M1F A;  2HDA A;  2E10 A;  2VGM A;  3QII A;  3JCM c;  4KT0 E;  2YUN A;  3CCM T;  2YLC A;  1S1N A;  2GTJ A;  5CQY A;  1T0H A;  1SRL A;  1PM3 A;  3V7C A;  5GAM d;  2RF0 A;  3CMA Q;  3EHR A;  3WVD B;  5KYX B;  1UB4 A;  1UGQ B;  3HTR A;  3MKD A;  2DJQ A;  1M1K C;  4DBQ A;  3PTA A;  2XDD A;  3DLM A;  8ATC B;  5GMK e;  3H9N A;  3FJ5 A;  4OB2 B;  1WJS A;  5GAN 2;  4E6R A;  1YJW Q;  3CD6 A;  4Z88 A;  1UGP B;  1MMA A;  2QI2 A;  2HEQ A;  2DET A;  5GAN 5;  5HK3 A;  2LMJ A;  2VUB A;  1T0J A;  2F1L A;  1ZHI A;  2NUP B;  4J6Y A;  2DEU A;  2QTV A;  2RPN A;  4DOW A;  5FU6 C;  3JCM J;  1X2Q A;  3X28 B;  3N5B B;  4QVC A;  2E41 A;  1Q7Y U;  1TUG B;  1QP3 A;  5GAN h;  1FX7 A;  1A0N B;  4ORZ A;  2AZS A;  4M75 A;  4A4H A;  5FWB A;  3VUZ A;  5KYW B;  3S3O A;  1QQJ A;  3PFS A;  1WYX A;  2LTO A;  3X24 B;  1KQ2 A;  4LDY A;  2ZZD A;  2CP7 A;  1Q81 R;  3M53 A;  2QDL A;  3OYF A;  2KY9 A;  5C6S A;  1WQ7 A;  2QA4 T;  3CCS T;  4RTZ A;  3JB9 I;  3OYK A;  2O9V A;  2QGG A;  4KGV B;  5D6W A;  2ROT A;  1BI3 A;  4BD3 A;  2DKG A;  1GCP A;  5CKE A;  2LJ0 A;  1WPY A;  4FYX B;  2EWN A;  2X4X A;  3CCR A;  2FZG B;  2X4W A;  4X1V A;  1KG1 A;  3VS4 A;  5GAN 3;  4N4I A;  3HFN A;  1KSW A;  4C92 A;  1AOJ A;  1R0C B;  2EQU A;  5LJ5 g;  1HYO A;  1Q86 U;  3LH5 A;  2A28 A;  4NL2 A;  4M7A D;  1VIF A;  5FRO A;  4AMC A;  1MV0 B;  1BB9 A;  2GFU A;  2MWP A;  2JOY A;  3RNJ A;  5L23 A;  1Y07 A;  1KD1 C;  3S3M A;  2YLB A;  1RAC B;  1VQ9 Q;  4ZGE B;  2OTL Q;  4KH0 B;  2WSF E;  2CH4 A;  2JMA A;  2DF6 A;  1Y0M A;  1K4U S;  2QQA A;  3RMQ A;  1QMC A;  2AKL A;  4C5H A;  4CC2 A;  2M0O A;  4M75 B;  1RAD B;  2RQV A;  2E6Z A;  3NTH A;  3AHU A;  2D8J A;  1U06 A;  4JLG A;  4RG8 A;  4E7S A;  3QG1 A;  4ZGD B;  4M7D C;  5GJW B;  1IRE B;  1I0C A;  2D0Q B;  1SG5 A;  1Q95 G;  3E19 A;  1VQL Q;  4MDW A;  2DIG A;  5FW9 A;  1BCM A;  2JS0 A;  1KQS A;  3VYG A;  1VQ4 A;  2X4J A;  2CSI A;  3X25 B;  4R55 A;  1YBY A;  3RIR A;  4B9X A;  3T9N A;  2BZ8 A;  3CCQ A;  2K6D A;  3CCU T;  3DKM A;  3CC2 A;  3KFV A;  3RER A;  1UG1 A;  1ARK A;  2IG0 A;  2YSQ A;  4BI4 A;  1VQP T;  4XTZ A;  2CP3 A;  4MDX A;  3ME9 A;  2O4X B;  1TG0 A;  1WI7 A;  4IUP A;  1D3B B;  5LL6 S;  2X51 A;  3X26 B;  5IT9 E;  1N9S A;  2L5Q A;  4C5G A;  1QKX A;  3EFO A;  1F1B B;  4C92 B;  4DQ2 A;  3CCV T;  2CT3 A;  2P0K A;  5KYN A;  3MCA B;  3QZ5 B;  3TRE A;  2VXF A;  3JB9 F;  1XJW B;  2AIR B;  2HMA A;  3X20 B;  3GP8 A;  2AZV A;  3VS1 A;  1YIT A;  3OMC A;  3GOX A;  1WXB A;  4FW1 A;  3VUB A;  1ABO A;  2LX9 A;  1HXD A;  3I55 Q;  3QXE B;  5FWC A;  1WX6 A;  4KBM B;  4NOY A;  3BW1 A;  1NPR A;  3SWN A;  2RNA A;  1I8F A;  2CZ0 B;  1ZSZ A;  1LOJ A;  2CYZ B;  5A0G A;  3CCJ T;  2IIM A;  3SEM A;  3SHW A;  4LDV A;  1WHK A;  1M3A A;  2HAX A;  1Z9Z A;  2LCL A;  3LH0 A;  2DEQ A;  2FPE A;  5A0D A;  3NFC A;  4OP0 A;  4ZN3 A;  1VQK Q;  1PKT A;  1I4K 1;  2ED1 A;  1NYG A;  3P8D A;  2F2V A;  4J9B A;  1WHG A;  4L5G A;  4XAX B;  2DX1 A;  1LJO A;  1EX4 A;  2EIF A;  3QKJ A;  1QCF A;  4PL6 A;  2NLU A;  4KGZ B;  2ZPE B;  1M1K R;  3I5R A;  1NZ9 A;  3G71 T;  1OEB A;  2CP5 A;  4ZNX A;  3JCM g;  2MIO A;  3NPF A;  1TSF A;  1Q7Y C;  2J05 A;  1N6A A;  2FZK B;  3JV3 A;  2PU9 B;  3FB9 A;  1WZO A;  1GBQ A;  1W1F A;  2DPP B;  5I2M A;  2FEI A;  3I9Q A;  3CC4 Q;  2DXT A;  1W70 A;  4HKE A;  2CZ7 B;  2DM1 A;  1X6O A;  3OYG A;  4PJJ A;  3L2R A;  1KC8 U;  4XU1 A;  3M0T A;  5FRM A;  2ZAE A;  1M2V B;  3OYI A;  4F7U G;  1D0Y A;  1U3O A;  2EQI A;  4FM4 B;  1H8K A;  1PKS A;  2MAM A;  5I2S A;  3JCM Q;  3UF4 A;  2COY A;  4GLM A;  3VJP A;  3KBG A;  4JRP A;  1IRX A;  4EMK B;  2HL5 C;  5A0L A;  4M7A F;  4XTY A;  4C8Q B;  4M7A G;  3EFS A;  3A1P A;  2M51 A;  3E2U A;  3M9Q A;  1ZLM A;  3CPW A;  2L3Q A;  2HBP A;  2HZY A;  3EGU A;  4DBR A;  1YJ9 T;  2DL7 A;  4ZGJ B;  1EZZ B;  3LGL A;  4PJO D;  5GMK l;  1VQ6 T;  1X6G A;  1X27 A;  4E7Z A;  2HKQ B;  3H0I A;  3INZ A;  4X9D A;  5FRN A;  1UEC A;  5GAN 6;  1K8A U;  4PLL A;  2RJD A;  1ACM B;  4BE1 A;  1W2B A;  1Y7X A;  1GXI E;  4N4H A;  3ZEH A;  4DEY A;  3SDZ A;  1D1A A;  3UT1 A;  2CDT A;  1BK2 A;  1JEG A;  1UUE A;  1QVP A;  1TWB A;  2D0N A;  2JXB A;  4PK4 A;  1C6V X;  1VQ9 A;  5GAM j;  1TOV A;  1SKU B;  1I5O B;  2QAZ A;  2KYM A;  1QLY A;  5GMK m;  1VUB A;  3HHT B;  1Y96 A;  3OYA A;  4M75 E;  3I56 A;  4N4G A;  1GRI A;  1KD1 R;  2DYI A;  4ATO A;  4IIO A;  2RI5 A;  1JBM A;  1KFZ A;  2JS2 A;  3GLX A;  1UGR B;  1QCO A;  2FRW A;  4RKU E;  3OA6 A;  4Z8A A;  3QHS A;  3UDC A;  3NTI A;  3EG3 A;  5ECA A;  3F70 A;  3TCJ A;  1JJ2 S;  2LP5 A;  2JVV A;  3FJP A;  2J6K A;  2FRY A;  4F14 A;  4L6V 5;  5CVI A;  4GY5 A;  3JB9 J;  3G6E T;  2QQR A;  4A53 A;  1YWP A;  1JB0 E;  2HQH A;  2K2V A;  3BY7 A;  3MEV A;  4KUI A;  2JTE A;  4M77 D;  5GAN d;  1X75 C;  4R0K A;  1G5V A;  3EAE A;  3M4Y A;  4AFQ C;  4F7U A;  2E65 A;  4C92 E;  1NJI U;  2DK3 A;  1C1A A;  2FVU A;  3V8L A;  2EPD A; 
#chains in the Genus database with same CATH homology
 4OB2 B;  1RL2 A;  2DD5 A;  4ZTF A;  1G3W A;  3C94 A;  3PNW C;  3OYH A;  4JRQ A;  4M7D E;  1WJS A;  5GAN 2;  1VQ5 A;  3CMA T;  4KUL A;  3OYC A;  3CD6 A;  3JSC A;  1OZ2 A;  4M7D F;  1UGP B;  4A4K A;  2QI2 A;  4M7A A;  1BIB A;  2ZPI B;  2RD1 A;  3SWN B;  2QA4 A;  2EJ9 A;  2RI3 A;  5GAN 5;  2F5T X;  2P4T A;  3PGG A;  4BY6 C;  1BKB A;  2HNI A;  3I55 A;  3EFR A;  5HK3 A;  2EKO A;  2VUB A;  1YIJ T;  2DVE A;  2E12 A;  1ZHI A;  2KMT A;  1H64 1;  4J6Y A;  2RH2 A;  4N0A A;  3M56 A;  1NE8 A;  3UWN A;  3HSB A;  1YJW T;  4J83 A;  2BIV A;  4BDZ A;  3QBY A;  4DOW A;  2EJF A;  1G3S A;  1Q82 C;  1Y96 B;  2DAQ A;  2VV5 A;  5FU6 C;  3RES A;  5KE2 A;  3JCM J;  1R8O B;  3CME T;  5CQX A;  3X28 B;  2VXE A;  2DXC A;  1Q86 C;  4MZP A;  2KVQ G;  3N5B B;  3L2U A;  2D9T A;  2QQS A;  4QVC A;  2E41 A;  2QEX T;  1Q7Y U;  1VQ8 A;  4M7A D;  4EPC A;  1QP3 A;  5LJ3 e;  5GAN h;  5LJ5 e;  2CZ1 B;  2QQB A;  1FX7 A;  5GAM h;  1YHQ A;  5GAO q;  4FT4 A;  4M7A E;  4M75 A;  3C12 A;  2RK2 A;  4OB1 B;  3VUZ A;  4A4H A;  3S3O A;  1VQO T;  4M7A C;  3M55 A;  2LDM A;  3JCM d;  3CC7 A;  4TVR A;  5CO7 A;  1WJQ A;  3PFS A;  3OW2 A;  1QVF S;  2DXB A;  2LTO A;  2RO0 A;  3A5Z B;  1BIA A;  3M57 A;  3X24 B;  5GAN 4;  4IKF A;  2Y4X A;  1KQ2 A;  4LDY A;  3A8M B;  2ZZD A;  1VQ5 T;  4ELZ C;  2R5M A;  2LQ8 A;  3A8H B;  2XK0 A;  3M53 A;  4LD9 K;  4N0A C;  3MO8 A;  3OYF A;  3ZFJ A;  2KY9 A;  3OBY A;  5C6S A;  1WQ7 A;  2QA4 T;  3CCS T;  3JRZ A;  1M4Z A;  3JB9 I;  3OYK A;  3QZ9 B;  4R56 A;  3FLG A;  5D6W A;  3CCM A;  5GAO r;  1VQ4 T;  4X34 A;  2EQK A;  1OZ3 A;  2QDY B;  1P92 A;  2RHY A;  1S72 A;  1BI3 A;  4EMK A;  1YI2 A;  1WJR A;  4BD3 A;  1RI0 A;  4BY6 B;  1KC8 C;  4J6X A;  3CCQ T;  2XKO C;  4KUD K;  4C8Q A;  3G4S T;  2R5A A;  1W4S A;  3CC2 T;  2DKG A;  5DLO A;  4M75 C;  2L89 A;  5LJ3 f;  1N8R C;  5CKE A;  3CC4 A;  2YHT A;  1U1T A;  3BFM A;  4F7U B;  2A3L A;  1WPY A;  2XU8 A;  1VQ8 T;  4HT8 A;  2EWN A;  2X4X A;  4PJO G;  3CCR A;  2E1H A;  3FDR A;  2PVD B;  4QQG A;  2A7Y A;  3JCM W;  2WAC A;  4E7I A;  4XU3 A;  1I5L A;  5GAO p;  2X4Y A;  2X4W A;  4JLI A;  1YHQ T;  1B34 B;  3OYM A;  4JRI A;  3A8G B;  2DTH A;  5GMK i;  1KG1 A;  3MP8 A;  2D6F A;  1YJN T;  2MI6 A;  2K3Y A;  4B9W A;  3TEE A;  5GAN 3;  1QVG S;  3FEO A;  1V29 B;  3HFN A;  4N4I A;  4C92 A;  3CMA A;  3DB3 A;  2BKD N;  3JCM h;  1Q82 U;  4IUR A;  4WF2 A;  5HKC A;  1N27 A;  4M78 B;  2K5I A;  4E7J A;  2EQU A;  4ME7 A;  5LJ5 g;  4JS4 A;  2JN0 A;  2OAU A;  4Y28 E;  3O8V A;  3JCM b;  1Q86 U;  3CBM A;  5CKB A;  2HQX A;  4EMK C;  1OYX A;  3CPF A;  4FSX A;  4BI3 A;  1VIE A;  3HRU A;  4IUU A;  2P0Q A;  4NL2 A;  1WGS A;  1VIF A;  4C8Q E;  4C8Q C;  5FRO A;  5CR2 A;  3WXM B;  4M7D A;  3SB2 A;  1HK9 A;  2GFU A;  2MWP A;  1YIT T;  3V7R A;  1QP2 A;  2JOY A;  2HD0 A;  2G3R A;  2KQW A;  4M77 B;  4LD6 A;  1YJW A;  2FHD A;  4HA8 A;  3UPU A;  1FXX A;  1VQM T;  3CCU A;  2RK1 A;  3HKS A;  1Y07 A;  1YI2 T;  1KD1 C;  3S3M A;  2YLB A;  4EMH A;  4PJO E;  2GQV A;  3CME A;  3OS5 A;  2MMP A;  4ZGE B;  1JRI A;  3LWH A;  2WSF E;  1VQN T;  2EQM A;  3M58 A;  4LDW A;  4PLI A;  2QQA A;  3RMQ A;  4C92 C;  5LJ3 j;  4C5H A;  3OYN A;  1EIF A;  3GF5 A;  3HP9 A;  2M0O A;  5GAN e;  1VQO A;  4M75 B;  1K73 U;  3L2V A;  2E6Z A;  1QW1 A;  4MZM A;  3NTH A;  2PUK B;  2FB7 A;  5GAM e;  3JB9 D;  3AHU A;  3CXC A;  4JLG A;  2OTL T;  4RG8 A;  3LWI A;  2BUD A;  2L3R A;  2VYT A;  3E9G A;  4M75 D;  4DA4 A;  2RHU A;  3OW2 S;  2C06 A;  3QG1 A;  4ZGD B;  4M7D C;  2X35 A;  2EJG A;  1IRE B;  2D0Q B;  4F7U F;  1ZQ1 A;  4BI8 B;  4C5E A;  1N8R U;  1IZ6 A;  3E19 A;  3RKX A;  5CIU A;  4V2S A;  5GAO m;  4QQ6 A;  5HY6 A;  4RCB A;  4MDW A;  2DIG A;  3G7Z A;  4OGC A;  4ZN1 A;  3CCS A;  4BUG A;  1KQS A;  2GFA A;  3VYG A;  1SSF A;  2DTI A;  1VQ4 A;  1M8V A;  1AHJ B;  2V8J A;  2X4J A;  4CRI A;  3OS0 A;  4C0D C;  2ZPF B;  5DY9 A;  3GNG A;  3X25 B;  4R55 A;  1M5Q 1;  3DLL A;  1YBY A;  2ZGW A;  3RIR A;  4B9X A;  2KAF A;  3QDR B;  3T9N A;  2K57 A;  4UC4 A;  3CCQ A;  3Q1J A;  2B8A A;  4GLK A;  3G4S A;  3VV0 A;  5A2Q E;  3DKM A;  4M78 F;  5CAI A;  3CCU T;  1K9M C;  3CC2 A;  1VQL T;  2CZ6 B;  4M78 G;  3OQ5 A;  3RER A;  2IG0 A;  4BI4 A;  2JTF A;  2PUO B;  4IUQ A;  4OF1 A;  1VQP T;  1WQW A;  4J5Y A;  4XTZ A;  4C8Q D;  4ELY C;  4HCB A;  4MDX A;  3BDU A;  3ME9 A;  3A8L B;  2O4X B;  2OTJ T;  2O01 E;  2LNV A;  5GAM f;  3NTK A;  4HCZ A;  4IUP A;  2DIQ A;  4M77 F;  1BI1 A;  1D3B B;  1M90 U;  2XDB A;  5LL6 S;  4M77 G;  4E7L A;  4XU0 A;  3X26 B;  3P8B B;  4O6J A;  4OB0 B;  2EFI A;  5IT9 E;  1N9S A;  4EDU A;  2L5Q A;  4C5G A;  1YJN A;  4YTL A;  3OY9 A;  2XD0 A;  5LJ3 d;  5FLX E;  1G3T A;  4C92 B;  2AHJ B;  4JJN K;  3QYG B;  1TH7 A;  4DQ2 A;  3WVE B;  2VGN A;  5IAY A;  3CCV T;  2E5Q A;  2P0K A;  4MML A;  1KD1 U;  3MCA B;  2LC4 A;  3QZ5 B;  3OYY A;  3TRE A;  5KCO A;  2VXF A;  3JAM E;  3URG A;  3RUX A;  3JB9 F;  4J8O A;  4MMK A;  4C92 D;  3JCM e;  3CCE T;  1KQ1 A;  2VC8 A;  5GAN g;  2K4Y A;  3X20 B;  1Y71 A;  4M75 F;  5GMK h;  1MGQ A;  3QO3 A;  1DJ7 B;  5L8R E;  4A4F A;  5GAM g;  3GP8 A;  2RHX A;  2XHC A;  4II1 A;  4M7D B;  3VKI A;  1YIT A;  1M1K U;  3OMC A;  3GOX A;  4HCC A;  4JUV A;  4J7F A;  5CKH A;  3VUB A;  2LX9 A;  3A8O B;  2RB6 A;  5M9O A;  2RJC A;  1VQM A;  4M7D D;  1HXD A;  3QXE B;  2EYQ A;  4JRK A;  3M4G A;  2F5K A;  4DOV A;  1N9R A;  4P5N A;  4LDU A;  4KBM B;  5AYF A;  4NOY A;  3BW1 A;  1VQN A;  1I81 A;  3VU3 C;  4XTW A;  5LJ5 f;  1NPR A;  4BE0 A;  2ZPH B;  2WSC E;  5D6X A;  2QXF A;  2CKK A;  2PQW A;  2LRQ A;  3SWN A;  1I8F A;  2CZ0 B;  5KE3 A;  2E6N A;  1LOJ A;  2CYZ B;  3QYH B;  5A0G A;  3CCJ T;  5D6Y A;  1NJI C;  4PJO A;  5FU6 B;  2DZ9 A;  4XTX A;  2E64 A;  4RMO A;  1U8R A;  2RHZ A;  2M1H A;  4OVA A;  2K5L A;  3OB9 A;  3SD4 A;  2EAY A;  4LDV A;  5GMK j;  2HAX A;  2OTL A;  2DD4 A;  2XID A;  1Q81 C;  2LCL A;  3CBO A;  3LH0 A;  2DEQ A;  3M54 A;  1M1G A;  4IUT A;  5A0D A;  5CKD A;  3CXC S;  2RA2 A;  3NFC A;  4OP0 A;  4ZN3 A;  4JS5 A;  2LT1 A;  4M7A B;  5LJ3 h;  1I4K 1;  5GAO l;  3P8D A;  3MEA A;  3PIP A;  3J7A F;  3LLR A;  4L5G A;  3OYL A;  4XAX B;  1LJO A;  3MET A;  3ZBD A;  2EIF A;  2MWO A;  3QKJ A;  4E7K A;  2R58 A;  3OSV A;  4PL6 A;  1KQS S;  1ZBX A;  5J3B A;  2NLU A;  4CI0 C;  5KCH A;  2DXU A;  2LVM A;  1U1S A;  2ZPE B;  4Y91 A;  3S6W A;  1NZ9 A;  1VQL A;  3J81 E;  4A4G A;  2PVO B;  3JCM g;  3G71 T;  4D6W A;  4PJO C;  4PNO A;  3HRT A;  1VQP A;  3L2W A;  3RKW A;  1Q7Y C;  1N6A A;  1K8A C;  2PU9 B;  2OTJ A;  2ZCF B;  3FB9 A;  3VYH B;  1XQH A;  3OS1 A;  4QVD A;  5I21 A;  3GPL A;  2DPP B;  5I2M A;  3M59 A;  5CK9 A;  3MP1 A;  5LJ5 j;  2DXT A;  4QW2 A;  4HKE A;  2KK4 A;  4IUV A;  2CZ7 B;  5HK0 A;  1X6O A;  4J7I A;  3OYG A;  2V8K A;  4BB7 A;  1VQ9 T;  4A4E A;  3CCL T;  3R6O A;  5J26 A;  3CEY A;  3CCV A;  3L2R A;  2YRV A;  1PSE A;  2H3J A;  4XU1 A;  1KC8 U;  3JCM P;  5FRM A;  2RHI A;  3OYI A;  3JCM X;  3L2Q A;  3I56 T;  4F7U G;  3CCE A;  1UGS B;  3LX7 A;  3LW5 E;  2GF7 A;  4FM4 B;  2RI2 A;  2MAM A;  3QJY A;  5I2S A;  3KXT A;  3JCM Q;  4C0G A;  5FU7 C;  5KH6 A;  3J80 E;  1B34 A;  3VJP A;  3KBG A;  3LYI A;  4JRP A;  1JJ2 A;  4EMK B;  1Q81 U;  5A0L A;  4M7A F;  4XTY A;  2IVW A;  4C8Q B;  3FRN A;  4M7A G;  4XK8 E;  3EFS A;  5GAN 8;  1BI0 A;  3QPH A;  2F69 A;  3RMS A;  4M78 A;  4FU6 A;  3BDL A;  3M9Q A;  3ER0 A;  1MHN A;  1X01 A;  3CPW A;  1XNI A;  5GAN f;  4XTU A;  4EMG A;  3CCJ A;  4FT2 A;  1VQ7 T;  2M9U A;  4PJO B;  1BI2 A;  2HBP A;  1KHI A;  4O5V A;  3JB9 H;  3V8J A;  4QQD A;  1XOV A;  1YJ9 T;  4E47 A;  4ZGJ B;  3LGL A;  4F7U E;  4M77 A;  4PJO D;  5GMK l;  4C0Z A;  1VQ6 T;  5GAO n;  4XU2 A;  3OYB A;  4NS5 A;  5LJ5 d;  4PKC C;  4FL6 A;  4VUB A;  2MF2 A;  4J6W A;  2FYK A;  2JZ2 A;  2ZPG B;  2V8I A;  3H6Z A;  3INZ A;  4X9D A;  5FRN A;  3OSS C;  2K5F A;  2FL7 A;  5CKF A;  2K3X A;  3JB9 G;  5GAN 6;  2RJE A;  2GCX A;  3FC3 A;  1K8A U;  4PLL A;  3OYE A;  3KUF A;  5DM7 R;  3PIO A;  2RJD A;  3CBP A;  4M75 G;  1M9S A;  1NPP A;  4RCC A;  4BAC A;  1Y7X A;  3E1S A;  4BE1 A;  1W2B A;  4M78 E;  3JCM V;  1UEB A;  2XG8 D;  4M78 C;  4Q5W A;  2M16 A;  1VQK A;  4N4H A;  2KSS A;  3ASK A;  1H3Z A;  1GXI E;  1G3Y A;  3ZEH A;  4LDX A;  4XQ3 A;  3GNF B;  5IN1 A;  3SDZ A;  3UT1 A;  3G71 A;  3OS2 A;  3V8K A;  4C0F A;  3PMT A;  5FU7 B;  4BE2 A;  4C0D B;  4MZT A;  3CD6 T;  2EQJ A;  3QJ6 A;  4M77 E;  2HQE A;  3PMI A;  4M77 C;  2XDP A;  3FIF A;  3G6E A;  4ZTJ A;  1QVP A;  2DTO A;  3QUI A;  3V7S A;  4L59 A;  2DO3 A;  5GAN 7;  4FIB A;  3P8H A;  3I55 T;  2CS7 A;  4JDS A;  4OMF B;  1K73 C;  3S3N A;  4C5I A;  5GAN j;  3OBW A;  2ZPB B;  2LT4 A;  2DJZ A;  1VQ9 A;  3CCL A;  4C8Q F;  3HPW A;  5GAM j;  4C8Q G;  3H8Z A;  5GMK m;  1VUB A;  3HHT B;  1K9M U;  3JCM f;  3GIB A;  2WSE E;  1Y96 A;  5DLQ E;  3DB4 A;  3OYA A;  2LCC A;  4M75 E;  5J39 A;  3I56 A;  2CGH A;  4NL3 A;  4N4G A;  5EG2 A;  3TU4 K;  1O9S A;  3L2Z A;  3C4S A;  1YCY A;  5C0M A;  5LJ5 h;  4PJO F;  4ATO A;  1KHC A;  1JBM A;  2RI5 A;  4X9C A;  3RKY A;  4BDY A;  3QSU A;  2XI9 A;  2O4X A;  1XTD A;  3MEU A;  2JNG A;  3E9F A;  3GLX A;  3HL8 A;  2I2L A;  1QVF A;  2JUF A;  1UGR B;  1D3B A;  4A54 A;  4RKU E;  3M5A A;  3MP6 A;  3OA6 A;  3L1A A;  3OYJ A;  4C92 F;  3QHS A;  3UDC A;  1VQK T;  2Y90 A;  3CC7 T;  2DZC A;  3NTI A;  3SWN C;  4C92 G;  2KDS A;  4Z02 A;  3F70 A;  2P0P A;  3TCJ A;  1JJ2 S;  2JVV A;  5CCA A;  3LGF A;  4HT9 A;  3FJP A;  5LJ3 g;  3HRS A;  4L6V 5;  3OMG A;  1M1F A;  1WNL A;  5CVI A;  2E10 A;  2QTX A;  3HFO A;  2VGM A;  1LNX A;  3PT9 A;  4GY5 A;  3JB9 J;  3QII A;  3G6E T;  1VQ7 A;  3JCM c;  4M7D G;  4KT0 E;  4XTV A;  1BYM A;  4M78 D;  3CPW S;  2QQR A;  1YIJ A;  4A53 A;  1M90 C;  1YJ9 A;  3CCM T;  2L8D A;  1JB0 E;  2K2V A;  3SFM A;  2YLC A;  1VQ6 A;  3BY7 A;  1FWZ A;  3C95 A;  1O75 A;  1S72 T;  1PSF A;  2PVG B;  3MEV A;  4KUI A;  5CQY A;  2R57 A;  3L42 A;  3MHX A;  5GAN d;  4M77 D;  1X75 C;  3V7C A;  2RM4 A;  5GAM d;  2QEX A;  1G5V A;  3EAE A;  3MEW A;  1OI1 A;  3M4Y A;  3CC4 T;  2RJF A;  2Y4Y A;  4F7U A;  4RG2 A;  2E65 A;  3WVD B;  1UB4 A;  4QVZ A;  1UGQ B;  4OGE A;  4C92 E;  3CCR T;  1NJI U;  2DK3 A;  1M1K C;  4OB3 B;  2E70 A;  2LQK A;  3DLM A;  2QQ9 A;  2FVU A;  2XDD A;  2XIC A;  3OYD A;  3PTA A;  4E7H A;  5GMK e;  2JTM A;  3V8L A;  1QVG A;  1W2B S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...