1LODA

Interaction of a legume lectin with two components of the bacterial cell wall
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
180
structure length
180
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of a legume lectin with two components of the bacterial cell wall. A crystallographic study.
pubmed rcsb
source organism Lathyrus ochrus
molecule tags Lectin
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
total genus 25
structure length 180
sequence length 180
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lodA00
2XB6C 1Q8PA 1A8DA 5CB7A 1MVQA 2SLIA 3V64A 2ZGLA 4YZ3A 1KITA 5KXDA 2R1DA 4BQ1A 1W0PA 4GXLA 1G7YA 2NMNA 3KQRA 3JUUA 3RMXA 2I2SA 3WUCA 1VIWB 2D6NA 5SV8A 4BOWA 1H9PA 4PQ9A 1FNYA 3W58A 3N7KA 2VUAA 3WDVA 5JDBA 3RRDA 3N35A 2PHUA 2WQZC 1JXNA 3TAYA 1UMZA 3AZVA 2ZABA 4Y1UA 1AJKA 4Y24A 2A70A 3A4UA 2DTWA 1S0BA 1BJQA 3N7JA 1Q56A 4W65A 3ZSJA 1W6NB 1VLNA 3WDTA 2ZACA 3ZSMA 4AYUA 5CBLA 5JLVA 3FLPA 4C1WA 1N3PA 1VALA 1Y7BA 3SISA 3HN1A 5BYNA 2EXKA 3VKOA 2YMZA 4XMIA 3ZSKA 1CJPA 1UZZA 4XTPA 4XXPA 1YI7A 5T5LA 1SLLA 4M3CA 2NM1A 4XDQA 3FUOA 2ZKNA 1GSLA 2JDZA 3AP6A 2TEPA 1IKQA 3N7MA 3R4SA 3IMNA 1BQPA 5T5OA 3MEPA 2DVGA 4R9BA 1WBFA 2DUOA 2E6VA 2A7AA 1ONAA 4U2AA 5IK4A 1J1TA 1WW6A 2P3KA 3OYWB 4YG0A 2ENRA 2PHXA 2R1BA 3AZYA 1AXKA 4YM1A 5DUXA 2DUQA 1QOTA 3OY8B 2D6LX 1HQLA 4AVTA 5KXBA 2HYKA 1FNZA 2P3JA 4XJ9A 3VKNA 3ZYRA 5DG2A 1S0JA 1MVEA 1N1VA 3C2UA 3N7LA 1DBNA 3M3QA 5GM0A 1WW4A 2P3IA 4OZXA 3UJOA 2ZHLA 1QNWA 5DG1A 4Q1PA 3N3HA 2GNDA 2NMOA 2GNBA 3VV1A 4FP2A 3AP4A 1H9WA 1UAIA 2R49A 2WLQA 1GYKA 4PBOA 1SCRA 4WZFA 5F9TA 3M3OA 1FV3A 2AGSA 3NV2A 1LOGA 1W6PB 1W6PA 2VW2A 3FLRA 4YZ2A 2UWCA 2E51A 1DGLA 4AWDA 1SLIA 5T55A 2D3RA 4YGEA 3RMYA 3A0NA 4YFZA 2A3WA 1V00A 4GWNA 4WV8A 3ZSLA 1GZWB 1HQWA 1CPNA 2WNEA 4AVSA 1LGNA 1DYKA 1HLCA 1I1EA 2OUHA 2R0FA 4KBBA 4YLZA 1YIFA 4CRQA 3FUQA 4XJ8A 4XMAA 1LGCA 2CWMA 3SNMA 3ILRA 4ATFA 5EYXA 4GWMA 4RA0A 1S0FA 3PMEA 1AVBA 3WDWA 4XZPA 2XG3A 4AGGA 2NZ9A 4FPFA 3BIWE 3ZXLA 1MZ5A 2A6XA 3SLIA 4YZ5A 4FOWA 1LHOA 2H0BA 4GA9A 1ZA4A 4AGRA 4XJZA 4DS0A 5IT6A 3AYCA 4ASMB 2EXJA 1AXYA 2D3PA 2DURA 2EIGA 2ZGUA 3AZZA 2DVFA 2Z42A 3LCPA 3NWKA 5E8AA 5HCFA 1W0OA 3PVNA 3I8TA 1W6OB 4Y1YA 1AZDA 4Y1VA 1U0AA 5JMCA 1HKDA 3WHUA 4FVVA 3B9CA 2ZGMA 3GALA 4M3CF 5EWSA 4XBNA 5T50A 4XE9A 3R4UA 2YV8A 3WG1A 2ZGTA 2JE7A 3V0AA 4D69A 1W6NA 1C1LA 1Z0HA 2LTNA 4K20A 4L8QA 2GNMA 4YW1A 2UU8A 2ZGRA 1GICA 1CESA 1UL9A 4DFSA 4ISRA 1CQ9A 3SH3A 1F5FA 1SCSA 2D44A 4XILA 4AVVA 5E88A 3AK0A 3OJBA 1DQ6A 2NYYA 4P14A 4YGDA 1UPSA 1GNHA 3ZVXA 3M1HA 3WZ1A 1LTEA 2D6PA 2GMMA 4FOQA 2UWBA 2A6ZA 1N1TA 3IPVA 1IS6A 4FPLA 1MS1A 4JCKA 4R9CA 2AH2A 4YGBA 3WG3A 3WDYA 5H9PA 1OKQA 1Q8VA 1X50A 4FPKA 3MW2A 4XBLA 2A6WA 1KDKA 4YW3A 4DRRA 1A3KA 2CY6A 1G86A 3H0OA 3M3CA 1UX6A 1W6OA 2BQPA 1YYNA 2W68A 1LENA 2ZGKA 1BKZA 5DUUA 2DVDA 4FPCA 3UJQA 3PVOA 4LBOA 3O0XA 3AYEA 3VKMA 3UL2A 2P34A 4LBJA 5H9QA 4YZ1A 1WCSA 2WJSA 1DZQA 2A6VA 3B01A 1SBEA 3V0BB 1DQ2A 4XJAA 1XQNA 2AREA 3ZXJA 4PF5A 3INAA 4Q8KA 4WVWA 3APBA 2DVAA 1R1ZA 1MS9A 3NV4A 1AF9A 1NLSA 4FP3A 3ZXKA 1QOSA 1I3HA 3QLQA 2P37A 4XHBA 2OVUA 1AX0A 2WSUA 3M2MA 1WD4A 1WD3A 2GNTA 1JYIA 4DRVA 3ZXEA 3WCRA 1N1SA 2ZA9A 1GNZA 1WW5A 2PHFA 4YW4A 1PZ8A 4HANA 3BOPA 1S0IA 1FV2A 3O0WA 4FPOB 2DWRA 2D3SA 1KDMA 1A78A 1V6LA 4K1ZA 5T5JA 5FREA 3ZYPA 1QU0A 1G8WA 1JUIA 2ZGNA 3AP9A 1MACA 3KM5A 1DQ4A 1FAYA 5GALA 5GLZA 3AXDA 2A3YA 3OPZA 4FPGA 2YZ4A 3B00A 1S1AA 5JOYA 2SBAA 4XOGA 2Q5TA 2GMPA 3USUB 3RQ0A 1RITA 4FQZA 1JHNA 3N36A 3VUOA 2B7YA 1C1FA 2ARBA 4YFWA 1Q8SA 3B3QE 2C5DA 3NV1A 3PVEA 1Q8QA 1LULA 3WV6A 5DUWA 2VY0A 3ILNA 3AZWA 2DYCA 4MYEA 3IN9A 4Y1XA 4ZXKA 1LJ7A 1YRZA 4DPNA 1ZM1A 5JOXA 1O4YA 1LHVA 3WLUA 5KXEA 4P9WA 2DUPA 5AVAA 1EPWA 3BODA 4M01A 4YG6A 2GMEA 1FYUA 2VXRA 1S0GA 2D6OX 2GALA 4Y26A 5GLWA 3ZPYA 1QF3A 5DZGA 1LU2A 3ENRA 4JC1A 1SBFA 2LALA 4UW6A 1W6QA 1WUVA 3O0VA 4UW4A 1WW7A 1PZ9A 3POWA 1GZCA 1ULGA 4XYXA 3TB0A 3D5OA 3B69A 3WOGA 1YXWA 5E89A 2VU9A 1JN2P 1ENSA 3RS6A 1LESA 2ARXA 5IK5A 1BXHA 3RSJA 2KM2A 2ZBJA 5CNAA 4BPZA 4XXAA 1WBLA 4M00A 2WT2A 4U36A 1LOFA 4FOYA 2GN3A 2CTVA 2EXHA 5EXOA 2D43A 5T5PA 1ULDA 3L2YA 4LBNA 1SLAA 3R05A 1WLDA 3OY8A 5JVVA 1RIRA 4Q26A 1KRIA 2EXIA 3FBYA 5IUQA 5GZDA 2W52A 2OW4A 3JU9A 5HCBA 3DGTA 1LOBA 3AP7A 1TEIA 3I4IA 4XTMA 3HR9A 1SLTA 2JD4A 4R9DA 3WG2A 4GKYA 1N3QA 2DU0A 1URXA 1N3OA 2P2KA 1AX1A 2ZGOA 1ENRA 2JECA 3USUA 1LODA 3WDUA 5H9SA 3T1MA 1LGBA 2AR6A 5JOWA 1JW6A 4BM8A 4PBPA 2ZGPA 4XJWA 3UK9A 2V5YA 4BLJA 4YM3A 3A0KA 2E7QA 2V73A 2FMDA 2ZGSA 2ZMLA 3D4KA 3BTAA 4LBQA 1MZ6A 3ZXFA 1MS4A 4K21A 5T54A 4YGCA 1LOEA 4GALA 4GKXA 3MPPG 2A71A 1G9CA 4XIOA 3V65A 4XIKA 4P9XA 1GANA 1OFSA 2C9AA 1D0HA 5KXCA 5GZGA 1RINA 4Y20A 3Q9OA 3V0AB 2GDFA 3VKFC 4CTEA 1JOJA 2CYFA 4NO4A 1DQ1A 1OQ1A 1QMJA 1D2SA 4SLIA 1C57A 1DQ5A 2A75A 3CNAA 4LBQB 1QDOA 2ES3A 2ZHKA 3PJQA 1GBGA 3AJZA 1V6NA 1F31A 5IK8A 1WLWA 4BMBA 1GLHA 2NN8A 5DZFA 4ZKTB 5GLUA 2CL2A 1AX2A 1LHWA 4YW2A 2CWSA 1SLCA 2EAKA 1IOAA 1LCLA 3SH4A 2JE9A 1QDCA 2VH9A 2VW0A 3OBTA 1UKGA 4FPYA 1CONA 3U4XA 1QOOA 5HCAA 3AP5A 3WG4A 3WNXA 1DFQA 3AX4A 5GJ6A 1Q8OA 4XHXA 2AYHA 5L73A 1N47A 2DTYA 2E7TA 1VAVA 4F83A 2R0HA 1S0EA 1CN1A 1KQRA 3QCWA 1IS4A 3AXEA 3D6EA 1ULFA 1GV9A 1DHKB 5CA6A 1CVNA 1LU1A 3T1LA 1CIWA 3IM0A 2W08A 3T2TA 1DLLA 4H55A 2D6KA 4Z8BA 1LEMA 5GZCA 1QGLA 2DVBA 5T52A 4ISQA 1MS8A 1ULCA 1LECA 1HDKA 1V6KA 1MS3A 3HMYA 3VKLA 1YO8A 5IK7A 2ZZJA 4Q27A 1O4ZA 3AYAA 4IQPA 5GLTA 1LOAA 1KJRA 2D7FA 3OGGA 1IS5A 3FFZA 4LBLA 1SLBA 4LBKA 4Q2FA 1DIWA 2AENA 2EF6A 4Y20B 3SITA 1N1YA 2AUYA 5GLVA 1S0DA 2ZHNA 3M3EA 3MW3A 2RHPA 4Y22A 1G9FA 2ZGQA 2PHTA 4NOTA 2VW1A 1GKBA 5GZEA 4K1YA 2WKKA 1W6MB 3RG0A 1G9DA 1VAMA 2UURA 4FPJA 4R9AA 4YZ4A 5DUVA 1CPMA 3LSEA 1B09A 3WUDA 4JRAA 4ATEA 5F5QA 4Q8LA 3POSA 5LK5A 2PELA 4DQAA 4Q1RA 5JOZA 2DV9A 4HL0A 4YW5A 1IS3A 2WT1A 1W6QB 5DXDA 4AGVA 4TYSA 2W39A 4FOVA 1UN1A 4BLIA 2A6YA 4BMEA 3POYA 5CAZA 1DQ0A 4YM2A 2A5ZA 1DYPA 1JBCA 4WVVA 1S0CA 3ATGA 2ERFA 3WCSA 4UW3A 1UZYA 4LBQD 4CZSA 3NV3A 4XBQA 2EALA 2ZMNA 3WHTA 1IKPA 2YY1A 3OYWA 2YXSA 1ENQA 1GZ9A 1GZWA 2R16A 2WSVA 2CNAA 1G9BA 4C1XA 1LOCA 5EYYA 1C4RA 1SBDA 2D6MA 2E53A 2PHRA 2A3XA 4YM0A 5H9RA 2JKBA 1SFYA 2YROA 1W6MA 2G4IA 4TZDA 2PHWA 1APNA 1FATA 1G9AA 1V6JA 1MR5A 1Z78A 3AJYA 4Y22B 5GZFA 3FLTA 4YG3A 3DUIA 4FPHA 1LEDA 1QNYA 3AFKA 3WDXA 1JYCA 4M3CB 1ULEA 1V6IA 3LSDA 2GN7A 3ILFA 2JJ6A 3W59A 3IPVB 4FPEA 3AYDA 2OUJA 1SACA 2WT0A 3O12A 4I30A 3ASIA 1MS0A 1LHUA 4UW5A 1BYHA 1NXD1 3O5SA 1LOFC 3MW4A 1F9KA 3IKWA 5DZEA 4FQ4A 2DU1A 2ZMKA 1V6MA 1FX5A 4Y1ZA 1WLCA 1BZWA 1H30A 4ITCA 4XJUA 2ZAAA 1CR7A 4RL7A 4M3CE 4PCRA 4LBMA 1MS5A 5FRAA 1PZ7A 1V6OA 3SH5A 2NP0A 1AJOA 2ZHMA 1LHNA 1AXZA 1KJLA 3GNEA 3OBRA 2UWAA 1QKQA 4P9YA 2FHRA 3AZXA 3V0BA 3WVJA
chains in the Genus database with same CATH superfamily
3F2ZA 1VBB2 2PHDA 2ID4A 2VZRA 2J1TA 3N9LA 2XJVA 4ZPIA 1OD5A 3V64A 2ZGLA 1OH4A 3ZYBA 1Y9MA 1QH6A 4Y3OA 1AR71 2NMNA 2QTWB 1SHWB 3KQRA 1NG0A 1VRH1 2YPJA 3VL8A 1H1IA 2RM22 2BPA2 3DXUA 4RD7A 5SV8A 4BOWA 5JZGB 4DINB 3JZVA 2VTFA 5A1FA 5JXIA 4LO4B 4S2GA 5A6YA 4LR4A 3SQOA 2Q30A 2WDBA 2MHFA 3TNQA 4M4PA 2WLPA 4QX7A 4Q4V2 2DTWA 3OTFA 1S0BA 2OS2A 2VOTA 1OLQA 1ZBA3 3K3NA 5CKMA 4OQ9A 1RUF3 1H2KA 1W6NB 1WMFA 5JLVA 1DG6A 3FLPA 1OD3A 4CUGA 5FLIA 5A7NA 5ANQA 3ZFGC 5BYNA 5JZGA 3SISA 2YB7A 5IVJA 4CDWC 2CGPA 1UZZA 4BHPA 3ACHA 1Z7S2 4NHLA 1H4HA 1COV1 4XDQA 3VBUA 2Q8CA 3UKTA 4NIHA 1VB4A 1OQDA 4Q4Y1 3N7MA 5T5OA 3IMNA 4NIGA 4BZ4A 1TVGA 2BGPA 2JD9A 3J8F2 4R9BA 3S30A 3WY6A 3MUY1 4IEOA 3S5QA 1RTVA 4BQ3A 1UO9A 1XC6A 2R042 1UD1A 5KHKA 4WM7B 4E8DA 1ULOA 2WN3A 4AEDB 1WW6A 1NE4A 2P3KA 3E5UA 2ENRA 4P9LA 4QQHA 4YM1A 2RS51 3LAGA 5KXBA 2HYKA 2XLGA 3CMGA 4XJ9A 3ZYRA 5JUVA 1D0GA 2JG9C 2HJIA 5F3CA 3C2UA 2WC2A 3HQUA 1AHSA 4QU2A 3QH7A 2P3IA 5BNOC 3LDRA 4Q4X2 5K9YA 1RUE1 4N53A 3D82A 3VV1A 5FPAA 5FP4A 1E5SA 4FP2A 1UAIA 1UU6A 1UZWA 1GYKA 3UKNA 2Z79A 2IUWA 1FV3A 3VBUB 5CFDA 2IZWA 4EZHA 2V4AA 2WNUB 3AMPA 1VPHA 3FLRA 3I49A 3BVCA 3MFCA 1DGLA 4NRQA 1CAXB 4RS5C 4AVCA 1RUI3 4BU2A 1EP0A 4CE8A 1ENXA 3KCXA 5FWEA 1K12A 4GWNA 4C90A 2D5HA 1CPNA 5DAXA 3DCQA 5F37A 3ZDVA 3NKTA 4AVSA 4M0NA 1DYKA 4N8MA 3P3NA 2RS11 4AEDC 4Z92B 4QWNA 4KWLA 3I2KA 5A32A 4GWMA 4RA0A 2X5IA 3WNPA 3RI8A 3BALA 1COV3 3TEXA 3WDWA 4A42A 1ZZ9A 2NZ9A 4I0AA 1RMU2 4YZ5A 2FMYA 5CZKA 2H0BA 1ZZ7A 5IT6A 3AYCA 4KL1A 4ORFA 1PVC2 2DBIA 4E9KA 4J1XA 4BE3A 3EB7A 2X8KA 2ZGUA 1O3QA 2DVFA 1RHI3 1W3VA 2XKOA 3FN9A 1HIXA 3PVNA 1UOGA 3I8TA 3LOIA 3PUIA 4WM8C 3BGAA 1GP6A 3ZFGB 1AZDA 1OA2A 4Y1VA 2VQ0A 5EP9A 2W95A 3GALA 3HOBA 4FVVA 4IEWA 5EWSA 4KU8A 4XBNA 3X29B 3R4UA 5FXZA 5FZKA 1ZRCA 1WMEA 2XBO3 5FPXA 4L8QA 4QX2A 2RR13 4Z2WA 2ZGRA 4W4ZA 3SH3A 4AVVA 1F5FA 5HPOA 1F4AA 4LIUA 5E88A 5KC6A 4QQOA 2RS12 4I09A 1AR61 1DQ6A 2K9ZA 3OJBA 4HFSA 4Q4W3 1KEXA 1W8FA 5C4WA 4ONUA 3SHRA 1O8PA 1OLME 2QQKA 5TSWA 1SFNA 3WZ1A 4MGSA 4FOQA 4NPLA 3VBOC 3VHRA 3IPVA 2VZOA 4DY3A 5H9PA 1OKQA 3DF0A 5FP7A 1YWKA 1RUOA 4DY5A 1KDKA 4MO3M 4A4AA 1VMFA 1RVF1 2VMFA 4JTNA 5FY8A 1AL23 1A3KA 4ARXA 2VZ1A 2PYTA 5T3NA 1NCRB 3M3CA 2HEYF 3ST7A 1W6OA 4MSVA 2VGDA 1YYNA 4AHWA 2W68A 3BPZA 3IBMA 4R4ZA 4LOSA 4HN1A 1D2QA 1W8ZA 1AR81 1REEA 3NNMA 5LW9A 2P34A 4JX0A 4KWKA 3A7QA 2VZ3A 3AKQA 5IFTA 3B01A 1NY71 1YIPA 1UW8A 1PVC3 3S7IA 1VB2A 2RS32 3GXUA 4PF5A 3KT1A 4WVWA 1C5IA 1ND3A 2K46A 5EQUA 5FZGA 5C4WB 3NV4A 1JUHA 1W9TA 4FFFA 4MHUA 1QOSA 1XXNA 4PT6A 3QLQA 4FXGB 4BIFA 3BTZA 3M2MA 4GAZA 4OHXA 1WD4A 1JYIA 2XL7A 4PLMA 1H8VA 3AC0A 2VNRA 3WINE 2ZA9A 3H3ZA 4QKNA 5I8YA 3ES4A 1QQP3 2RJ2A 1FPN2 2WZ8A 5JIUA 2ORXA 3NW4A 3PMSA 3H9AA 1RVF2 4P9JA 3VD9A 1JU3A 2D3SA 1KDMA 1R1A2 1V6LA 2DWRA 3I2DA 1Y9QA 4HZFA 5FREA 4LPLA 1G8WA 2RS33 2YFZA 1CAXA 1QJY3 1VP6A 2DCTA 1W9SA 1X8MA 2N7GA 2IVJA 4O9EA 4F7ZA 4K40A 3I3EA 5GALA 5LCWL 3T3YA 4E4DX 1XYNA 4FPGA 5C8CC 3VBUC 4ASLA 5FZ1A 1EUTA 4XFFA 2Q5TA 3USUB 2W5FA 4LUMA 4FQZA 3HT2A 3N36A 4CDQA 5LA1A 3VUOA 3D3AA 4PIZA 1DGWX 4XFCA 4OI0A 2C5DA 4N43B 4YW6A 1Q8QA 5F3GA 2FDFA 5DUWA 4KNCA 1BBT3 5LBFA 3K77A 2WN2A 4Y1XA 4AFCA 1LJ7A 4X8PA 2JDPA 3LZZA 3LKJA 2F4PA 1O4YA 2DCZA 4Q4Y2 1AYM3 5C3QA 3WLUA 1HB3A 5KXEA 4LOTA 1GQGA 4G4FA 4AZZA 4QGMA 2YC2A 5BNOA 3VDCA 2HWB3 2VXRA 4Y26A 5EHDA 1ASJ2 4S2DA 5DZGA 4N53C 2O14A 1LU2A 1W0NA 5C3SA 4LEJA 1PO22 3TN91 4NHYA 1PZ9A 3POWA 4HVQA 1O6UA 1GZCA 1NLQA 4LITA 5DAPA 3TOJA 1SG3A 2W2IA 2VU9A 2W47A 4GZ9A 1JN2P 1QQP2 2BVVA 1LESA 1Z7S3 4RS5A 3H8UA 2ZX0A 2KM2A 1ZBA1 2D98A 2WA4A 1PGW1 2J1SA 2WO7A 5F1RA 4KWJA 1Q5OA 3D0SA 4XQ4A 5EXOA 4LBNA 4CEYB 3R05A 4B8EA 5DAWA 1HRI1 1W2OA 5ISLA 2VCAA 5JVVA 1RIRA 1XSQA 3MLJA 4Q26A 2EXIA 2RJKA 4BQ4A 4EZ4A 1O3RA 2YGMA 4B7EA 4FCAA 3FE5A 4K8RB 3CLPA 5ERLA 2X5IC 4BYYA 1CGPA 2Y6GA 2XVLA 3AKTA 4LE3A 1ASJ1 2XDVA 1N3QA 4GKYA 4KH9A 3I59A 2DU0A 1URXA 1N3OA 1YFYA 3NRUA 3USUA 5FMOS 1YI9A 2D93A 4WBBA 2VCBA 5JIAA 1L7QA 1JW6A 1EY2A 4NR1A 3SKVA 3K75B 3RDIA 2HWC3 5A32B 3URFA 4G9SB 3A0KA 2E7QA 3BTAA 4IL7A 4WM8A 4LBQA 5AFEA 5J1XA 1MZ6A 4NHKA 4OMDA 4P9IA 4OHWA 3ZXFA 4IUGA 2C9KA 2QQWA 3KHBA 1LOEA 4AFMA 1UXZA 3MPPG 3RVHA 4JDMA 3I2JA 4XIKA 3ZSEA 2W46A 2E31A 4ES8A 1AR62 3B94A 1RINA 4Y20A 5JI9A 1XRUA 1OQ1A 3OBAA 1UY3A 4DMIA 1TE1B 2E26A 1DQ5A 2A75A 4CU9A 1QDOA 2JG8C 2R072 3ZIWA 2ZXQA 3VBOA 4TLGA 3EQEA 5BNPB 1WLWA 4BMBA 4LK6A 2NN8A 1OC1A 2XONA 1DGRN 4ZKTB 1XU1A 1JZ7A 2P3YA 2EAKA 2DFBA 2VZVA 2YBSA 3QH6A 5FZ8A 1QDCA 1W9WA 2VW0A 4FPYA 1GOGA 1VBD1 4XCAA 4QU1A 1RGSA 1W03A 3VZLA 2FQPA 4GWIA 4QDSA 1VE0A 1RUJ1 5HV0A 4MH0E 5C5TA 1PNFA 2DTYA 1AYN3 2E7TA 3CJXA 3QCWA 2R041 4BCUA 1IS4A 1PGL1 3ETPA 1YQ2A 1HW5A 1IGOA 1WMDA 3FHAA 4WZCA 3WF1A 5I93A 3LIGA 1HJFA 1CVNA 3B5LB 2HEWF 1CIWA 1HRV3 1POQA 1XNCA 4N43C 5J7MA 1UU5A 2OYZA 3AKPA 3VBSC 3KWVA 4AAPA 1ND3C 1OOPB 4RHV1 4XFHA 5JR7B 4AE2A 4CCKA 1JYTA 1MS8A 1PO23 1HDKA 4LO6B 1V6KA 1MS3A 3HMYA 1BK0A 2ZZJA 4Q27A 3VDDA 1ZRDA 2ORZA 1LOAA 4GB33 2D7FA 5JR2A 1JYXA 3ZYIB 2BEOA 4IGQA 1SLBA 1KXGA 2AENA 3LGRA 3SITA 2P17A 5LEJA 1CZSA 2LM3A 4RQPA 3R4DB 2VMHA 4NMIA 2RHPA 3JD73 3OPTA 2DDUA 3ZKUA 2PHTA 2VOVA 4RGGA 4BQWA 1G9DA 3OB8A 4X8NA 1W6MB 3RG0A 5DUVA 5A3TA 4JRAA 4AVBA 4UF0B 1UZ0A 4H7LA 2QDRA 5LK5A 4YW7A 5C8CA 4SBVA 5JOZA 2YC0A 2DV9A 2PAKA 4Z07A 3RZHA 2ARAA 1AUYA 4AGVA 4CDQC 1ND3B 1OOPC 4FOVA 4CP0A 3W5MA 2FCUA 1JZ4A 2G9ZA 2JDNA 2YBPA 4LIVA 2W9XA 1J1LA 5A7WA 3WQ7A 3S6PA 2A5ZA 2HWE2 1TQ5A 1JBCA 1NLRA 1RUJ2 3KS7A 3WF0A 2VZTA 5IVVA 2XLAA 1UZYA 5FAXA 2B9VA 4XF3A 4CZSA 5A1LA 3LOBA 4ZU4A 4K7JA 2YXSA 1HN1A 2R16A 3RJRA 4URAA 5DAQA 4C1XA 4Y5Z0 5D1IA 5H9RA 1FI2A 2JKBA 4HT1T 2ZX1A 1TNFA 3UGGA 3VZMA 1APNA 2XMLA 1Z78A 1MR5A 4IERA 5BNPC 2RDRA 4YG3A 1STMA 1O7FA 5BY5A 3AFKA 5FCCA 1TMF3 5FYTA 3ROUA 1RHI2 1V6IA 5F6LB 5FJKA 3ILFA 2JJ6A 2FDIA 4Q4Y3 1PMJX 2JKXA 4CDWB 1P8JA 3O12A 1QY4A 1U5XA 5LK7B 1R093 2F4LA 3HT1A 2CHHA 1OPOA 5DZEA 2QUOA 3OPWA 1H4GA 2VL4A 2WWUA 1FX5A 3ZYGA 5A3LA 1JH5A 2GH2A 3LDKA 1XJAA 1SDWA 2JDHA 4RL7A 5I91A 3BUCA 5FRAA 2AACA 1HXS2 1V6OA 3BI3A 4OZOA 4TSVA 5IHRA 2VQAA 2W94A 5FZHA 1CAUB 2FHRA 5DDJ2 3SXWA 1D7PM 2MPFA 4XFIA 1XBFA 4D6RA 5ABJC 4QGLA 2XOMA 4UAPA 4OUEA 4CCDA 4DIQA 4YZ3A 2R1DA 3HVDA 2VZSA 4BQ1A 1HB2A 1W0PA 4E4ZA 5IATA 1BMV1 2OPWA 2Y64A 4QB6A 2I2SA 4KG8A 3WUCA 2D6NA 3TN93 3P5BA 1H9PA 2BRTA 3S0MA 3IAPA 4KGGA 2DBNA 2JENA 2VR4A 3N7KA 4JTOA 3U1XA 3W58A 4CPBD 2IXLA 2Z4FA 1W2NA 3MIBA 1RUI2 2BBAA 5LASA 1YNAA 4XAAA 4Y5TA 3CIHA 4UBHA 4Y24A 5C70A 4KU7A 4RR3B 3RNSA 2YUEA 1BJQA 2JIGA 1Q56A 2R30A 3KQ4B 3RWNA 4RS5B 4XURA 3J8F3 1YFWA 2QQUA 1JZ3A 3OOXA 4N9HA 4UI9L 2JG8A 5FXVA 3HN1A 4HETA 5FMOL 4XMIA 3ZSKA 2XH6A 2Y38A 3IWZA 2XJPA 1SLLA 5FYSA 3GBWA 2JDZA 2C6SA 4N7IA 3ES1A 4TTGA 2TEPA 1PMIA 3HN3A 2VXJA 3R4SA 3MEPA 2Q4SA 5BNOB 4N90A 1LR5A 2E6VA 2DUOA 4MLOA 2JG9B 3VBRA 2YDEA 5FY9A 4CUBA 3GHMA 4JHZA 1J1TA 3WNKA 2PHXA 3ZYFA 4Y4YA 4CYDA 5FZ9A 5F2SA 5FYCA 5C71A 5CG9A 1AL21 1RUC3 2P6HA 1FNZA 2P3JA 2DFCA 4B3NA 3CZUA 3PTYA 4CSWA 5DG2A 1RC6A 4N43A 1N1VA 2UY9A 3VBSA 3T09A 3UYJA 3ZOIA 5DG1A 3O1VA 3N3HA 4IE7A 2GNDA 4L11A 1B35B 1JTZX 1RMU1 3C7OA 4IV1A 4AEJA 4FT8A 3VDDC 1RXFA 2R49A 4OMCA 3HBZA 5DQ0A 5J48A 5D21A 1UQXA 2MEV3 3M3OA 2HWD3 2WFF1 3M4FA 2DCKA 1AYN2 4O61A 1LOGA 3OG2A 1AR93 1MPXA 1W6PB 1KGYA 2CU5A 5K7PA 2J1UA 4BDVB 2WWSA 2UWCA 2ATFA 3NKGA 4RQPC 4YZ2A 1RUNA 2E51A 3VBFB 1MEC1 1SLIA 3VZKA 4YGEA 3U07A 5FIXA 3RMYA 2VBDA 3KV5A 2IXJA 2A3WA 1V00A 4WV8A 3O14A 3ZSLA 1JI6A 5BNQA 2YHJA 1ZBA2 2WNEA 1MQTA 1ZX5A 3DKWA 4MGIE 4LMFA 1LGNA 4W8JA 5E16A 2OUHA 1BVVA 4N9IA 1PX4A 4A7ZA 5A3OA 3FUQA 1OOPA 1EUUA 4IV3C 2VG9A 3CKHA 3POBA 5EYXA 3PMEA 1AVBA 4X6RB 2PLV1 2XG3A 4Q4X1 3M70A 5C6CA 4FPFA 5FOBB 1I9RA 3BIWE 3SLIA 5FPUA 4GA9A 3SEPA 4XETA 4ZONA 5FPLA 4ASMB 1AXYA 2D3PA 2DURA 1YUDA 2EVXA 1RUC2 5HCFA 1W0OA 2WRAA 1YQ5A 2OX0A 1W6OB 3GZEA 1AYM1 4OI4A 4Y1YA 5FYVA 3BN6A 1RUD1 3WHUA 2ZGMA 1FPN3 4QB2A 5EFUA 5T50A 4XE9A 2YV8A 4JGYB 5FPZA 2ZGTA 4PIXA 4RGKA 2LW8A 4XUTA 3LEGA 3V0AA 4UOJA 3HQRA 5BNPA 2WZR2 4QDRA 1EV13 3MI8A 2HEVF 2BTVC 2GNMA 1ALYA 1GICA 4QX0A 1CESA 3MIGA 4J25A 4ISRA 4JKKA 1EAH2 1SCSA 2D44A 2EA7A 3ON7A 5FZ7A 2R061 5IVYA 3BTYA 3EYPA 5FKBA 3KMHA 2QNKA 2IVIB 4CUCA 1POV0 4P14A 2BNNA 1J3PA 1VBD2 3M1HA 4V2VA 2FD8A 1QJEA 3R6SA 2D6PA 3UETA 2A6ZA 2WNVC 1S55A 4FPLA 4UFIA 4CCOA 3WG3A 2Y6FA 2L9LA 3N9QA 4L97A 5JSOA 4NIDA 1NA1B 2A6WA 3EO6A 4H3WA 1GQPA 5DN2A 3WQ0A 4ET7A 5A1AA 5FZIA 1R083 5E1RA 5IW0A 2WQ8A 2CY6A 3J7LA 2RS13 4DO0A 1UX6A 1QJU1 2HWB1 3CJIC 1KFUL 1RXGA 1W8HA 1BKZA 1AYM2 4MGQA 1WA6X 4LBOA 3AYEA 2Y0OA 3UL2A 2ZEZA 4LBJA 5H9QA 2JEMA 2BDRA 1WCSA 5ABJA 2WJSA 1DZQA 2A6VA 3I59B 1SBEA 2QKDA 1DQ2A 1W3XA 5IAXA 2GC1A 4AHZA 4Q4V3 1VJ2A 2CGNA 1PVC1 3ZXJA 3GM8A 3INAA 4Q8KA 5JCTA 3APBA 4H7MA 4WVZA 3M8LA 4CU6A 1MS9A 1AF9A 3ME2A 1NLSA 2VMIA 3WF3A 3ZXKA 3BCWA 1I3HA 2W87A 5FO7B 2P37A 2OVUA 2WSUA 3ORJA 2B8MA 2C4XA 3MIDA 5BV6A 1T6GC 4DRVA 3AMNA 1N1SA 5LEKA 4QPGC 1WW5A 1YQCA 2PHFA 3WXPA 2WBKA 1SMVA 4EV0A 1HRV2 1QJY1 4P08A 4I0WB 1FV2A 2X09A 1DCSA 5FXXA 1E5HA 3BU0A 2XBO2 4K1ZA 5C3PA 1QU0A 5FQ0B 1DF0A 4N7UA 1MACA 1DQ4A 5GLZA 3BPSA 3ZXDA 3FBMA 3OPZA 3B00A 3OGSA 3SCHA 3EMRA 1A8MA 3FFQA 4XOGA 1HQNA 2RMU2 3RQ0A 1RITA 4NN0A 1NE6A 1XE7A 1UY1A 2VULA 3JXSA 3UV9A 3B3QE 2X05A 3ZFFA 4Q4X3 5HXMA 1FMD2 3NL1A 3O7OA 3VBRC 1C28A 5FJHA 3WD5A 4LA2A 2VY0A 3LIHA 3WV6A 5I8SA 3ZDSA 1GQHA 1REDA 1YCIA 3AZWA 2DYCA 3P3PA 4MYEA 4ZXKA 1LAJA 1YRZA 1G6NA 1T2XA 3OEBA 3T0BA 2W1WA 1H1AA 4FFGA 4L99A 4DXRA 4QHZA 1SFPA 2XWBB 5I0UA 4JAAA 4BJ0A 2XQRA 4NUBA 3O1PA 5C7GA 4YG6A 2GMEA 4IGPA 4NRPA 2D6OX 2GALA 4P9GA 4RYDA 4IV1C 1TME3 4PI2A 2KXLA 4FAGA 1O5LA 3WT3A 2LALA 2CAUA 1UY0A 2VM9A 4HPKB 1GOHA 5B4XA 2OIIA 5A7SA 2HKXA 3O0VA 4MVTA 4UW4A 3L2HA 1WW7A 1VBE2 2XJQA 3QD6A 5F7UA 1ULGA 2BVBA 4XYXA 4QQ2A 3OUJA 3D5OA 3TB0A 2EAAA 5L7OC 4JZRA 3TEWA 1UF2C 4QQLA 2VPVA 2WR9A 4LKDA 5A80A 5JPMB 3KF5A 5IVFA 2R32A 5G05L 3N9MA 4XXAA 5FZ6A 1WCQA 4U36A 2BW8A 5EV7A 4QX3A 3H1WA 5GKAC 1NZIA 2GN3A 4FOYA 3CDZB 4NROA 3LB9A 4AG4A 2RDSA 5KHJA 1MQTC 5T5PA 4Q5OA 3GBFA 3IDCB 3NMBA 1XSRA 1YJKA 3KLSA 3OY8A 4ZY9A 2Q8EA 3RFRA 5K0UB 4KWUA 2TBVA 3B7MA 4COUA 5GZDA 3FHIB 1NKGA 3WP5A 1OA3A 4IV3A 3JU9A 5HCBA 3PIJA 1LOBA 1SLTA 3KCCA 3G6JB 1UMIA 4BM8A 2JECA 3AFGA 3H7YA 4XUOA 5H9SA 1EPZA 1PM4A 3GDBA 1XNBA 4IEVA 2DF7A 3IZOA 3MV11 4OUSA 5DDJ1 4NIIA 5A7QA 2QCSB 1W06A 4XJWA 3CHXA 1RUD2 4NHXA 4XFAA 4BLJA 5FO9B 4YM3A 4COZA 2ZGSA 4CXYA 4PDWB 3ACGA 2ZAHA 4XIOA 5FP9A 2WZEA 4MZUA 4XCBA 1YC61 5FUIA 4K21A 5T54A 4GALA 4B29A 2QQVA 3NNGA 1S2KA 2OPKA 3V65A 2VNVA 3GBGA 1IQDC 3AMQA 4P9XA 1OPMA 2VNGA 5GZGA 1HRI2 2IXIA 4I2OA 4CTEA 2CYFA 1D4M3 1RUG1 1DQ1A 3H8OA 2C26A 3NO8A 1NX9A 1ND2A 4NPRA 1UX7A 3CNAA 2VCMA 2GP5A 1X7NA 5DMYA 4LHSA 4S2HA 2ES3A 2ZHKA 4LULA 1TMF1 2WNVA 4YRDA 1H8TA 3I7DA 5L36A 1V6NA 2W92A 3KZ4C 1GLHA 2JX9A 3FJSA 1NT0A 3FWEA 4YVSC 2CL2A 2VQTA 1LHWA 3H50A 5FLHA 4YW2A 2WZR3 1LCLA 2PHLA 3EHKA 4GMP0 3CJIA 4K9SA 1JZ5A 3AP5A 3RZZA 4CVUA 4IEZA 1H2MA 3VD5A 3I2HA 4F8AA 3K48A 2HLEA 4CDXB 1FOD3 2RS53 1NQJA 5JXGA 2VE1A 2QE3A 1ULFA 1PK6B 4P02B 2WS93 1UYYA 3T1LA 1LU1A 4COVA 2BGOA 3IM0A 2JDMA 2WNOA 1DLLA 1WZXA 2D6KA 4H55A 5FZOB 2XVKA 2WZPP 5I0TA 3T2TA 1R1A3 4LTAA 3C7EA 4ISQA 4KI5M 4CDUA 1O4TA 2J7MA 1ULCA 2O8QA 1HN0A 3IT8A 1R091 3EBRA 3EJKA 2VCCA 2RM23 4YWAA 3USSA 5IVEA 1KJRA 3OGGA 1IS5A 3FFZA 4QPGA 4LBLA 4D7YA 4MXWB 4QX8A 3Q8EA 1N1YA 3J4UH 3PTRB 2VUCA 5GLVA 5EIYB 3M3EA 1X9PA 2CSGA 3MW3A 3J7MA 4E2GA 4X6QB 2ZGQA 1UIKA 3JD71 1GR3A 3E5QA 4XVHA 4YYOA 2FBEA 4NOTA 1GKBA 2I07B 5GZEA 1H0BA 3O1TA 1VAMA 2OQ6A 4Y33A 4FSJA 2XXZA 5FZDA 3WUDA 4ATEA 4DXZA 5F5QA 1QH7A 1ST8A 4Q8LA 1ZREA 2PELA 4QHOA 5FYMA 4BISA 3MLKA 4DQAA 3PU3A 4YVWB 4MHRA 4NE9A 3RZKA 2B9UA 4BLIA 4QX1A 1RYYA 1UIJA 3HNYM 3POYA 4XF0A 4ZXEA 3O1OA 3ZFFC 1V0AA 4RHV2 4BH9A 2J42A 1S4CA 2BU9A 4CEWC 1DYPA 4AEKA 3PUQA 5IVBA 4MGTA 1XE8A 1GWKA 1S0CA 3ATGA 2ERFA 1SPPA 4A44A 2PAMA 3VHNA 4XBQA 4AI2A 1BEV3 1E5IA 2ZMNA 4F3JA 5C9AB 1XE0A 1GZWA 2XR4A 3DYOA 3NSTA 3AMHA 4LHKA 2P1BA 3UT0A 1LOCA 5EYYA 2D6MA 1BVP1 2PHRA 2R062 2BWCA 2X10A 2ZX2A 1RUC1 3J7HA 4Y4RA 3K2OA 1VBE1 2YROA 2G4IA 3NJXA 4AI8A 4TZDA 4CU8A 3VBHA 3TRSB 5C3RA 3A21A 1GWLA 2DCJA 4NVPA 3THCA 3WW2A 4FPHA 3WNOA 3LE0A 1RUF2 4JGZB 3Q8FA 2XJUA 4OLLA 3GZUC 3LSDA 2GN7A 5AVPA 4A3XA 2VOXA 2WO1A 1SACA 2WT0A 5HBAA 4IETA 2YG0A 2HH9A 3AL6A 4CCCA 3DPRC 5BXXA 5FZ4A 5L7OA 1W8WA 3TEYA 4L2NA 3AL5A 4IE5A 1BZWA 4GH4B 2B4KA 4ITCA 4ES9A 4D6SA 2QQJA 1CR7A 2FDGA 3J7NA 1GP4A 3KVAA 1DZTA 2XVGA 2VMCA 2ZX4A 4NWVA 4PCRA 3A23A 4UWDA 2HWC1 4EN7B 5FP8A 1LHNA 1H6YA 1AXZA 5AC92 2R6QA 2R7EB 3SC7X 2X29A 3OGRA 3PVBB 2J1RA 4AK3A 2B5HA 1PHMA 4EWEA 1W99A 3AZXA 3IDBB 3SCFA 4UFJA 3WVJA 3V0BA 1Q8PA 4AQSA 4GQ7A 5CB7A 1TME2 1AR63 4DZGA 1MVQA 1K5MB 5DABA 3MBWA 4XQDA 5F5AA 2HWE3 2RVAA 5KXDA 3RZMA 1QJY2 2AZ5A 2QVSB 1DZRA 1HV1A 5C3OA 3LF7A 3JUUA 3RMXA 5JAXA 2XBO1 1VIWB 5F8PA 4PQ9A 2WFF2 5FZCA 1FNYA 2ADEA 3N35A 2PHUA 3H7JA 4ZU5A 2WQZC 3VL9A 1JXNA 4D8MA 4J6GA 1DGWA 4NAOA 3VHPA 3POIA 1JOPA 3AZVA 4Y1UA 2A70A 3A4UA 4R52A 1NZCA 1W2TA 1VBB3 3N7JA 1W9YA 1UYPA 3ZSMA 1CZTA 1ND2C 2ZACA 3WDTA 4AYUA 3KV9A 3WP4A 5CBLA 2VMDA 2NLRA 1Y7BA 4H14A 4E27A 3S7EA 4G3YC 2EXKA 3MFAA 2YMZA 3HNMA 1CJPA 3GZTB 1H8TC 1IQAA 1YI7A 4XTPA 4XXPA 4M3CA 4MGYE 1MZEA 2Q1FA 2GH8A 2Q1ZB 3VZOA 1W04A 3FUOA 4HSJA 2ZKNA 4YVSA 1UZVA 5CKNA 4GMP3 2HWF1 1XB9A 4MOAA 4PIYA 4AL9A 1IKQA 1CAVA 3SCGA 5L19A 3OCPA 2KR2A 4XQWA 2BOIA 2RMU1 2BUKA 1ONAA 2QQPA 3AVRA 5A6ZA 4GJZA 1TZOA 5FYUA 5IK4A 3OYWB 1UY2A 4YG0A 2R1BA 3AZYA 4OI1A 3HEIA 4QGNA 5FY4A 1QOTA 3ZO0B 1R081 1HQLA 2D6LX 4JQTA 2JB4A 1Y3TA 5FZLA 1RUI1 4AVTA 3NAPC 4JHTA 1RB8G 1F8VA 3VKNA 3JBG1 4XUNA 2Y8KA 1ZNPA 3E1F1 1FT9A 5K0UC 3N7LA 1H2LA 2EIBA 4BIOA 5DDJ3 4OZXA 4RFT0 3BU7A 4CDUC 1QNWA 3LFMA 4ZHNA 4Q1PA 3VD3A 2NMOA 4LHNA 5FYBA 2WZR1 4Q29A 3RYRA 3OGVA 4C0HA 1LB2A 3MYXA 1F5JA 1H9WA 2UYAA 2WLQA 4BK4A 3ZN6B 4DOUA 5F9TA 4EN0A 1HB1A 1XYPA 2QQLA 4QM9A 2B46X 1LKNA 1W6PA 4JKMA 4Q4W2 3TN92 4AFDA 4CP1A 3T0AA 4AWDA 4HG6B 2PA7A 5FY5A 4UBGA 5T55A 1RUG3 2D3RA 4LKSA 4CDUB 3CO2A 3A0NA 4DUXA 4YFZA 5J98B 5FDBA 1B35A 5LBEA 2BBVA 1T6BX 3IB3A 3H42B 4ASKA 1PK6A 1XNAA 5IYYA 1O3TA 2ZEXA 1I1EA 5ACA2 2R0FA 2IFRA 4YLZA 3BYWA 3OUIA 1XU2A 3ZFEB 4CRQA 1LGCA 2CWMA 3SNMA 4ATFA 4MV2A 1W8NA 2YPDA 4XEZA 3H1YA 1BBT1 4QD2A 3R0RA 4XFBA 4CXXA 5FXWA 4CEWA 5FBZA 1VR3A 2RR12 2G9FA 2A6XA 4NPMA 4DUVA 1LHOA 3W9AA 2LUWA 1MZFA 3QOPA 5FY7A 4QB1A 3POGA 5F3EA 5CFCB 4L0PA 3AZZA 1V70A 1WKYA 1ZZBA 3LCPA 5E6HA 5E8AA 3VN4A 1TNRA 1WMXA 2CV6A 1X33A 3GF6A 3AVSA 3T2PA 1C8M2 3O1SA 2JB8A 1EV11 2VNOA 4OCTA 1OF3A 2V5DA 3CQOA 3WG1A 3VBHC 2JE7A 2OZ6A 4XUPA 2VOKA 5LA9A 4P5HA 4D69A 1FPN1 1NY72 5FQ0A 5FP3A 3KGLA 2VAUA 1Z0HA 4K20A 4RR3A 2UU8A 3HAGA 3MF9A 1AR91 1WCDJ 4YW1A 4CP9A 1UL9A 5FK7A 3AM2A 1QJFA 3AK0A 4TLFA 4Q4W1 3VZNA 1TG7A 4YGDA 5L9VA 2FCTA 3ZVXA 3TNPB 3DPRA 1OSGA 1LTEA 2GMMA 1OHFA 4JCKA 1IS6A 3WDYA 4R9CA 3ZM8A 2AH2A 1K45A 2BNMA 2RR11 2VO5A 2PLV3 4QPIB 5F5IA 1Y9GA 2XQXA 5JSRA 1US2A 1X50A 2B39A 3DV8A 4FPKA 4IE4A 2OZJA 3MW2A 4KQ7A 4XBLA 4WVMB 5LB6A 1PGL2 1RUH3 1PMHX 4DRRA 1CX1A 3GCWA 3H0OA 1FMD1 3U78A 1A6CA 3C7GA 2LRPA 2PTMA 2IC1A 5FZFA 1AR83 2ZGKA 1UOFA 4JDOA 3KT7A 4AEMA 2DVDA 4FPCA 2ARCA 5KC5A 1M4WA 3O0XA 5FMDA 3VKMA 3H3LA 1PO13 1WGPA 2F17A 4WVMA 1CAWA 2VZQA 1RVF3 4PQQA 2ZEYA 4LLOA 4W6YA 4CCEA 4QPIC 3LA7A 4JQRA 3PLQA 2BJSA 4QKDA 4A7KA 1XQNA 5IFPA 2FDHA 4XDPA 2O1QA 1EAH1 5FPVA 4QXCA 3I2GA 4YARA 2DVAA 1R1ZA 1VBA2 3LEKA 5FFOC 4XF4A 1ZRIA 4CCMA 2ZTNA 4B1LA 1NCQB 3DXTA 1C5HA 4K3UA 1AX0A 4HKOA 4M4RA 4XHBA 3ZFEA 3H8XA 2GNTA 4J1WA 3ZXEA 2NQYA 1H6XA 1GNZA 3RGBA 3THTA 1ZVFA 2ZX3A 2HBTA 2ZPXA 1PZ8A 1QJU3 3BOPA 5LBBA 1W28A 5T5JA 1Q3EA 4FAHA 5EPAA 5FZ0A 5D8AB 5FYZA 4JGYC 1PIV3 3DN7A 1OMIA 4I3GA 2WUHA 5FK8A 1FAYA 4FTBA 1XYOA 4W50A 4C91A 4LE4A 4AW7A 1W8TA 4KG0A 3OUHA 2XJSA 2YZ4A 1S1AA 5JWPA 1SPPB 3DYPA 2BGCA 3U0ZA 4FXKB 2GMPA 2A73B 4O9GA 5FZ3A 3SEEA 5F6KA 3EXUA 2WINB 1JHNA 3ZN6A 1RJ8A 1RUE3 1UOBA 1UU4A 4CEWB 5HV4A 4YFWA 1NAEA 3UNPA 1W39A 1Q8SA 1O3SA 2BWAA 1PGW2 3NV1A 4NIAA 4MGZE 3ZFFB 5FMCA 1LULA 3ILNA 4GULA 2XJTA 1R082 2Q1MA 2OA2A 3MICA 1W2UA 1CAWB 1BCXA 1QJX3 4DPNA 4BQ5A 4IE6A 1LHVA 3O1RA 3NAPA 4DXTA 5J96B 3NNJA 3AKRA 2DUPA 5K0UA 1EPWA 3BODA 3WF4A 5L7OB 2W0XA 4LT5A 2YGLA 4QXKA 1QF3A 4QX5A 3VD7A 3ENRA 4JC1A 1SBFA 1HX6A 1W6QA 1ZRRA 5KBFA 1PVXA 4Q0QA 3WR0A 2P6CA 3ZX7A 4NJ4A 4AI3A 4IXLA 5LWBA 2XWJB 3K3OA 1PX3A 4RQPB 2VUJA 3B69A 3JCIA 5A33B 2ET7A 5E89A 4QKBA 4XUQA 1ENSA 2V72A 3RS6A 5BNNB 3CL1A 3PUHA 1JYVA 5IK5A 1RUF1 3RSJA 2ZBJA 5D8AC 5CNAA 3VD4A 1WBLA 1ND2B 3MO4A 3THDA 2E33A 2WT2A 4CPBA 4QXHA 1B35C 1BLZA 5F5CA 2AEZA 3KD4A 2CTVA 2EXHA 2D43A 2E63A 2OKXA 3T2OA 1ULDA 3L2YA 1PK6C 3MIEA 1SLAA 3UGHA 3GZAA 3JBG3 1WLDA 4CCNA 1ODMA 4HLTA 3POJA 1MEC3 1K5JA 3HIFA 3Q8CA 3GJBA 3FBYA 2ZOEB 5IUQA 2AEYA 4CDXC 2NPIA 1KRIA 2W52A 1RUD3 4HMZA 4IE0A 3WNNA 1VRH3 5KHHA 4MUVA 2JWPA 1AR73 4GIQA 2LROA 3DGTA 1VBC1 3AP7A 1TEIA 2PQSA 3I4IA 2JICA 4IEYA 1YFXA 2PXJA 3WG2A 2RMU3 5AFBA 2PN5A 2P2KA 2GSYA 1ENRA 3N9OA 5FTTC 3WDUA 3OGJA 4H2AA 1JOBA 3T1MA 3U37A 1LGBA 2HWF3 4UFKA 3P6BA 5B4NA 2ZKLA 4LK7A 1EAH3 1D4M1 1OURA 3UK9A 2V5YA 4LO5B 3D4KA 2ZMLA 1ULPA 1OF4A 3K51A 3SMHA 4GD4A 1CZVA 3ZMNA 1MS4A 4LJHA 5AC93 1J59A 2ZZQA 4COYA 1AR72 4YGCA 2IFWA 1UMHA 4GKXA 1G9CA 2GP3A 4HK9A 1JU4A 1KS5A 2W91A 3CU7A 2V4VA 4IW3A 4META 1JODA 4GH4C 1GANA 3GYDA 4LKEA 1OXCA 4RR3C 5IAVA 2Q8OA 3OD0A 2J1EA 5CIRA 3JD72 3Q9OA 3V0AB 2GDFA 1L3JA 3VKFC 2HWF2 1DDLA 4IDZA 1QMJA 4NO4A 5BNNC 4RGAA 4PDWC 5D2AA 2ZS6B 2YU2A 3K4DA 1Y43B 3PJQA 4BWOA 3ZN4A 4JGZC 1S2EA 3AJZA 5IK8A 1SDDB 4CP9B 3VGIA 2IXHA 5DZFA 4AFBA 4LNVA 3KGZA 1OUSA 4JKLA 1SLCA 1IOAA 1RMU3 4C0BA 4HPKA 4XFGA 3OBTA 4LUKA 1DYOA 4CU7A 1UKGA 1E57A 2VECA 1QOOA 2Y6LA 5J3UA 4BA6A 2QZ2A 2X53S 1DFQA 3AX4A 4PLOA 5GJ6A 1RUJ3 4XACA 4D7TA 1ACCA 1Q8OA 2HWD2 5L73A 3VDAA 1VBC2 4LQRA 5LBCA 2R0HA 1S0EA 1CN1A 1KQRA 5HCHA 5EJ1B 3AXEA 1GFF2 3D6EA 4UFMA 3PUAA 2WAOA 5CA6A 4QPIA 4QXBA 3MLLA 2W08A 2HWB2 3HQXA 5GZCA 4Z8BA 5EJZB 4URTA 4EROA 2DVBA 5FO8B 5T52A 1XNKA 4IEUA 3E6CC 4AAXA 2BZDA 3A22A 4GB31 4AVAA 2W1SA 3VKLA 1K42A 3AYAA 3LPFA 1IPSA 5GLTA 3ZFEC 2QJVA 1TMF2 2XLFA 1S2BA 2QZ3A 3ACFA 2YYOA 4LBKA 2GC3A 4Q2FA 5CKQA 2AUYA 2ZHNA 2WYSA 5FZMA 4Q0VA 1G9FA 2VVEA 1IZ3A 2RDNA 2VW1A 1I5ZA 4JGYA 2E32A 2WKKA 4EE2A 5CISA 3FL7A 4FPJA 1GWMA 2H0VA 2YBKA 3POFA 1NYWA 1B09A 1POV3 5A7OA 3SKJE 1ZBE3 3POSA 4DEVA 1O59A 1BEV1 1NCQC 1OVPA 1VBD3 3KCYA 4JDNA 5L9BA 5FWJA 3H8RA 3RZGA 2J1VA 4OHZA 2GZWA 2WT1A 1W6QB 1WWYA 4A2UA 4TYSA 2W39A 5FY0A 2UYBA 1UN1A 5HXVA 2A6YA 5I0SA 1RJ7A 3T30A 4BMEA 5KR7A 2RG4A 5FYHA 2IXCA 1JS9A 3NQHA 1UPIA 1CD3G 1OH3A 2GC0A 1EV12 3MF6A 3T08A 3U14A 2WS91 4IEPA 5FZOA 1D4VB 4WVVA 3KB5A 4FFHA 4CA9A 1UOJA 4IV3B 4B7KA 1ZYBA 4UW3A 4LA3A 4Q0UA 3NV3A 3CEWA 1KFXL 3WHTA 2QDNA 1UYZA 3OYWA 1ENQA 1GZ9A 2BYVE 1QXPA 2VQUA 1RL3A 2CNAA 2WSVA 2Y6JA 4QM8A 5HCAA 1WCKA 1C4RA 2E53A 4P00B 2A3XA 1U5YA 3DL3A 4YM0A 4AQ2A 1SFYA 1BHGA 1W6MA 3KT4A 4DNYA 2PHWA 1FATA 1G9AA 4EJRA 3NJVA 4B4RA 3LEIA 3I2FA 4NAMA 3DUIA 1QNYA 1GOFA 3JQXA 1WA4A 4HONA 4M3CB 3B93A 2OT7A 3RZJA 1H8TB 1NQDA 3RZLA 1X82A 4Y5SA 1AR92 2VBPA 3AYDA 2RM21 2Y33A 4FPEA 4I30A 5D8AA 2QBXA 3ASIA 3LDBA 5C8WA 4D3WA 1BYHA 1QIQA 3T0DA 4RFRB 3MW4A 3IKWA 1POV1 3GJAA 2WWJA 4Q0PA 1ASJ3 2VZPA 5FV3A 3ZXAC 5FPBA 1V6MA 4QT6A 3C7FA 1AL0G 1ZRFA 4W6WA 1WLCA 1H30A 3ITQA 4XJUA 1YHFA 1U12A 2ZAAA 2JDAA 1J3RA 4CDXA 3O1UA 1XOYA 4M3CE 1W8OA 4LBMA 1W05A 1PZ7A 1CWPA 2ZHMA 3AKSA 1OKOA 3ZLIA 5A70A 1FXZA 4YSFA 4A7YA 3WQBA 3OBRA 1QXRA 1VBA1 5CFCC 2UWAA 3LEMA 3PIGA 1GMMA 3O1MA 1OBNA 4YVSB 1NCRA 2B42B 2XB6C 1A8DA 1CIYA 4LHLA 3U75A 1JMUB 4RHV3 2WIIB 1LNSA 2SLIA 3TWIA 3IMMA 3WW3A 2A1XA 1KITA 2ADDA 5J36A 4D7SA 1HRV1 5A6XA 4GXLA 1G7YA 5JXJA 4NWWA 4FBFA 2RS31 2UY8A 4L9BA 3ZN5A 5CEHA 4YVWA 3WDVA 4LORA 4E4HA 2VUAA 1AYN1 3RYPA 5JDBA 3RRDA 4LKFA 2VBBA 3TAYA 1UMZA 4V2WA 5BUVA 2XHKA 1OA4A 4GH4A 1UCXA 1RUG2 2Z5WA 2ZABA 1AJKA 1IPJA 2LS6A 5F2WA 3LWCA 5A3WA 2QQMA 2BFUL 4BQXA 4XF9A 4D94A 4W65A 5BNNA 3DPRB 3ZSJA 1VLNA 3MDPA 4UFLA 4CP2A 5B2GB 4PDWA 1N3PA 1VALA 1UXXX 2CGOA 3VKOA 5T5LA 4JGZA 2NM1A 4MX3A 4BQYA 5J09A 4KBZA 3MGUA 5BPXA 1GSLA 4DUWA 3AP6A 3WX5A 2JDYA 1TME1 1BQPA 2D5FA 2DVGA 4OVEA 5A7WB 4E2SA 1CAUA 1WBFA 2VVDA 2WYFA 2A7AA 2EIEA 1UNBA 4U2AA 3NAPB 2Z2SB 3NJZA 2VJXA 2XUMA 3ECQA 3FX3A 4XF1A 5M0TA 2HWC2 4BPZA 2FZ2A 1AXKA 3HBKA 5DUXA 5AC91 2DUQA 3OY8B 1JZ6A 5FKCA 3VLBB 1MQTB 1GU3A 1S0JA 3FZ3A 4A45A 1MVEA 5GM0A 1DBNA 2PFWA 2BNOA 1WW4A 3F95A 3M3QA 4ZZ8A 1GZTA 1QQP1 3UJOA 2ZHLA 4B4QA 3VBRB 1UY4A 2HWD1 2GNBA 3FC0A 3VHOA 2Q8DA 1W90A 1PM7A 2EICA 3AP4A 3HJRA 4PBOA 3PL0A 1SCRA 1QJZA 4WZFA 3RWKX 3PNAA 3ZYHA 2VMGA 2AGSA 3NV2A 1VBC3 3KF3A 1F2NA 1F4HA 1XNDA 2J22A 2WNUA 4GWJA 2VW2A 4D6QA 3BB6A 2V09A 2K0GA 3I2IA 3ZXGA 4IV1B 3TYJA 3PJYA 3BOWA 4K6BA 5CG8A 4KMQA 5FZAA 2FDKA 1GZWB 1HQWA 3Q8BA 2RDQA 5F3IA 3UGFA 4DS0A 5A3NA 3IIIA 3U11A 4AHYA 5CU1A 4MXWA 1HLCA 1NCQA 1YFUA 1E5RA 4KBBA 4AHXA 1Z7S1 4DXSA 1YIFA 3IIAA 4XJ8A 4XMAA 1EYBA 1J83A 1XPWA 3ILRA 1CX4A 1RUH1 4HSLA 4IEXA 1KD7A 2D40A 2WABA 3LD8A 2WA3A 1S0FA 5K4LA 4RN5A 4XZPA 1K5MA 4EWDA 2TUNA 4E8CA 4AGGA 5CYYA 4A6SA 5JXHA 3VZJA 3ZXLA 1MZ5A 2BFUS 5IVCA 2FZ1A 4FOWA 1V9U1 2C0ZA 2Q0AA 3CF6E 3K4AA 1ZA4A 1H2NA 2BERA 4XJZA 3T4VA 4AGRA 3OF1A 4M0HA 2EXJA 4NHMA 2ZJCA 3I3DA 2TNFA 1A34A 2EIGA 3NWKA 2Z42A 4AOCA 2FDJA 4FTSA 3M3IA 4BB3A 5C33A 3FMGA 4TWTA 4UYBA 3E6BA 3ZR6A 5A3UA 4AXOA 1U0AA 3I3MA 5JMCA 1HKDA 1IG3A 1YLLA 2VUDA 3B9CA 2WS92 3CJIB 3I3BA 1U5IA 3JB8A 1QJX1 3KSCA 4M3CF 4EN9B 1W6NA 1C1LA 4INDA 2LTNA 5FYYA 4QPGB 2GAUA 4C8DA 4AR2A 2JDUA 4DFSA 1CQ9A 5A3MA 4XILA 1HB4A 5LA0A 3CBNA 2WNVB 4A41A 4R4XA 4OHYA 1C8M3 2NYYA 5L9RA 1FOD2 1GNHA 1UPSA 4EQVA 3IDAA 2P4EA 2G19A 2QFEA 2GC2A 2ETEA 2UWBA 1N1TA 1MS1A 4MADA 3E97A 4YGBA 5C5UA 1DGRA 4D0QA 3VBSB 1Q8VA 3OSDA 3VBHB 3QBQA 5ABJB 4P5YA 4YW3A 4EN6B 5APAA 3U4SA 4IESA 3I3QA 1G86A 4XW3A 2BQPA 4EWAA 1W8UA 2BP6A 5LRSA 3N4MA 1LENA 4I3PA 4MXVA 1O8SA 5C9AC 2E9QA 4L92A 4TN7A 5DUUA 3UJQA 3KVBA 3PVOA 5CFCA 3W5NA 1JZ8A 2RJLA 4QKFA 1R092 1SZBA 2PLV2 4YZ1A 3ZIXA 1GP5A 1QXJA 1NCRC 5LATA 3D0JA 1UWWA 3HWJA 3V0BB 4XJAA 4EN8B 2ET1A 4HBNA 3UESA 1VMHA 4O65A 2AREA 4R8HA 4DB5A 2O8OA 3ETQA 1IG0A 1C8NA 2GU9A 4FP3A 2BOJA 4YVWC 1C8M1 1PNGA 3DECA 4ARYA 1PO12 1WD3A 3S57A 1VBB1 5J37A 2R063 5KHIA 2HBUA 3W21A 3WCRA 5FZEA 3BIEA 3I54A 1W9FA 3POEA 4YW4A 4HKLA 4XDOA 3TEZA 1IPKA 1BMV2 2Y6KA 4HANA 3ZMOA 1S0IA 1FMD3 3O0WA 2ZEWA 3BKZA 4FPOB 5LZ6A 1A78A 1IHMA 3ZYPA 2XHNA 4YNIA 3H1MA 3N9PA 1JUIA 4XAEA 3WEZA 1CJDA 5A33A 1X8EA 2YC4A 3VBFA 2ZGNA 2VOWA 2CAVA 3AP9A 3KM5A 3GHNA 2XKPA 3AXDA 5CVRA 2A3YA 2VC9A 1Q43A 2HWE1 2MEV1 3K4ZA 4QMAA 4WM8B 3UKVA 4QPYA 1VMJA 4EYUA 3LQCA 2SBAA 5JOYA 2QQNA 2Y34A 3MUZ1 4E2QA 4QAWA 2B7YA 1C1FA 1LRHA 2ARBA 5FBJA 3PDQA 4GMP1 2AC1A 4CCLA 3D8CA 3PVEA 4HK8A 1F15A 3NVCA 5SV5A 3OEAA 5KHGA 2KD7A 1AL22 3OD4A 4PJYA 4AFAA 2C24A 4BXFA 2W1QA 3IN9A 4PLNA 4UT5A 4E4SA 3HNBM 1ZM1A 3PU8A 1SEFA 5JOXA 1AR82 1PO11 5EJ3A 3DKQA 2EIDA 1J3QA 1BK1A 1OQEA 2WO2A 4K8FA 4OHVA 4OYUA 4P9WA 3W20A 1RUE2 2XUEA 2XL9A 4LO8A 5AVAA 1RHI1 4CEYC 4UXAA 4HXCA 2J1AA 1ZZCA 1FYUA 4M01A 1S0GA 1CAVB 1YQ6A 5GLWA 3NNFA 3WNMA 3ZPYA 3MHZA 1JYNA 2O0OA 4HOOA 4UW6A 1NA1A 2WL1A 1WUVA 4UFHA 2Y6HA 1SQ4A 4Z82A 1ZZ6A 1L7LA 2IXKA 1I5PA 3JBG2 4LXLA 1D4M2 1C3HA 1L7RA 1M06G 3WOGA 1MEC2 1YXWA 2WNUC 4QQPA 4B1MA 2WFF3 2VD7A 3VDDB 2ARXA 3HPNA 4FI9A 2XJRA 1BXHA 5JMOA 2Z69A 4PI0A 3WW4A 4HN0A 3JQWA 3KV4A 4M00A 4N53B 1LOFA 2WO3A 2JDKA 3NNLA 3LPGA 4S2FA 4XPVA 3WSOA 1UKRA 2IWGB 2QQOA 2H6BA 1VRBA 5A6QA 2MEV2 1JZ2A 2DCYA 4BK5A 2OW4A 3BTXA 4I01A 1NOVA 5FY1A 3THPA 4AQ6A 1J84A 4OULA 1VAKA 4GJYA 4ZS2A 4XTMA 2Y26A 4W6XA 3HR9A 4IEQA 1K5MC 5ANNA 2JXAA 3WW1A 2JD4A 4WM7A 4R9DA 4ZU7A 3QACA 1JHJA 5G04L 2ZGOA 4C1WA 2D97A 1AX1A 2QQIA 1LODA 2E7AA 1NUKA 2RE9A 4A6OA 2MNGA 4LLFA 2AR6A 1I6XA 3CZJA 3ACIA 5JOWA 4Z2AA 3DYMA 3OBZA 4PBPA 2ZGPA 5I0DA 3N9NA 4BXSV 4Q4V1 3B9IA 1X36A 2JG8B 1QJX2 2V73A 4GB32 2FMDA 2VTXA 3ELNA 5DAVA 4CUAA 3C7HA 1K3IA 2ZCWA 2WAAA 5F39A 1QWRA 3P1IA 1QHDA 5LA2A 2P5BA 2A71A 1XNTA 2VVFA 4AI0A 1OLMA 2JE8A 2PQQA 1OLRA 1OFSA 2C9AA 1D0HA 5LY2A 3PUSA 5KXCA 4B4PA 5K8SA 3GGLA 1JOJA 1D2SA 4SLIA 1C57A 1KS4A 5JPNB 2H6CA 4LBQB 2WFPA 4XC9A 5JZGC 3NJYA 3ZFGA 2BV4A 4CDWA 3ZYJB 1GBGA 4TXWA 5IWFA 1H1MA 1F31A 3ALQA 1REFA 3FHQA 5GLUA 1AX2A 2CWSA 3GCXA 3MIHA 4AI1A 1GUIA 3SH4A 3KHCA 2JE9A 5JSPA 2VH9A 1FOD1 3U4XA 1CONA 3I97A 1HRI3 2RV9A 4QDQA 2X5IB 1VBA3 3ABZA 4QPWA 3WG4A 3WNXA 5C9AA 5IJRA 2R073 3B02A 5I8TA 4PHZA 4XHXA 2AYHA 3M7AA 1N47A 4F83A 1VAVA 2G9GA 3AB0A 3E6DA 2PMWB 1BEV2 1PGSA 2FCVA 1R64A 5LY1A 3LFIA 1X9TA 5A7PA 3J9SA 1GV9A 1DHKB 1YJLA 1JYWA 3C3VA 1QJU2 3C8XA 2JG9A 3VDBA 3ZR5A 4FFIA 4V1PA 1LEMA 2K2SA 2WQ4A 2W1UA 1QGLA 2YFUA 5FOJB 1LECA 2XGXA 4OUMA 3VBOB 4HKWA 1YO8A 3MIFA 1V9U3 5IK7A 1O4ZA 2VTXJ 4IQPA 2F6BA 4O7XA 5FR3A 5CFDC 1O91A 4HVRA 4Y20B 1DIWA 1R1A1 2EF6A 4UF0A 4LO7A 5F32A 4YPJA 1S0DA 4I02A 2PAEA 5ACA1 1U5ZA 1DP0A 3I2OA 4MG2A 1DU3D 4OI2A 2I45A 4Y22A 3ACLA 1UYXA 3LA3A 1OI6A 2VZUA 4OQ8A 1O5UA 2I74A 5LRRA 4K1YA 3KV6A 3VBFC 2UURA 1BBT2 4R9AA 4YZ4A 1CPMA 1WLTA 3LSEA 3Q8AA 4JRLA 2R071 4KGQA 1V9U2 1ODNA 4Q1RA 4XZUG 3MZHA 3WNLA 1HXS1 1NXMA 3J26N 1HJGA 4HL0A 2G1MA 4YW5A 4AEDA 1IS3A 3H3UA 5DXDA 4I0BA 5FYIA 1OFNA 3MV01 5DPNA 2KA3A 1OVSA 3IAQA 4MGKE 2XPJA 5CAZA 5CADA 1OUXA 1DQ0A 2JIJA 2YU1A 1RUH2 4YM2A 5EZWA 4CDQB 3RPQA 3AMMA 3MPBA 3PHMA 1ZZ8A 3ZKYA 4AF9A 3RJ2X 1F35A 1PIV1 1WCUA 3WCSA 4HVOA 5C8CB 1US3A 4LBQD 4NRMA 2EALA 2B45X 1IKPA 2YY1A 2OXBA 1ZBE1 1G9BA 3S5AA 4CEYA 1SBDA 2ILMA 4XABA 3L9JT 3K46A 5JI7A 2OQ7A 3JB4C 1ZA7A 2VMEA 1NA1C 4Q0SA 3WP6A 1Y4WA 4BQ2A 3E5XA 4PF1A 5FUPA 5FUNA 1V6JA 3AJYA 4Y22B 5GZFA 3G7DA 3FLTA 3RI9A 3WDXA 1LEDA 5KWRA 2Y60A 1JYCA 4OFGA 1DLCA 1ULEA 4DEQA 5CFDB 5A3PA 3T4HB 2HYXA 3IPVB 4QHBA 1J58A 4RSUA 1VRH2 4JVAA 3W59A 1HXS3 2OUJA 1W2AX 4AQTA 5C4WC 1YQ8A 1MS0A 1LHUA 4UW5A 1PO21 1NXD1 3O5SA 1HV0A 2CDOA 1LOFC 3WP3A 1F9KA 1QEXA 4FQ4A 2DU1A 2ZMKA 2CDPA 2Y0IA 3WF2A 4A3ZA 4Z1VA 4COWA 1OT5A 4ZS3A 2W3JA 4Y1ZA 3V56A 1PIV2 3LA2A 3J8F1 3DEMA 3T2QA 1VBE3 3HD8B 5FMBA 3IDEA 3U10A 5ACA3 2R043 4AI9A 1MS5A 1YEWA 5I0RA 1ZBE2 3SH5A 5FZBA 3PURA 4JV4A 4FTEA 1AJOA 2C1FA 4CCJA 2NP0A 5FLJA 1KJLA 3GNEA 4WM7C 2RS52 4CXWA 5HI0A 3ZPOA 1QKQA 4P9YA 1COV2 4FO9A 3RYKA 3WQ1A 3VB9A 4ZZ5A 3TBDA 4IGOA 1GNYA
chains in the Genus database with same CATH topology
1VBB2 2PHDA 2XJVA 1OD5A 3V64A 2ZGLA 1QH6A 1AR71 2NMNA 3KQRA 1NG0A 1VRH1 2YPJA 3VL8A 1H1IA 2RM22 2BPA2 4RD7A 5SV8A 4BOWA 5JZGB 4DINB 3JZVA 4LO4B 4S2GA 4LR4A 2Q30A 2MHFA 3TNQA 2WLPA 4Q4V2 2DTWA 3OTFA 1S0BA 1OLQA 1ZBA3 1RUF3 1H2KA 1W6NB 1WMFA 5JLVA 1DG6A 3FLPA 5FLIA 5JZGA 3ZFGC 5BYNA 3SISA 4CDWC 2CGPA 1UZZA 4BHPA 1Z7S2 4NHLA 1H4HA 1COV1 4XDQA 3VBUA 3UKTA 1VB4A 1OQDA 4Q4Y1 3N7MA 5T5OA 3IMNA 4BZ4A 3WY6A 3J8F2 4R9BA 3S30A 4IEOA 1RTVA 2R042 1UD1A 5KHKA 4WM7B 4AEDB 1WW6A 1NE4A 2P3KA 3E5UA 2ENRA 4P9LA 4QQHA 4YM1A 2RS51 3LAGA 5KXBA 2HYKA 2XLGA 4XJ9A 3ZYRA 1D0GA 2JG9C 2HJIA 3C2UA 2WC2A 4QU2A 1AHSA 3QH7A 2P3IA 5BNOC 4Q4X2 5K9YA 1RUE1 4N53A 3D82A 3VV1A 4FP2A 1UAIA 1UU6A 1GYKA 3UKNA 2Z79A 1FV3A 3VBUB 5CFDA 2IZWA 3AMPA 2WNUB 3FLRA 3MFCA 1DGLA 4RS5C 1CAXB 4AVCA 1RUI3 1EP0A 1ENXA 3KCXA 4GWNA 4C90A 2D5HA 1CPNA 3NKTA 4AVSA 4M0NA 1DYKA 3P3NA 2RS11 4AEDC 4Z92B 4KWLA 5A32A 4GWMA 4RA0A 2X5IA 3RI8A 3BALA 1COV3 3WDWA 1ZZ9A 2NZ9A 4I0AA 1RMU2 4YZ5A 2FMYA 2H0BA 1ZZ7A 5IT6A 3AYCA 4KL1A 4ORFA 1PVC2 4E9KA 4J1XA 4BE3A 2X8KA 2ZGUA 1O3QA 2DVFA 1RHI3 2XKOA 1HIXA 3PVNA 3I8TA 3LOIA 4WM8C 3ZFGB 1AZDA 1OA2A 4Y1VA 2VQ0A 4FVVA 3GALA 4IEWA 5EWSA 3X29B 4KU8A 4XBNA 3R4UA 1ZRCA 1WMEA 2XBO3 5FPXA 4L8QA 4Z2WA 2RR13 2ZGRA 3SH3A 4AVVA 1F5FA 5E88A 5KC6A 4QQOA 2RS12 4I09A 1AR61 1DQ6A 2K9ZA 3OJBA 4HFSA 4Q4W3 5C4WA 3SHRA 4ONUA 3WZ1A 5TSWA 1SFNA 3VBOC 4FOQA 3VHRA 3IPVA 4DY3A 5H9PA 1OKQA 3DF0A 1RUOA 1YWKA 1KDKA 1RVF1 4JTNA 1AL23 1A3KA 2PYTA 5T3NA 1NCRB 3M3CA 2HEYF 3ST7A 1W6OA 4MSVA 2VGDA 1YYNA 4AHWA 2W68A 3BPZA 3IBMA 4R4ZA 4HN1A 1D2QA 1AR81 1REEA 2P34A 4KWKA 3AKQA 3B01A 1NY71 1YIPA 1UW8A 1PVC3 3S7IA 1VB2A 2RS32 4PF5A 3KT1A 4WVWA 1C5IA 1ND3A 5C4WB 3NV4A 1JUHA 1QOSA 1XXNA 3QLQA 4FXGB 4BIFA 3M2MA 4OHXA 1WD4A 1JYIA 2XL7A 4PLMA 1H8VA 2VNRA 3WINE 2ZA9A 3H3ZA 5I8YA 3ES4A 1QQP3 1FPN2 5JIUA 3NW4A 3PMSA 3H9AA 1RVF2 4P9JA 2DWRA 2D3SA 1KDMA 1R1A2 1V6LA 3I2DA 1Y9QA 4HZFA 5FREA 1G8WA 2RS33 1CAXA 1QJY3 1VP6A 2DCTA 1X8MA 2N7GA 4O9EA 4F7ZA 4K40A 5GALA 4E4DX 1XYNA 4FPGA 5C8CC 3VBUC 4ASLA 4XFFA 2Q5TA 3USUB 4LUMA 4FQZA 3HT2A 3N36A 4CDQA 3VUOA 4PIZA 1DGWX 4XFCA 4OI0A 2C5DA 4N43B 1Q8QA 5DUWA 4KNCA 1BBT3 4Y1XA 4AFCA 1LJ7A 4X8PA 3LZZA 3LKJA 2F4PA 1O4YA 2DCZA 4Q4Y2 1AYM3 3WLUA 5KXEA 1GQGA 4G4FA 4QGMA 5BNOA 2HWB3 2VXRA 4Y26A 1ASJ2 4S2DA 5DZGA 4N53C 1LU2A 4LEJA 1PO22 3TN91 1PZ9A 3POWA 4HVQA 1GZCA 3TOJA 2VU9A 1JN2P 1QQP2 2BVVA 1LESA 1Z7S3 4RS5A 3H8UA 2ZX0A 2KM2A 1ZBA1 2D98A 2WA4A 1PGW1 5F1RA 4KWJA 1Q5OA 3D0SA 4XQ4A 5EXOA 4LBNA 4CEYB 3R05A 4B8EA 1HRI1 5JVVA 1RIRA 3MLJA 4Q26A 2EXIA 2RJKA 1O3RA 2YGMA 4B7EA 4FCAA 3FE5A 3CLPA 2X5IC 4BYYA 1CGPA 2XVLA 3AKTA 4LE3A 1ASJ1 4GKYA 1N3QA 4DY5A 4KH9A 3I59A 2DU0A 1URXA 1N3OA 1YFYA 3USUA 5FMOS 1YI9A 2D93A 4WBBA 5JIAA 1JW6A 1EY2A 4NR1A 3RDIA 2HWC3 5A32B 3URFA 4G9SB 3A0KA 2E7QA 3BTAA 4IL7A 4WM8A 4LBQA 5AFEA 1MZ6A 4NHKA 4P9IA 4OHWA 3ZXFA 1LOEA 4AFMA 3MPPG 4JDMA 4XIKA 3ZSEA 4ES8A 1AR62 3B94A 1RINA 4Y20A 5JI9A 1XRUA 1OQ1A 4DMIA 1TE1B 1DQ5A 2A75A 1QDOA 2JG8C 2R072 3ZIWA 3VBOA 3EQEA 5BNPB 1WLWA 4BMBA 2NN8A 1DGRN 4ZKTB 1XU1A 2EAKA 2DFBA 3QH6A 1QDCA 2VW0A 4FPYA 1VBD1 1RGSA 3VZLA 2FQPA 1RUJ1 4MH0E 1PNFA 2DTYA 1AYN3 3CJXA 2E7TA 3QCWA 2R041 4BCUA 1IS4A 1PGL1 1HW5A 1IGOA 1WMDA 4WZCA 5I93A 1CVNA 3B5LB 2HEWF 1CIWA 1HRV3 1XNCA 4N43C 5J7MA 1UU5A 2OYZA 3AKPA 3VBSC 1ND3C 1OOPB 4RHV1 4XFHA 5JR7B 4AE2A 1MS8A 1PO23 1HDKA 4LO6B 1V6KA 1MS3A 3HMYA 2ZZJA 4Q27A 3VDDA 1ZRDA 1LOAA 4GB33 2D7FA 3ZYIB 2BEOA 1SLBA 1KXGA 2AENA 3LGRA 3SITA 2P17A 5LEJA 2LM3A 4RQPA 3R4DB 2VMHA 2RHPA 3JD73 2PHTA 2VOVA 4RGGA 1G9DA 4X8NA 1W6MB 3RG0A 5DUVA 4JRAA 4AVBA 4H7LA 5LK5A 2QDRA 5C8CA 4SBVA 5JOZA 2YC0A 2DV9A 2PAKA 4Z07A 1AUYA 4AGVA 4CDQC 1ND3B 1OOPC 4FOVA 1J1LA 3WQ7A 3S6PA 2A5ZA 2HWE2 1TQ5A 1JBCA 1NLRA 1RUJ2 3KS7A 2XLAA 1UZYA 5FAXA 4CZSA 4XF3A 3LOBA 4ZU4A 4K7JA 2YXSA 2R16A 3RJRA 4C1XA 4Y5Z0 5D1IA 5H9RA 1FI2A 2JKBA 4HT1T 2ZX1A 1TNFA 3VZMA 1APNA 1Z78A 1MR5A 4IERA 5BNPC 4YG3A 1O7FA 5BY5A 3AFKA 5FCCA 1TMF3 3ROUA 1RHI2 1V6IA 5F6LB 3ILFA 2JJ6A 4Q4Y3 4CDWB 3O12A 1QY4A 1U5XA 5LK7B 1R093 3HT1A 1OPOA 5DZEA 2QUOA 1H4GA 1FX5A 3ZYGA 5A3LA 1JH5A 2GH2A 1SDWA 4RL7A 5I91A 5FRAA 1HXS2 1V6OA 4TSVA 2VQAA 1CAUB 2FHRA 5DDJ2 3SXWA 4XFIA 2MPFA 5ABJC 4QGLA 4YZ3A 2R1DA 1BMV1 4BQ1A 1W0PA 4E4ZA 2I2SA 4KG8A 3WUCA 2D6NA 3TN93 1H9PA 3S0MA 4KGGA 4JTOA 2JENA 3N7KA 3W58A 2IXLA 3MIBA 1RUI2 1YNAA 4UBHA 4Y24A 4KU7A 4RR3B 3RNSA 2YUEA 1BJQA 2R30A 1Q56A 3RWNA 4RS5B 3J8F3 1YFWA 4N9HA 2JG8A 3HN1A 4HETA 5FMOL 4XMIA 3ZSKA 2XH6A 2Y38A 3IWZA 2XJPA 1SLLA 3GBWA 2JDZA 4N7IA 3ES1A 2TEPA 1PMIA 3R4SA 3MEPA 2Q4SA 5BNOB 4N90A 1LR5A 2E6VA 2DUOA 4MLOA 2JG9B 3VBRA 2YDEA 3GHMA 1J1TA 2PHXA 4CYDA 4Y4YA 5CG9A 1AL21 1RUC3 1FNZA 2P3JA 2DFCA 4B3NA 3PTYA 5DG2A 1RC6A 4N43A 1N1VA 2UY9A 3VBSA 5DG1A 3N3HA 2GNDA 4L11A 1B35B 1JTZX 1RMU1 4IV1A 4AEJA 4FT8A 3VDDC 2R49A 3HBZA 5J48A 3M3OA 2MEV3 3M4FA 2HWD3 2WFF1 2DCKA 1AYN2 1LOGA 1AR93 1W6PB 5K7PA 4YZ2A 2WWSA 2UWCA 2ATFA 3NKGA 4RQPC 1RUNA 2E51A 3VBFB 1MEC1 1SLIA 3VZKA 4YGEA 3U07A 3RMYA 2IXJA 2A3WA 1V00A 4WV8A 3O14A 3ZSLA 5BNQA 2YHJA 1ZBA2 2WNEA 1MQTA 1ZX5A 3DKWA 4MGIE 1LGNA 5E16A 2OUHA 1BVVA 4N9IA 4A7ZA 3FUQA 1OOPA 4IV3C 2VG9A 5EYXA 3PMEA 1AVBA 4X6RB 2PLV1 2XG3A 4Q4X1 3M70A 5C6CA 4FPFA 5FOBB 1I9RA 3BIWE 3SLIA 4GA9A 4XETA 4ASMB 1AXYA 2D3PA 2DURA 1YUDA 2EVXA 1RUC2 5HCFA 1W0OA 1W6OB 4Y1YA 1AYM1 4OI4A 1RUD1 3WHUA 2ZGMA 1FPN3 5EFUA 5T50A 4XE9A 2YV8A 4JGYB 5FPZA 2ZGTA 4PIXA 3V0AA 5BNPA 2WZR2 1EV13 3MI8A 2HEVF 2BTVC 2GNMA 1ALYA 1GICA 1CESA 3MIGA 4ISRA 1EAH2 1SCSA 2D44A 2EA7A 2R061 3KMHA 2QNKA 1POV0 4P14A 2BNNA 1J3PA 1VBD2 3M1HA 3R6SA 2D6PA 2A6ZA 2WNVC 1S55A 4FPLA 3WG3A 4L97A 5JSOA 1NA1B 2A6WA 3EO6A 4H3WA 3WQ0A 1R083 5E1RA 2CY6A 2RS13 1UX6A 1QJU1 2HWB1 3CJIC 1KFUL 1BKZA 1AYM2 4LBOA 3AYEA 2Y0OA 3UL2A 4LBJA 5H9QA 2JEMA 1WCSA 5ABJA 2WJSA 1DZQA 2A6VA 3I59B 1SBEA 2QKDA 1DQ2A 2GC1A 4AHZA 4Q4V3 1VJ2A 2CGNA 1PVC1 3ZXJA 3INAA 4Q8KA 5JCTA 3APBA 4H7MA 4WVZA 3M8LA 1MS9A 1AF9A 3ME2A 1NLSA 2VMIA 3ZXKA 3BCWA 1I3HA 5FO7B 2P37A 2OVUA 2WSUA 2B8MA 3MIDA 5BV6A 1T6GC 4DRVA 3AMNA 1N1SA 5LEKA 4QPGC 1WW5A 2PHFA 3WXPA 1SMVA 4EV0A 1HRV2 1QJY1 4I0WB 1FV2A 2XBO2 4K1ZA 1QU0A 5FQ0B 1DF0A 4N7UA 1MACA 1DQ4A 5GLZA 3ZXDA 3FBMA 3OPZA 3B00A 3SCHA 1A8MA 3FFQA 4XOGA 1HQNA 2RMU2 3RQ0A 1RITA 4NN0A 1NE6A 1XE7A 2VULA 3UV9A 3B3QE 3ZFFA 4Q4X3 1FMD2 3NL1A 3O7OA 3VBRC 1C28A 3WD5A 3WV6A 4LA2A 2VY0A 3ZDSA 5I8SA 1GQHA 1REDA 1YCIA 3AZWA 2DYCA 3P3PA 4MYEA 4ZXKA 1YRZA 1G6NA 1H1AA 4L99A 2XWBB 5I0UA 4JAAA 4YG6A 2GMEA 4P9GA 2D6OX 2GALA 4IV1C 1TME3 2KXLA 4FAGA 1O5LA 3WT3A 2LALA 2CAUA 4HPKB 2OIIA 2HKXA 3O0VA 4MVTA 4UW4A 3L2HA 1WW7A 1VBE2 2XJQA 3QD6A 1ULGA 2BVBA 4XYXA 4QQ2A 3TB0A 3D5OA 2EAAA 1UF2C 4QQLA 2VPVA 5JPMB 2R32A 4XXAA 4U36A 2BW8A 5EV7A 3H1WA 5GKAC 4FOYA 2GN3A 5L7OC 3LB9A 4AG4A 5KHJA 1MQTC 5T5PA 3GBFA 3IDCB 3KLSA 1YJKA 5K0UB 3OY8A 2TBVA 3B7MA 4COUA 5GZDA 3FHIB 3WP5A 1OA3A 4IV3A 3JU9A 5HCBA 1LOBA 1SLTA 3KCCA 3G6JB 4BM8A 2JECA 3AFGA 3H7YA 5H9SA 1EPZA 1XNBA 4IEVA 2DF7A 4OUSA 5DDJ1 2QCSB 4XJWA 1RUD2 4XFAA 4BLJA 5FO9B 4YM3A 4COZA 2ZGSA 4PDWB 2ZAHA 4MZUA 4K21A 5T54A 4GALA 4B29A 1S2KA 2OPKA 3V65A 3GBGA 4P9XA 3AMQA 1OPMA 2VNGA 5GZGA 1HRI2 2IXIA 4I2OA 4CTEA 1D4M3 2CYFA 1RUG1 1DQ1A 3NO8A 1ND2A 4NPRA 3CNAA 1X7NA 4S2HA 2ES3A 2ZHKA 4LULA 1TMF1 2WNVA 4YRDA 1H8TA 3I7DA 5L36A 1V6NA 3KZ4C 1GLHA 2JX9A 3FJSA 3FWEA 4YVSC 5FLHA 2CL2A 4YW2A 1LHWA 3H50A 2WZR3 1LCLA 2PHLA 3EHKA 4GMP0 3CJIA 4K9SA 3AP5A 3RZZA 4IEZA 1H2MA 4F8AA 3K48A 4CDXB 1FOD3 2RS53 1NQJA 2QE3A 1ULFA 1PK6B 2WS93 3T1LA 1LU1A 4COVA 3IM0A 3T2TA 1DLLA 4H55A 2D6KA 2XVKA 2WZPP 5I0TA 1R1A3 4LTAA 4ISQA 4CDUA 1O4TA 1ULCA 2O8QA 3IT8A 1R091 3EBRA 3EJKA 2RM23 3USSA 1KJRA 3OGGA 1IS5A 3FFZA 4QPGA 4LBLA 4D7YA 4MXWB 1N1YA 3J4UH