1LNXA

Crystal structure of the p.aerophilum smap1 heptamer in a new crystal form (c2221)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEIIDGNVYKRGTMVVRGENVLFISPVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Rna binding protein, transcription
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
total genus 13
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2002-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lnxA00
4XU3A 1BIBA 4JRIA 4M78D 3JCMP 3BY7A 2RA2A 1WNLA 3L1AA 3JCMV 1WPYA 5GAN5 1I8FA 3JB9J 1Y96B 3RKYA 4M75E 4M78F 1M8VA 4M7AD 4PJOD 4M77C 5LJ5j 1N9RA 3JCMW 3RIRA 4JLIA 4M77E 3AHUA 3JB9F 1I81A 2YHTA 2E64A 1D3BA 4N0AC 3SWNC 4C92D 1M5Q1 4N0AA 3SWNA 3EFSA 4PJOA 2FB7A 3HFNA 1B34B 5LJ5d 4V2SA 5GANg 4M75B 2E41A 4M75G 2DKGA 4EMHA 3RERA 3V8JA 2EAYA 4M77G 2DTOA 4M77B 4NOYA 2EJGA 3HFOA 2CGHA 4NL2A 4XU0A 4C8QE 5GAMe 4XTVA 1HK9A 5LJ3f 4RCBA 4F7UA 3GIBA 1WQ7A 3SWNB 3RUXA 5GAMg 3JB9H 5GMKm 3V7SA 5GAN8 4J6XA 1YCYA 3V7RA 4MMKA 1JBMA 4DQ2A 3FJPA 4EMGA 1LNXA 3SB2A 5GMKl 1LOJA 4J5YA 4M78G 4M78B 4M78C 5GAMd 5GAN7 4F7UF 1I5LA 4C8QA 5LJ5f 3JB9I 5LJ3g 5GAOp 1KQ2A 4C92F 2DVEA 5GANe 3FIFA 2K57A 4J6YA 1BIAA 5LJ3h 4HT8A 3JCMX 4M7DC 5GAOm 4M7AE 2E10A 3JCMh 5LJ5e 1N9SA 3INZA 3RKWA 4A53A 1B34A 2RD1A 4RCCA 4XTZA 5LJ3d 1Y96A 4C8QC 1X01A 3FB9A 4XU2A 3RKXA 5GANj 2DTHA 1WQWA 2FYKA 4M77D 5GMKi 4M77F 5I21A 3QUIA 5LJ5g 4M75C 2DEQA 2ZGWA 4M7DA 4M7AB 2VC8A 5GMKh 4M7AA 2DTIA 2DZ9A 2DZCA 3JCMQ 4M7AG 1I4K1 4JRKA 3JCMJ 5GAMj 5GAN2 3BW1A 4XTXA 4EMKC 1JRIA 4MMLA 3VU3C 5GANf 4EMKA 1LJOA 3BFMA 1U1SA 4XU1A 1TH7A 2VXFA 4F7UB 4F7UG 4QVDA 3L2ZA 1HXDA 2DXTA 3JB9D 4C92B 4PJOF 2QTXA 4C92G 4XTYA 4JUVA 4C8QD 2YLCA 5GAOn 2DXUA 4A54A 2RB6A 5GAOq 5LJ3e 4C8QF 5GANh 4M78A 5GAMf 1MGQA 2I2LA 2E65A 3V8KA 5GAN4 4PNOA 3JCMf 4Y91A 4M77A 4M7DF 2HNIA 4C92E 2DJZA 3BDUA 3QO3A 4C92C 5GANd 3JB9G 5GMKj 2EJFA 4X9CA 4PJOE 3V8LA 4PJOC 3RESA 4HA8A 4QVCA 4OP0A 3QSUA 4M7AC 5DY9A 4HT9A 4XQ3A 4EMKB 4M78E 4M75F 4J6WA 3HSBA 5GAMh 3M4GA 5GMKe 2EJ9A 2JN0A 3JCMb 5GAN6 4NL3A 2VXEA 5GAN3 4C92A 5CAIA 4F7UE 4M7AF 4M7DE 4M75D 4PJOG 2RM4A 4PJOB 3QHSA 3JCMd 1H641 4X9DA 4XTUA 2E1HA 2Y90A 5GAOr 3V7CA 4M75A 2EWNA 4C8QB 4C8QG 1KQ1A 5LJ5h 1U1TA 3JCMg 3JCMe 5GAOl 4WF2A 3EFRA 4M7DD 4M7DG 4XTWA 4M7DB 5LJ3j 1D3BB 3PGGA 3JCMc 2YLBA
chains in the Genus database with same CATH superfamily
2OTLA 4BDYA 1X27A 2MF2A 1ZX6A 3CCVT 2CT4A 4M78F 2VGNA 2L3SA 4N0AC 4RTXA 4QW2A 4OMMA 1Y7XA 2P0KA 4R0KA 1ZUUA 1WHHA 3S3OA 3MEUA 1WYXA 3DKMA 1VQNQ 2CP0A 1X43A 1WQ7A 3RUXA 4E6RA 2ZPHB 1QKWA 3VRZA 5GAMd 5GAOp 2QA4A 2ECZA 2GF7A 2M0OA 3INZA 1Q81C 2AKLA 2FRWA 2A08A 3Q1JA 4ZGJB 4QQ6A 2JJ9A 2P0QA 5I2SA 2V8IA 2HKNA 4M7DA 2DTIA 4AFZC 5IAYA 1AEYA 2R58A 1OX8A 1QP3A 1U1SA 1WHKA 4VUBA 4C92G 1BCOA 2H3JA 3T9NA 3L2WA 1VQ7Q 2MMPA 3H41A 4D8DA 4M78A 1YITQ 2CH4A 3V8KA 2L3RA 4ZGDB 5CKEA 2HNIA 1WLPB 4BE1A 3JRZA 5AYFA 4KGVB 4OP0A 2LTOA 2DL4A 4HCZA 1VQLA 1TUDA 2DYBA 4NL3A 4C92A 3OW2P 2CP5A 3CD6T 1SHFA 2VUBA 1NLOC 1LCKA 4M7DG 1Q7YC 4A4FA 5KE2A 1VIFA 2DK3A 2DPPB 4HVWA 1AWWA 5KYNA 4R56A 4FYYB 4QQGA 4Z88A 4N4HA 3GOXA 4AT1B 2J7IA 1G3WA 5I2MA 4J9EA 1B34B 1KC8R 2RNAA 2SEMA 2K5LA 3L2UA 1N8RC 3CC7T 2OAUA 1Y07A 3VS2A 3GIBA 5LJ3f 1AZEA 3WVEB 3R6NA 1ABQA 2BZ8A 2XG8D 4M78B 1WIEA 3O8VA 2QEXT 9ATCB 1BIAA 1VQMQ 1KC8U 2LMJA 4J83A 1PG5B 2LC4A 2LQWA 2VC8A 1Q95G 5D7UA 4PLLA 1JRIA 2CDTA 4KUIA 1I0CA 2YSQA 4C0ZA 3MP6A 3L2ZA 1ZSZC 2LJ1A 5FRMA 1Q82R 2M02A 5GAOn 4JRPA 3C12A 4IUUA 2E70A 4C8QF 1OPKA 4LE9A 2P4TA 2HSEB 1R0BG 4N4GA 2JNGA 1FWZA 1OU9A 3SD4A 2J6KA 5GAMh 3REAB 2KQWA 3OQ5A 1UJYA 3JCMb 2KRSA 2QDYB 2DIQA 4PJOG 4PJMA 2BE7D 3H0HA 2RHZA 1KQ1A 1H8KA 4BI3A 2J05A 3PFSA 2P84A 2VB6A 3VS6A 3A8MB 2DF6A 1BIBA 2WSEE 3RNJA 3EG1A 3RKYA 2YRVA 1JJ2S 3SWNC 1RAFB 4LDXA 3OW2A 1KK7A 1UGSB 3H6ZA 3TQ7P 2O4XA 3MKDA 3F70A 3S3NA 1FX7A 4J7FA 2WSCE 1U5SA 3OY9A 3JB9H 1VQPT 2HBWA 2KGTA 5EG2A 1LNXA 4DBHA 4D8KA 2FZCB 1MHNA 2YUQA 3TCJA 1W2BP 4DEYA 2LQKA 3JCMX 3CMET 1ZQ1A 3EGDA 2ABLA 1NM7A 2SRCA 3QZ9B 4OMNA 3QUIA 3CCQQ 1KJWA 5LJ5g 4RUGA 2MIOA 1YBYA 5FU6B 3JCMQ 2ZPEB 1X6BA 1S72T 3LH5A 2L89A 2NUPA 1VQPQ 4E7IA 1QKXA 1VQ8A 4F7UB 4OGEA 5HK3A 2QK0A 2QTXA 3M0PA 2XKOC 2JMAA 1VOMA 5FW9A 1WHLA 5KE3A 3I55A 2HBPA 5LJ3e 2X4XA 2QQBA 1NE8A 4M7DF 4F04B 1M2VA 3BDUA 3LX7A 4HCKA 4BE2A 4Z8AA 3CCVQ 3QSUA 3G6EA 3CC4A 4F7UE 4HXJA 1MV3A 3PNWC 4DBQA 2HQEA 2CP3A 4IUPA 2COWA 3RBBB 3FDRA 4KT0E 3VV0A 3M59A 2ROLA 2L8DA 3ULRB 2CUDA 4CC7A 2K6DA 1YIJA 1JO8A 2KYBA 1WPYA 1KC8C 4FT4A 3CEYA 3QWYA 3L2RA 2KY9A 1VQ6A 5LJ5j 1N9RA 2OJ2A 4BUGA 3NGPA 1M1KC 2RQWA 1G3SA 1RAAB 2QA4Q 1ZSZB 1TOVA 1ACMB 3OB9A 1ZSGA 2COYA 3HFNA 1YJ9A 3EGXB 2PZ1A 4J7IA 4E7KA 1JU5C 1KD1U 2BKDN 4E7HA 2XDPA 2EAYA 2DTOA 3WXMB 2F5KA 2Z0WA 3ASKA 4RCBA 1C0MA 2BZXA 2M9UA 3EFOB 2OTLQ 1QCNA 1FYNA 1QWEA 1TWBA 1JQQA 5GAN8 3I55T 5IHKA 3M0QA 1YI2Q 3X26B 3SB2A 3EG0A 1G2BA 3CCMA 4RMOA 4KRTA 2ZZDA 3EG9B 2K57A 2X51A 4HT8A 3OYIA 3OYGA 1JB0E 2OAWA 3FB9A 2B86A 4J9GA 1WQWA 1M3BA 2H3EB 1BKBA 1YITA 1Q7YU 1MV0B 3CXCA 2D9TA 1TS9A 3VS0A 2RI5A 1WJQA 4FU6A 1ZHIA 3BFMA 4PKCC 2DXTA 4L59A 4C92B 4PJOF 2CSIA 2GFAA 3PMIA 2DYIA 4Y91A 1WHMA 5DM7R 1HD3A 3CCRT 3A5ZB 2GNCA 2D8JA 4IUQA 4N4IA 4ZTJA 1WA7A 3QG1A 3CD6A 3LYIA 4M7AF 3NHNA 4TVRA 1Z9QA 1KQSP 1RI9A 2Y90A 4ATOA 2AZSA 3M53A 1OQKA 3A8OB 2JOYA 6AT1B 5IT9E 4RG8A 1OU8A 8AT1B 2A0FB 1K9MR 4LNPA 3JCMc 1ABOA 4AMCA 2KYMA 3JB9J 2QG9B 3GNGA 5KCOA 4J9IA 3RIRA 4QT7A 4ZN3A 1PSEA 4N0AA 3CC7A 2EYYA 2FB7A 2DD5A 4CI0C 3CCJA 1KSWA 1PNJA 1YJNT 2LNVA 3OS5A 3TREA 1RABB 1VQNA 1XNIA 1GXIE 1QVPA 5GAMe 2K79A 5GMKm 2EVRA 3V7SA 4NS5A 1UUEA 5J26A 4L5GA 1K1ZA 1VQ9Q 1QVGA 2ZPGB 3E9GA 4OB3B 2F69A 3FIFA 1YNZA 1UG1A 1GCPA 3CBPA 5FWBA 2LT4A 4C8QC 1OI1A 2HQHA 1C1AA 1UHCA 3M0TA 2ZGWA 4M7AA 1I4K1 4BB7A 3OS2A 3VS5A 3GP8A 2DIGA 3OW2S 2D0NA 4JUVA 2G6FX 2V26A 1NJIR 1VQ4T 3EGDB 2KK4A 3LWHA 1VQOA 3UA7A 2DJZA 2R57A 2COZA 4XAXB 1GBQA 4PL6A 2YRCA 2LDMA 1NPRA 2RPNA 4QKUA 1NEBA 2DL3A 4WTOB 3HPWA 1WZOA 2O2OA 1PHTA 4PJOB 2RM4A 2E5QA 1M9SA 1JXMA 3DB4A 2EWNA 4PJLA 1U1TA 5GAOl 3OS1A 5I22A 4P5NA 4RTYA 3OYHA 3BY7A 2NWMA 1G3YA 2K5IA 2OTJQ 2AKKA 2QQSA 2LCSA 4J9CA 1RACB 2JS2A 2EGAA 4JLGA 1NYGA 3OBYA 4K11A 5GANg 5IHIA 2ZCFB 3G71T 1NYFA 5KYXA 1VQOT 3CCQT 1RADB 1G3TA 3EG2A 1ZLMA 2AZVA 2DXCA 2JW4A 2YUPA 4MMKA 4PJNA 1OPLA 3QPHA 3EH2A 2GQVA 3JB9I 3PIPA 4C92F 3CCLA 1WX6A 4DA4A 1O9SA 2LQ8A 4C5IA 5GAOm 4XTZA 1U8RA 1RUWA 1B7TA 1N5ZA 1VQKT 1SRLA 2KEAA 2QYZA 1WJSA 4M77D 2NUTA 1TG0A 5GMKh 3FRNA 1YHQA 1WJRA 3M0UA 1I1JA 2FEIA 4B9XA 1SRMA 3H0FA 1CKAA 2FO0A 3CC4Q 3CMAT 3H9NA 2AT1B 2XICA 2BE9B 5KYWA 1K73C 2GFUA 2VGMA 4IIMA 3J80E 1TUGB 3JAME 1FMWA 4HVVA 3H0IA 5GANd 2IIMA 3GLXA 3QWXX 1YJWT 1OULA 3G4ST 1QW1A 1ZUYA 2HL3A 3CPWP 1BCMA 1JJ2P 2JN0A 1N8RU 1U3OA 2FPDA 2FL7A 3MEVA 1Q7YR 4IKFA 1K8AU 1NZ9A 1IRXA 2E1HA 1YJ9Q 5FWCA 4C8QB 1UDLA 4LN2A 2LX9A 3G71A 1M90R 1T0JA 3CCJT 2HSPA 2J06A 5GAN5 1JXOA 1N8RR 2LCLA 3OMGA 3ER0A 4C92D 2YXYA 1M5Q1 2NUZA 3SWNA 2DRMA 4CC4B 2P4RA 2DKGA 2K3XA 4C8QE 1T3LA 1HJDA 2EQUA 3H8ZA 1K4US 4BI4A 4MZTA 2QQ9A 2X4JA 3UA6A 1AWJA 2QI2A 3UPUA 4JS4A 2DMOA 2RQVA 1R0CB 1G8XA 2CP2A 5LJ3h 1NG2A 2E10A 3JCMh 3NFCA 3EGXA 1K9MU 3VYHB 4HVUA 1KIKA 1K0XA 2RK1A 1VIEA 2KE9A 2DZCA 2L2PA 3C94A 3HKSA 3JCMJ 1NJIC 3CCUQ 2K3YA 4BE0A 2DLPA 4GBQA 4C8QD 4A54A 1RAIB 2RB6A 4FW2A 5KH6A 4BI8B 3M56A 3MPUB 4LDYA 5D6YA 2M51A 4IUTA 1X2KA 4PJOE 5L8RE 4RG2A 1VYTA 3V8LA 4PJOC 2EGEA 2PVGB 3CCVA 4HT9A 2J6FA 2DEUA 5GJWB 1BU1A 5GMKe 2DAQA 4FYXB 1H641 4J9DA 2R5AA 3CBOA 2ED1A 3E19A 1MMAA 1I07A 1YWPA 1WXBA 3M5AA 2KRMA 5LJ3j 4J9BA 1D3BB 4FSSA 4PJJA 3ZFJA 4D6WA 3CMEQ 3E9FA 1Y96B 2HZYA 1UGRB 4M77C 4M77E 3JB9F 4AG1C 3NMZC 3TSZA 4RTZA 1VQ7T 4Y92A 4OB1B 4EDUA 4M75B 2AIRB 2IG0A 2B8AA 5IXBA 4LUEA 3S6WA 2W10A 2EJGA 5LL6S 1GBRA 2OTJT 3SWNB 1VQNT 3SEMA 1W1FA 2X4YA 1UJ0A 4J6XA 1E7OA 1JBMA 5KYUB 1UTIA 1I5LA 2E6NA 1OZ3A 2FVUA 1QWFA 5ECAA 2FPEA 8ATCB 1E6GA 2KXDA 1Y96A 2A28A 1N6AA 2CZ0B 3CMAA 1Y57A 4BACA 4M77F 5KYWB 2K3BA 1ARKA 1YN8A 3MP1A 3MEWA 4M7AB 3VUBA 4R55A 3EAEA 3X25B 3VU3C 1YFNA 3P8BB 3M55A 2NYSA 1PRMC 4FYWB 2D1XA 4UC4A 2F2WA 1MNDA 3A8GB 1G83A 3D7SB 2E65A 2GBQA 4JJCA 2JTFA 4JJBA 5KYXB 2KMTA 3I5RA 1PC0A 3CCEA 1Y0MA 2HD0A 1YITT 1I5OB 3CC2T 2NLUA 3UT1A 2VASA 3RESA 4HA8A 3CPWA 2QTVA 3OYAA 4OMQA 4EMKB 4M75F 2DFUA 2VXEA 2KT1A 5GAN3 1M27C 1VYVA 1XOVA 2E12A 1M90C 2YUNA 3JCMd 3PVLA 4DOVA 2ED0A 3I9QA 2V1RA 1S72A 1JEGA 1VQ8T 1B07A 2M0YA 5KYYA 2K5FA 3OYNA 2HQXA 2C06A 4GLKA 4PFOA 3JCMP 3J81E 4X1VA 3KFVA 3OA6A 2KI7A 5HY6A 1RAHB 2XDDA 2I0NA 4A4HA 4V2SA 2KT8A 2E41A 5CKDA 3CCJQ 2AHJB 3HFOA 2JZ2A 1D0ZA 2KXCA 4JDSA 2D6FA 5CVIA 2LVMA 1K8AR 4A4EA 1VQ9A 2EFIA 2V8KA 3CC4T 4WCIA 2LJ0A 1V29B 2DVEA 2K4YA 1WFWA 4FT2A 1IZ6A 1XTDA 3RKXA 2RQTA 4KULA 4FM4B 1PD1A 2D8HA 1VQ6T 1AZGB 1KQSA 3FJ5A 5GAMj 4XTXA 2BUDA 1QVFS 1TH7A 1Y71A 2KDSA 1HXDA 4KGZB 2K7AA 1N27A 1CKBA 3A1PA 4GLMA 2C0IA 5HKCA 2R5MA 2K2VA 1X69A 5GAN4 2G3RA 2KVQG 3OYYA 4Z02A 3CCSQ 2D0QB 3CCMT 1SSFA 2K9GA 3RR6A 1YHQQ 1KD1R 1PCXA 1W2BA 2CUBA 1YJNQ 1YJWA 4JJNK 4M78E 1WGSA 4RTUA 2QGFB 4MZMA 1MMNA 1VUBA 2L3PA 1D0YA 2Y4XA 3SFMA 4EIKA 3QHSA 7AT1B 3HTRA 4X9DA 2F2XA 3NTKA 2CS7A 3MJXA 1SKUB 3NTIA 3M0RA 3C4SA 3JCMe 3EFRA 1QMCA 2ZAEA 1PKTA 2LCCA 1NLPC 3QYGB 4A63B 3PMTA 4B9WA 4C0DB 1YIJQ 5IXFA 1I8FA 2X3WD 2FHDA 4M7AD 3MCAB 2KAFA 3JCMW 3UDCA 3QDFA 2EKHA 1I81A 3QJYA 2ZPBB 2O9SA 4OVAA 1M90U 1K0SA 5LJ5d 1KG1A 4ZGEB 1AWOA 4EMHA 2RI3A 4Z89A 3X24B 4M77G 3M54A 1ZBXA 3UATA 1RLQC 4XU0A 2X3XD 3IQLA 4GY5A 1PSFA 3LGFA 3P8HA 4RTTA 5J39A 3I56Q 2QQRA 1AD5A 3CCUT 1YI2A 4E7ZA 3LLRA 1IGUA 3OYEA 1TU0B 3OYFA 3GF5A 3PE0A 2JVVA 3HHTB 3I5SA 1GFDA 4AG2C 3MEAA 2WSFE 4RTWA 1QVGP 2QGGA 3VYGA 4M75C 3OYCA 1M8MA 2MI6A 3EHRA 2QEXA 2EQJA 2EYQA 1FXXA 1VA7A 1AOJA 5GAN2 4EMKC 3P8DA 4HCCA 4BD3A 1GFCA 4F7UG 2QA4T 2LP5A 2F2VA 1EX4A 4RTVA 5CKHA 4IURA 5GANh 1EIFA 3X20B 3JCMf 1XJWB 2EPDA 3TSWA 3CCUA 1YI2T 2PUOB 2F5TX 3CD6Q 4ZN1A 5CAIA 1SG5A 4M7DE 5DLOA 1BI0A 2YWWA 1W4SA 2JS0A 2HAXA 1W2BS 3X28B 3JCMg 4M4ZA 3CPFA 4O6JA 2DJQA 1M1KU 2YRDA 3QDRB 4ZNXA 1D1BA 5KYYB 1B3QA 2YUOA 2DO3A 2PNIA 2HDAA 2DERA 3SDZA 1LVKA 1D3BA 1E6HA 3ZL7C 3CC7Q 2E5KA 4ELZC 3EFOA 4FIBA 4F16A 1C6VX 2LNHB 1VQ5T 1KQSS 2L5QA 3EH1A 3V8JA 4MZPA 1AT1B 2HMAA 3CMAQ 1M2OA 4OB2B 5J3BA 3PVQA 5CKBA 1D09B 1ZSZA 3ZEHA 2V8JA 2KROA 2EYWA 3CXCP 5A0LA 2OTLT 5GAN7 3A8LB 4M78C 1TTHB 5LJ5f 3EGUA 4E2FB 4JRQA 2CT3A 1M2VB 3VUZA 3G4SQ 1MUZA 3QBYA 1BI3A 1EZZB 3O5ZA 2BIVA 1D1CA 3CXCS 3CCEQ 4M7AG 1K73R 1PKSA 2RK2A 4DEXA 5CCAA 4XTYA 1VQKQ 1WHJA 2EYXA 4PFPA 5D6WA 1IGQA 4CRIA 2I2LA 3OS0A 2CSQA 4M77A 3RMSA 4PK4A 3QO3A 3M58A 5GJVB 3C95A 3DB3A 1H92A 2MK5A 1GCQA 2GCXA 2LQNA 3OSVA 1VQLQ 3PT9A 3BE3A 5FLXE 2OI3A 3VS4A 5A0DA 2M16A 2QAZA 2FZKB 5L23A 1H3HA 3UF4A 3MP8A 1BBZA 4XTWA 1KFZA 1SEMA 2MCNA 2MAMA 2MOXA 2VWFA 2DXBA 3I35A 1G5VA 4F17A 1QLYA 4M75E 1EFNA 2L0AA 2QDLA 2RHXA 4FL6A 2ROTA 3GPLA 4JJDA 4QQDA 3TU4K 2PTKA 1SF9A 2RJFA 1YIJT 1O75A 2VKNA 1BI2A 1Q82U 3FC3A 1UB4A 4LDUA 2EIFA 4DQ2A 1OYXA 2FPFA 3ME9A 2FG0A 1M1GA 4F7UF 1GL5A 2DETA 1TSFA 4J6YA 4B6MA 4M7DC 1MMDA 4PLIA 5LJ5e 4OF1A 1VQ4A 3REBB 3I56T 2DTHA 2XHCA 2NUTB 2FYKA 3KBGA 4BY6B 4E47A 1UECA 1Q81U 2MYSA 4JRKA 2CKKA 5CQYA 2O01E 2HEQA 4EMKA 1IREB 1P92A 3A98A 3QIIA 1YP5A 5IN1A 1VYUA 1UFFA 4O5VA 4YTLA 2CP6A 4JZ3A 2IPOB 5CO7A 4DBRA 4Y28E 1QCFA 3OYMA 3THKA 5IHNA 1M3AA 1PM3A 5CKFA 3CCRA 1FMKA 5FRNA 2EJFA 3CC2Q 2MPXC 3HSBA 4FW1A 2EQMA 3MO8A 3LWIA 2LZ6B 1UHFA 2A3LA 2XIDA 3JSCA 4C5HA 1AHJB 4AFQC 4M75A 2EW3A 1X6OA 4F14A 3CBMA 1GCQC 2CH4W 2OX7A 2LT1A 4M78D 2V1QA 3I56A 1IXDA 1WNLA 3M4YA 4KBMB 1Q86U 1WHGA 2KNBB 3KXTA 5KYUA 1QCOA 3AHUA 1BK2A 1FMVA 4LUDA 3E1SA 1W70A 3L2VA 3U23A 5I11A 1VQMT 3RERA 5EC7A 1K9AA 2CYZB 2GTJA 2JTMA 2DX1A 2M1HA 4M77B 5FU7C 2PVOB 2CGHA 2DNUA 1HK9A 2DRKA 2KSSA 2E3IA 4ESRA 1IB8A 1YCSB 3LH0A 4LD6A 1RL2A 5DLQE 4AFUC 4JS5A 2O4XB 2JUFA 1OX9A 1QVFP 1M30A 1WI7A 1ZA1B 3VKIA 5GANe 3QZ5B 1KHIA 1KHCA 4M7AE 1YJ9T 3RKWA 3QJ6A 4BDZA 1X01A 2O31A 5KCHA 1F1BB 3EG9A 2DEQA 2XI9A 2CP7A 5A2QE 1V76A 3HRUA 4E7JA 3TVTA 5GANf 2PVDB 2VV5A 1VQPA 1JJ2A 3QYHB 3L2QA 2HKQB 2VXFA 1TUCA 1W6XA 4QVZA 4KH0B 1VQ8Q 3JB9D 1PWTA 1CSKA 1D0XA 1M3CA 3ZBDA 2KBTA 1QVFA 2YLCA 4ZTFA 1X2QA 1U06A 1V1CA 2A36A 3EG3A 3QXEB 5GAMf 2BTTA 4KUDK 1BB9A 5D6XA 2JT4A 2QEXQ 4RKUE 1IHWA 3CCST 3VJPA 1S1NA 3HRTA 3NPFA 4X9CA 4J8OA 4Q5WA 2P0PA 2ESWA 5DY9A 4E7LA 4J6WA 1YJWQ 3BDLA 1M4ZA 4FYVB 4A4GA 1HSQA 5HCKA 4M75D 1NJIU 2H8HA 3TEEA 3N5BB 1VQ5Q 5CR2A 3V7CA 2A37A 4C8QG 2DD4A 2GQIA 3M9QA 1DJ7B 1SHGA 2CREA 3PGGA 1BYMA 3CMEA 1Q86R 4FSXA 1VQ6Q 4ELYC 1LPLA 2E64A 2QQAA 4OMOA 2RHUA 4PJOA 2RJEA 1NBEB 2RHIA 4ME7A 2LX7A 4BY6C 1K8AC 3PTAA 3CCLT 2F1LA 4NL2A 2E3HA 2XK0A 2JXBA 3L42A 4FCYA 3UWNA 2Y4YA 4OGCA 2XDBA 2X4WA 4J5YA 5C0MA 3CCMQ 4HCBA 5LJ3g 2E4HA 1IHVA 4EPCA 3HRSA 5FU6C 1PRLC 1VQKA 2RD1A 2PU9B 1NEGA 3G7ZA 5GMKi 2HL5C 3VS1A 3FEOA 1XQHA 3URGA 2EYZA 2DZ9A 4OMPA 3RMQA 5FU7B 3BW1A 2RMOA 4MMLA 2C0TA 4KH1B 4OMFB 1ZA2B 4XU1A 1UGPB 3G1JA 3EHQA 1KD1C 3G4SA 3DLLA 2DXUA 1H3ZA 2EGCA 1TXQA 2CZ1B 2JM9A 1T0HA 2BZYA 1OOTA 3JB9G 2KR3A 1IO6A 2RQRA 4QVCA 4MDXA 4C0FA 3OBWA 2CZ6B 2YT6A 2MWOA 2EJ9A 2O88A 4LD9K 4J9HA 2A7YA 4C0DC 1VQ7A 1S72Q 2WACA 1RI0A 3VS3A 3META 5LJ5h 2DBMA 4M7DB 4XK8E 1PD0A 4II1A 2YLBA 1RLPC 4JRIA 1R8OB 4HKEA 3JCMV 4CC3A 3VRYA 4OB0B 1M8VA 4JZ4A 2RH2A 4PJOD 1RAEB 3JV3A 2EBPA 1VQMA 4M75G 3FLGA 1VQ4Q 3HP9A 2DA9A 1M1KR 2DL5A 1SSHA 2MWPA 5GAMg 2RF0A 1YCYA 1WXUA 2XD0A 3FJPA 3A8HB 4EMGA 5GMKl 4ANJA 4M78G 1QVGS 4C8QA 5A0GA 4ORZA 2X9HA 1N9SA 3NTHA 1X6GA 1B34A 3OYJA 1ZBJA 4L6V5 2ZPIB 1GRIA 2RI2A 3S3MA 2RHYA 3CCQA 1UGQB 2RQUA 2C0OA 4AFSC 2YDLA 2EQIA 2XU8A 3G6ET 1Q81R 3WVDB 1Z9ZA 3CC2A 5CK9A 1LJOA 3HL8A 2DM1A 1NPPA 1D1AA 3I55Q 2JMCA 5GAOq 1MGQA 3CCSA 4PNOA 4C92E 1VQOQ 3AT1B 3LGLA 4C92C 1K73U 2DL7A 2DL8A 4C0GA 1YJNA 1YWOA 4XQ3A 3G6EQ 1K76A 3OYLA 3M4GA 2L3QA 4LXCA 4MDWA 1VQLT 1OZ2A 2K2MA 5C6SA 3MHXA 3R6OA 1QQJA 1Q86C 4C5EA 5GAOr 2GGRA 2VVKA 4E7SA 4LDWA 4PFZA 4WF2A 5FROA 2X35A 2DILA 3KUFA 4M7DD 5AT1B 2DBKA 1T3SA 4XU3A 2KRNA 3L1AA 2RA2A 4CC2A 1AVZC 1R77A 4JLIA 2OTJA 1UGVA 2RJDA 2YHTA 5CQXA 1K9MC 1VQ9T 4JPBW 3EFSA 1X75C 3OYBA 1HYOA 3OSSC 2EQKA 5M9OA 3DLMA 3PIOA 1MMGA 2RN8A 3SHWA 4NOYA 4C5GA 4XTVA 4F7UA 1UE9A 2VYTA 1AWXA 2FRYA 1BI1A 2NUPB 3V7RA 1SPKA 3OMCA 1LOJA 3M57A 1KQ2A 2EKOA 3QKJA 3CCLQ 1M1FA 2LJ3A 4A53A 4RCCA 2O9VA 5LJ3d 4XU2A 2DVJA 2GTOA 2W0ZA 5GANj 2PQWA 3OYDA 2LRQA 5I21A 1WDXA 4IUVA 4DOWA 1UEBA 4OMLA 2DE0X 4KGXB 3M0SA 4LDVA 2ENMA 2J6OA 2ZPFB 3J7AF 4QVDA 3GBQA 3CPWS 1QP2A 2JTEA 2QXFA 3VS7A 3CQTA 1VQ5A 4X34A 2ATCB 2RJCA 1ZUKA 1A0NB 3CCET 3CCRQ 3OYKA 1Q82C 2XMFA 4A4KA 5GMKj 4IIOA 1OEBA 1RAGB 4M7AC 1MNEA 2RO0A 5HK0A 2IVWA 2PUKB 1YHQT 1OV3A 1J3TA 2CZ7B 5GAN6 3E2UA 1WXTA 2JM8A 2FZGB 4XTUA 4DBFA 2HCKA 3LW5E 3GNFB 2AK5A 2E6ZA 2QASA 5CIUA 3C0CA 3RDVA 4J9FA 5IH2A 3G71Q
chains in the Genus database with same CATH topology
2OTLA 2K5FA 3OYNA 2HQXA 4BDYA 2C06A 4GLKA 4M78D 2MF2A 3I56A 3JCMP 1WNLA 3CCVT 3M4YA 4KBMB 3J81E 1Q86U 3JB9J 3GNGA 4M78F 5KCOA 3KXTA 2VGNA 3RIRA 3AHUA 3OA6A 5HY6A 4N0AC 3E1SA 4QW2A 1Y7XA 2P0KA 2XDDA 4ZN3A 1PSEA 4N0AA 3L2VA 3CC7A 2FB7A 3S3OA 2DD5A 4A4HA 4V2SA 4CI0C 3CCJA 3MEUA 2LNVA 2E41A 5CKDA 3OS5A 3DKMA 1YJNT 1VQMT 3RERA 3TREA 2CYZB 1VQNA 2JTMA 1XNIA 1GXIE 2M1HA 4M77B 2AHJB 1QVPA 2PVOB 3HFOA 2CGHA 5FU7C 5GAMe 1HK9A 2JZ2A 2KSSA 1WQ7A 4JDSA 2D6FA 3RUXA 5CVIA 5GMKm 3V7SA 3LH0A 2LVMA 4NS5A 2ZPHB 4LD6A 1RL2A 5DLQE 4JS5A 5J26A 2O4XB 4L5GA 2JUFA 4A4EA 5GAMd 1QVGA 1VQ9A 2EFIA 2V8KA 2ZPGB 3E9GA 5GAOp 3CC4T 2QA4A 1V29B 2DVEA 2F69A 2K4YA 3FIFA 3QZ5B 4OB3B 3VKIA 5GANe 1KHIA 1KHCA 2GF7A 3CBPA 4M7AE 4FT2A 2M0OA 3INZA 3RKWA 1IZ6A 1YJ9T 2LT4A 3QJ6A 4C8QC 4BDZA 1OI1A 1X01A 1XTDA 3RKXA 4KULA 5KCHA 3Q1JA 4FM4B 4QQ6A 4ZGJB 2P0QA 5I2SA 2V8IA 1VQ6T 2DEQA 2ZGWA 4M7DA 1KQSA 2XI9A 4M7AA 2DTIA 5A2QE 5IAYA 1I4K1 4BB7A 5GAMj 2R58A 3HRUA 4XTXA 4E7JA 3OS2A 5GANf 1QP3A 2PVDB 2BUDA 2VV5A 1VQPA 3QYHB 3L2QA 1JJ2A 1U1SA 1QVFS 1TH7A 2VXFA 1Y71A 4QVZA 2DIGA 4VUBA 2KDSA 3GP8A 3OW2S 1HXDA 3JB9D 4C92G 2H3JA 1N27A 4JUVA 3ZBDA 3T9NA 5HKCA 2YLCA 3L2WA 4ZTFA 2R5MA 1VQ4T 1QVFA 2K2VA 2MMPA 3QXEB 4M78A 5GAMf 3V8KA 5GAN4 2G3RA 2KVQG 2L3RA 2KK4A 3OYYA 4Z02A 4ZGDB 4KUDK 2D0QB 5CKEA 2HNIA 4RKUE 5D6XA 1SSFA 2DJZA 2R57A 3LWHA 3CCMT 4XAXB 3CCST 3VJPA 3HRTA 4PL6A 4BE1A 4X9CA 2LDMA 3JRZA 4J8OA 5AYFA 4Q5WA 1NPRA 1W2BA 4OP0A 2P0PA 5DY9A 2LTOA 1YJWA 4E7LA 4JJNK 4HCZA 4M78E 4J6WA 1VQLA 3BDLA 1WGSA 3HPWA 1M4ZA 4A4GA 4MZMA 1VUBA 4NL3A 4C92A 2Y4XA 4M75D 1NJIU 2RM4A 3SFMA 4PJOB 3QHSA 2E5QA 3CD6T 4X9DA 3NTKA 3TEEA 1KD1U 3N5BB 1M9SA 2VUBA 2CS7A 5CR2A 3V7CA 3DB4A 2EWNA 3NTIA 4C8QG 2DD4A 3C4SA 3JCMe 1U1TA 5GAOl 3M9QA 3OS1A 3EFRA 4M7DG 1DJ7B 1Q7YC 2LCCA 4A4FA 3QYGB 5KE2A 4P5NA 3PGGA 3PMTA 4B9WA 2DK3A 1VIFA 1BYMA 2DPPB 4C0DB 3OYHA 3CMEA 3BY7A 4FSXA 1I8FA 4R56A 4QQGA 2FHDA 4M7AD 1G3YA 4N4HA 2K5IA 3MCAB 2KAFA 3GOXA 3JCMW 2QQSA 3UDCA 4ELYC 1I81A 2E64A 1G3WA 2QQAA 5I2MA 3QJYA 2RHUA 2ZPBB 2RJEA 4JLGA 4OVAA 3OBYA 4PJOA 1M90U 1B34B 5LJ5d 1KG1A 4ZGEB 2RHIA 5GANg 4ME7A 2ZCFB 4EMHA 2RI3A 2K5LA 4BY6C 3L2UA 1N8RC 3G71T 2OAUA 1Y07A 1K8AC 3CC7T 3X24B 3PTAA 4M77G 3M54A 1ZBXA 3CCLT 4NL2A 3CCQT 1VQOT 4XU0A 3GIBA 2XK0A 5LJ3f 4GY5A 3L42A 1PSFA 1G3TA 3LGFA 3P8HA 3WVEB 5J39A 2QQRA 2DXCA 3UWNA 2Y4YA 3CCUT 1YI2A 4MMKA 4OGCA 3QPHA 2XDBA 2XG8D 2X4WA 4J5YA 4M78B 5C0MA 2GQVA 3O8VA 3LLRA 5LJ3g 3JB9I 3OYEA 3PIPA 4C92F 2QEXT 3CCLA 4HCBA 4EPCA 1BIAA 3OYFA 3GF5A 4DA4A 3HRSA 1O9SA 2LQ8A 5FU6C 4C5IA 5GAOm 1KC8U 2JVVA 1VQKA 2RD1A 4J83A 4XTZA 1U8RA 2PU9B 3HHTB 3MEAA 1VQKT 2WSFE 1WJSA 3G7ZA 4M77D 5GMKi 3FEOA 1XQHA 3VYGA 4M75C 3OYCA 3URGA 2MI6A 2QEXA 2LC4A 2EQJA 5GMKh 2VC8A 2EYQA 3FRNA 2DZ9A 1YHQA 1FXXA 1Q81C 1WJRA 3RMQA 5FU7B 5GAN2 3BW1A 4PLLA 4EMKC 1JRIA 4KUIA 4MMLA 4B9XA 4OMFB 3P8DA 4HCCA 4XU1A 4BD3A 4C0ZA 2QA4T 3MP6A 1UGPB 4F7UG 3L2ZA 3CMAT 2XICA 1K73C 5FRMA 2GFUA 5CKHA 2VGMA 1KD1C 3G4SA 3DLLA 5GAOn 4JRPA 3C12A 2DXUA 1H3ZA 4IUUA 2E70A 4IURA 4C8QF 5GANh 3J80E 1EIFA 2CZ1B 3X20B 3JAME 3JCMf 5GANd 3GLXA 3JB9G 2P4TA 1YJWT 3CCUA 4N4GA 1YI2T 4QVCA 4MDXA 2JNGA 4C0FA 3G4ST 1QW1A 1FWZA 3SD4A 2PUOB 2F5TX 3OBWA 2CZ6B 4ZN1A 5GAMh 2KQWA 3OQ5A 2MWOA 2EJ9A 2JN0A 3JCMb 1N8RU 2QDYB 5CAIA 2DIQA 1VQOA 2FL7A 3MEVA 4LD9K 4PJOG 4M7DE 4IKFA 2A7YA 4C0DC 1K8AU 1VQ7A 1NZ9A 2E1HA 5DLOA 1BI0A 2WACA 1W4SA 1RI0A 2RHZA 4C8QB 1W2BS 1KQ1A 3X28B 3META 5LJ5h 3JCMg 2HAXA 3CPFA 4BI3A 4O6JA 4M7DB 2LX9A 3PFSA 3G71A 1M1KU 4XK8E 3QDRB 3A8MB 4II1A 2YLBA 3CCJT 1BIBA 4JRIA 1R8OB 4HKEA 2WSEE 3JCMV 5GAN5 2DO3A 4OB0B 3RKYA 1M8VA 2RH2A 2LCLA 4PJOD 3OMGA 3SDZA 3ER0A 2YRVA 1JJ2S 4C92D 3SWNC 1D3BA 4LDXA 4ELZC 1M5Q1 3SWNA 3OW2A 1VQMA 1UGSB 3H6ZA 4FIBA 1VQ5T 2O4XA 4M75G 3FLGA 1KQSS 2L5QA 2DKGA 3F70A 3HP9A 2K3XA 3V8JA 4MZPA 3S3NA 1FX7A 4J7FA 4C8QE 2WSCE 4OB2B 5J3BA 3OY9A 2MWPA 5CKBA 5GAMg 3JB9H 1VQPT 3ZEHA 2V8JA 2EQUA 3H8ZA 5EG2A 4BI4A 4MZTA 1YCYA 2QQ9A 2XD0A 2X4JA 3FJPA 3A8HB 4EMGA 2QI2A 1LNXA 5A0LA 5GMKl 5GAN7 3A8LB 4M78G 4JS4A 4M78C 3UPUA 2OTLT 1QVGS 4C8QA 1MHNA 5LJ5f 5A0GA 4JRQA 5LJ3h 3TCJA 2LQKA 3JCMX 2E10A 3JCMh 3NFCA 3VUZA 1N9SA 3NTHA 1B34A 3OYJA 4L6V5 1K9MU 3CMET 3QBYA 1ZQ1A 2ZPIB 2RI2A 3S3MA 1BI3A 3VYHB 2RHYA 3CCQA 1UGQB 3QZ9B 2RK1A 3QUIA 1VIEA 5LJ5g 2BIVA 3CXCS 4M7AG 1YBYA 2DZCA 2XU8A 3C94A 3HKSA 5FU6B 2RK2A 2ZPEB 3JCMQ 3G6ET 3WVDB 3JCMJ 1S72T 1NJIC 2L89A 4E7IA 2K3YA 3CC2A 5CK9A 1LJOA 5CCAA 4BE0A 3HL8A 1VQ8A 4F7UB 4OGEA 5HK3A 2QTXA 4XTYA 2XKOC 1NPPA 4C8QD 5D6WA 5KE3A 4A54A 2RB6A 5GAOq 3I55A 2HBPA 4CRIA 5LJ3e 2X4XA 2QQBA 1MGQA 2I2LA 1NE8A 3OS0A 3CCSA 4PNOA 5KH6A 4M77A 4M7DF 4BI8B 3RMSA 3M56A 4LDYA 5D6YA 4C92E 3QO3A 3BDUA 3LGLA 3M58A 4C92C 1K73U 3C95A 4IUTA 3DB3A 4PJOE 4RG2A 5L8RE 3LX7A 4C0GA 3V8LA 4BE2A 1YJNA 4PJOC 2GCXA 3QSUA 2PVGB 3CCVA 4HT9A 4XQ3A 3OSVA 3G6EA 3OYLA 3M4GA 3CC4A 5GMKe 3PT9A 4MDWA 1VQLT 4F7UE 1OZ2A 2DAQA 3MHXA 1H641 3PNWC 5C6SA 3R6OA 5FLXE 1Q86C 2HQEA 5A0DA 2R5AA 4C5EA 3CBOA 4IUPA 5GAOr 2M16A 3E19A 3FDRA 4KT0E 3VV0A 4LDWA 4WF2A 5FROA 2X35A 3KUFA 3M5AA 3MP8A 4XTWA 4M7DD 3M59A 5LJ3j 1D3BB 2L8DA 2MAMA 4XU3A 2DXBA 3ZFJA 3L1AA 2RA2A 4D6WA 1YIJA 1G5VA 1WPYA 3E9FA 1KC8C 4FT4A 1Y96B 3CEYA 3L2RA 4M75E 2KY9A 1UGRB 1VQ6A 4M77C 2RHXA 1N9RA 4FL6A 4BUGA 4JLIA 4M77E 5LJ5j 2RJDA 1M1KC 3JB9F 2OTJA 1G3SA 2YHTA 5CQXA 1K9MC 1VQ9T 3GPLA 4QQDA 3EFSA 3OB9A 1X75C 3OYBA 3TU4K 1VQ7T 1YJ9A 3HFNA 4OB1B 4EDUA 4J7IA 4M75B 3OSSC 2EQKA 4E7KA 2RJFA 1YIJT 2BKDN 3DLMA 2IG0A 2XDPA 5M9OA 3PIOA 4E7HA 1O75A 2B8AA 2EAYA 1BI2A 2DTOA 3S6WA 4NOYA 2EJGA 2F5KA 5LL6S 3WXMB 4C5GA 3FC3A 1Q82U 3ASKA 4XTVA 4RCBA 4F7UA 1UB4A 2M9UA 2VYTA 3SWNB 2OTJT 1VQNT 1BI1A 2X4YA 5GAN8 4J6XA 3I55T 4LDUA 3V7RA 2EIFA 1JBMA 3OMCA 4DQ2A 1OYXA 3ME9A 3X26B 3SB2A 1LOJA 1I5LA 3CCMA 2E6NA 1M1GA 1OZ3A 3M57A 4F7UF 4RMOA 1KQ2A 2FVUA 2ZZDA 2EKOA 4J6YA 2K57A 3QKJA 4HT8A 1M1FA 4M7DC 4PLIA 5LJ5e 3OYIA 4OF1A 4A53A 4RCCA 3OYGA 1JB0E 1Y96A 5LJ3d 3FB9A 4XU2A 1VQ4A 3I56T 1N6AA 5GANj 2CZ0B 1WQWA 2DTHA 2PQWA 2XHCA 3OYDA 1BKBA 3CMAA 1YITA 2FYKA 1Q7YU 2LRQA 3KBGA 4M77F 4BY6B 5I21A 4BACA 4E47A 3CXCA 3MP1A 1Q81U 3MEWA 4M7AB 2D9TA 4IUVA 3VUBA 4R55A 4JRKA 4DOWA 2CKKA 1UEBA 2RI5A 3EAEA 5CQYA 2O01E 1WJQA 3X25B 3VU3C 4FU6A 4EMKA 3P8BB 1IREB 1ZHIA 4LDVA 3BFMA 4PKCC 1P92A 2ZPFB 3J7AF 4QVDA 3M55A 2DXTA 3QIIA 4L59A 5IN1A 4C92B 4PJOF 4O5VA 3CPWS 2GFAA 1QP2A 4YTLA 4UC4A 5CO7A 2QXFA 4Y28E 3A8GB 3OYMA 1VQ5A 4X34A 2RJCA 3PMIA 5CKFA 2E65A 3CCRA 3CCET 4Y91A 5DM7R 2JTFA 3OYKA 2KMTA 5FRNA 3CCEA 3CCRT 4A4KA 1Q82C 2HD0A 3A5ZB 5GMKj 1YITT 2EJFA 3CC2T 2NLUA 3UT1A 3RESA 4HA8A 3CPWA 4M7AC 4IUQA 3OYAA 2RO0A 4N4IA 5HK0A 2IVWA 4EMKB 4M75F 2PUKB 4ZTJA 1YHQT 3QG1A 3HSBA 3CD6A 2CZ7B 3LYIA 2EQMA 3MO8A 3LWIA 5GAN6 2VXEA 5GAN3 4M7AF 1XOVA 2A3LA 2E12A 4TVRA 1M90C 2XIDA 3JCMd 3JSCA 4XTUA 4DOVA 4C5HA 2Y90A 3LW5E 1AHJB 3GNFB 1S72A 2E6ZA 4ATOA 4M75A 3M53A 3A8OB 2JOYA 5IT9E 5CIUA 1X6OA 3CBMA 4RG8A 1VQ8T 2LT1A 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU3 A;  1BIB A;  4JRI A;  4M78 D;  3JCM P;  3BY7 A;  2RA2 A;  1WNL A;  3L1A A;  3JCM V;  1WPY A;  5GAN 5;  1I8F A;  3JB9 J;  1Y96 B;  3RKY A;  4M75 E;  4M78 F;  1M8V A;  4M7A D;  4PJO D;  4M77 C;  5LJ5 j;  1N9R A;  3JCM W;  3RIR A;  4JLI A;  4M77 E;  3AHU A;  3JB9 F;  1I81 A;  2YHT A;  2E64 A;  1D3B A;  4N0A C;  3SWN C;  4C92 D;  1M5Q 1;  4N0A A;  3SWN A;  3EFS A;  4PJO A;  2FB7 A;  3HFN A;  1B34 B;  5LJ5 d;  4V2S A;  5GAN g;  4M75 B;  2E41 A;  4M75 G;  2DKG A;  4EMH A;  3RER A;  3V8J A;  2EAY A;  4M77 G;  2DTO A;  4M77 B;  4NOY A;  2EJG A;  3HFO A;  2CGH A;  4NL2 A;  4XU0 A;  4C8Q E;  5GAM e;  4XTV A;  1HK9 A;  5LJ3 f;  4RCB A;  4F7U A;  3GIB A;  1WQ7 A;  3SWN B;  3RUX A;  5GAM g;  3JB9 H;  5GMK m;  3V7S A;  5GAN 8;  4J6X A;  1YCY A;  3V7R A;  4MMK A;  1JBM A;  4DQ2 A;  3FJP A;  4EMG A;  1LNX A;  3SB2 A;  5GMK l;  1LOJ A;  4J5Y A;  4M78 G;  4M78 B;  4M78 C;  5GAM d;  5GAN 7;  4F7U F;  1I5L A;  4C8Q A;  5LJ5 f;  3JB9 I;  5LJ3 g;  5GAO p;  1KQ2 A;  4C92 F;  2DVE A;  5GAN e;  3FIF A;  2K57 A;  4J6Y A;  1BIA A;  5LJ3 h;  4HT8 A;  3JCM X;  4M7D C;  5GAO m;  4M7A E;  2E10 A;  3JCM h;  5LJ5 e;  1N9S A;  3INZ A;  3RKW A;  4A53 A;  1B34 A;  2RD1 A;  4RCC A;  4XTZ A;  5LJ3 d;  1Y96 A;  4C8Q C;  1X01 A;  3FB9 A;  4XU2 A;  3RKX A;  5GAN j;  2DTH A;  1WQW A;  2FYK A;  4M77 D;  5GMK i;  4M77 F;  5I21 A;  3QUI A;  5LJ5 g;  4M75 C;  2DEQ A;  2ZGW A;  4M7D A;  4M7A B;  2VC8 A;  5GMK h;  4M7A A;  2DTI A;  2DZ9 A;  2DZC A;  3JCM Q;  4M7A G;  1I4K 1;  4JRK A;  3JCM J;  5GAM j;  5GAN 2;  3BW1 A;  4XTX A;  4EMK C;  1JRI A;  4MML A;  3VU3 C;  5GAN f;  4EMK A;  1LJO A;  3BFM A;  1U1S A;  4XU1 A;  1TH7 A;  2VXF A;  4F7U B;  4F7U G;  4QVD A;  3L2Z A;  1HXD A;  2DXT A;  3JB9 D;  4C92 B;  4PJO F;  2QTX A;  4C92 G;  4XTY A;  4JUV A;  4C8Q D;  2YLC A;  5GAO n;  2DXU A;  4A54 A;  2RB6 A;  5GAO q;  5LJ3 e;  4C8Q F;  5GAN h;  4M78 A;  5GAM f;  1MGQ A;  2I2L A;  2E65 A;  3V8K A;  5GAN 4;  4PNO A;  3JCM f;  4Y91 A;  4M77 A;  4M7D F;  2HNI A;  4C92 E;  2DJZ A;  3BDU A;  3QO3 A;  4C92 C;  5GAN d;  3JB9 G;  5GMK j;  2EJF A;  4X9C A;  4PJO E;  3V8L A;  4PJO C;  3RES A;  4HA8 A;  4QVC A;  4OP0 A;  3QSU A;  4M7A C;  5DY9 A;  4HT9 A;  4XQ3 A;  4EMK B;  4M78 E;  4M75 F;  4J6W A;  3HSB A;  5GAM h;  3M4G A;  5GMK e;  2EJ9 A;  2JN0 A;  3JCM b;  5GAN 6;  4NL3 A;  2VXE A;  5GAN 3;  4C92 A;  5CAI A;  4F7U E;  4M7A F;  4M7D E;  4M75 D;  4PJO G;  2RM4 A;  4PJO B;  3QHS A;  3JCM d;  1H64 1;  4X9D A;  4XTU A;  2E1H A;  2Y90 A;  5GAO r;  3V7C A;  4M75 A;  2EWN A;  4C8Q B;  4C8Q G;  1KQ1 A;  5LJ5 h;  1U1T A;  3JCM g;  3JCM e;  5GAO l;  4WF2 A;  3EFR A;  4M7D D;  4M7D G;  4XTW A;  4M7D B;  5LJ3 j;  1D3B B;  3PGG A;  3JCM c;  2YLB A; 
#chains in the Genus database with same CATH topology
 2OTL A;  4BDY A;  1X27 A;  2MF2 A;  1ZX6 A;  3CCV T;  2CT4 A;  4M78 F;  2VGN A;  2L3S A;  4N0A C;  4RTX A;  4QW2 A;  4OMM A;  1Y7X A;  2P0K A;  4R0K A;  1ZUU A;  1WHH A;  3S3O A;  3MEU A;  1WYX A;  3DKM A;  1VQN Q;  2CP0 A;  1X43 A;  1WQ7 A;  3RUX A;  4E6R A;  2ZPH B;  1QKW A;  3VRZ A;  5GAM d;  5GAO p;  2QA4 A;  2ECZ A;  2GF7 A;  2M0O A;  3INZ A;  1Q81 C;  2AKL A;  2FRW A;  2A08 A;  3Q1J A;  4ZGJ B;  4QQ6 A;  2JJ9 A;  2P0Q A;  5I2S A;  2V8I A;  2HKN A;  4M7D A;  2DTI A;  4AFZ C;  5IAY A;  1AEY A;  2R58 A;  1OX8 A;  1QP3 A;  1U1S A;  1WHK A;  4VUB A;  4C92 G;  1BCO A;  2H3J A;  3T9N A;  3L2W A;  1VQ7 Q;  2MMP A;  3H41 A;  4D8D A;  4M78 A;  1YIT Q;  2CH4 A;  3V8K A;  2L3R A;  4ZGD B;  5CKE A;  2HNI A;  1WLP B;  4BE1 A;  3JRZ A;  5AYF A;  4KGV B;  4OP0 A;  2LTO A;  2DL4 A;  4HCZ A;  1VQL A;  1TUD A;  2DYB A;  4NL3 A;  4C92 A;  3OW2 P;  2CP5 A;  3CD6 T;  1SHF A;  2VUB A;  1NLO C;  1LCK A;  4M7D G;  1Q7Y C;  4A4F A;  5KE2 A;  1VIF A;  2DK3 A;  2DPP B;  4HVW A;  1AWW A;  5KYN A;  4R56 A;  4FYY B;  4QQG A;  4Z88 A;  4N4H A;  3GOX A;  4AT1 B;  2J7I A;  1G3W A;  5I2M A;  4J9E A;  1B34 B;  1KC8 R;  2RNA A;  2SEM A;  2K5L A;  3L2U A;  1N8R C;  3CC7 T;  2OAU A;  1Y07 A;  3VS2 A;  3GIB A;  5LJ3 f;  1AZE A;  3WVE B;  3R6N A;  1ABQ A;  2BZ8 A;  2XG8 D;  4M78 B;  1WIE A;  3O8V A;  2QEX T;  9ATC B;  1BIA A;  1VQM Q;  1KC8 U;  2LMJ A;  4J83 A;  1PG5 B;  2LC4 A;  2LQW A;  2VC8 A;  1Q95 G;  5D7U A;  4PLL A;  1JRI A;  2CDT A;  4KUI A;  1I0C A;  2YSQ A;  4C0Z A;  3MP6 A;  3L2Z A;  1ZSZ C;  2LJ1 A;  5FRM A;  1Q82 R;  2M02 A;  5GAO n;  4JRP A;  3C12 A;  4IUU A;  2E70 A;  4C8Q F;  1OPK A;  4LE9 A;  2P4T A;  2HSE B;  1R0B G;  4N4G A;  2JNG A;  1FWZ A;  1OU9 A;  3SD4 A;  2J6K A;  5GAM h;  3REA B;  2KQW A;  3OQ5 A;  1UJY A;  3JCM b;  2KRS A;  2QDY B;  2DIQ A;  4PJO G;  4PJM A;  2BE7 D;  3H0H A;  2RHZ A;  1KQ1 A;  1H8K A;  4BI3 A;  2J05 A;  3PFS A;  2P84 A;  2VB6 A;  3VS6 A;  3A8M B;  2DF6 A;  1BIB A;  2WSE E;  3RNJ A;  3EG1 A;  3RKY A;  2YRV A;  1JJ2 S;  3SWN C;  1RAF B;  4LDX A;  3OW2 A;  1KK7 A;  1UGS B;  3H6Z A;  3TQ7 P;  2O4X A;  3MKD A;  3F70 A;  3S3N A;  1FX7 A;  4J7F A;  2WSC E;  1U5S A;  3OY9 A;  3JB9 H;  1VQP T;  2HBW A;  2KGT A;  5EG2 A;  1LNX A;  4DBH A;  4D8K A;  2FZC B;  1MHN A;  2YUQ A;  3TCJ A;  1W2B P;  4DEY A;  2LQK A;  3JCM X;  3CME T;  1ZQ1 A;  3EGD A;  2ABL A;  1NM7 A;  2SRC A;  3QZ9 B;  4OMN A;  3QUI A;  3CCQ Q;  1KJW A;  5LJ5 g;  4RUG A;  2MIO A;  1YBY A;  5FU6 B;  3JCM Q;  2ZPE B;  1X6B A;  1S72 T;  3LH5 A;  2L89 A;  2NUP A;  1VQP Q;  4E7I A;  1QKX A;  1VQ8 A;  4F7U B;  4OGE A;  5HK3 A;  2QK0 A;  2QTX A;  3M0P A;  2XKO C;  2JMA A;  1VOM A;  5FW9 A;  1WHL A;  5KE3 A;  3I55 A;  2HBP A;  5LJ3 e;  2X4X A;  2QQB A;  1NE8 A;  4M7D F;  4F04 B;  1M2V A;  3BDU A;  3LX7 A;  4HCK A;  4BE2 A;  4Z8A A;  3CCV Q;  3QSU A;  3G6E A;  3CC4 A;  4F7U E;  4HXJ A;  1MV3 A;  3PNW C;  4DBQ A;  2HQE A;  2CP3 A;  4IUP A;  2COW A;  3RBB B;  3FDR A;  4KT0 E;  3VV0 A;  3M59 A;  2ROL A;  2L8D A;  3ULR B;  2CUD A;  4CC7 A;  2K6D A;  1YIJ A;  1JO8 A;  2KYB A;  1WPY A;  1KC8 C;  4FT4 A;  3CEY A;  3QWY A;  3L2R A;  2KY9 A;  1VQ6 A;  5LJ5 j;  1N9R A;  2OJ2 A;  4BUG A;  3NGP A;  1M1K C;  2RQW A;  1G3S A;  1RAA B;  2QA4 Q;  1ZSZ B;  1TOV A;  1ACM B;  3OB9 A;  1ZSG A;  2COY A;  3HFN A;  1YJ9 A;  3EGX B;  2PZ1 A;  4J7I A;  4E7K A;  1JU5 C;  1KD1 U;  2BKD N;  4E7H A;  2XDP A;  2EAY A;  2DTO A;  3WXM B;  2F5K A;  2Z0W A;  3ASK A;  4RCB A;  1C0M A;  2BZX A;  2M9U A;  3EFO B;  2OTL Q;  1QCN A;  1FYN A;  1QWE A;  1TWB A;  1JQQ A;  5GAN 8;  3I55 T;  5IHK A;  3M0Q A;  1YI2 Q;  3X26 B;  3SB2 A;  3EG0 A;  1G2B A;  3CCM A;  4RMO A;  4KRT A;  2ZZD A;  3EG9 B;  2K57 A;  2X51 A;  4HT8 A;  3OYI A;  3OYG A;  1JB0 E;  2OAW A;  3FB9 A;  2B86 A;  4J9G A;  1WQW A;  1M3B A;  2H3E B;  1BKB A;  1YIT A;  1Q7Y U;  1MV0 B;  3CXC A;  2D9T A;  1TS9 A;  3VS0 A;  2RI5 A;  1WJQ A;  4FU6 A;  1ZHI A;  3BFM A;  4PKC C;  2DXT A;  4L59 A;  4C92 B;  4PJO F;  2CSI A;  2GFA A;  3PMI A;  2DYI A;  4Y91 A;  1WHM A;  5DM7 R;  1HD3 A;  3CCR T;  3A5Z B;  2GNC A;  2D8J A;  4IUQ A;  4N4I A;  4ZTJ A;  1WA7 A;  3QG1 A;  3CD6 A;  3LYI A;  4M7A F;  3NHN A;  4TVR A;  1Z9Q A;  1KQS P;  1RI9 A;  2Y90 A;  4ATO A;  2AZS A;  3M53 A;  1OQK A;  3A8O B;  2JOY A;  6AT1 B;  5IT9 E;  4RG8 A;  1OU8 A;  8AT1 B;  2A0F B;  1K9M R;  4LNP A;  3JCM c;  1ABO A;  4AMC A;  2KYM A;  3JB9 J;  2QG9 B;  3GNG A;  5KCO A;  4J9I A;  3RIR A;  4QT7 A;  4ZN3 A;  1PSE A;  4N0A A;  3CC7 A;  2EYY A;  2FB7 A;  2DD5 A;  4CI0 C;  3CCJ A;  1KSW A;  1PNJ A;  1YJN T;  2LNV A;  3OS5 A;  3TRE A;  1RAB B;  1VQN A;  1XNI A;  1GXI E;  1QVP A;  5GAM e;  2K79 A;  5GMK m;  2EVR A;  3V7S A;  4NS5 A;  1UUE A;  5J26 A;  4L5G A;  1K1Z A;  1VQ9 Q;  1QVG A;  2ZPG B;  3E9G A;  4OB3 B;  2F69 A;  3FIF A;  1YNZ A;  1UG1 A;  1GCP A;  3CBP A;  5FWB A;  2LT4 A;  4C8Q C;  1OI1 A;  2HQH A;  1C1A A;  1UHC A;  3M0T A;  2ZGW A;  4M7A A;  1I4K 1;  4BB7 A;  3OS2 A;  3VS5 A;  3GP8 A;  2DIG A;  3OW2 S;  2D0N A;  4JUV A;  2G6F X;  2V26 A;  1NJI R;  1VQ4 T;  3EGD B;  2KK4 A;  3LWH A;  1VQO A;  3UA7 A;  2DJZ A;  2R57 A;  2COZ A;  4XAX B;  1GBQ A;  4PL6 A;  2YRC A;  2LDM A;  1NPR A;  2RPN A;  4QKU A;  1NEB A;  2DL3 A;  4WTO B;  3HPW A;  1WZO A;  2O2O A;  1PHT A;  4PJO B;  2RM4 A;  2E5Q A;  1M9S A;  1JXM A;  3DB4 A;  2EWN A;  4PJL A;  1U1T A;  5GAO l;  3OS1 A;  5I22 A;  4P5N A;  4RTY A;  3OYH A;  3BY7 A;  2NWM A;  1G3Y A;  2K5I A;  2OTJ Q;  2AKK A;  2QQS A;  2LCS A;  4J9C A;  1RAC B;  2JS2 A;  2EGA A;  4JLG A;  1NYG A;  3OBY A;  4K11 A;  5GAN g;  5IHI A;  2ZCF B;  3G71 T;  1NYF A;  5KYX A;  1VQO T;  3CCQ T;  1RAD B;  1G3T A;  3EG2 A;  1ZLM A;  2AZV A;  2DXC A;  2JW4 A;  2YUP A;  4MMK A;  4PJN A;  1OPL A;  3QPH A;  3EH2 A;  2GQV A;  3JB9 I;  3PIP A;  4C92 F;  3CCL A;  1WX6 A;  4DA4 A;  1O9S A;  2LQ8 A;  4C5I A;  5GAO m;  4XTZ A;  1U8R A;  1RUW A;  1B7T A;  1N5Z A;  1VQK T;  1SRL A;  2KEA A;  2QYZ A;  1WJS A;  4M77 D;  2NUT A;  1TG0 A;  5GMK h;  3FRN A;  1YHQ A;  1WJR A;  3M0U A;  1I1J A;  2FEI A;  4B9X A;  1SRM A;  3H0F A;  1CKA A;  2FO0 A;  3CC4 Q;  3CMA T;  3H9N A;  2AT1 B;  2XIC A;  2BE9 B;  5KYW A;  1K73 C;  2GFU A;  2VGM A;  4IIM A;  3J80 E;  1TUG B;  3JAM E;  1FMW A;  4HVV A;  3H0I A;  5GAN d;  2IIM A;  3GLX A;  3QWX X;  1YJW T;  1OUL A;  3G4S T;  1QW1 A;  1ZUY A;  2HL3 A;  3CPW P;  1BCM A;  1JJ2 P;  2JN0 A;  1N8R U;  1U3O A;  2FPD A;  2FL7 A;  3MEV A;  1Q7Y R;  4IKF A;  1K8A U;  1NZ9 A;  1IRX A;  2E1H A;  1YJ9 Q;  5FWC A;  4C8Q B;  1UDL A;  4LN2 A;  2LX9 A;  3G71 A;  1M90 R;  1T0J A;  3CCJ T;  2HSP A;  2J06 A;  5GAN 5;  1JXO A;  1N8R R;  2LCL A;  3OMG A;  3ER0 A;  4C92 D;  2YXY A;  1M5Q 1;  2NUZ A;  3SWN A;  2DRM A;  4CC4 B;  2P4R A;  2DKG A;  2K3X A;  4C8Q E;  1T3L A;  1HJD A;  2EQU A;  3H8Z A;  1K4U S;  4BI4 A;  4MZT A;  2QQ9 A;  2X4J A;  3UA6 A;  1AWJ A;  2QI2 A;  3UPU A;  4JS4 A;  2DMO A;  2RQV A;  1R0C B;  1G8X A;  2CP2 A;  5LJ3 h;  1NG2 A;  2E10 A;  3JCM h;  3NFC A;  3EGX A;  1K9M U;  3VYH B;  4HVU A;  1KIK A;  1K0X A;  2RK1 A;  1VIE A;  2KE9 A;  2DZC A;  2L2P A;  3C94 A;  3HKS A;  3JCM J;  1NJI C;  3CCU Q;  2K3Y A;  4BE0 A;  2DLP A;  4GBQ A;  4C8Q D;  4A54 A;  1RAI B;  2RB6 A;  4FW2 A;  5KH6 A;  4BI8 B;  3M56 A;  3MPU B;  4LDY A;  5D6Y A;  2M51 A;  4IUT A;  1X2K A;  4PJO E;  5L8R E;  4RG2 A;  1VYT A;  3V8L A;  4PJO C;  2EGE A;  2PVG B;  3CCV A;  4HT9 A;  2J6F A;  2DEU A;  5GJW B;  1BU1 A;  5GMK e;  2DAQ A;  4FYX B;  1H64 1;  4J9D A;  2R5A A;  3CBO A;  2ED1 A;  3E19 A;  1MMA A;  1I07 A;  1YWP A;  1WXB A;  3M5A A;  2KRM A;  5LJ3 j;  4J9B A;  1D3B B;  4FSS A;  4PJJ A;  3ZFJ A;  4D6W A;  3CME Q;  3E9F A;  1Y96 B;  2HZY A;  1UGR B;  4M77 C;  4M77 E;  3JB9 F;  4AG1 C;  3NMZ C;  3TSZ A;  4RTZ A;  1VQ7 T;  4Y92 A;  4OB1 B;  4EDU A;  4M75 B;  2AIR B;  2IG0 A;  2B8A A;  5IXB A;  4LUE A;  3S6W A;  2W10 A;  2EJG A;  5LL6 S;  1GBR A;  2OTJ T;  3SWN B;  1VQN T;  3SEM A;  1W1F A;  2X4Y A;  1UJ0 A;  4J6X A;  1E7O A;  1JBM A;  5KYU B;  1UTI A;  1I5L A;  2E6N A;  1OZ3 A;  2FVU A;  1QWF A;  5ECA A;  2FPE A;  8ATC B;  1E6G A;  2KXD A;  1Y96 A;  2A28 A;  1N6A A;  2CZ0 B;  3CMA A;  1Y57 A;  4BAC A;  4M77 F;  5KYW B;  2K3B A;  1ARK A;  1YN8 A;  3MP1 A;  3MEW A;  4M7A B;  3VUB A;  4R55 A;  3EAE A;  3X25 B;  3VU3 C;  1YFN A;  3P8B B;  3M55 A;  2NYS A;  1PRM C;  4FYW B;  2D1X A;  4UC4 A;  2F2W A;  1MND A;  3A8G B;  1G83 A;  3D7S B;  2E65 A;  2GBQ A;  4JJC A;  2JTF A;  4JJB A;  5KYX B;  2KMT A;  3I5R A;  1PC0 A;  3CCE A;  1Y0M A;  2HD0 A;  1YIT T;  1I5O B;  3CC2 T;  2NLU A;  3UT1 A;  2VAS A;  3RES A;  4HA8 A;  3CPW A;  2QTV A;  3OYA A;  4OMQ A;  4EMK B;  4M75 F;  2DFU A;  2VXE A;  2KT1 A;  5GAN 3;  1M27 C;  1VYV A;  1XOV A;  2E12 A;  1M90 C;  2YUN A;  3JCM d;  3PVL A;  4DOV A;  2ED0 A;  3I9Q A;  2V1R A;  1S72 A;  1JEG A;  1VQ8 T;  1B07 A;  2M0Y A;  5KYY A;  2K5F A;  3OYN A;  2HQX A;  2C06 A;  4GLK A;  4PFO A;  3JCM P;  3J81 E;  4X1V A;  3KFV A;  3OA6 A;  2KI7 A;  5HY6 A;  1RAH B;  2XDD A;  2I0N A;  4A4H A;  4V2S A;  2KT8 A;  2E41 A;  5CKD A;  3CCJ Q;  2AHJ B;  3HFO A;  2JZ2 A;  1D0Z A;  2KXC A;  4JDS A;  2D6F A;  5CVI A;  2LVM A;  1K8A R;  4A4E A;  1VQ9 A;  2EFI A;  2V8K A;  3CC4 T;  4WCI A;  2LJ0 A;  1V29 B;  2DVE A;  2K4Y A;  1WFW A;  4FT2 A;  1IZ6 A;  1XTD A;  3RKX A;  2RQT A;  4KUL A;  4FM4 B;  1PD1 A;  2D8H A;  1VQ6 T;  1AZG B;  1KQS A;  3FJ5 A;  5GAM j;  4XTX A;  2BUD A;  1QVF S;  1TH7 A;  1Y71 A;  2KDS A;  1HXD A;  4KGZ B;  2K7A A;  1N27 A;  1CKB A;  3A1P A;  4GLM A;  2C0I A;  5HKC A;  2R5M A;  2K2V A;  1X69 A;  5GAN 4;  2G3R A;  2KVQ G;  3OYY A;  4Z02 A;  3CCS Q;  2D0Q B;  3CCM T;  1SSF A;  2K9G A;  3RR6 A;  1YHQ Q;  1KD1 R;  1PCX A;  1W2B A;  2CUB A;  1YJN Q;  1YJW A;  4JJN K;  4M78 E;  1WGS A;  4RTU A;  2QGF B;  4MZM A;  1MMN A;  1VUB A;  2L3P A;  1D0Y A;  2Y4X A;  3SFM A;  4EIK A;  3QHS A;  7AT1 B;  3HTR A;  4X9D A;  2F2X A;  3NTK A;  2CS7 A;  3MJX A;  1SKU B;  3NTI A;  3M0R A;  3C4S A;  3JCM e;  3EFR A;  1QMC A;  2ZAE A;  1PKT A;  2LCC A;  1NLP C;  3QYG B;  4A63 B;  3PMT A;  4B9W A;  4C0D B;  1YIJ Q;  5IXF A;  1I8F A;  2X3W D;  2FHD A;  4M7A D;  3MCA B;  2KAF A;  3JCM W;  3UDC A;  3QDF A;  2EKH A;  1I81 A;  3QJY A;  2ZPB B;  2O9S A;  4OVA A;  1M90 U;  1K0S A;  5LJ5 d;  1KG1 A;  4ZGE B;  1AWO A;  4EMH A;  2RI3 A;  4Z89 A;  3X24 B;  4M77 G;  3M54 A;  1ZBX A;  3UAT A;  1RLQ C;  4XU0 A;  2X3X D;  3IQL A;  4GY5 A;  1PSF A;  3LGF A;  3P8H A;  4RTT A;  5J39 A;  3I56 Q;  2QQR A;  1AD5 A;  3CCU T;  1YI2 A;  4E7Z A;  3LLR A;  1IGU A;  3OYE A;  1TU0 B;  3OYF A;  3GF5 A;  3PE0 A;  2JVV A;  3HHT B;  3I5S A;  1GFD A;  4AG2 C;  3MEA A;  2WSF E;  4RTW A;  1QVG P;  2QGG A;  3VYG A;  4M75 C;  3OYC A;  1M8M A;  2MI6 A;  3EHR A;  2QEX A;  2EQJ A;  2EYQ A;  1FXX A;  1VA7 A;  1AOJ A;  5GAN 2;  4EMK C;  3P8D A;  4HCC A;  4BD3 A;  1GFC A;  4F7U G;  2QA4 T;  2LP5 A;  2F2V A;  1EX4 A;  4RTV A;  5CKH A;  4IUR A;  5GAN h;  1EIF A;  3X20 B;  3JCM f;  1XJW B;  2EPD A;  3TSW A;  3CCU A;  1YI2 T;  2PUO B;  2F5T X;  3CD6 Q;  4ZN1 A;  5CAI A;  1SG5 A;  4M7D E;  5DLO A;  1BI0 A;  2YWW A;  1W4S A;  2JS0 A;  2HAX A;  1W2B S;  3X28 B;  3JCM g;  4M4Z A;  3CPF A;  4O6J A;  2DJQ A;  1M1K U;  2YRD A;  3QDR B;  4ZNX A;  1D1B A;  5KYY B;  1B3Q A;  2YUO A;  2DO3 A;  2PNI A;  2HDA A;  2DER A;  3SDZ A;  1LVK A;  1D3B A;  1E6H A;  3ZL7 C;  3CC7 Q;  2E5K A;  4ELZ C;  3EFO A;  4FIB A;  4F16 A;  1C6V X;  2LNH B;  1VQ5 T;  1KQS S;  2L5Q A;  3EH1 A;  3V8J A;  4MZP A;  1AT1 B;  2HMA A;  3CMA Q;  1M2O A;  4OB2 B;  5J3B A;  3PVQ A;  5CKB A;  1D09 B;  1ZSZ A;  3ZEH A;  2V8J A;  2KRO A;  2EYW A;  3CXC P;  5A0L A;  2OTL T;  5GAN 7;  3A8L B;  4M78 C;  1TTH B;  5LJ5 f;  3EGU A;  4E2F B;  4JRQ A;  2CT3 A;  1M2V B;  3VUZ A;  3G4S Q;  1MUZ A;  3QBY A;  1BI3 A;  1EZZ B;  3O5Z A;  2BIV A;  1D1C A;  3CXC S;  3CCE Q;  4M7A G;  1K73 R;  1PKS A;  2RK2 A;  4DEX A;  5CCA A;  4XTY A;  1VQK Q;  1WHJ A;  2EYX A;  4PFP A;  5D6W A;  1IGQ A;  4CRI A;  2I2L A;  3OS0 A;  2CSQ A;  4M77 A;  3RMS A;  4PK4 A;  3QO3 A;  3M58 A;  5GJV B;  3C95 A;  3DB3 A;  1H92 A;  2MK5 A;  1GCQ A;  2GCX A;  2LQN A;  3OSV A;  1VQL Q;  3PT9 A;  3BE3 A;  5FLX E;  2OI3 A;  3VS4 A;  5A0D A;  2M16 A;  2QAZ A;  2FZK B;  5L23 A;  1H3H A;  3UF4 A;  3MP8 A;  1BBZ A;  4XTW A;  1KFZ A;  1SEM A;  2MCN A;  2MAM A;  2MOX A;  2VWF A;  2DXB A;  3I35 A;  1G5V A;  4F17 A;  1QLY A;  4M75 E;  1EFN A;  2L0A A;  2QDL A;  2RHX A;  4FL6 A;  2ROT A;  3GPL A;  4JJD A;  4QQD A;  3TU4 K;  2PTK A;  1SF9 A;  2RJF A;  1YIJ T;  1O75 A;  2VKN A;  1BI2 A;  1Q82 U;  3FC3 A;  1UB4 A;  4LDU A;  2EIF A;  4DQ2 A;  1OYX A;  2FPF A;  3ME9 A;  2FG0 A;  1M1G A;  4F7U F;  1GL5 A;  2DET A;  1TSF A;  4J6Y A;  4B6M A;  4M7D C;  1MMD A;  4PLI A;  5LJ5 e;  4OF1 A;  1VQ4 A;  3REB B;  3I56 T;  2DTH A;  2XHC A;  2NUT B;  2FYK A;  3KBG A;  4BY6 B;  4E47 A;  1UEC A;  1Q81 U;  2MYS A;  4JRK A;  2CKK A;  5CQY A;  2O01 E;  2HEQ A;  4EMK A;  1IRE B;  1P92 A;  3A98 A;  3QII A;  1YP5 A;  5IN1 A;  1VYU A;  1UFF A;  4O5V A;  4YTL A;  2CP6 A;  4JZ3 A;  2IPO B;  5CO7 A;  4DBR A;  4Y28 E;  1QCF A;  3OYM A;  3THK A;  5IHN A;  1M3A A;  1PM3 A;  5CKF A;  3CCR A;  1FMK A;  5FRN A;  2EJF A;  3CC2 Q;  2MPX C;  3HSB A;  4FW1 A;  2EQM A;  3MO8 A;  3LWI A;  2LZ6 B;  1UHF A;  2A3L A;  2XID A;  3JSC A;  4C5H A;  1AHJ B;  4AFQ C;  4M75 A;  2EW3 A;  1X6O A;  4F14 A;  3CBM A;  1GCQ C;  2CH4 W;  2OX7 A;  2LT1 A;  4M78 D;  2V1Q A;  3I56 A;  1IXD A;  1WNL A;  3M4Y A;  4KBM B;  1Q86 U;  1WHG A;  2KNB B;  3KXT A;  5KYU A;  1QCO A;  3AHU A;  1BK2 A;  1FMV A;  4LUD A;  3E1S A;  1W70 A;  3L2V A;  3U23 A;  5I11 A;  1VQM T;  3RER A;  5EC7 A;  1K9A A;  2CYZ B;  2GTJ A;  2JTM A;  2DX1 A;  2M1H A;  4M77 B;  5FU7 C;  2PVO B;  2CGH A;  2DNU A;  1HK9 A;  2DRK A;  2KSS A;  2E3I A;  4ESR A;  1IB8 A;  1YCS B;  3LH0 A;  4LD6 A;  1RL2 A;  5DLQ E;  4AFU C;  4JS5 A;  2O4X B;  2JUF A;  1OX9 A;  1QVF P;  1M30 A;  1WI7 A;  1ZA1 B;  3VKI A;  5GAN e;  3QZ5 B;  1KHI A;  1KHC A;  4M7A E;  1YJ9 T;  3RKW A;  3QJ6 A;  4BDZ A;  1X01 A;  2O31 A;  5KCH A;  1F1B B;  3EG9 A;  2DEQ A;  2XI9 A;  2CP7 A;  5A2Q E;  1V76 A;  3HRU A;  4E7J A;  3TVT A;  5GAN f;  2PVD B;  2VV5 A;  1VQP A;  1JJ2 A;  3QYH B;  3L2Q A;  2HKQ B;  2VXF A;  1TUC A;  1W6X A;  4QVZ A;  4KH0 B;  1VQ8 Q;  3JB9 D;  1PWT A;  1CSK A;  1D0X A;  1M3C A;  3ZBD A;  2KBT A;  1QVF A;  2YLC A;  4ZTF A;  1X2Q A;  1U06 A;  1V1C A;  2A36 A;  3EG3 A;  3QXE B;  5GAM f;  2BTT A;  4KUD K;  1BB9 A;  5D6X A;  2JT4 A;  2QEX Q;  4RKU E;  1IHW A;  3CCS T;  3VJP A;  1S1N A;  3HRT A;  3NPF A;  4X9C A;  4J8O A;  4Q5W A;  2P0P A;  2ESW A;  5DY9 A;  4E7L A;  4J6W A;  1YJW Q;  3BDL A;  1M4Z A;  4FYV B;  4A4G A;  1HSQ A;  5HCK A;  4M75 D;  1NJI U;  2H8H A;  3TEE A;  3N5B B;  1VQ5 Q;  5CR2 A;  3V7C A;  2A37 A;  4C8Q G;  2DD4 A;  2GQI A;  3M9Q A;  1DJ7 B;  1SHG A;  2CRE A;  3PGG A;  1BYM A;  3CME A;  1Q86 R;  4FSX A;  1VQ6 Q;  4ELY C;  1LPL A;  2E64 A;  2QQA A;  4OMO A;  2RHU A;  4PJO A;  2RJE A;  1NBE B;  2RHI A;  4ME7 A;  2LX7 A;  4BY6 C;  1K8A C;  3PTA A;  3CCL T;  2F1L A;  4NL2 A;  2E3H A;  2XK0 A;  2JXB A;  3L42 A;  4FCY A;  3UWN A;  2Y4Y A;  4OGC A;  2XDB A;  2X4W A;  4J5Y A;  5C0M A;  3CCM Q;  4HCB A;  5LJ3 g;  2E4H A;  1IHV A;  4EPC A;  3HRS A;  5FU6 C;  1PRL C;  1VQK A;  2RD1 A;  2PU9 B;  1NEG A;  3G7Z A;  5GMK i;  2HL5 C;  3VS1 A;  3FEO A;  1XQH A;  3URG A;  2EYZ A;  2DZ9 A;  4OMP A;  3RMQ A;  5FU7 B;  3BW1 A;  2RMO A;  4MML A;  2C0T A;  4KH1 B;  4OMF B;  1ZA2 B;  4XU1 A;  1UGP B;  3G1J A;  3EHQ A;  1KD1 C;  3G4S A;  3DLL A;  2DXU A;  1H3Z A;  2EGC A;  1TXQ A;  2CZ1 B;  2JM9 A;  1T0H A;  2BZY A;  1OOT A;  3JB9 G;  2KR3 A;  1IO6 A;  2RQR A;  4QVC A;  4MDX A;  4C0F A;  3OBW A;  2CZ6 B;  2YT6 A;  2MWO A;  2EJ9 A;  2O88 A;  4LD9 K;  4J9H A;  2A7Y A;  4C0D C;  1VQ7 A;  1S72 Q;  2WAC A;  1RI0 A;  3VS3 A;  3MET A;  5LJ5 h;  2DBM A;  4M7D B;  4XK8 E;  1PD0 A;  4II1 A;  2YLB A;  1RLP C;  4JRI A;  1R8O B;  4HKE A;  3JCM V;  4CC3 A;  3VRY A;  4OB0 B;  1M8V A;  4JZ4 A;  2RH2 A;  4PJO D;  1RAE B;  3JV3 A;  2EBP A;  1VQM A;  4M75 G;  3FLG A;  1VQ4 Q;  3HP9 A;  2DA9 A;  1M1K R;  2DL5 A;  1SSH A;  2MWP A;  5GAM g;  2RF0 A;  1YCY A;  1WXU A;  2XD0 A;  3FJP A;  3A8H B;  4EMG A;  5GMK l;  4ANJ A;  4M78 G;  1QVG S;  4C8Q A;  5A0G A;  4ORZ A;  2X9H A;  1N9S A;  3NTH A;  1X6G A;  1B34 A;  3OYJ A;  1ZBJ A;  4L6V 5;  2ZPI B;  1GRI A;  2RI2 A;  3S3M A;  2RHY A;  3CCQ A;  1UGQ B;  2RQU A;  2C0O A;  4AFS C;  2YDL A;  2EQI A;  2XU8 A;  3G6E T;  1Q81 R;  3WVD B;  1Z9Z A;  3CC2 A;  5CK9 A;  1LJO A;  3HL8 A;  2DM1 A;  1NPP A;  1D1A A;  3I55 Q;  2JMC A;  5GAO q;  1MGQ A;  3CCS A;  4PNO A;  4C92 E;  1VQO Q;  3AT1 B;  3LGL A;  4C92 C;  1K73 U;  2DL7 A;  2DL8 A;  4C0G A;  1YJN A;  1YWO A;  4XQ3 A;  3G6E Q;  1K76 A;  3OYL A;  3M4G A;  2L3Q A;  4LXC A;  4MDW A;  1VQL T;  1OZ2 A;  2K2M A;  5C6S A;  3MHX A;  3R6O A;  1QQJ A;  1Q86 C;  4C5E A;  5GAO r;  2GGR A;  2VVK A;  4E7S A;  4LDW A;  4PFZ A;  4WF2 A;  5FRO A;  2X35 A;  2DIL A;  3KUF A;  4M7D D;  5AT1 B;  2DBK A;  1T3S A;  4XU3 A;  2KRN A;  3L1A A;  2RA2 A;  4CC2 A;  1AVZ C;  1R77 A;  4JLI A;  2OTJ A;  1UGV A;  2RJD A;  2YHT A;  5CQX A;  1K9M C;  1VQ9 T;  4JPB W;  3EFS A;  1X75 C;  3OYB A;  1HYO A;  3OSS C;  2EQK A;  5M9O A;  3DLM A;  3PIO A;  1MMG A;  2RN8 A;  3SHW A;  4NOY A;  4C5G A;  4XTV A;  4F7U A;  1UE9 A;  2VYT A;  1AWX A;  2FRY A;  1BI1 A;  2NUP B;  3V7R A;  1SPK A;  3OMC A;  1LOJ A;  3M57 A;  1KQ2 A;  2EKO A;  3QKJ A;  3CCL Q;  1M1F A;  2LJ3 A;  4A53 A;  4RCC A;  2O9V A;  5LJ3 d;  4XU2 A;  2DVJ A;  2GTO A;  2W0Z A;  5GAN j;  2PQW A;  3OYD A;  2LRQ A;  5I21 A;  1WDX A;  4IUV A;  4DOW A;  1UEB A;  4OML A;  2DE0 X;  4KGX B;  3M0S A;  4LDV A;  2ENM A;  2J6O A;  2ZPF B;  3J7A F;  4QVD A;  3GBQ A;  3CPW S;  1QP2 A;  2JTE A;  2QXF A;  3VS7 A;  3CQT A;  1VQ5 A;  4X34 A;  2ATC B;  2RJC A;  1ZUK A;  1A0N B;  3CCE T;  3CCR Q;  3OYK A;  1Q82 C;  2XMF A;  4A4K A;  5GMK j;  4IIO A;  1OEB A;  1RAG B;  4M7A C;  1MNE A;  2RO0 A;  5HK0 A;  2IVW A;  2PUK B;  1YHQ T;  1OV3 A;  1J3T A;  2CZ7 B;  5GAN 6;  3E2U A;  1WXT A;  2JM8 A;  2FZG B;  4XTU A;  4DBF A;  2HCK A;  3LW5 E;  3GNF B;  2AK5 A;  2E6Z A;  2QAS A;  5CIU A;  3C0C A;  3RDV A;  4J9F A;  5IH2 A;  3G71 Q; 
#chains in the Genus database with same CATH homology
 2OTL A;  2K5F A;  3OYN A;  2HQX A;  4BDY A;  2C06 A;  4GLK A;  4M78 D;  2MF2 A;  3I56 A;  3JCM P;  1WNL A;  3CCV T;  3M4Y A;  4KBM B;  3J81 E;  1Q86 U;  3JB9 J;  3GNG A;  4M78 F;  5KCO A;  3KXT A;  2VGN A;  3RIR A;  3AHU A;  3OA6 A;  5HY6 A;  4N0A C;  3E1S A;  4QW2 A;  1Y7X A;  2P0K A;  2XDD A;  4ZN3 A;  1PSE A;  4N0A A;  3L2V A;  3CC7 A;  2FB7 A;  3S3O A;  2DD5 A;  4A4H A;  4V2S A;  4CI0 C;  3CCJ A;  3MEU A;  2LNV A;  2E41 A;  5CKD A;  3OS5 A;  3DKM A;  1YJN T;  1VQM T;  3RER A;  3TRE A;  2CYZ B;  1VQN A;  2JTM A;  1XNI A;  1GXI E;  2M1H A;  4M77 B;  2AHJ B;  1QVP A;  2PVO B;  3HFO A;  2CGH A;  5FU7 C;  5GAM e;  1HK9 A;  2JZ2 A;  2KSS A;  1WQ7 A;  4JDS A;  2D6F A;  3RUX A;  5CVI A;  5GMK m;  3V7S A;  3LH0 A;  2LVM A;  4NS5 A;  2ZPH B;  4LD6 A;  1RL2 A;  5DLQ E;  4JS5 A;  5J26 A;  2O4X B;  4L5G A;  2JUF A;  4A4E A;  5GAM d;  1QVG A;  1VQ9 A;  2EFI A;  2V8K A;  2ZPG B;  3E9G A;  5GAO p;  3CC4 T;  2QA4 A;  1V29 B;  2DVE A;  2F69 A;  2K4Y A;  3FIF A;  3QZ5 B;  4OB3 B;  3VKI A;  5GAN e;  1KHI A;  1KHC A;  2GF7 A;  3CBP A;  4M7A E;  4FT2 A;  2M0O A;  3INZ A;  3RKW A;  1IZ6 A;  1YJ9 T;  2LT4 A;  3QJ6 A;  4C8Q C;  4BDZ A;  1OI1 A;  1X01 A;  1XTD A;  3RKX A;  4KUL A;  5KCH A;  3Q1J A;  4FM4 B;  4QQ6 A;  4ZGJ B;  2P0Q A;  5I2S A;  2V8I A;  1VQ6 T;  2DEQ A;  2ZGW A;  4M7D A;  1KQS A;  2XI9 A;  4M7A A;  2DTI A;  5A2Q E;  5IAY A;  1I4K 1;  4BB7 A;  5GAM j;  2R58 A;  3HRU A;  4XTX A;  4E7J A;  3OS2 A;  5GAN f;  1QP3 A;  2PVD B;  2BUD A;  2VV5 A;  1VQP A;  3QYH B;  3L2Q A;  1JJ2 A;  1U1S A;  1QVF S;  1TH7 A;  2VXF A;  1Y71 A;  4QVZ A;  2DIG A;  4VUB A;  2KDS A;  3GP8 A;  3OW2 S;  1HXD A;  3JB9 D;  4C92 G;  2H3J A;  1N27 A;  4JUV A;  3ZBD A;  3T9N A;  5HKC A;  2YLC A;  3L2W A;  4ZTF A;  2R5M A;  1VQ4 T;  1QVF A;  2K2V A;  2MMP A;  3QXE B;  4M78 A;  5GAM f;  3V8K A;  5GAN 4;  2G3R A;  2KVQ G;  2L3R A;  2KK4 A;  3OYY A;  4Z02 A;  4ZGD B;  4KUD K;  2D0Q B;  5CKE A;  2HNI A;  4RKU E;  5D6X A;  1SSF A;  2DJZ A;  2R57 A;  3LWH A;  3CCM T;  4XAX B;  3CCS T;  3VJP A;  3HRT A;  4PL6 A;  4BE1 A;  4X9C A;  2LDM A;  3JRZ A;  4J8O A;  5AYF A;  4Q5W A;  1NPR A;  1W2B A;  4OP0 A;  2P0P A;  5DY9 A;  2LTO A;  1YJW A;  4E7L A;  4JJN K;  4HCZ A;  4M78 E;  4J6W A;  1VQL A;  3BDL A;  1WGS A;  3HPW A;  1M4Z A;  4A4G A;  4MZM A;  1VUB A;  4NL3 A;  4C92 A;  2Y4X A;  4M75 D;  1NJI U;  2RM4 A;  3SFM A;  4PJO B;  3QHS A;  2E5Q A;  3CD6 T;  4X9D A;  3NTK A;  3TEE A;  1KD1 U;  3N5B B;  1M9S A;  2VUB A;  2CS7 A;  5CR2 A;  3V7C A;  3DB4 A;  2EWN A;  3NTI A;  4C8Q G;  2DD4 A;  3C4S A;  3JCM e;  1U1T A;  5GAO l;  3M9Q A;  3OS1 A;  3EFR A;  4M7D G;  1DJ7 B;  1Q7Y C;  2LCC A;  4A4F A;  3QYG B;  5KE2 A;  4P5N A;  3PGG A;  3PMT A;  4B9W A;  2DK3 A;  1VIF A;  1BYM A;  2DPP B;  4C0D B;  3OYH A;  3CME A;  3BY7 A;  4FSX A;  1I8F A;  4R56 A;  4QQG A;  2FHD A;  4M7A D;  1G3Y A;  4N4H A;  2K5I A;  3MCA B;  2KAF A;  3GOX A;  3JCM W;  2QQS A;  3UDC A;  4ELY C;  1I81 A;  2E64 A;  1G3W A;  2QQA A;  5I2M A;  3QJY A;  2RHU A;  2ZPB B;  2RJE A;  4JLG A;  4OVA A;  3OBY A;  4PJO A;  1M90 U;  1B34 B;  5LJ5 d;  1KG1 A;  4ZGE B;  2RHI A;  5GAN g;  4ME7 A;  2ZCF B;  4EMH A;  2RI3 A;  2K5L A;  4BY6 C;  3L2U A;  1N8R C;  3G71 T;  2OAU A;  1Y07 A;  1K8A C;  3CC7 T;  3X24 B;  3PTA A;  4M77 G;  3M54 A;  1ZBX A;  3CCL T;  4NL2 A;  3CCQ T;  1VQO T;  4XU0 A;  3GIB A;  2XK0 A;  5LJ3 f;  4GY5 A;  3L42 A;  1PSF A;  1G3T A;  3LGF A;  3P8H A;  3WVE B;  5J39 A;  2QQR A;  2DXC A;  3UWN A;  2Y4Y A;  3CCU T;  1YI2 A;  4MMK A;  4OGC A;  3QPH A;  2XDB A;  2XG8 D;  2X4W A;  4J5Y A;  4M78 B;  5C0M A;  2GQV A;  3O8V A;  3LLR A;  5LJ3 g;  3JB9 I;  3OYE A;  3PIP A;  4C92 F;  2QEX T;  3CCL A;  4HCB A;  4EPC A;  1BIA A;  3OYF A;  3GF5 A;  4DA4 A;  3HRS A;  1O9S A;  2LQ8 A;  5FU6 C;  4C5I A;  5GAO m;  1KC8 U;  2JVV A;  1VQK A;  2RD1 A;  4J83 A;  4XTZ A;  1U8R A;  2PU9 B;  3HHT B;  3MEA A;  1VQK T;  2WSF E;  1WJS A;  3G7Z A;  4M77 D;  5GMK i;  3FEO A;  1XQH A;  3VYG A;  4M75 C;  3OYC A;  3URG A;  2MI6 A;  2QEX A;  2LC4 A;  2EQJ A;  5GMK h;  2VC8 A;  2EYQ A;  3FRN A;  2DZ9 A;  1YHQ A;  1FXX A;  1Q81 C;  1WJR A;  3RMQ A;  5FU7 B;  5GAN 2;  3BW1 A;  4PLL A;  4EMK C;  1JRI A;  4KUI A;  4MML A;  4B9X A;  4OMF B;  3P8D A;  4HCC A;  4XU1 A;  4BD3 A;  4C0Z A;  2QA4 T;  3MP6 A;  1UGP B;  4F7U G;  3L2Z A;  3CMA T;  2XIC A;  1K73 C;  5FRM A;  2GFU A;  5CKH A;  2VGM A;  1KD1 C;  3G4S A;  3DLL A;  5GAO n;  4JRP A;  3C12 A;  2DXU A;  1H3Z A;  4IUU A;  2E70 A;  4IUR A;  4C8Q F;  5GAN h;  3J80 E;  1EIF A;  2CZ1 B;  3X20 B;  3JAM E;  3JCM f;  5GAN d;  3GLX A;  3JB9 G;  2P4T A;  1YJW T;  3CCU A;  4N4G A;  1YI2 T;  4QVC A;  4MDX A;  2JNG A;  4C0F A;  3G4S T;  1QW1 A;  1FWZ A;  3SD4 A;  2PUO B;  2F5T X;  3OBW A;  2CZ6 B;  4ZN1 A;  5GAM h;  2KQW A;  3OQ5 A;  2MWO A;  2EJ9 A;  2JN0 A;  3JCM b;  1N8R U;  2QDY B;  5CAI A;  2DIQ A;  1VQO A;  2FL7 A;  3MEV A;  4LD9 K;  4PJO G;  4M7D E;  4IKF A;  2A7Y A;  4C0D C;  1K8A U;  1VQ7 A;  1NZ9 A;  2E1H A;  5DLO A;  1BI0 A;  2WAC A;  1W4S A;  1RI0 A;  2RHZ A;  4C8Q B;  1W2B S;  1KQ1 A;  3X28 B;  3MET A;  5LJ5 h;  3JCM g;  2HAX A;  3CPF A;  4BI3 A;  4O6J A;  4M7D B;  2LX9 A;  3PFS A;  3G71 A;  1M1K U;  4XK8 E;  3QDR B;  3A8M B;  4II1 A;  2YLB A;  3CCJ T;  1BIB A;  4JRI A;  1R8O B;  4HKE A;  2WSE E;  3JCM V;  5GAN 5;  2DO3 A;  4OB0 B;  3RKY A;  1M8V A;  2RH2 A;  2LCL A;  4PJO D;  3OMG A;  3SDZ A;  3ER0 A;  2YRV A;  1JJ2 S;  4C92 D;  3SWN C;  1D3B A;  4LDX A;  4ELZ C;  1M5Q 1;  3SWN A;  3OW2 A;  1VQM A;  1UGS B;  3H6Z A;  4FIB A;  1VQ5 T;  2O4X A;  4M75 G;  3FLG A;  1KQS S;  2L5Q A;  2DKG A;  3F70 A;  3HP9 A;  2K3X A;  3V8J A;  4MZP A;  3S3N A;  1FX7 A;  4J7F A;  4C8Q E;  2WSC E;  4OB2 B;  5J3B A;  3OY9 A;  2MWP A;  5CKB A;  5GAM g;  3JB9 H;  1VQP T;  3ZEH A;  2V8J A;  2EQU A;  3H8Z A;  5EG2 A;  4BI4 A;  4MZT A;  1YCY A;  2QQ9 A;  2XD0 A;  2X4J A;  3FJP A;  3A8H B;  4EMG A;  2QI2 A;  1LNX A;  5A0L A;  5GMK l;  5GAN 7;  3A8L B;  4M78 G;  4JS4 A;  4M78 C;  3UPU A;  2OTL T;  1QVG S;  4C8Q A;  1MHN A;  5LJ5 f;  5A0G A;  4JRQ A;  5LJ3 h;  3TCJ A;  2LQK A;  3JCM X;  2E10 A;  3JCM h;  3NFC A;  3VUZ A;  1N9S A;  3NTH A;  1B34 A;  3OYJ A;  4L6V 5;  1K9M U;  3CME T;  3QBY A;  1ZQ1 A;  2ZPI B;  2RI2 A;  3S3M A;  1BI3 A;  3VYH B;  2RHY A;  3CCQ A;  1UGQ B;  3QZ9 B;  2RK1 A;  3QUI A;  1VIE A;  5LJ5 g;  2BIV A;  3CXC S;  4M7A G;  1YBY A;  2DZC A;  2XU8 A;  3C94 A;  3HKS A;  5FU6 B;  2RK2 A;  2ZPE B;  3JCM Q;  3G6E T;  3WVD B;  3JCM J;  1S72 T;  1NJI C;  2L89 A;  4E7I A;  2K3Y A;  3CC2 A;  5CK9 A;  1LJO A;  5CCA A;  4BE0 A;  3HL8 A;  1VQ8 A;  4F7U B;  4OGE A;  5HK3 A;  2QTX A;  4XTY A;  2XKO C;  1NPP A;  4C8Q D;  5D6W A;  5KE3 A;  4A54 A;  2RB6 A;  5GAO q;  3I55 A;  2HBP A;  4CRI A;  5LJ3 e;  2X4X A;  2QQB A;  1MGQ A;  2I2L A;  1NE8 A;  3OS0 A;  3CCS A;  4PNO A;  5KH6 A;  4M77 A;  4M7D F;  4BI8 B;  3RMS A;  3M56 A;  4LDY A;  5D6Y A;  4C92 E;  3QO3 A;  3BDU A;  3LGL A;  3M58 A;  4C92 C;  1K73 U;  3C95 A;  4IUT A;  3DB3 A;  4PJO E;  4RG2 A;  5L8R E;  3LX7 A;  4C0G A;  3V8L A;  4BE2 A;  1YJN A;  4PJO C;  2GCX A;  3QSU A;  2PVG B;  3CCV A;  4HT9 A;  4XQ3 A;  3OSV A;  3G6E A;  3OYL A;  3M4G A;  3CC4 A;  5GMK e;  3PT9 A;  4MDW A;  1VQL T;  4F7U E;  1OZ2 A;  2DAQ A;  3MHX A;  1H64 1;  3PNW C;  5C6S A;  3R6O A;  5FLX E;  1Q86 C;  2HQE A;  5A0D A;  2R5A A;  4C5E A;  3CBO A;  4IUP A;  5GAO r;  2M16 A;  3E19 A;  3FDR A;  4KT0 E;  3VV0 A;  4LDW A;  4WF2 A;  5FRO A;  2X35 A;  3KUF A;  3M5A A;  3MP8 A;  4XTW A;  4M7D D;  3M59 A;  5LJ3 j;  1D3B B;  2L8D A;  2MAM A;  4XU3 A;  2DXB A;  3ZFJ A;  3L1A A;  2RA2 A;  4D6W A;  1YIJ A;  1G5V A;  1WPY A;  3E9F A;  1KC8 C;  4FT4 A;  1Y96 B;  3CEY A;  3L2R A;  4M75 E;  2KY9 A;  1UGR B;  1VQ6 A;  4M77 C;  2RHX A;  1N9R A;  4FL6 A;  4BUG A;  4JLI A;  4M77 E;  5LJ5 j;  2RJD A;  1M1K C;  3JB9 F;  2OTJ A;  1G3S A;  2YHT A;  5CQX A;  1K9M C;  1VQ9 T;  3GPL A;  4QQD A;  3EFS A;  3OB9 A;  1X75 C;  3OYB A;  3TU4 K;  1VQ7 T;  1YJ9 A;  3HFN A;  4OB1 B;  4EDU A;  4J7I A;  4M75 B;  3OSS C;  2EQK A;  4E7K A;  2RJF A;  1YIJ T;  2BKD N;  3DLM A;  2IG0 A;  2XDP A;  5M9O A;  3PIO A;  4E7H A;  1O75 A;  2B8A A;  2EAY A;  1BI2 A;  2DTO A;  3S6W A;  4NOY A;  2EJG A;  2F5K A;  5LL6 S;  3WXM B;  4C5G A;  3FC3 A;  1Q82 U;  3ASK A;  4XTV A;  4RCB A;  4F7U A;  1UB4 A;  2M9U A;  2VYT A;  3SWN B;  2OTJ T;  1VQN T;  1BI1 A;  2X4Y A;  5GAN 8;  4J6X A;  3I55 T;  4LDU A;  3V7R A;  2EIF A;  1JBM A;  3OMC A;  4DQ2 A;  1OYX A;  3ME9 A;  3X26 B;  3SB2 A;  1LOJ A;  1I5L A;  3CCM A;  2E6N A;  1M1G A;  1OZ3 A;  3M57 A;  4F7U F;  4RMO A;  1KQ2 A;  2FVU A;  2ZZD A;  2EKO A;  4J6Y A;  2K57 A;  3QKJ A;  4HT8 A;  1M1F A;  4M7D C;  4PLI A;  5LJ5 e;  3OYI A;  4OF1 A;  4A53 A;  4RCC A;  3OYG A;  1JB0 E;  1Y96 A;  5LJ3 d;  3FB9 A;  4XU2 A;  1VQ4 A;  3I56 T;  1N6A A;  5GAN j;  2CZ0 B;  1WQW A;  2DTH A;  2PQW A;  2XHC A;  3OYD A;  1BKB A;  3CMA A;  1YIT A;  2FYK A;  1Q7Y U;  2LRQ A;  3KBG A;  4M77 F;  4BY6 B;  5I21 A;  4BAC A;  4E47 A;  3CXC A;  3MP1 A;  1Q81 U;  3MEW A;  4M7A B;  2D9T A;  4IUV A;  3VUB A;  4R55 A;  4JRK A;  4DOW A;  2CKK A;  1UEB A;  2RI5 A;  3EAE A;  5CQY A;  2O01 E;  1WJQ A;  3X25 B;  3VU3 C;  4FU6 A;  4EMK A;  3P8B B;  1IRE B;  1ZHI A;  4LDV A;  3BFM A;  4PKC C;  1P92 A;  2ZPF B;  3J7A F;  4QVD A;  3M55 A;  2DXT A;  3QII A;  4L59 A;  5IN1 A;  4C92 B;  4PJO F;  4O5V A;  3CPW S;  2GFA A;  1QP2 A;  4YTL A;  4UC4 A;  5CO7 A;  2QXF A;  4Y28 E;  3A8G B;  3OYM A;  1VQ5 A;  4X34 A;  2RJC A;  3PMI A;  5CKF A;  2E65 A;  3CCR A;  3CCE T;  4Y91 A;  5DM7 R;  2JTF A;  3OYK A;  2KMT A;  5FRN A;  3CCE A;  3CCR T;  4A4K A;  1Q82 C;  2HD0 A;  3A5Z B;  5GMK j;  1YIT T;  2EJF A;  3CC2 T;  2NLU A;  3UT1 A;  3RES A;  4HA8 A;  3CPW A;  4M7A C;  4IUQ A;  3OYA A;  2RO0 A;  4N4I A;  5HK0 A;  2IVW A;  4EMK B;  4M75 F;  2PUK B;  4ZTJ A;  1YHQ T;  3QG1 A;  3HSB A;  3CD6 A;  2CZ7 B;  3LYI A;  2EQM A;  3MO8 A;  3LWI A;  5GAN 6;  2VXE A;  5GAN 3;  4M7A F;  1XOV A;  2A3L A;  2E12 A;  4TVR A;  1M90 C;  2XID A;  3JCM d;  3JSC A;  4XTU A;  4DOV A;  4C5H A;  2Y90 A;  3LW5 E;  1AHJ B;  3GNF B;  1S72 A;  2E6Z A;  4ATO A;  4M75 A;  3M53 A;  3A8O B;  2JOY A;  5IT9 E;  5CIU A;  1X6O A;  3CBM A;  4RG8 A;  1VQ8 T;  2LT1 A;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...