1LNXA

Crystal structure of the p.aerophilum smap1 heptamer in a new crystal form (c2221)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Rna binding protein, transcription
total genus 13
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lnxA00
4DQ2A 5GAMh 4M7DD 3EFSA 2DEQA 2YLCA 5GAOq 4XTWA 4C92G 5GAOr 3SWNC 1JRIA 3BDUA 4F7UE 5GANe 2HNIA 1BIBA 3VU3C 2DTIA 3V8LA 2DKGA 4WF2A 4M77A 4M78G 5GAMe 1N9RA 1YCYA 4M7AA 1U1TA 4M77D 3L2ZA 4EMKC 4PNOA 3HFOA 4M7AD 2DVEA 4F7UF 1H641 1I5LA 1I8FA 5GMKe 4XQ3A 4M7DG 5GMKh 1LOJA 3HFNA 2QTXA 4EMKB 2DZ9A 3INZA 4MMLA 2E1HA 4M78D 4M75F 3JCMc 4C8QA 5GAOp 2RB6A 3BY7A 4F7UA 3JB9J 4V2SA 4C8QD 1I81A 5LJ5h 5GAN2 3RUXA 2VC8A 3JB9G 4M77G 4EMGA 2EJFA 4M75A 5GMKl 4XTZA 4XU3A 4M7AG 2EAYA 4PJOE 4M75D 3JB9I 5GAOn 1D3BB 4XU2A 4Y91A 4C92B 3JCMf 2YLBA 5GANh 2VXEA 3JCMV 4A54A 4XTVA 3RKYA 3GIBA 3JB9D 2E41A 4PJOC 4C8QG 1B34B 4F7UG 1KQ2A 3SWNA 2EJGA 4J6XA 1Y96B 1KQ1A 3RESA 3JB9H 1U1SA 4MMKA 5GMKm 2DZCA 3V8JA 4PJOB 3JCMg 1WNLA 2JN0A 1MGQA 4M75G 4C92E 5CAIA 2DTHA 5GMKi 4EMKA 5GAMg 4M7DB 1TH7A 2E65A 2VXFA 5LJ3f 5GAN4 1WPYA 4JRIA 2YHTA 4NL2A 3RKWA 4C92C 2DXTA 3PGGA 4C92F 3JCMb 2Y90A 4M77B 5GAN6 3QHSA 5LJ3j 3JCMJ 2ZGWA 2DXUA 3V7SA 1WQ7A 5LJ5f 3AHUA 4M7AB 2EJ9A 4HT8A 4M7DE 1M5Q1 1M8VA 5LJ3g 3M4GA 2RA2A 1LNXA 5GAMf 4XTYA 2DJZA 4J6YA 3QUIA 3L1AA 4RCBA 4HT9A 4M78B 4PJOF 3BW1A 5LJ5j 3JCMd 2CGHA 2RD1A 1B34A 2DTOA 5GAMd 5GANf 4M77E 4C8QB 3EFRA 3JCMQ 3RKXA 4M7DF 5LJ5g 5GAN7 3QO3A 4XTUA 5GAMj 4M7AE 4QVCA 4A53A 2K57A 4PJOA 1HXDA 5DY9A 4JRKA 5GANj 4M77C 4PJOD 4M77F 4M78E 1HK9A 4OP0A 4QVDA 1WQWA 5GANg 3HSBA 4M7AC 1LJOA 5GAN5 4M7AF 2RM4A 3FIFA 4N0AC 4C8QE 5LJ3d 3RIRA 2FYKA 1I4K1 1X01A 3JCMW 5GAOm 3V7CA 1BIAA 5GAN8 4M78C 4X9DA 2I2LA 4XU1A 4M78F 4JLIA 5GMKj 4J5YA 4M75E 4XU0A 3SWNB 1D3BA 3V7RA 4C8QC 4N0AA 2E10A 4C8QF 4C92A 3V8KA 3SB2A 5LJ3e 4NL3A 5LJ5d 4M7DC 4PJOG 5LJ3h 4XTXA 4C92D 1JBMA 2EWNA 4HA8A 2E64A 4J6WA 4M78A 5GAN3 3QSUA 5GAOl 4M75C 4F7UB 1Y96A 3RERA 3JCMP 3JCMX 4NOYA 4RCCA 3FJPA 5LJ5e 3BFMA 4JUVA 1N9SA 5GANd 3FB9A 2FB7A 4EMHA 5I21A 3JCMe 4M7DA 4M75B 4X9CA 3JCMh 3JB9F
chains in the Genus database with same CATH superfamily
2F2XA 3CC7A 5GAOq 3BDUA 2EGEA 2QQRA 1QVFA 4BE2A 2X35A 1N9RA 3CCRQ 2XD0A 1ARKA 2DVEA 1YHQQ 4ESRA 3SD4A 2LNVA 2CP3A 2E12A 2LNHB 4WTOB 2QTXA 2RJCA 2EYXA 4M75F 5KYNA 2XICA 4ORZA 5EC7A 5GAN2 1SKUB 5FRMA 2MWPA 1VOMA 1RABB 4OGCA 4Y91A 1KSWA 4JS5A 3GP8A 4DEXA 4F7UG 1H92A 3QKJA 4OB0B 2KDSA 2LJ0A 2ROTA 1VQLQ 1PKTA 3NHNA 2Y4YA 1Y07A 2ZCFB 2QI2A 3CCSQ 1TH7A 1D0YA 3VUZA 1WIEA 4EPCA 3FEOA 2EQKA 1VQ5Q 2MIOA 3G71A 3C95A 5GAN6 3M56A 3CC2A 3KFVA 2MMPA 1YI2A 1LNXA 1M4ZA 2KYBA 4J9BA 2RI5A 3BW1A 2DBKA 4II1A 2DIQA 2DL4A 1OULA 2KXDA 5IN1A 4OMMA 2EGAA 1RAAB 3H9NA 3KUFA 4E7JA 1WA7A 2KK4A 2KT8A 3CC4Q 2FPFA 1WI7A 3HSBA 2DYBA 3A8MB 4M7AF 1TTHB 2KT1A 3ZEHA 3CMEQ 3M0RA 3MPUB 4N0AA 1QVFS 5FU6B 1CKBA 4D8DA 1VQ9A 3OS0A 5KYWA 4RTTA 2QDLA 1OX9A 1WDXA 1KK7A 4FU6A 4DA4A 2VKNA 1NM7A 2LQKA 2H8HA 3OQ5A 2JW4A 4GY5A 4C92G 2O4XA 2HNIA 2VGNA 3V8LA 4E7ZA 5FU6C 2EFIA 2RHIA 3CCET 4M7AA 4EMKC 4PNOA 4M7AD 1T0HA 2O31A 3PVQA 2W0ZA 4XQ3A 1WHKA 1VQ4Q 3TQ7P 1AZGB 1I81A 2EYWA 4M77G 2GTJA 2L5QA 5GMKl 2K5IA 1VYUA 2EAYA 2KVQG 1QQJA 1N8RU 2EKOA 5IXBA 4KH0B 4E7LA 4GBQA 4MDWA 4P5NA 4KH1B 3LX7A 4L5GA 2DVJA 2JNGA 3JCMg 2CZ1B 2DO3A 2X51A 4LE9A 2P4TA 2B86A 4JRIA 3CCVQ 3DLMA 3DLLA 4C5EA 2BIVA 2EIFA 4QW2A 2OTLA 2JT4A 1Q81U 4OF1A 3VKIA 1UJYA 4YTLA 2ZPIB 1VQ8A 3Q1JA 3NTKA 5KYWB 3EG3A 2HMAA 5GAN7 1X6BA 2FPDA 3QO3A 4DBHA 2RF0A 3CQTA 2JS2A 3VYHB 2K5LA 2MF2A 4N0AC 1N6AA 2JMCA 1JEGA 4CC4B 4XU0A 2XU8A 3SWNB 3A8OB 1WHLA 4NL3A 5IHNA 5LJ3h 3L2UA 3TU4K 2E6NA 3P8HA 4IUPA 3MEWA 4Z8AA 2WSCE 1MHNA 1PRLC 1VQ6A 2P4RA 1GCQC 3JSCA 3L2VA 3X24B 4KBMB 1TXQA 2AHJB 2YLCA 1BCMA 3CMAA 1Q7YC 3SWNC 2CSIA 3PTAA 2GF7A 1K8AU 1NPRA 1KG1A 2C0TA 2XDDA 1EX4A 2A08A 2HDAA 2FG0A 2IVWA 1I5LA 2COYA 1OPLA 2EYYA 3L2WA 2FL7A 2XK0A 4OGEA 1I1JA 2O88A 2VC8A 1RAHB 2ED0A 2K2MA 1PM3A 5IH2A 2FPEA 4B9WA 5CR2A 5J39A 1UHFA 1GCPA 3CCUQ 2L3PA 2V26A 2MPXC 1FX7A 3UA6A 1N8RR 3CC4T 3CCJQ 2M0OA 1VQKQ 3OYLA 1VQ7Q 4J8OA 5GAN4 3EFOB 1MUZA 1B7TA 4IUUA 5LJ3j 3V7SA 3AHUA 3CD6Q 2MK5A 5KYYB 4HT8A 3O8VA 3M4GA 2QYZA 5FWCA 4RKUE 4LDVA 3EH1A 4RG8A 3KXTA 3TSWA 4XTUA 5I2MA 1HSQA 3PIOA 1ZSGA 1Q81R 2DD4A 4KGVB 4JPBW 4PJOA 1EFNA 4QQDA 2A28A 2EYQA 1UJ0A 5GANj 4PJOD 2ABLA 1KQSP 3M4YA 1UHCA 3VS4A 2RM4A 3EGDA 1UECA 1X01A 2LQWA 4DOVA 2K2VA 3C94A 4JRQA 2JTEA 4JLIA 1H3HA 3MKDA 3EG9A 3OS1A 1T0JA 4XTXA 2HSEB 2KAFA 1ZBJA 3QJ6A 3RERA 3JCMP 1G5VA 1Z9ZA 4AT1B 3QZ9B 3BDLA 4EMHA 5KCHA 2QEXT 2BKDN 1SG5A 1VQOA 1YITA 3MEAA 2DX1A 1YJ9Q 1GL5A 2OI3A 2LRQA 1BU1A 2V8JA 3VS6A 1M1KU 2NUPB 3J7AF 1U1TA 1M3BA 4E2FB 4KT0E 2SEMA 4F7UF 3CEYA 2K7AA 4E7IA 1YJWQ 2RO0A 1K8AR 3OYNA 3GNFB 3ULRB 3CCVT 2MYSA 2RB6A 3RDVA 1OZ2A 1EIFA 2KY9A 2MI6A 2ZPFB 1KQSA 2DETA 4X34A 5LJ5h 4AFQC 1GBRA 4M7AG 5M9OA 1VQMA 3HTRA 5FU7B 4OMPA 3MP1A 2VV5A 1Q82U 2EJGA 2HQXA 5AYFA 4R55A 1N27A 3I9QA 2L8DA 4PJOB 1TS9A 4Z88A 5CAIA 5GMKi 2IPOB 1VQPT 3G6EA 3EGDB 2L3QA 3GF5A 2LVMA 4RUGA 2QGFB 3G4SQ 2E4HA 1TU0B 4ZN3A 2BUDA 2DJZA 1ZA1B 1M2OA 3QDFA 2XIDA 5CKEA 2IG0A 2NYSA 1RAIB 3RKXA 2CP5A 2QQAA 1WX6A 1AZEA 4VUBA 1GFCA 3M55A 4FM4B 5KE3A 5CVIA 2VGMA 4DEYA 2CP0A 3I5RA 4O5VA 3VS1A 1UGVA 4M4ZA 4PJLA 2PZ1A 2K3YA 3CPWP 2RJFA 1K73U 2E3IA 2GNCA 2DRKA 3L2RA 1K9AA 5C6SA 1PG5B 1X6GA 2X4WA 3OS2A 4JUVA 2G6FX 3EGXB 2LT4A 2R57A 5GAMe 1KQSS 2COZA 1OU9A 4DQ2A 4MZMA 3OS5A 2D9TA 1KC8U 2NUZA 2JMAA 3CXCP 4FL6A 4KULA 2SRCA 3FLGA 1H641 2AKLA 3J80E 1M1KR 1QP2A 4J9DA 1SSFA 4ZNXA 1VQNA 1C0MA 4V2SA 1V76A 4BACA 4JJNK 4BD3A 2L89A 2RNAA 4XU3A 1AWWA 3ZBDA 2K5FA 3CPWA 2CSQA 4LNPA 1YJNT 2RHYA 2C0IA 2KGTA 1T3SA 2HZYA 1M90U 1K9MU 2LX9A 2JXBA 1YIJA 4JLGA 1Q82R 4HCKA 1RLQC 1M30A 2F2WA 1NEGA 1SPKA 4F17A 3RKWA 2VVKA 2JM8A 3E9FA 4BY6B 3I56A 1WQ7A 3N5BB 3M0UA 2DLPA 1HYOA 3S3NA 3QUIA 3EG1A 2YXYA 3UATA 3A8HB 3CCEQ 3QWXX 1BKBA 2KR3A 4BY6C 3THKA 2F5TX 5KYUB 3FIFA 2ZPGB 3CPFA 3H6ZA 3RBBB 1R0CB 4XU1A 1YJWT 3ER0A 2P84A 5LJ5d 3LWHA 4PJOG 1TUGB 4ME7A 1BB9A 4M78A 1S72A 4MDXA 4EIKA 4OB1B 3LLRA 1ZA2B 2HCKA 1K73R 5LJ5e 1N9SA 2FRYA 2WSEE 1MNDA 2OTJT 4LDWA 2V8KA 1VYVA 3LH0A 3A8GB 4JJCA 3EG2A 3S6WA 1K1ZA 3CPWS 2LX7A 3UDCA 1K0XA 1RI0A 2DL8A 1GRIA 1WGSA 1KC8R 1M8VA 1ABOA 3X28B 1AEYA 1FWZA 2KYMA 3FRNA 1O9SA 5C0MA 1PD0A 1G8XA 2MOXA 3U23A 1N8RC 2CT4A 1K76A 1NPPA 1H8KA 3OY9A 1G2BA 2E41A 1JXMA 1UE9A 2A0FB 2YT6A 3ME9A 2YRDA 3X20B 4Z02A 4LN2A 1XJWB 5GAMg 4M7DB 4EMKA 1M90R 1WPYA 1K9MR 1M9SA 2R58A 3OYBA 1WLPB 2ZGWA 1A0NB 2OTLQ 2GFAA 4KRTA 1FYNA 4M7DE 3G7ZA 2A7YA 2ZPBB 4QVZA 1QCOA 2D0QB 2RQRA 3I55A 4MZPA 4M78B 1JJ2P 4M7DC 2HQEA 2RQVA 3CC7T 2ZPEB 5LL6S 2DL7A 4J7FA 2DILA 1PCXA 2CT3A 1QP3A 2PVOB 4M78E 4JZ4A 4GLKA 1GFDA 4M78C 1UTIA 2YUPA 3V7RA 3V8KA 1QVGP 2KMTA 5IXFA 4PJJA 4CC7A 2FRWA 2A36A 2M0YA 4JZ3A 4E47A 4X9CA 2XDPA 2K4YA 3QXEB 2YRCA 1PSFA 2E70A 3SEMA 3MP6A 1RLPC 1JJ2A 4DBRA 1OV3A 2RHZA 4Y28E 3QYHB 2CUDA 5GMKh 4EMKB 1PNJA 3G71T 3OYHA 2CZ6B 3CC2T 1YI2T 2KRMA 3JB9G 4O6JA 4F14A 2EJFA 2BZ8A 4D6WA 1DJ7B 2LQNA 5GAOn 8ATCB 2WACA 1SRMA 2QA4A 1RAEB 1Q95G 2O2OA 4DBFA 3KBGA 1QVGA 1GCQA 1MMGA 3CBMA 3OSSC 4FYVB 2QXFA 4LDYA 3H8ZA 2P0KA 3SWNA 1F1BB 1U1SA 1MGQA 2DA9A 2RPNA 1X2KA 2LT1A 2O9VA 3VRZA 1OZ3A 1D1CA 1WJSA 2BE7D 2DFUA 5L8RE 1VQ9T 3VV0A 2QEXQ 1QKXA 4XTYA 3VS7A 4FYXB 5J3BA 1RADB 4HVWA 1ZSZB 1SEMA 2K57A 2JUFA 3CCQA 2X4JA 4CRIA 1NJIU 4RTVA 5GAN5 3HPWA 2O9SA 2NWMA 2JTMA 5GMKj 4M75E 3CCLQ 3CCRA 2E10A 3SB2A 3L2QA 1R0BG 2KNBB 1ZSZC 1JJ2S 1JXOA 1YHQA 2LCCA 4FW2A 4M75C 4A4KA 4AFZC 2WSFE 3EHRA 2CREA 3OYDA 1UB4A 4C5HA 4J83A 1VQOQ 4J9HA 3SFMA 2RJEA 3QBYA 3REBB 2DEQA 2F1LA 4FSSA 3VU3C 1YWPA 3EFOA 5HK3A 1M1KC 1VQPQ 4M78G 1MMNA 1N5ZA 3GPLA 5KYYA 1FXXA 1QVGS 5A0GA 1D1AA 1VQLA 1LOJA 2AT1B 2DZ9A 2AZVA 3INZA 4QKUA 3CCSA 4L59A 4F16A 2OTLT 4KGZB 2C06A 1MNEA 2LDMA 4BI4A 1VQ8T 1VQ5A 1TUCA 1OI1A 4CC3A 4XU2A 5GANh 2AK5A 4BDZA 3GIBA 2AKKA 1W70A 2JS0A 3M0SA 4PJNA 1R8OB 1EZZB 4FT2A 1QVPA 2VXFA 2JVVA 3CC4A 5CKFA 3HKSA 4KGXB 2DD5A 2QG9B 3CMEA 2RA2A 3DKMA 2XI9A 4ZGEB 2NUPA 4MZTA 4PJOF 1VQ6T 4C8QB 1HJDA 3CMAT 1B07A 2QAZA 1U5SA 4E7HA 4RTUA 1WHMA 2G3RA 5CQYA 4C8QE 2LZ6B 2C0OA 4F04B 2VASA 4J9FA 1K73C 4N4HA 2HQHA 1NJIR 4C8QC 2O01E 2EWNA 1YJNQ 2F2VA 3MJXA 4A63B 1VQ4A 4JJBA 1IREB 2FB7A 4D8KA 5A0LA 1FMWA 1WJRA 5CCAA 1KC8C 4FSXA 4OMFB 2NLUA 3T9NA 2YUOA 1UDLA 1VA7A 3HFOA 4MMLA 2E1HA 1X2QA 2M16A 2HSPA 1U3OA 3CCMA 4AFSC 1QW1A 2DBMA 4EMGA 1PHTA 1RAGB 3P8DA 3CCVA 3QPHA 1X69A 1KHCA 3C12A 3WVDB 4OMLA 4A54A 4KUIA 4OVAA 5CKDA 4A4HA 3J81E 2LJ3A 1M90C 2DIGA 3MHXA 2PUKB 3ZFJA 4R56A 1Y96B 5KH6A 4J9GA 4MMKA 2ATCB 1AHJB 5HK0A 2ZAEA 3QWYA 4NL2A 3I56Q 1SF9A 3EGXA 3CCLT 3ASKA 3FJ5A 1PRMC 2KI7A 2OTJQ 1I5OB 5GAMf 2DNUA 1M3CA 2CGHA 2RD1A 3VS3A 2KBTA 1VQOT 2M51A 1YITT 2CS7A 2H3JA 1HXDA 3PE0A 4JRKA 2LMJA 3EHQA 2XHCA 1X6OA 5LJ3d 4FYWB 1Q7YU 2RQUA 4J9EA 5KE2A 1M1FA 4IUVA 5LJ3e 1XNIA 4RG2A 2CH4W 3M5AA 5CQXA 4RTYA 1YN8A 5D7UA 1SSHA 2R5AA 2RI2A 1VQMT 2LJ1A 1D1BA 2J6OA 5GANd 1KHIA 2A3LA 3JCMh 3JB9F 4JRPA 1WZOA 2ENMA 3LGFA 3WVEB 5GANe 4PFPA 3URGA 1Y71A 2PQWA 2F5KA 3PMTA 1KFZA 3L2ZA 2X3XD 4C0DB 3M0TA 2KRNA 3CCUA 3GNGA 2QK0A 1I8FA 3G6ET 1S1NA 3CCJA 2Z0WA 4PJMA 1VQKA 2KQWA 1C6VX 1VQ7A 3S3OA 1JQQA 5IHKA 1BI0A 5DLOA 3CC7Q 3X26B 4J9CA 1J3TA 4LUEA 3NTHA 1PKSA 5KYUA 2EYZA 4C0DC 2RN8A 3CD6A 4C0FA 2CUBA 3RKYA 4LDXA 2J6KA 2VWFA 3JB9D 1KJWA 4J6XA 2EKHA 5GMKm 2D0NA 1Y0MA 1KD1U 2JN0A 3OYIA 2EGCA 4AFUC 2YHTA 5CKHA 2DXTA 1UEBA 1Y57A 1XOVA 3QHSA 5LJ5f 3OA6A 4ANJA 3I55Q 3H0IA 1X75C 1XQHA 4HCCA 4M7DF 2BE9B 2VB6A 4QVCA 4A4GA 3OSVA 5DY9A 1IXDA 2YSQA 4UC4A 2DXBA 2ED1A 1OX8A 3G71Q 1YJ9A 2W10A 3CC2Q 1YI2Q 3V7CA 3OYCA 4M78F 3VJPA 3CXCA 1WHGA 1ZQ1A 1NEBA 3MCAB 1LPLA 1TWBA 3TSZA 1Q7YR 5AT1B 2CZ0B 2E64A 4HA8A 1YJWA 3OMCA 1NZ9A 3PMIA 4NOYA 2A37A 1FMKA 5I21A 4M7DA 2P0PA 2HAXA 2RQWA 4M7DD 2RQTA 1QWEA 3EFSA 3OBYA 5GJWB 1G3TA 2LP5A 1H3ZA 4XK8E 1VQ9Q 1QCNA 2OX7A 3R6NA 1WFWA 4M78D 3I56T 3A98A 3M58A 4HVVA 2K3XA 4ZGJB 5DM7R 2X9HA 2QGGA 3OW2P 2KE9A 1UGRB 2AZSA 6AT1B 3TEEA 4X1VA 1D3BB 2VYTA 3G4SA 2COWA 4C92B 2YLBA 3HHTB 1GBQA 1JO8A 2MWOA 3MO8A 1KQ1A 4QQ6A 3TVTA 1TOVA 2PVGB 4C92E 5D6YA 1NYGA 2E65A 3NPFA 4LDUA 2DE0X 1VIFA 4C92C 2LCSA 1KD1R 4M77B 2FZCB 1RL2A 1VYTA 2DXUA 3OYMA 1S72T 3OYEA 3BE3A 4IKFA 5I22A 2M9UA 3L1AA 3CXCS 4LUDA 3JCMd 4M77E 3EFRA 3OYKA 1M27C 2FVUA 3HRTA 2CP7A 1OYXA 3JRZA 4Z89A 1NJIC 4M77C 3OW2A 2HKNA 3DB4A 1HK9A 4QVDA 1CSKA 1W4SA 2DXCA 3A8LB 2DRMA 3VUBA 3CBOA 4OMNA 1Q81C 3ZL7C 2QDYB 1VQ8Q 2FHDA 2JOYA 1NLPC 1JBMA 4OB3B 3AT1B 4J6WA 2CYZB 4AMCA 5GAN3 5GAOl 1ZUUA 1TG0A 3BFMA 4ZN1A 4N4GA 2EVRA 1WXUA 3VS2A 3NMZC 1UUEA 1PSEA 5GAOr 3D7SB 2LQ8A 3QIIA 1BIBA 4AG1C 1ZUKA 4HKEA 1YP5A 3I5SA 1YCYA 3S3MA 4N4IA 2FZGB 2PU9B 1TUDA 1OPKA 3UF4A 2K6DA 2D6FA 2JM9A 2EQIA 2EQUA 5FW9A 2RH2A 1ZSZA 1VQ6Q 3LH5A 2CH4A 2OAUA 3I55T 4M75A 2RK1A 3CMAQ 4PLIA 1M3AA 4M75D 2CP2A 1Q86U 1K8AC 2VXEA 1AT1B 3RMQA 3JCMV 2ESWA 4XTVA 1BYMA 4RMOA 3QZ5B 1D0ZA 2DF6A 3JB9H 3CCEA 4RTWA 1ACMB 5FWBA 2JJ9A 3OW2S 3PGGA 1AWJA 1BBZA 4BDYA 1I0CA 1M5Q1 1M2VA 2FEIA 2GCXA 1Y7XA 3EAEA 2E3HA 5D6XA 3X25B 5LJ5g 4DBQA 2DMOA 1IB8A 1RAFB 1NG2A 1LJOA 4LD6A 3RIRA 1MV0B 3M9QA 1GXIE 4A4EA 3JCMW 4XAXB 1BIAA 2NUTA 4Y92A 2ZZDA 5CK9A 4C8QF 1G3SA 2KROA 2DL5A 5GJVB 1IHVA 1IRXA 2L2PA 3QSUA 2K79A 1JB0E 1IGUA 4RCCA 1YFNA 2QA4T 2QQSA 3C4SA 3H0HA 4M75B 5HCKA 4BI8B 2K9GA 1BI2A 1I07A 3NGPA 2XG8D 1G3YA 1C1AA 3I35A 3LYIA 5HY6A 2DTIA 2DKGA 4RTXA 3OMGA 1AWXA 1W6XA 3EGUA 1QWFA 2PVDB 4IUTA 4E7SA 1ZLMA 2LTOA 2KSSA 1NBEB 4M7DG 3LGLA 1QLYA 2B8AA 4FCYA 3UPUA 1YNZA 4FW1A 4JDSA 4C8QA 1SHGA 3BY7A 3MP8A 3OYYA 3CCMQ 4C8QD 2EBPA 1YITQ 4XTZA 2D1XA 2L3RA 4OMQA 1M2VB 2EQMA 3JV3A 2GQVA 4BI3A 4C5GA 3SDZA 3CCQT 1KQ2A 1D0XA 1PWTA 1Q86R 2D8HA 3PFSA 1WNLA 2K3BA 5IT9E 5IAYA 4HCZA 2HBWA 2QQ9A 3VS0A 2R5MA 1BK2A 3CCRT 2O4XB 2GFUA 1E7OA 2MAMA 1VQMQ 4J9IA 2EQJA 3JCMJ 1YHQT 2NUTB 4M7AB 2EJ9A 3OB9A 2E6ZA 1O75A 1TSFA 3HRSA 3UT1A 1Q82C 3OYGA 3M0PA 1WYXA 2DTOA 2KRSA 1MV3A 4QQGA 3JCMQ 1D09B 4M7AE 5CO7A 2Y4XA 2DM1A 4ELYC 3TCJA 3G6EQ 3UWNA 1WQWA 4M7AC 4WCIA 4E6RA 3OYAA 3M0QA 1VQLT 4PFOA 2IIMA 5ECAA 3GBQA 3CCST 2L0AA 3RNJA 2E5KA 1PD1A 2EW3A 1WHJA 3MEVA 2RHUA 1Y96A 2OAWA 1VQ5T 4BUGA 3EH2A 1QKWA 2FO0A 1IO6A 5L23A 5CIUA 5GAMh 2RMOA 2X4YA 3TREA 4XTWA 5FLXE 3IQLA 1BI1A 1MMDA 2YUNA 4PL6A 2JZ2A 5FROA 1IGQA 1W2BP 4CI0C 3LW5E 5GMKe 4C0ZA 1HD3A 2J6FA 3NTIA 3JCMc 1RI9A 3JB9J 2I0NA 1WJQA 1IHWA 1OQKA 5A2QE 2PTKA 3RUXA 3CMET 2VUBA 2DYIA 3RR6A 1V1CA 2BTTA 3JB9I 3A5ZB 2J06A 2QEXA 1RACB 4PK4A 4B6MA 4PKCC 3RESA 1KD1C 4OB2B 2DZCA 3V8JA 4IURA 2HEQA 3PNWC 4M75G 1ZX6A 1VQNQ 2KXCA 5LJ3f 2CZ7B 3QJYA 2QQBA 9ATCB 1MMAA 1VIEA 1SRLA 1Z9QA 2X4XA 3H0FA 1AOJA 2LCLA 3CCLA 2RI3A 4ZGDB 2YWWA 3EG0A 4FT4A 4J6YA 1VQ4T 4RCBA 1W2BA 4LXCA 2EPDA 1W1FA 5D6WA 1B34A 1K9MC 5GANf 3L42A 5GAMj 1U8RA 5J26A 1YIJQ 3A1PA 1T3LA 3M57A 2DK3A 2M02A 1WXBA 2DERA 3E9GA 5GAOm 1E6HA 1VQPA 4C0GA 3GOXA 1UGSB 1BI3A 1UFFA 3G1JA 3DB3A 3CCMT 2YUQA 3JCMX 4ATOA 3E1SA 2ECZA 3LWIA 1BCOA 2OJ2A 1JRIA 3F70A 4BE1A 1U06A 4WF2A 4ZTJA 3PT9A 5KYXA 3RMSA 4IIMA 1S72Q 1V29B 1OU8A 1AWOA 3PVLA 4PFZA 1K4US 3HRUA 5DLQE 5HKCA 4F7UA 2QTVA 5IHIA 1IZ6A 2J05A 4R0KA 2HL3A 5FU7C 3E19A 4PLLA 4J7IA 2DJQA 2XDBA 2M1HA 1R77A 4PJOE 4IUQA 4DOWA 3HL8A 3EG9B 3P8BB 1VUBA 2GQIA 3META 4RTZA 4PJOC 4C8QG 1B34B 4FIBA 1M1GA 3E2UA 1W2BS 3REAB 2XKOC 2V8IA 2RK2A 3OBWA 4TVRA 3QDRB 3C0CA 2DL3A 2DTHA 1FMVA 2F69A 4JJDA 1NLOC 1ABQA 3M59A 3JCMb 2E5QA 2LC4A 4C92F 2Y90A 2ROLA 3FDRA 4EDUA 2GBQA 4ZTFA 1G3WA 1SHFA 4HT9A 1ZHIA 2V1RA 5FRNA 5LJ5j 5GAMd 1YJNA 1QMCA 1CKAA 2KEAA 4LD9K 5KCOA 1UGPB 2L3SA 1AVZC 4M77F 1B3QA 4OP0A 3R6OA 1OEBA 2HBPA 1YWOA 2BZYA 3CCUT 1LVKA 4IIOA 5GAN8 2I2LA 4HXJA 5KYXB 3CCJT 2J7IA 1D3BA 2DPPB 4C92A 1VQKT 1VQ7T 4C92D 1XTDA 2X3WD 3OYJA 3WXMB 4ELZC 4F7UB 2XMFA 3FJPA 3CD6T 4E7KA 3JAME 5I2SA 4KUDK 4A4FA 4F7UE 2V1QA 4M77A 7AT1B 3CBPA 2DEUA 2H3EB 4M77D 2RJDA 2HD0A 2PNIA 4FYYB 1VQNT 1AD5A 1RUWA 3MEUA 1KIKA 2MCNA 3HFNA 5GAOp 4BE0A 3QYGB 4OMOA 4GLMA 4CC2A 5EG2A 1NE8A 3OYFA 1Q86C 2DAQA 4NS5A 1LCKA 3M53A 3JCMf 1UG1A 2OTJA 4AG2C 2CKKA 1E6GA 2YRVA 2CP6A 5A0DA 1YIJT 1ZBXA 2JTFA 2YDLA 1NYFA 2GGRA 1QCFA 1YJ9T 1X27A 2D8JA 3VRYA 3FC3A 1M8MA 4B9XA 3SHWA 2P0QA 3QG1A 1YBYA 4K11A 4C5IA 3HP9A 2QA4Q 1X43A 1WHHA 3H41A 5LJ3g 1UGQB 1QVFP 2PUOB 2QASA 1WXTA 4HVUA 4BB7A 5I11A 1PC0A 4Q5WA 4L6V5 2FZKB 4HCBA 4JS4A 4A53A 2BZXA 3UA7A 2GTOA 5GANg 4QT7A 2HL5C 3GLXA 1G83A 3NFCA 2FYKA 1I4K1 3O5ZA 5CKBA 3M54A 8AT1B 4X9DA 3VYGA 4J5YA 1ZUYA 2RHXA 1YCSB 2AIRB 1OOTA 2HKQB 2CDTA 3CCQQ 3VS5A 1P92A 1JU5C 3FB9A 2ZPHB 3PIPA 3G4ST 3JCMe 1K0SA
chains in the Genus database with same CATH topology
4DQ2A 3CC7A 2XG8D 5GAOq 1WJRA 4MZMA 1G3YA 3OS5A 3LYIA 3BDUA 5HY6A 5CCAA 1KC8C 2DTIA 4FSXA 4OMFB 2DKGA 2D9TA 2NLUA 2QQRA 3T9NA 5GAMe 4BE2A 3OMGA 1KC8U 2X35A 1QVFA 1N9RA 2XD0A 2PVDB 4FL6A 4IUTA 4KULA 3HFOA 2DVEA 3FLGA 1H641 2LTOA 2KSSA 3SD4A 2LNVA 2E12A 3J80E 3LGLA 4M7DG 2QTXA 2B8AA 2RJCA 4MMLA 1QP2A 2E1HA 3UPUA 2M16A 4JDSA 4M75F 1SSFA 2XICA 3BY7A 4C8QA 1VQNA 4V2SA 4BACA 3MP8A 3OYYA 4C8QD 5GAN2 3CCMA 4JJNK 4BD3A 1QW1A 2L89A 4EMGA 3P8DA 2MWPA 5FRMA 3CCVA 3QPHA 4XTZA 4XU3A 3ZBDA 1KHCA 2K5FA 2L3RA 3C12A 3WVDB 3CPWA 4OGCA 4Y91A 4JS5A 2EQMA 1YJNT 2RHYA 3GP8A 2GQVA 4A54A 4KUIA 4OVAA 4BI3A 4A4HA 5CKDA 3J81E 1M90C 2DIGA 4C5GA 3MHXA 3SDZA 3CCQT 1M90U 4F7UG 2PUKB 1KQ2A 3ZFJA 3QKJA 1Y96B 4OB0B 2KDSA 5KH6A 4R56A 3PFSA 4MMKA 1K9MU 2LX9A 2Y4YA 1Y07A 2ZCFB 2QI2A 1AHJB 1WNLA 5IT9E 5IAYA 5HK0A 4HCZA 1YIJA 1TH7A 2QQ9A 4JLGA 2R5MA 3VUZA 4EPCA 3CCRT 2O4XB 3FEOA 4NL2A 3RKWA 2GFUA 2EQKA 3CCLT 3ASKA 2MAMA 3E9FA 4BY6B 3I56A 2EQJA 3G71A 3C95A 5GAN6 3M56A 3JCMJ 3CC2A 1YHQT 1WQ7A 3N5BB 2MMPA 4M7AB 1YI2A 2EJ9A 3OB9A 1LNXA 2E6ZA 1O75A 5GAMf 1M4ZA 3HRSA 3UT1A 1Q82C 3S3NA 3QUIA 3OYGA 2RI5A 3BW1A 4II1A 2CGHA 2DIQA 2DTOA 2RD1A 4QQGA 3JCMQ 1VQOT 1YITT 5IN1A 3A8HB 2CS7A 2H3JA 4M7AE 3KUFA 1BKBA 5CO7A 1HXDA 4E7JA 2Y4XA 2KK4A 4BY6C 4JRKA 4ELYC 3TCJA 3UWNA 1WQWA 3HSBA 4M7AC 3A8MB 2F5TX 2XHCA 4M7AF 3FIFA 1X6OA 2ZPGB 5LJ3d 3ZEHA 1Q7YU 3CPFA 3H6ZA 3OYAA 4XU1A 5KE2A 1VQLT 1YJWT 1M1FA 3ER0A 4IUVA 4N0AA 1QVFS 5FU6B 5LJ3e 1XNIA 5LJ5d 3CCST 3LWHA 4RG2A 4PJOG 1VQ9A 3OS0A 4ME7A 4M78A 1S72A 3M5AA 5CQXA 3MEVA 2RHUA 4MDXA 4OB1B 1Y96A 3LLRA 2R5AA 1VQ5T 2RI2A 4FU6A 4BUGA 4DA4A 5LJ5e 1VQMT 5GANd 1N9SA 1KHIA 2WSEE 2LQKA 2A3LA 3JCMh 3JB9F 2OTJT 3OQ5A 5CIUA 5GAMh 4JRPA 2X4YA 4LDWA 3TREA 4GY5A 2V8KA 3LGFA 4XTWA 3WVEB 4C92G 3LH0A 5FLXE 2O4XA 2HNIA 2VGNA 3A8GB 3V8LA 3URGA 1BI1A 5FU6C 5GANe 1Y71A 2EFIA 2PQWA 3CPWS 3S6WA 2RHIA 3CCET 4M7AA 2F5KA 3PMTA 3L2ZA 4EMKC 4PL6A 4PNOA 4C0DB 2JZ2A 5FROA 3CCUA 4M7AD 3GNGA 3UDCA 1I8FA 4CI0C 3LW5E 5GMKe 4XQ3A 3G6ET 1RI0A 4C0ZA 1WGSA 3NTIA 3CCJA 3JCMc 1M8VA 3X28B 1VQKA 1FWZA 2KQWA 3JB9J 1WJQA 5A2QE 1VQ7A 3S3OA 3FRNA 1I81A 1BI0A 3CMET 3RUXA 5DLOA 1O9SA 4M77G 2L5QA 3X26B 2K5IA 5C0MA 5GMKl 2VUBA 2EAYA 3NTHA 3JB9I 3A5ZB 1N8RC 2KVQG 4C0DC 3CD6A 4C0FA 1N8RU 2EKOA 2QEXA 1NPPA 3RKYA 4E7LA 4LDXA 3OY9A 3JB9D 2E41A 4MDWA 3ME9A 4J6XA 3X20B 4PKCC 4Z02A 3RESA 1KD1C 4OB2B 4P5NA 3LX7A 5GMKm 2DZCA 3V8JA 4IURA 4L5GA 2JNGA 3PNWC 3JCMg 2CZ1B 2JN0A 4M75G 1KD1U 5GAMg 4M7DB 4EMKA 2DO3A 3OYIA 5LJ3f 2CZ7B 2P4TA 1WPYA 3QJYA 2QQBA 4JRIA 2YHTA 5CKHA 2DXTA 1M9SA 1UEBA 1VIEA 2R58A 3DLMA 3OYBA 3DLLA 1XOVA 3QHSA 4C5EA 2X4XA 2ZGWA 2BIVA 5LJ5f 3OA6A 2EIFA 2GFAA 4M7DE 4QW2A 2OTLA 3G7ZA 2A7YA 2ZPBB 4OF1A 2D0QB 4QVZA 2LCLA 3VKIA 3I55A 2RI3A 4YTLA 1X75C 4FT4A 1XQHA 2ZPIB 4J6YA 4RCBA 4ZGDB 3Q1JA 3NTKA 4M78B 4MZPA 1VQ8A 4HCCA 5D6WA 4M7DC 1B34A 1K9MC 5GANf 3L42A 4M7DF 2HQEA 5GAN7 3CC7T 3QO3A 5GAMj 4QVCA 1U8RA 4A4GA 5J26A 2ZPEB 5LL6S 4J7FA 3OSVA 1QP3A 5DY9A 3VYHB 2PVOB 4M78E 3M57A 2DK3A 2K5LA 4UC4A 2MF2A 2DXBA 4GLKA 4N0AC 1N6AA 1YJ9A 3E9GA 5GAOm 3V7CA 3OYCA 4M78C 1VQPA 4M78F 3VJPA 4C0GA 3GOXA 4XU0A 2XU8A 3SWNB 3A8OB 1UGSB 1BI3A 1ZQ1A 3V7RA 3CXCA 3MCAB 3V8KA 4NL3A 3DB3A 2KMTA 5LJ3h 3L2UA 3TU4K 3CCMT 2CZ0B 2E64A 2E6NA 3P8HA 4HA8A 1YJWA 4IUPA 4LD9K 3OMCA 3MEWA 1W2BA 3JCMX 1NZ9A 3PMIA 2WSCE 1MHNA 4NOYA 4ATOA 3E1SA 5I21A 1VQ6A 3LWIA 4M7DA 4E47A 4X9CA 2XDPA 2K4YA 3QXEB 3JSCA 3L2VA 2P0PA 2HAXA 4M7DD 3X24B 3EFSA 2AHJB 2YLCA 3OBYA 4KBMB 3CMAA 1Q7YC 1PSFA 1G3TA 1JRIA 3SWNC 3F70A 4BE1A 2E70A 3PTAA 2GF7A 1K8AU 4WF2A 4ZTJA 1NPRA 3MP6A 1H3ZA 1KG1A 1JJ2A 2XDDA 3PT9A 3RMSA 4XK8E 2IVWA 1I5LA 2RHZA 4Y28E 1V29B 3QYHB 5GMKh 4EMKB 3L2WA 2FL7A 3HRUA 5DLQE 2XK0A 4M78D 3I56T 5HKCA 4F7UA 3G71T 3OYHA 2CZ6B 3CC2T 4OGEA 1YI2T 3M58A 1IZ6A 2K3XA 4ZGJB 5FU7C 2VC8A 3E19A 4PLLA 4O6JA 5DM7R 4J7IA 3JB9G 2EJFA 2XDBA 2M1HA 4D6WA 1DJ7B 1UGRB 4PJOE 4IUQA 4DOWA 4B9WA 5GAOn 3TEEA 3HL8A 5CR2A 2WACA 2QA4A 1D3BB 2VYTA 3P8BB 3G4SA 4C92B 5J39A 2YLBA 1VUBA 3HHTB 3KBGA 3META 1QVGA 3CBMA 3OSSC 4PJOC 4C8QG 2QXFA 1B34B 4FIBA 3H8ZA 2P0KA 4LDYA 3SWNA 2MWOA 1M1GA 3MO8A 1W2BS 1KQ1A 4QQ6A 1FX7A 1U1SA 2XKOC 2V8IA 2RK2A 3OBWA 4TVRA 3CC4T 3QDRB 2M0OA 2PVGB 1MGQA 4C92E 5D6YA 2DTHA 2F69A 2LT1A 3OYLA 1Q81U 2E65A 4LDUA 1OZ3A 4J8OA 5GAN4 3M59A 1VIFA 1WJSA 4C92C 2E5QA 3JCMb 2LC4A 4C92F 4IUUA 2Y90A 3FDRA 1RL2A 4M77B 5L8RE 4EDUA 5LJ3j 1VQ9T 2DXUA 3V7SA 3VV0A 3OYMA 1S72T 3AHUA 4ZTFA 1G3WA 4HT8A 3O8VA 3OYEA 3M4GA 4IKFA 4RKUE 4LDVA 4XTYA 2M9UA 3L1AA 4HT9A 1ZHIA 3CXCS 5FRNA 3JCMd 5LJ5j 4RG8A 5GAMd 4M77E 3EFRA 1YJNA 5J3BA 3OYKA 3KXTA 2FVUA 4XTUA 5I2MA 3PIOA 3HRTA 2DD4A 1OYXA 2K57A 1UGPB 2JUFA 3JRZA 2X4JA 5KCOA 3CCQA 1NJIC 4QQDA 2EYQA 4PJOA 4CRIA 5GANj 4PJOD 4M77C 3OW2A 3DB4A 4M77F 1HK9A 4OP0A 3M4YA 3R6OA 4QVDA 1NJIU 2HBPA 1W4SA 5GAN5 2DXCA 2RM4A 3HPWA 3A8LB 3CCUT 3VUBA 3CBOA 1X01A 4DOVA 2JTMA 2K2VA 3C94A 4JRQA 5GAN8 1Q81C 2I2LA 4JLIA 5GMKj 4M75E 3CCJT 3CCRA 1D3BA 2DPPB 2E10A 4C92A 3OS1A 1VQKT 3SB2A 2QDYB 3L2QA 2FHDA 2JOYA 1VQ7T 4XTXA 4C92D 1JBMA 1XTDA 4OB3B 1YHQA 1JJ2S 4J6WA 2CYZB 5GAN3 2LCCA 3WXMB 5GAOl 4M75C 4ELZC 3OYJA 4A4KA 4F7UB 2KAFA 3QJ6A 3RERA 3JCMP 1G5VA 2WSFE 3OYDA 3FJPA 3BFMA 1UB4A 4ZN1A 3CD6T 4N4GA 4J83A 4C5HA 4EMHA 3QZ9B 3BDLA 5KCHA 2QEXT 2BKDN 1VQOA 1YITA 3SFMA 2RJEA 3MEAA 3QBYA 2DEQA 4E7KA 1PSEA 3JAME 5GAOr 5I2SA 4KUDK 2LQ8A 4A4FA 4F7UE 3QIIA 1BIBA 3VU3C 5HK3A 2LRQA 1M1KC 4HKEA 4M77A 2V8JA 4M78G 1M1KU 3CBPA 1YCYA 3GPLA 1U1TA 2RJDA 4M77D 2HD0A 4N4IA 4KT0E 3S3MA 1FXXA 3J7AF 1QVGS 1VQNT 5A0GA 2PU9B 4F7UF 3CEYA 4E7IA 2RO0A 3MEUA 1LOJA 1VQLA 3HFNA 2DZ9A 3INZA 5GAOp 3GNFB 3QYGB 3OYNA 3CCVT 4BE0A 2D6FA 2RB6A 1OZ2A 2EQUA 1EIFA 3CCSA 2KY9A 2MI6A 2ZPFB 1KQSA 2RH2A 4X34A 4L59A 5LJ5h 5EG2A 2OAUA 2OTLT 1NE8A 3OYFA 3I55T 2C06A 4M75A 2LDMA 4BI4A 2RK1A 1Q86C 2DAQA 4M7AG 4PLIA 4NS5A 1VQ8T 1VQ5A 5M9OA 4M75D 1VQMA 1OI1A 1Q86U 3M53A 1K8AC 4XU2A 5FU7B 3JCMf 5GANh 2VXEA 4BDZA 3RMQA 3JCMV 2OTJA 4XTVA 3GIBA 1BYMA 3MP1A 2CKKA 2YRVA 2VV5A 5A0DA 1Q82U 4RMOA 1YIJT 1ZBXA 2EJGA 2JTFA 3QZ5B 2HQXA 3JB9H 5AYFA 4R55A 1N27A 2L8DA 4PJOB 3CCEA 5CAIA 1R8OB 5GMKi 1YJ9T 4FT2A 1QVPA 2VXFA 2JVVA 3FC3A 1VQPT 4B9XA 2P0QA 3G6EA 3CC4A 3QG1A 3OW2S 3PGGA 1YBYA 4C5IA 3GF5A 2LVMA 3HP9A 5CKFA 4BDYA 3HKSA 1M5Q1 2DD5A 5LJ3g 3CMEA 2RA2A 1UGQB 2GCXA 3DKMA 2BUDA 1Y7XA 2XI9A 2PUOB 4ZGEB 2DJZA 4BB7A 4ZN3A 2XIDA 5CKEA 2IG0A 4MZTA 4Q5WA 4PJOF 4L6V5 1VQ6T 3EAEA 4C8QB 3RKXA 5D6XA 3X25B 5LJ5g 2QQAA 4HCBA 4JS4A 3CMAT 4A53A 4VUBA 3M55A 4E7HA 4FM4B 5KE3A 5CVIA 2VGMA 2G3RA 5CQYA 3GLXA 5GANg 1LJOA 4C8QE 4LD6A 4O5VA 3NFCA 3RIRA 2FYKA 1I4K1 3M9QA 1GXIE 5CKBA 4A4EA 3JCMW 3M54A 4XAXB 1BIAA 1K73C 4X9DA 3VYGA 2K3YA 4J5YA 4N4HA 2ZZDA 2RJFA 4C8QC 5CK9A 1K73U 4C8QF 1G3SA 3L2RA 2O01E 2RHXA 2EWNA 3CCLA 5C6SA 3QSUA 1VQ4T 1JB0E 2X4WA 1VQ4A 4RCCA 3OS2A 1IREB 4JUVA 1P92A 2QA4T 3FB9A 2FB7A 2ZPHB 3PIPA 3G4ST 5A0LA 2QQSA 3C4SA 4M75B 2LT4A 2R57A 4BI8B 3JCMe 1BI2A 1KQSS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQ2 A;  5GAM h;  4M7D D;  3EFS A;  2DEQ A;  2YLC A;  5GAO q;  4XTW A;  4C92 G;  5GAO r;  3SWN C;  1JRI A;  3BDU A;  4F7U E;  5GAN e;  2HNI A;  1BIB A;  3VU3 C;  2DTI A;  3V8L A;  2DKG A;  4WF2 A;  4M77 A;  4M78 G;  5GAM e;  1N9R A;  1YCY A;  4M7A A;  1U1T A;  4M77 D;  3L2Z A;  4EMK C;  4PNO A;  3HFO A;  4M7A D;  2DVE A;  4F7U F;  1H64 1;  1I5L A;  1I8F A;  5GMK e;  4XQ3 A;  4M7D G;  5GMK h;  1LOJ A;  3HFN A;  2QTX A;  4EMK B;  2DZ9 A;  3INZ A;  4MML A;  2E1H A;  4M78 D;  4M75 F;  3JCM c;  4C8Q A;  5GAO p;  2RB6 A;  3BY7 A;  4F7U A;  3JB9 J;  4V2S A;  4C8Q D;  1I81 A;  5LJ5 h;  5GAN 2;  3RUX A;  2VC8 A;  3JB9 G;  4M77 G;  4EMG A;  2EJF A;  4M75 A;  5GMK l;  4XTZ A;  4XU3 A;  4M7A G;  2EAY A;  4PJO E;  4M75 D;  3JB9 I;  5GAO n;  1D3B B;  4XU2 A;  4Y91 A;  4C92 B;  3JCM f;  2YLB A;  5GAN h;  2VXE A;  3JCM V;  4A54 A;  4XTV A;  3RKY A;  3GIB A;  3JB9 D;  2E41 A;  4PJO C;  4C8Q G;  1B34 B;  4F7U G;  1KQ2 A;  3SWN A;  2EJG A;  4J6X A;  1Y96 B;  1KQ1 A;  3RES A;  3JB9 H;  1U1S A;  4MMK A;  5GMK m;  2DZC A;  3V8J A;  4PJO B;  3JCM g;  1WNL A;  2JN0 A;  1MGQ A;  4M75 G;  4C92 E;  5CAI A;  2DTH A;  5GMK i;  4EMK A;  5GAM g;  4M7D B;  1TH7 A;  2E65 A;  2VXF A;  5LJ3 f;  5GAN 4;  1WPY A;  4JRI A;  2YHT A;  4NL2 A;  3RKW A;  4C92 C;  2DXT A;  3PGG A;  4C92 F;  3JCM b;  2Y90 A;  4M77 B;  5GAN 6;  3QHS A;  5LJ3 j;  3JCM J;  2ZGW A;  2DXU A;  3V7S A;  1WQ7 A;  5LJ5 f;  3AHU A;  4M7A B;  2EJ9 A;  4HT8 A;  4M7D E;  1M5Q 1;  1M8V A;  5LJ3 g;  3M4G A;  2RA2 A;  1LNX A;  5GAM f;  4XTY A;  2DJZ A;  4J6Y A;  3QUI A;  3L1A A;  4RCB A;  4HT9 A;  4M78 B;  4PJO F;  3BW1 A;  5LJ5 j;  3JCM d;  2CGH A;  2RD1 A;  1B34 A;  2DTO A;  5GAM d;  5GAN f;  4M77 E;  4C8Q B;  3EFR A;  3JCM Q;  3RKX A;  4M7D F;  5LJ5 g;  5GAN 7;  3QO3 A;  4XTU A;  5GAM j;  4M7A E;  4QVC A;  4A53 A;  2K57 A;  4PJO A;  1HXD A;  5DY9 A;  4JRK A;  5GAN j;  4M77 C;  4PJO D;  4M77 F;  4M78 E;  1HK9 A;  4OP0 A;  4QVD A;  1WQW A;  5GAN g;  3HSB A;  4M7A C;  1LJO A;  5GAN 5;  4M7A F;  2RM4 A;  3FIF A;  4N0A C;  4C8Q E;  5LJ3 d;  3RIR A;  2FYK A;  1I4K 1;  1X01 A;  3JCM W;  5GAO m;  3V7C A;  1BIA A;  5GAN 8;  4M78 C;  4X9D A;  2I2L A;  4XU1 A;  4M78 F;  4JLI A;  5GMK j;  4J5Y A;  4M75 E;  4XU0 A;  3SWN B;  1D3B A;  3V7R A;  4C8Q C;  4N0A A;  2E10 A;  4C8Q F;  4C92 A;  3V8K A;  3SB2 A;  5LJ3 e;  4NL3 A;  5LJ5 d;  4M7D C;  4PJO G;  5LJ3 h;  4XTX A;  4C92 D;  1JBM A;  2EWN A;  4HA8 A;  2E64 A;  4J6W A;  4M78 A;  5GAN 3;  3QSU A;  5GAO l;  4M75 C;  4F7U B;  1Y96 A;  3RER A;  3JCM P;  3JCM X;  4NOY A;  4RCC A;  3FJP A;  5LJ5 e;  3BFM A;  4JUV A;  1N9S A;  5GAN d;  3FB9 A;  2FB7 A;  4EMH A;  5I21 A;  3JCM e;  4M7D A;  4M75 B;  4X9C A;  3JCM h;  3JB9 F; 
#chains in the Genus database with same CATH topology
 2F2X A;  3CC7 A;  5GAO q;  3BDU A;  2EGE A;  2QQR A;  1QVF A;  4BE2 A;  2X35 A;  1N9R A;  3CCR Q;  2XD0 A;  1ARK A;  2DVE A;  1YHQ Q;  4ESR A;  3SD4 A;  2LNV A;  2CP3 A;  2E12 A;  2LNH B;  4WTO B;  2QTX A;  2RJC A;  2EYX A;  4M75 F;  5KYN A;  2XIC A;  4ORZ A;  5EC7 A;  5GAN 2;  1SKU B;  5FRM A;  2MWP A;  1VOM A;  1RAB B;  4OGC A;  4Y91 A;  1KSW A;  4JS5 A;  3GP8 A;  4DEX A;  4F7U G;  1H92 A;  3QKJ A;  4OB0 B;  2KDS A;  2LJ0 A;  2ROT A;  1VQL Q;  1PKT A;  3NHN A;  2Y4Y A;  1Y07 A;  2ZCF B;  2QI2 A;  3CCS Q;  1TH7 A;  1D0Y A;  3VUZ A;  1WIE A;  4EPC A;  3FEO A;  2EQK A;  1VQ5 Q;  2MIO A;  3G71 A;  3C95 A;  5GAN 6;  3M56 A;  3CC2 A;  3KFV A;  2MMP A;  1YI2 A;  1LNX A;  1M4Z A;  2KYB A;  4J9B A;  2RI5 A;  3BW1 A;  2DBK A;  4II1 A;  2DIQ A;  2DL4 A;  1OUL A;  2KXD A;  5IN1 A;  4OMM A;  2EGA A;  1RAA B;  3H9N A;  3KUF A;  4E7J A;  1WA7 A;  2KK4 A;  2KT8 A;  3CC4 Q;  2FPF A;  1WI7 A;  3HSB A;  2DYB A;  3A8M B;  4M7A F;  1TTH B;  2KT1 A;  3ZEH A;  3CME Q;  3M0R A;  3MPU B;  4N0A A;  1QVF S;  5FU6 B;  1CKB A;  4D8D A;  1VQ9 A;  3OS0 A;  5KYW A;  4RTT A;  2QDL A;  1OX9 A;  1WDX A;  1KK7 A;  4FU6 A;  4DA4 A;  2VKN A;  1NM7 A;  2LQK A;  2H8H A;  3OQ5 A;  2JW4 A;  4GY5 A;  4C92 G;  2O4X A;  2HNI A;  2VGN A;  3V8L A;  4E7Z A;  5FU6 C;  2EFI A;  2RHI A;  3CCE T;  4M7A A;  4EMK C;  4PNO A;  4M7A D;  1T0H A;  2O31 A;  3PVQ A;  2W0Z A;  4XQ3 A;  1WHK A;  1VQ4 Q;  3TQ7 P;  1AZG B;  1I81 A;  2EYW A;  4M77 G;  2GTJ A;  2L5Q A;  5GMK l;  2K5I A;  1VYU A;  2EAY A;  2KVQ G;  1QQJ A;  1N8R U;  2EKO A;  5IXB A;  4KH0 B;  4E7L A;  4GBQ A;  4MDW A;  4P5N A;  4KH1 B;  3LX7 A;  4L5G A;  2DVJ A;  2JNG A;  3JCM g;  2CZ1 B;  2DO3 A;  2X51 A;  4LE9 A;  2P4T A;  2B86 A;  4JRI A;  3CCV Q;  3DLM A;  3DLL A;  4C5E A;  2BIV A;  2EIF A;  4QW2 A;  2OTL A;  2JT4 A;  1Q81 U;  4OF1 A;  3VKI A;  1UJY A;  4YTL A;  2ZPI B;  1VQ8 A;  3Q1J A;  3NTK A;  5KYW B;  3EG3 A;  2HMA A;  5GAN 7;  1X6B A;  2FPD A;  3QO3 A;  4DBH A;  2RF0 A;  3CQT A;  2JS2 A;  3VYH B;  2K5L A;  2MF2 A;  4N0A C;  1N6A A;  2JMC A;  1JEG A;  4CC4 B;  4XU0 A;  2XU8 A;  3SWN B;  3A8O B;  1WHL A;  4NL3 A;  5IHN A;  5LJ3 h;  3L2U A;  3TU4 K;  2E6N A;  3P8H A;  4IUP A;  3MEW A;  4Z8A A;  2WSC E;  1MHN A;  1PRL C;  1VQ6 A;  2P4R A;  1GCQ C;  3JSC A;  3L2V A;  3X24 B;  4KBM B;  1TXQ A;  2AHJ B;  2YLC A;  1BCM A;  3CMA A;  1Q7Y C;  3SWN C;  2CSI A;  3PTA A;  2GF7 A;  1K8A U;  1NPR A;  1KG1 A;  2C0T A;  2XDD A;  1EX4 A;  2A08 A;  2HDA A;  2FG0 A;  2IVW A;  1I5L A;  2COY A;  1OPL A;  2EYY A;  3L2W A;  2FL7 A;  2XK0 A;  4OGE A;  1I1J A;  2O88 A;  2VC8 A;  1RAH B;  2ED0 A;  2K2M A;  1PM3 A;  5IH2 A;  2FPE A;  4B9W A;  5CR2 A;  5J39 A;  1UHF A;  1GCP A;  3CCU Q;  2L3P A;  2V26 A;  2MPX C;  1FX7 A;  3UA6 A;  1N8R R;  3CC4 T;  3CCJ Q;  2M0O A;  1VQK Q;  3OYL A;  1VQ7 Q;  4J8O A;  5GAN 4;  3EFO B;  1MUZ A;  1B7T A;  4IUU A;  5LJ3 j;  3V7S A;  3AHU A;  3CD6 Q;  2MK5 A;  5KYY B;  4HT8 A;  3O8V A;  3M4G A;  2QYZ A;  5FWC A;  4RKU E;  4LDV A;  3EH1 A;  4RG8 A;  3KXT A;  3TSW A;  4XTU A;  5I2M A;  1HSQ A;  3PIO A;  1ZSG A;  1Q81 R;  2DD4 A;  4KGV B;  4JPB W;  4PJO A;  1EFN A;  4QQD A;  2A28 A;  2EYQ A;  1UJ0 A;  5GAN j;  4PJO D;  2ABL A;  1KQS P;  3M4Y A;  1UHC A;  3VS4 A;  2RM4 A;  3EGD A;  1UEC A;  1X01 A;  2LQW A;  4DOV A;  2K2V A;  3C94 A;  4JRQ A;  2JTE A;  4JLI A;  1H3H A;  3MKD A;  3EG9 A;  3OS1 A;  1T0J A;  4XTX A;  2HSE B;  2KAF A;  1ZBJ A;  3QJ6 A;  3RER A;  3JCM P;  1G5V A;  1Z9Z A;  4AT1 B;  3QZ9 B;  3BDL A;  4EMH A;  5KCH A;  2QEX T;  2BKD N;  1SG5 A;  1VQO A;  1YIT A;  3MEA A;  2DX1 A;  1YJ9 Q;  1GL5 A;  2OI3 A;  2LRQ A;  1BU1 A;  2V8J A;  3VS6 A;  1M1K U;  2NUP B;  3J7A F;  1U1T A;  1M3B A;  4E2F B;  4KT0 E;  2SEM A;  4F7U F;  3CEY A;  2K7A A;  4E7I A;  1YJW Q;  2RO0 A;  1K8A R;  3OYN A;  3GNF B;  3ULR B;  3CCV T;  2MYS A;  2RB6 A;  3RDV A;  1OZ2 A;  1EIF A;  2KY9 A;  2MI6 A;  2ZPF B;  1KQS A;  2DET A;  4X34 A;  5LJ5 h;  4AFQ C;  1GBR A;  4M7A G;  5M9O A;  1VQM A;  3HTR A;  5FU7 B;  4OMP A;  3MP1 A;  2VV5 A;  1Q82 U;  2EJG A;  2HQX A;  5AYF A;  4R55 A;  1N27 A;  3I9Q A;  2L8D A;  4PJO B;  1TS9 A;  4Z88 A;  5CAI A;  5GMK i;  2IPO B;  1VQP T;  3G6E A;  3EGD B;  2L3Q A;  3GF5 A;  2LVM A;  4RUG A;  2QGF B;  3G4S Q;  2E4H A;  1TU0 B;  4ZN3 A;  2BUD A;  2DJZ A;  1ZA1 B;  1M2O A;  3QDF A;  2XID A;  5CKE A;  2IG0 A;  2NYS A;  1RAI B;  3RKX A;  2CP5 A;  2QQA A;  1WX6 A;  1AZE A;  4VUB A;  1GFC A;  3M55 A;  4FM4 B;  5KE3 A;  5CVI A;  2VGM A;  4DEY A;  2CP0 A;  3I5R A;  4O5V A;  3VS1 A;  1UGV A;  4M4Z A;  4PJL A;  2PZ1 A;  2K3Y A;  3CPW P;  2RJF A;  1K73 U;  2E3I A;  2GNC A;  2DRK A;  3L2R A;  1K9A A;  5C6S A;  1PG5 B;  1X6G A;  2X4W A;  3OS2 A;  4JUV A;  2G6F X;  3EGX B;  2LT4 A;  2R57 A;  5GAM e;  1KQS S;  2COZ A;  1OU9 A;  4DQ2 A;  4MZM A;  3OS5 A;  2D9T A;  1KC8 U;  2NUZ A;  2JMA A;  3CXC P;  4FL6 A;  4KUL A;  2SRC A;  3FLG A;  1H64 1;  2AKL A;  3J80 E;  1M1K R;  1QP2 A;  4J9D A;  1SSF A;  4ZNX A;  1VQN A;  1C0M A;  4V2S A;  1V76 A;  4BAC A;  4JJN K;  4BD3 A;  2L89 A;  2RNA A;  4XU3 A;  1AWW A;  3ZBD A;  2K5F A;  3CPW A;  2CSQ A;  4LNP A;  1YJN T;  2RHY A;  2C0I A;  2KGT A;  1T3S A;  2HZY A;  1M90 U;  1K9M U;  2LX9 A;  2JXB A;  1YIJ A;  4JLG A;  1Q82 R;  4HCK A;  1RLQ C;  1M30 A;  2F2W A;  1NEG A;  1SPK A;  4F17 A;  3RKW A;  2VVK A;  2JM8 A;  3E9F A;  4BY6 B;  3I56 A;  1WQ7 A;  3N5B B;  3M0U A;  2DLP A;  1HYO A;  3S3N A;  3QUI A;  3EG1 A;  2YXY A;  3UAT A;  3A8H B;  3CCE Q;  3QWX X;  1BKB A;  2KR3 A;  4BY6 C;  3THK A;  2F5T X;  5KYU B;  3FIF A;  2ZPG B;  3CPF A;  3H6Z A;  3RBB B;  1R0C B;  4XU1 A;  1YJW T;  3ER0 A;  2P84 A;  5LJ5 d;  3LWH A;  4PJO G;  1TUG B;  4ME7 A;  1BB9 A;  4M78 A;  1S72 A;  4MDX A;  4EIK A;  4OB1 B;  3LLR A;  1ZA2 B;  2HCK A;  1K73 R;  5LJ5 e;  1N9S A;  2FRY A;  2WSE E;  1MND A;  2OTJ T;  4LDW A;  2V8K A;  1VYV A;  3LH0 A;  3A8G B;  4JJC A;  3EG2 A;  3S6W A;  1K1Z A;  3CPW S;  2LX7 A;  3UDC A;  1K0X A;  1RI0 A;  2DL8 A;  1GRI A;  1WGS A;  1KC8 R;  1M8V A;  1ABO A;  3X28 B;  1AEY A;  1FWZ A;  2KYM A;  3FRN A;  1O9S A;  5C0M A;  1PD0 A;  1G8X A;  2MOX A;  3U23 A;  1N8R C;  2CT4 A;  1K76 A;  1NPP A;  1H8K A;  3OY9 A;  1G2B A;  2E41 A;  1JXM A;  1UE9 A;  2A0F B;  2YT6 A;  3ME9 A;  2YRD A;  3X20 B;  4Z02 A;  4LN2 A;  1XJW B;  5GAM g;  4M7D B;  4EMK A;  1M90 R;  1WPY A;  1K9M R;  1M9S A;  2R58 A;  3OYB A;  1WLP B;  2ZGW A;  1A0N B;  2OTL Q;  2GFA A;  4KRT A;  1FYN A;  4M7D E;  3G7Z A;  2A7Y A;  2ZPB B;  4QVZ A;  1QCO A;  2D0Q B;  2RQR A;  3I55 A;  4MZP A;  4M78 B;  1JJ2 P;  4M7D C;  2HQE A;  2RQV A;  3CC7 T;  2ZPE B;  5LL6 S;  2DL7 A;  4J7F A;  2DIL A;  1PCX A;  2CT3 A;  1QP3 A;  2PVO B;  4M78 E;  4JZ4 A;  4GLK A;  1GFD A;  4M78 C;  1UTI A;  2YUP A;  3V7R A;  3V8K A;  1QVG P;  2KMT A;  5IXF A;  4PJJ A;  4CC7 A;  2FRW A;  2A36 A;  2M0Y A;  4JZ3 A;  4E47 A;  4X9C A;  2XDP A;  2K4Y A;  3QXE B;  2YRC A;  1PSF A;  2E70 A;  3SEM A;  3MP6 A;  1RLP C;  1JJ2 A;  4DBR A;  1OV3 A;  2RHZ A;  4Y28 E;  3QYH B;  2CUD A;  5GMK h;  4EMK B;  1PNJ A;  3G71 T;  3OYH A;  2CZ6 B;  3CC2 T;  1YI2 T;  2KRM A;  3JB9 G;  4O6J A;  4F14 A;  2EJF A;  2BZ8 A;  4D6W A;  1DJ7 B;  2LQN A;  5GAO n;  8ATC B;  2WAC A;  1SRM A;  2QA4 A;  1RAE B;  1Q95 G;  2O2O A;  4DBF A;  3KBG A;  1QVG A;  1GCQ A;  1MMG A;  3CBM A;  3OSS C;  4FYV B;  2QXF A;  4LDY A;  3H8Z A;  2P0K A;  3SWN A;  1F1B B;  1U1S A;  1MGQ A;  2DA9 A;  2RPN A;  1X2K A;  2LT1 A;  2O9V A;  3VRZ A;  1OZ3 A;  1D1C A;  1WJS A;  2BE7 D;  2DFU A;  5L8R E;  1VQ9 T;  3VV0 A;  2QEX Q;  1QKX A;  4XTY A;  3VS7 A;  4FYX B;  5J3B A;  1RAD B;  4HVW A;  1ZSZ B;  1SEM A;  2K57 A;  2JUF A;  3CCQ A;  2X4J A;  4CRI A;  1NJI U;  4RTV A;  5GAN 5;  3HPW A;  2O9S A;  2NWM A;  2JTM A;  5GMK j;  4M75 E;  3CCL Q;  3CCR A;  2E10 A;  3SB2 A;  3L2Q A;  1R0B G;  2KNB B;  1ZSZ C;  1JJ2 S;  1JXO A;  1YHQ A;  2LCC A;  4FW2 A;  4M75 C;  4A4K A;  4AFZ C;  2WSF E;  3EHR A;  2CRE A;  3OYD A;  1UB4 A;  4C5H A;  4J83 A;  1VQO Q;  4J9H A;  3SFM A;  2RJE A;  3QBY A;  3REB B;  2DEQ A;  2F1L A;  4FSS A;  3VU3 C;  1YWP A;  3EFO A;  5HK3 A;  1M1K C;  1VQP Q;  4M78 G;  1MMN A;  1N5Z A;  3GPL A;  5KYY A;  1FXX A;  1QVG S;  5A0G A;  1D1A A;  1VQL A;  1LOJ A;  2AT1 B;  2DZ9 A;  2AZV A;  3INZ A;  4QKU A;  3CCS A;  4L59 A;  4F16 A;  2OTL T;  4KGZ B;  2C06 A;  1MNE A;  2LDM A;  4BI4 A;  1VQ8 T;  1VQ5 A;  1TUC A;  1OI1 A;  4CC3 A;  4XU2 A;  5GAN h;  2AK5 A;  4BDZ A;  3GIB A;  2AKK A;  1W70 A;  2JS0 A;  3M0S A;  4PJN A;  1R8O B;  1EZZ B;  4FT2 A;  1QVP A;  2VXF A;  2JVV A;  3CC4 A;  5CKF A;  3HKS A;  4KGX B;  2DD5 A;  2QG9 B;  3CME A;  2RA2 A;  3DKM A;  2XI9 A;  4ZGE B;  2NUP A;  4MZT A;  4PJO F;  1VQ6 T;  4C8Q B;  1HJD A;  3CMA T;  1B07 A;  2QAZ A;  1U5S A;  4E7H A;  4RTU A;  1WHM A;  2G3R A;  5CQY A;  4C8Q E;  2LZ6 B;  2C0O A;  4F04 B;  2VAS A;  4J9F A;  1K73 C;  4N4H A;  2HQH A;  1NJI R;  4C8Q C;  2O01 E;  2EWN A;  1YJN Q;  2F2V A;  3MJX A;  4A63 B;  1VQ4 A;  4JJB A;  1IRE B;  2FB7 A;  4D8K A;  5A0L A;  1FMW A;  1WJR A;  5CCA A;  1KC8 C;  4FSX A;  4OMF B;  2NLU A;  3T9N A;  2YUO A;  1UDL A;  1VA7 A;  3HFO A;  4MML A;  2E1H A;  1X2Q A;  2M16 A;  2HSP A;  1U3O A;  3CCM A;  4AFS C;  1QW1 A;  2DBM A;  4EMG A;  1PHT A;  1RAG B;  3P8D A;  3CCV A;  3QPH A;  1X69 A;  1KHC A;  3C12 A;  3WVD B;  4OML A;  4A54 A;  4KUI A;  4OVA A;  5CKD A;  4A4H A;  3J81 E;  2LJ3 A;  1M90 C;  2DIG A;  3MHX A;  2PUK B;  3ZFJ A;  4R56 A;  1Y96 B;  5KH6 A;  4J9G A;  4MMK A;  2ATC B;  1AHJ B;  5HK0 A;  2ZAE A;  3QWY A;  4NL2 A;  3I56 Q;  1SF9 A;  3EGX A;  3CCL T;  3ASK A;  3FJ5 A;  1PRM C;  2KI7 A;  2OTJ Q;  1I5O B;  5GAM f;  2DNU A;  1M3C A;  2CGH A;  2RD1 A;  3VS3 A;  2KBT A;  1VQO T;  2M51 A;  1YIT T;  2CS7 A;  2H3J A;  1HXD A;  3PE0 A;  4JRK A;  2LMJ A;  3EHQ A;  2XHC A;  1X6O A;  5LJ3 d;  4FYW B;  1Q7Y U;  2RQU A;  4J9E A;  5KE2 A;  1M1F A;  4IUV A;  5LJ3 e;  1XNI A;  4RG2 A;  2CH4 W;  3M5A A;  5CQX A;  4RTY A;  1YN8 A;  5D7U A;  1SSH A;  2R5A A;  2RI2 A;  1VQM T;  2LJ1 A;  1D1B A;  2J6O A;  5GAN d;  1KHI A;  2A3L A;  3JCM h;  3JB9 F;  4JRP A;  1WZO A;  2ENM A;  3LGF A;  3WVE B;  5GAN e;  4PFP A;  3URG A;  1Y71 A;  2PQW A;  2F5K A;  3PMT A;  1KFZ A;  3L2Z A;  2X3X D;  4C0D B;  3M0T A;  2KRN A;  3CCU A;  3GNG A;  2QK0 A;  1I8F A;  3G6E T;  1S1N A;  3CCJ A;  2Z0W A;  4PJM A;  1VQK A;  2KQW A;  1C6V X;  1VQ7 A;  3S3O A;  1JQQ A;  5IHK A;  1BI0 A;  5DLO A;  3CC7 Q;  3X26 B;  4J9C A;  1J3T A;  4LUE A;  3NTH A;  1PKS A;  5KYU A;  2EYZ A;  4C0D C;  2RN8 A;  3CD6 A;  4C0F A;  2CUB A;  3RKY A;  4LDX A;  2J6K A;  2VWF A;  3JB9 D;  1KJW A;  4J6X A;  2EKH A;  5GMK m;  2D0N A;  1Y0M A;  1KD1 U;  2JN0 A;  3OYI A;  2EGC A;  4AFU C;  2YHT A;  5CKH A;  2DXT A;  1UEB A;  1Y57 A;  1XOV A;  3QHS A;  5LJ5 f;  3OA6 A;  4ANJ A;  3I55 Q;  3H0I A;  1X75 C;  1XQH A;  4HCC A;  4M7D F;  2BE9 B;  2VB6 A;  4QVC A;  4A4G A;  3OSV A;  5DY9 A;  1IXD A;  2YSQ A;  4UC4 A;  2DXB A;  2ED1 A;  1OX8 A;  3G71 Q;  1YJ9 A;  2W10 A;  3CC2 Q;  1YI2 Q;  3V7C A;  3OYC A;  4M78 F;  3VJP A;  3CXC A;  1WHG A;  1ZQ1 A;  1NEB A;  3MCA B;  1LPL A;  1TWB A;  3TSZ A;  1Q7Y R;  5AT1 B;  2CZ0 B;  2E64 A;  4HA8 A;  1YJW A;  3OMC A;  1NZ9 A;  3PMI A;  4NOY A;  2A37 A;  1FMK A;  5I21 A;  4M7D A;  2P0P A;  2HAX A;  2RQW A;  4M7D D;  2RQT A;  1QWE A;  3EFS A;  3OBY A;  5GJW B;  1G3T A;  2LP5 A;  1H3Z A;  4XK8 E;  1VQ9 Q;  1QCN A;  2OX7 A;  3R6N A;  1WFW A;  4M78 D;  3I56 T;  3A98 A;  3M58 A;  4HVV A;  2K3X A;  4ZGJ B;  5DM7 R;  2X9H A;  2QGG A;  3OW2 P;  2KE9 A;  1UGR B;  2AZS A;  6AT1 B;  3TEE A;  4X1V A;  1D3B B;  2VYT A;  3G4S A;  2COW A;  4C92 B;  2YLB A;  3HHT B;  1GBQ A;  1JO8 A;  2MWO A;  3MO8 A;  1KQ1 A;  4QQ6 A;  3TVT A;  1TOV A;  2PVG B;  4C92 E;  5D6Y A;  1NYG A;  2E65 A;  3NPF A;  4LDU A;  2DE0 X;  1VIF A;  4C92 C;  2LCS A;  1KD1 R;  4M77 B;  2FZC B;  1RL2 A;  1VYT A;  2DXU A;  3OYM A;  1S72 T;  3OYE A;  3BE3 A;  4IKF A;  5I22 A;  2M9U A;  3L1A A;  3CXC S;  4LUD A;  3JCM d;  4M77 E;  3EFR A;  3OYK A;  1M27 C;  2FVU A;  3HRT A;  2CP7 A;  1OYX A;  3JRZ A;  4Z89 A;  1NJI C;  4M77 C;  3OW2 A;  2HKN A;  3DB4 A;  1HK9 A;  4QVD A;  1CSK A;  1W4S A;  2DXC A;  3A8L B;  2DRM A;  3VUB A;  3CBO A;  4OMN A;  1Q81 C;  3ZL7 C;  2QDY B;  1VQ8 Q;  2FHD A;  2JOY A;  1NLP C;  1JBM A;  4OB3 B;  3AT1 B;  4J6W A;  2CYZ B;  4AMC A;  5GAN 3;  5GAO l;  1ZUU A;  1TG0 A;  3BFM A;  4ZN1 A;  4N4G A;  2EVR A;  1WXU A;  3VS2 A;  3NMZ C;  1UUE A;  1PSE A;  5GAO r;  3D7S B;  2LQ8 A;  3QII A;  1BIB A;  4AG1 C;  1ZUK A;  4HKE A;  1YP5 A;  3I5S A;  1YCY A;  3S3M A;  4N4I A;  2FZG B;  2PU9 B;  1TUD A;  1OPK A;  3UF4 A;  2K6D A;  2D6F A;  2JM9 A;  2EQI A;  2EQU A;  5FW9 A;  2RH2 A;  1ZSZ A;  1VQ6 Q;  3LH5 A;  2CH4 A;  2OAU A;  3I55 T;  4M75 A;  2RK1 A;  3CMA Q;  4PLI A;  1M3A A;  4M75 D;  2CP2 A;  1Q86 U;  1K8A C;  2VXE A;  1AT1 B;  3RMQ A;  3JCM V;  2ESW A;  4XTV A;  1BYM A;  4RMO A;  3QZ5 B;  1D0Z A;  2DF6 A;  3JB9 H;  3CCE A;  4RTW A;  1ACM B;  5FWB A;  2JJ9 A;  3OW2 S;  3PGG A;  1AWJ A;  1BBZ A;  4BDY A;  1I0C A;  1M5Q 1;  1M2V A;  2FEI A;  2GCX A;  1Y7X A;  3EAE A;  2E3H A;  5D6X A;  3X25 B;  5LJ5 g;  4DBQ A;  2DMO A;  1IB8 A;  1RAF B;  1NG2 A;  1LJO A;  4LD6 A;  3RIR A;  1MV0 B;  3M9Q A;  1GXI E;  4A4E A;  3JCM W;  4XAX B;  1BIA A;  2NUT A;  4Y92 A;  2ZZD A;  5CK9 A;  4C8Q F;  1G3S A;  2KRO A;  2DL5 A;  5GJV B;  1IHV A;  1IRX A;  2L2P A;  3QSU A;  2K79 A;  1JB0 E;  1IGU A;  4RCC A;  1YFN A;  2QA4 T;  2QQS A;  3C4S A;  3H0H A;  4M75 B;  5HCK A;  4BI8 B;  2K9G A;  1BI2 A;  1I07 A;  3NGP A;  2XG8 D;  1G3Y A;  1C1A A;  3I35 A;  3LYI A;  5HY6 A;  2DTI A;  2DKG A;  4RTX A;  3OMG A;  1AWX A;  1W6X A;  3EGU A;  1QWF A;  2PVD B;  4IUT A;  4E7S A;  1ZLM A;  2LTO A;  2KSS A;  1NBE B;  4M7D G;  3LGL A;  1QLY A;  2B8A A;  4FCY A;  3UPU A;  1YNZ A;  4FW1 A;  4JDS A;  4C8Q A;  1SHG A;  3BY7 A;  3MP8 A;  3OYY A;  3CCM Q;  4C8Q D;  2EBP A;  1YIT Q;  4XTZ A;  2D1X A;  2L3R A;  4OMQ A;  1M2V B;  2EQM A;  3JV3 A;  2GQV A;  4BI3 A;  4C5G A;  3SDZ A;  3CCQ T;  1KQ2 A;  1D0X A;  1PWT A;  1Q86 R;  2D8H A;  3PFS A;  1WNL A;  2K3B A;  5IT9 E;  5IAY A;  4HCZ A;  2HBW A;  2QQ9 A;  3VS0 A;  2R5M A;  1BK2 A;  3CCR T;  2O4X B;  2GFU A;  1E7O A;  2MAM A;  1VQM Q;  4J9I A;  2EQJ A;  3JCM J;  1YHQ T;  2NUT B;  4M7A B;  2EJ9 A;  3OB9 A;  2E6Z A;  1O75 A;  1TSF A;  3HRS A;  3UT1 A;  1Q82 C;  3OYG A;  3M0P A;  1WYX A;  2DTO A;  2KRS A;  1MV3 A;  4QQG A;  3JCM Q;  1D09 B;  4M7A E;  5CO7 A;  2Y4X A;  2DM1 A;  4ELY C;  3TCJ A;  3G6E Q;  3UWN A;  1WQW A;  4M7A C;  4WCI A;  4E6R A;  3OYA A;  3M0Q A;  1VQL T;  4PFO A;  2IIM A;  5ECA A;  3GBQ A;  3CCS T;  2L0A A;  3RNJ A;  2E5K A;  1PD1 A;  2EW3 A;  1WHJ A;  3MEV A;  2RHU A;  1Y96 A;  2OAW A;  1VQ5 T;  4BUG A;  3EH2 A;  1QKW A;  2FO0 A;  1IO6 A;  5L23 A;  5CIU A;  5GAM h;  2RMO A;  2X4Y A;  3TRE A;  4XTW A;  5FLX E;  3IQL A;  1BI1 A;  1MMD A;  2YUN A;  4PL6 A;  2JZ2 A;  5FRO A;  1IGQ A;  1W2B P;  4CI0 C;  3LW5 E;  5GMK e;  4C0Z A;  1HD3 A;  2J6F A;  3NTI A;  3JCM c;  1RI9 A;  3JB9 J;  2I0N A;  1WJQ A;  1IHW A;  1OQK A;  5A2Q E;  2PTK A;  3RUX A;  3CME T;  2VUB A;  2DYI A;  3RR6 A;  1V1C A;  2BTT A;  3JB9 I;  3A5Z B;  2J06 A;  2QEX A;  1RAC B;  4PK4 A;  4B6M A;  4PKC C;  3RES A;  1KD1 C;  4OB2 B;  2DZC A;  3V8J A;  4IUR A;  2HEQ A;  3PNW C;  4M75 G;  1ZX6 A;  1VQN Q;  2KXC A;  5LJ3 f;  2CZ7 B;  3QJY A;  2QQB A;  9ATC B;  1MMA A;  1VIE A;  1SRL A;  1Z9Q A;  2X4X A;  3H0F A;  1AOJ A;  2LCL A;  3CCL A;  2RI3 A;  4ZGD B;  2YWW A;  3EG0 A;  4FT4 A;  4J6Y A;  1VQ4 T;  4RCB A;  1W2B A;  4LXC A;  2EPD A;  1W1F A;  5D6W A;  1B34 A;  1K9M C;  5GAN f;  3L42 A;  5GAM j;  1U8R A;  5J26 A;  1YIJ Q;  3A1P A;  1T3L A;  3M57 A;  2DK3 A;  2M02 A;  1WXB A;  2DER A;  3E9G A;  5GAO m;  1E6H A;  1VQP A;  4C0G A;  3GOX A;  1UGS B;  1BI3 A;  1UFF A;  3G1J A;  3DB3 A;  3CCM T;  2YUQ A;  3JCM X;  4ATO A;  3E1S A;  2ECZ A;  3LWI A;  1BCO A;  2OJ2 A;  1JRI A;  3F70 A;  4BE1 A;  1U06 A;  4WF2 A;  4ZTJ A;  3PT9 A;  5KYX A;  3RMS A;  4IIM A;  1S72 Q;  1V29 B;  1OU8 A;  1AWO A;  3PVL A;  4PFZ A;  1K4U S;  3HRU A;  5DLQ E;  5HKC A;  4F7U A;  2QTV A;  5IHI A;  1IZ6 A;  2J05 A;  4R0K A;  2HL3 A;  5FU7 C;  3E19 A;  4PLL A;  4J7I A;  2DJQ A;  2XDB A;  2M1H A;  1R77 A;  4PJO E;  4IUQ A;  4DOW A;  3HL8 A;  3EG9 B;  3P8B B;  1VUB A;  2GQI A;  3MET A;  4RTZ A;  4PJO C;  4C8Q G;  1B34 B;  4FIB A;  1M1G A;  3E2U A;  1W2B S;  3REA B;  2XKO C;  2V8I A;  2RK2 A;  3OBW A;  4TVR A;  3QDR B;  3C0C A;  2DL3 A;  2DTH A;  1FMV A;  2F69 A;  4JJD A;  1NLO C;  1ABQ A;  3M59 A;  3JCM b;  2E5Q A;  2LC4 A;  4C92 F;  2Y90 A;  2ROL A;  3FDR A;  4EDU A;  2GBQ A;  4ZTF A;  1G3W A;  1SHF A;  4HT9 A;  1ZHI A;  2V1R A;  5FRN A;  5LJ5 j;  5GAM d;  1YJN A;  1QMC A;  1CKA A;  2KEA A;  4LD9 K;  5KCO A;  1UGP B;  2L3S A;  1AVZ C;  4M77 F;  1B3Q A;  4OP0 A;  3R6O A;  1OEB A;  2HBP A;  1YWO A;  2BZY A;  3CCU T;  1LVK A;  4IIO A;  5GAN 8;  2I2L A;  4HXJ A;  5KYX B;  3CCJ T;  2J7I A;  1D3B A;  2DPP B;  4C92 A;  1VQK T;  1VQ7 T;  4C92 D;  1XTD A;  2X3W D;  3OYJ A;  3WXM B;  4ELZ C;  4F7U B;  2XMF A;  3FJP A;  3CD6 T;  4E7K A;  3JAM E;  5I2S A;  4KUD K;  4A4F A;  4F7U E;  2V1Q A;  4M77 A;  7AT1 B;  3CBP A;  2DEU A;  2H3E B;  4M77 D;  2RJD A;  2HD0 A;  2PNI A;  4FYY B;  1VQN T;  1AD5 A;  1RUW A;  3MEU A;  1KIK A;  2MCN A;  3HFN A;  5GAO p;  4BE0 A;  3QYG B;  4OMO A;  4GLM A;  4CC2 A;  5EG2 A;  1NE8 A;  3OYF A;  1Q86 C;  2DAQ A;  4NS5 A;  1LCK A;  3M53 A;  3JCM f;  1UG1 A;  2OTJ A;  4AG2 C;  2CKK A;  1E6G A;  2YRV A;  2CP6 A;  5A0D A;  1YIJ T;  1ZBX A;  2JTF A;  2YDL A;  1NYF A;  2GGR A;  1QCF A;  1YJ9 T;  1X27 A;  2D8J A;  3VRY A;  3FC3 A;  1M8M A;  4B9X A;  3SHW A;  2P0Q A;  3QG1 A;  1YBY A;  4K11 A;  4C5I A;  3HP9 A;  2QA4 Q;  1X43 A;  1WHH A;  3H41 A;  5LJ3 g;  1UGQ B;  1QVF P;  2PUO B;  2QAS A;  1WXT A;  4HVU A;  4BB7 A;  5I11 A;  1PC0 A;  4Q5W A;  4L6V 5;  2FZK B;  4HCB A;  4JS4 A;  4A53 A;  2BZX A;  3UA7 A;  2GTO A;  5GAN g;  4QT7 A;  2HL5 C;  3GLX A;  1G83 A;  3NFC A;  2FYK A;  1I4K 1;  3O5Z A;  5CKB A;  3M54 A;  8AT1 B;  4X9D A;  3VYG A;  4J5Y A;  1ZUY A;  2RHX A;  1YCS B;  2AIR B;  1OOT A;  2HKQ B;  2CDT A;  3CCQ Q;  3VS5 A;  1P92 A;  1JU5 C;  3FB9 A;  2ZPH B;  3PIP A;  3G4S T;  3JCM e;  1K0S A; 
#chains in the Genus database with same CATH homology
 4DQ2 A;  3CC7 A;  2XG8 D;  5GAO q;  1WJR A;  4MZM A;  1G3Y A;  3OS5 A;  3LYI A;  3BDU A;  5HY6 A;  5CCA A;  1KC8 C;  2DTI A;  4FSX A;  4OMF B;  2DKG A;  2D9T A;  2NLU A;  2QQR A;  3T9N A;  5GAM e;  4BE2 A;  3OMG A;  1KC8 U;  2X35 A;  1QVF A;  1N9R A;  2XD0 A;  2PVD B;  4FL6 A;  4IUT A;  4KUL A;  3HFO A;  2DVE A;  3FLG A;  1H64 1;  2LTO A;  2KSS A;  3SD4 A;  2LNV A;  2E12 A;  3J80 E;  3LGL A;  4M7D G;  2QTX A;  2B8A A;  2RJC A;  4MML A;  1QP2 A;  2E1H A;  3UPU A;  2M16 A;  4JDS A;  4M75 F;  1SSF A;  2XIC A;  3BY7 A;  4C8Q A;  1VQN A;  4V2S A;  4BAC A;  3MP8 A;  3OYY A;  4C8Q D;  5GAN 2;  3CCM A;  4JJN K;  4BD3 A;  1QW1 A;  2L89 A;  4EMG A;  3P8D A;  2MWP A;  5FRM A;  3CCV A;  3QPH A;  4XTZ A;  4XU3 A;  3ZBD A;  1KHC A;  2K5F A;  2L3R A;  3C12 A;  3WVD B;  3CPW A;  4OGC A;  4Y91 A;  4JS5 A;  2EQM A;  1YJN T;  2RHY A;  3GP8 A;  2GQV A;  4A54 A;  4KUI A;  4OVA A;  4BI3 A;  4A4H A;  5CKD A;  3J81 E;  1M90 C;  2DIG A;  4C5G A;  3MHX A;  3SDZ A;  3CCQ T;  1M90 U;  4F7U G;  2PUK B;  1KQ2 A;  3ZFJ A;  3QKJ A;  1Y96 B;  4OB0 B;  2KDS A;  5KH6 A;  4R56 A;  3PFS A;  4MMK A;  1K9M U;  2LX9 A;  2Y4Y A;  1Y07 A;  2ZCF B;  2QI2 A;  1AHJ B;  1WNL A;  5IT9 E;  5IAY A;  5HK0 A;  4HCZ A;  1YIJ A;  1TH7 A;  2QQ9 A;  4JLG A;  2R5M A;  3VUZ A;  4EPC A;  3CCR T;  2O4X B;  3FEO A;  4NL2 A;  3RKW A;  2GFU A;  2EQK A;  3CCL T;  3ASK A;  2MAM A;  3E9F A;  4BY6 B;  3I56 A;  2EQJ A;  3G71 A;  3C95 A;  5GAN 6;  3M56 A;  3JCM J;  3CC2 A;  1YHQ T;  1WQ7 A;  3N5B B;  2MMP A;  4M7A B;  1YI2 A;  2EJ9 A;  3OB9 A;  1LNX A;  2E6Z A;  1O75 A;  5GAM f;  1M4Z A;  3HRS A;  3UT1 A;  1Q82 C;  3S3N A;  3QUI A;  3OYG A;  2RI5 A;  3BW1 A;  4II1 A;  2CGH A;  2DIQ A;  2DTO A;  2RD1 A;  4QQG A;  3JCM Q;  1VQO T;  1YIT T;  5IN1 A;  3A8H B;  2CS7 A;  2H3J A;  4M7A E;  3KUF A;  1BKB A;  5CO7 A;  1HXD A;  4E7J A;  2Y4X A;  2KK4 A;  4BY6 C;  4JRK A;  4ELY C;  3TCJ A;  3UWN A;  1WQW A;  3HSB A;  4M7A C;  3A8M B;  2F5T X;  2XHC A;  4M7A F;  3FIF A;  1X6O A;  2ZPG B;  5LJ3 d;  3ZEH A;  1Q7Y U;  3CPF A;  3H6Z A;  3OYA A;  4XU1 A;  5KE2 A;  1VQL T;  1YJW T;  1M1F A;  3ER0 A;  4IUV A;  4N0A A;  1QVF S;  5FU6 B;  5LJ3 e;  1XNI A;  5LJ5 d;  3CCS T;  3LWH A;  4RG2 A;  4PJO G;  1VQ9 A;  3OS0 A;  4ME7 A;  4M78 A;  1S72 A;  3M5A A;  5CQX A;  3MEV A;  2RHU A;  4MDX A;  4OB1 B;  1Y96 A;  3LLR A;  2R5A A;  1VQ5 T;  2RI2 A;  4FU6 A;  4BUG A;  4DA4 A;  5LJ5 e;  1VQM T;  5GAN d;  1N9S A;  1KHI A;  2WSE E;  2LQK A;  2A3L A;  3JCM h;  3JB9 F;  2OTJ T;  3OQ5 A;  5CIU A;  5GAM h;  4JRP A;  2X4Y A;  4LDW A;  3TRE A;  4GY5 A;  2V8K A;  3LGF A;  4XTW A;  3WVE B;  4C92 G;  3LH0 A;  5FLX E;  2O4X A;  2HNI A;  2VGN A;  3A8G B;  3V8L A;  3URG A;  1BI1 A;  5FU6 C;  5GAN e;  1Y71 A;  2EFI A;  2PQW A;  3CPW S;  3S6W A;  2RHI A;  3CCE T;  4M7A A;  2F5K A;  3PMT A;  3L2Z A;  4EMK C;  4PL6 A;  4PNO A;  4C0D B;  2JZ2 A;  5FRO A;  3CCU A;  4M7A D;  3GNG A;  3UDC A;  1I8F A;  4CI0 C;  3LW5 E;  5GMK e;  4XQ3 A;  3G6E T;  1RI0 A;  4C0Z A;  1WGS A;  3NTI A;  3CCJ A;  3JCM c;  1M8V A;  3X28 B;  1VQK A;  1FWZ A;  2KQW A;  3JB9 J;  1WJQ A;  5A2Q E;  1VQ7 A;  3S3O A;  3FRN A;  1I81 A;  1BI0 A;  3CME T;  3RUX A;  5DLO A;  1O9S A;  4M77 G;  2L5Q A;  3X26 B;  2K5I A;  5C0M A;  5GMK l;  2VUB A;  2EAY A;  3NTH A;  3JB9 I;  3A5Z B;  1N8R C;  2KVQ G;  4C0D C;  3CD6 A;  4C0F A;  1N8R U;  2EKO A;  2QEX A;  1NPP A;  3RKY A;  4E7L A;  4LDX A;  3OY9 A;  3JB9 D;  2E41 A;  4MDW A;  3ME9 A;  4J6X A;  3X20 B;  4PKC C;  4Z02 A;  3RES A;  1KD1 C;  4OB2 B;  4P5N A;  3LX7 A;  5GMK m;  2DZC A;  3V8J A;  4IUR A;  4L5G A;  2JNG A;  3PNW C;  3JCM g;  2CZ1 B;  2JN0 A;  4M75 G;  1KD1 U;  5GAM g;  4M7D B;  4EMK A;  2DO3 A;  3OYI A;  5LJ3 f;  2CZ7 B;  2P4T A;  1WPY A;  3QJY A;  2QQB A;  4JRI A;  2YHT A;  5CKH A;  2DXT A;  1M9S A;  1UEB A;  1VIE A;  2R58 A;  3DLM A;  3OYB A;  3DLL A;  1XOV A;  3QHS A;  4C5E A;  2X4X A;  2ZGW A;  2BIV A;  5LJ5 f;  3OA6 A;  2EIF A;  2GFA A;  4M7D E;  4QW2 A;  2OTL A;  3G7Z A;  2A7Y A;  2ZPB B;  4OF1 A;  2D0Q B;  4QVZ A;  2LCL A;  3VKI A;  3I55 A;  2RI3 A;  4YTL A;  1X75 C;  4FT4 A;  1XQH A;  2ZPI B;  4J6Y A;  4RCB A;  4ZGD B;  3Q1J A;  3NTK A;  4M78 B;  4MZP A;  1VQ8 A;  4HCC A;  5D6W A;  4M7D C;  1B34 A;  1K9M C;  5GAN f;  3L42 A;  4M7D F;  2HQE A;  5GAN 7;  3CC7 T;  3QO3 A;  5GAM j;  4QVC A;  1U8R A;  4A4G A;  5J26 A;  2ZPE B;  5LL6 S;  4J7F A;  3OSV A;  1QP3 A;  5DY9 A;  3VYH B;  2PVO B;  4M78 E;  3M57 A;  2DK3 A;  2K5L A;  4UC4 A;  2MF2 A;  2DXB A;  4GLK A;  4N0A C;  1N6A A;  1YJ9 A;  3E9G A;  5GAO m;  3V7C A;  3OYC A;  4M78 C;  1VQP A;  4M78 F;  3VJP A;  4C0G A;  3GOX A;  4XU0 A;  2XU8 A;  3SWN B;  3A8O B;  1UGS B;  1BI3 A;  1ZQ1 A;  3V7R A;  3CXC A;  3MCA B;  3V8K A;  4NL3 A;  3DB3 A;  2KMT A;  5LJ3 h;  3L2U A;  3TU4 K;  3CCM T;  2CZ0 B;  2E64 A;  2E6N A;  3P8H A;  4HA8 A;  1YJW A;  4IUP A;  4LD9 K;  3OMC A;  3MEW A;  1W2B A;  3JCM X;  1NZ9 A;  3PMI A;  2WSC E;  1MHN A;  4NOY A;  4ATO A;  3E1S A;  5I21 A;  1VQ6 A;  3LWI A;  4M7D A;  4E47 A;  4X9C A;  2XDP A;  2K4Y A;  3QXE B;  3JSC A;  3L2V A;  2P0P A;  2HAX A;  4M7D D;  3X24 B;  3EFS A;  2AHJ B;  2YLC A;  3OBY A;  4KBM B;  3CMA A;  1Q7Y C;  1PSF A;  1G3T A;  1JRI A;  3SWN C;  3F70 A;  4BE1 A;  2E70 A;  3PTA A;  2GF7 A;  1K8A U;  4WF2 A;  4ZTJ A;  1NPR A;  3MP6 A;  1H3Z A;  1KG1 A;  1JJ2 A;  2XDD A;  3PT9 A;  3RMS A;  4XK8 E;  2IVW A;  1I5L A;  2RHZ A;  4Y28 E;  1V29 B;  3QYH B;  5GMK h;  4EMK B;  3L2W A;  2FL7 A;  3HRU A;  5DLQ E;  2XK0 A;  4M78 D;  3I56 T;  5HKC A;  4F7U A;  3G71 T;  3OYH A;  2CZ6 B;  3CC2 T;  4OGE A;  1YI2 T;  3M58 A;  1IZ6 A;  2K3X A;  4ZGJ B;  5FU7 C;  2VC8 A;  3E19 A;  4PLL A;  4O6J A;  5DM7 R;  4J7I A;  3JB9 G;  2EJF A;  2XDB A;  2M1H A;  4D6W A;  1DJ7 B;  1UGR B;  4PJO E;  4IUQ A;  4DOW A;  4B9W A;  5GAO n;  3TEE A;  3HL8 A;  5CR2 A;  2WAC A;  2QA4 A;  1D3B B;  2VYT A;  3P8B B;  3G4S A;  4C92 B;  5J39 A;  2YLB A;  1VUB A;  3HHT B;  3KBG A;  3MET A;  1QVG A;  3CBM A;  3OSS C;  4PJO C;  4C8Q G;  2QXF A;  1B34 B;  4FIB A;  3H8Z A;  2P0K A;  4LDY A;  3SWN A;  2MWO A;  1M1G A;  3MO8 A;  1W2B S;  1KQ1 A;  4QQ6 A;  1FX7 A;  1U1S A;  2XKO C;  2V8I A;  2RK2 A;  3OBW A;  4TVR A;  3CC4 T;  3QDR B;  2M0O A;  2PVG B;  1MGQ A;  4C92 E;  5D6Y A;  2DTH A;  2F69 A;  2LT1 A;  3OYL A;  1Q81 U;  2E65 A;  4LDU A;  1OZ3 A;  4J8O A;  5GAN 4;  3M59 A;  1VIF A;  1WJS A;  4C92 C;  2E5Q A;  3JCM b;  2LC4 A;  4C92 F;  4IUU A;  2Y90 A;  3FDR A;  1RL2 A;  4M77 B;  5L8R E;  4EDU A;  5LJ3 j;  1VQ9 T;  2DXU A;  3V7S A;  3VV0 A;  3OYM A;  1S72 T;  3AHU A;  4ZTF A;  1G3W A;  4HT8 A;  3O8V A;  3OYE A;  3M4G A;  4IKF A;  4RKU E;  4LDV A;  4XTY A;  2M9U A;  3L1A A;  4HT9 A;  1ZHI A;  3CXC S;  5FRN A;  3JCM d;  5LJ5 j;  4RG8 A;  5GAM d;  4M77 E;  3EFR A;  1YJN A;  5J3B A;  3OYK A;  3KXT A;  2FVU A;  4XTU A;  5I2M A;  3PIO A;  3HRT A;  2DD4 A;  1OYX A;  2K57 A;  1UGP B;  2JUF A;  3JRZ A;  2X4J A;  5KCO A;  3CCQ A;  1NJI C;  4QQD A;  2EYQ A;  4PJO A;  4CRI A;  5GAN j;  4PJO D;  4M77 C;  3OW2 A;  3DB4 A;  4M77 F;  1HK9 A;  4OP0 A;  3M4Y A;  3R6O A;  4QVD A;  1NJI U;  2HBP A;  1W4S A;  5GAN 5;  2DXC A;  2RM4 A;  3HPW A;  3A8L B;  3CCU T;  3VUB A;  3CBO A;  1X01 A;  4DOV A;  2JTM A;  2K2V A;  3C94 A;  4JRQ A;  5GAN 8;  1Q81 C;  2I2L A;  4JLI A;  5GMK j;  4M75 E;  3CCJ T;  3CCR A;  1D3B A;  2DPP B;  2E10 A;  4C92 A;  3OS1 A;  1VQK T;  3SB2 A;  2QDY B;  3L2Q A;  2FHD A;  2JOY A;  1VQ7 T;  4XTX A;  4C92 D;  1JBM A;  1XTD A;  4OB3 B;  1YHQ A;  1JJ2 S;  4J6W A;  2CYZ B;  5GAN 3;  2LCC A;  3WXM B;  5GAO l;  4M75 C;  4ELZ C;  3OYJ A;  4A4K A;  4F7U B;  2KAF A;  3QJ6 A;  3RER A;  3JCM P;  1G5V A;  2WSF E;  3OYD A;  3FJP A;  3BFM A;  1UB4 A;  4ZN1 A;  3CD6 T;  4N4G A;  4J83 A;  4C5H A;  4EMH A;  3QZ9 B;  3BDL A;  5KCH A;  2QEX T;  2BKD N;  1VQO A;  1YIT A;  3SFM A;  2RJE A;  3MEA A;  3QBY A;  2DEQ A;  4E7K A;  1PSE A;  3JAM E;  5GAO r;  5I2S A;  4KUD K;  2LQ8 A;  4A4F A;  4F7U E;  3QII A;  1BIB A;  3VU3 C;  5HK3 A;  2LRQ A;  1M1K C;  4HKE A;  4M77 A;  2V8J A;  4M78 G;  1M1K U;  3CBP A;  1YCY A;  3GPL A;  1U1T A;  2RJD A;  4M77 D;  2HD0 A;  4N4I A;  4KT0 E;  3S3M A;  1FXX A;  3J7A F;  1QVG S;  1VQN T;  5A0G A;  2PU9 B;  4F7U F;  3CEY A;  4E7I A;  2RO0 A;  3MEU A;  1LOJ A;  1VQL A;  3HFN A;  2DZ9 A;  3INZ A;  5GAO p;  3GNF B;  3QYG B;  3OYN A;  3CCV T;  4BE0 A;  2D6F A;  2RB6 A;  1OZ2 A;  2EQU A;  1EIF A;  3CCS A;  2KY9 A;  2MI6 A;  2ZPF B;  1KQS A;  2RH2 A;  4X34 A;  4L59 A;  5LJ5 h;  5EG2 A;  2OAU A;  2OTL T;  1NE8 A;  3OYF A;  3I55 T;  2C06 A;  4M75 A;  2LDM A;  4BI4 A;  2RK1 A;  1Q86 C;  2DAQ A;  4M7A G;  4PLI A;  4NS5 A;  1VQ8 T;  1VQ5 A;  5M9O A;  4M75 D;  1VQM A;  1OI1 A;  1Q86 U;  3M53 A;  1K8A C;  4XU2 A;  5FU7 B;  3JCM f;  5GAN h;  2VXE A;  4BDZ A;  3RMQ A;  3JCM V;  2OTJ A;  4XTV A;  3GIB A;  1BYM A;  3MP1 A;  2CKK A;  2YRV A;  2VV5 A;  5A0D A;  1Q82 U;  4RMO A;  1YIJ T;  1ZBX A;  2EJG A;  2JTF A;  3QZ5 B;  2HQX A;  3JB9 H;  5AYF A;  4R55 A;  1N27 A;  2L8D A;  4PJO B;  3CCE A;  5CAI A;  1R8O B;  5GMK i;  1YJ9 T;  4FT2 A;  1QVP A;  2VXF A;  2JVV A;  3FC3 A;  1VQP T;  4B9X A;  2P0Q A;  3G6E A;  3CC4 A;  3QG1 A;  3OW2 S;  3PGG A;  1YBY A;  4C5I A;  3GF5 A;  2LVM A;  3HP9 A;  5CKF A;  4BDY A;  3HKS A;  1M5Q 1;  2DD5 A;  5LJ3 g;  3CME A;  2RA2 A;  1UGQ B;  2GCX A;  3DKM A;  2BUD A;  1Y7X A;  2XI9 A;  2PUO B;  4ZGE B;  2DJZ A;  4BB7 A;  4ZN3 A;  2XID A;  5CKE A;  2IG0 A;  4MZT A;  4Q5W A;  4PJO F;  4L6V 5;  1VQ6 T;  3EAE A;  4C8Q B;  3RKX A;  5D6X A;  3X25 B;  5LJ5 g;  2QQA A;  4HCB A;  4JS4 A;  3CMA T;  4A53 A;  4VUB A;  3M55 A;  4E7H A;  4FM4 B;  5KE3 A;  5CVI A;  2VGM A;  2G3R A;  5CQY A;  3GLX A;  5GAN g;  1LJO A;  4C8Q E;  4LD6 A;  4O5V A;  3NFC A;  3RIR A;  2FYK A;  1I4K 1;  3M9Q A;  1GXI E;  5CKB A;  4A4E A;  3JCM W;  3M54 A;  4XAX B;  1BIA A;  1K73 C;  4X9D A;  3VYG A;  2K3Y A;  4J5Y A;  4N4H A;  2ZZD A;  2RJF A;  4C8Q C;  5CK9 A;  1K73 U;  4C8Q F;  1G3S A;  3L2R A;  2O01 E;  2RHX A;  2EWN A;  3CCL A;  5C6S A;  3QSU A;  1VQ4 T;  1JB0 E;  2X4W A;  1VQ4 A;  4RCC A;  3OS2 A;  1IRE B;  4JUV A;  1P92 A;  2QA4 T;  3FB9 A;  2FB7 A;  2ZPH B;  3PIP A;  3G4S T;  5A0L A;  2QQS A;  3C4S A;  4M75 B;  2LT4 A;  2R57 A;  4BI8 B;  3JCM e;  1BI2 A;  1KQS S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...