1LOFA

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
molecule tags Lectin
total genus 27
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofA00
3OJBA 3AXDA 4YGBA 4M3CB 1GICA 5GLZA 3VV1A 3BTAA 3ILNA 1WLCA 5KXDA 4Q27A 2CL2A 1S0GA 3HMYA 1LOFC 4YLZA 3USUB 3FLRA 1AX1A 1OKQA 2R0FA 4YM2A 1GZWA 1MS1A 3ILRA 4BMEA 2D6LX 4FP3A 2D43A 2UWCA 1MZ5A 4BQ1A 1S0FA 3SH4A 2LTNA 2WKKA 2NN8A 2GDFA 2CTVA 1G9FA 5HCBA 1YI7A 4YGDA 3WNXA 4M3CF 3CNAA 4FPYA 3UL2A 1N47A 2OW4A 3R4SA 2CNAA 5HCAA 3W58A 3AYAA 3NV3A 3V64A 5GLWA 2R1DA 1SACA 1GNZA 5DZFA 5JLVA 4C1XA 1LCLA 1DFQA 1NXD1 4YZ4A 1O4ZA 1U0AA 1VIWB 3UJQA 4DQAA 4Y1XA 4AVTA 2DUPA 4FQZA 1Q8VA 4Y1YA 2FHRA 2R16A 4GA9A 2AH2A 1ENSA 1AJKA 1LJ7A 1OQ1A 5SV8A 1D0HA 4RA0A 3IPVB 1SLIA 4SLIA 1WUVA 1FNYA 5T50A 4BOWA 1G9DA 1FV2A 1AVBA 4NOTA 1GNHA 3AZXA 2P34A 4AGGA 2NP0A 2DV9A 3BIWE 1JBCA 1KITA 2UU8A 5GZCA 4GWMA 3DUIA 1O4YA 3I4IA 3POSA 2E6VA 1LU2A 1CPMA 3B69A 2PHUA 3D5OA 1GZ9A 1H9WA 3O0VA 3DGTA 1LOFA 1CQ9A 1ULFA 2A3XA 2ARXA 2ZACA 1GKBA 1SLTA 3KM5A 3WDVA 4K1YA 3OGGA 1I1EA 3PVOA 3O5SA 4Z8BA 2JE9A 4M01A 4XJZA 2EXHA 2ZGOA 4AVSA 3VKFC 2CWMA 3WG4A 4DPNA 3ZXKA 1FYUA 2GMMA 2E51A 5FREA 4LBNA 1QMJA 5JMCA 2ERFA 4CTEA 5GJ6A 4XBQA 3WDUA 1CONA 4BM8A 1KQRA 2PHXA 1BYHA 3VKOA 4XXPA 2W08A 2NM1A 3FLTA 4FPHA 1IS5A 3FFZA 3ZSLA 5DZGA 1CPNA 1Q8OA 1YO8A 3O12A 4YGCA 2BQPA 1EPWA 4GALA 1QGLA 1DQ2A 4BLJA 2VW2A 3MW2A 2GALA 2ZGKA 1F31A 2A6YA 2ZBJA 3AZVA 5DXDA 5L73A 1GZWB 4YZ2A 5T52A 4LBQB 1CVNA 4FPJA 4AGRA 4Q2FA 2I2SA 1JOJA 1UMZA 2DWRA 4Q1PA 2W68A 3VKMA 2NMNA 3HR9A 1NLSA 3RRDA 1C57A 3WG1A 5CA6A 3VKNA 4XZPA 2CWSA 5DUWA 1N1SA 2EAKA 3RSJA 3PVNA 3N7LA 2D6KA 5DZEA 2ZHLA 1HQLA 1IS6A 1WD4A 4Y26A 3ZYPA 2AGSA 3AZWA 1Z78A 5GM0A 3LSEA 2A71A 1AJOA 3INAA 1FATA 4LBOA 4XYXA 2AYHA 4FOQA 2GN3A 4Y1VA 2WSUA 1SLAA 1BKZA 1B09A 4XHBA 2DVDA 4XBNA 1S0CA 2A70A 3D6EA 4Q8LA 3LCPA 1CESA 2A6XA 4JCKA 5EYYA 2VXRA 4R9BA 1HQWA 2NYYA 3M3EA 5GZDA 5JOYA 3NWKA 1HKDA 4UW4A 3N7MA 1DYKA 4Q8KA 2ARBA 4PCRA 1WW7A 1MS8A 2D6PA 4ATFA 4XMIA 1AZDA 2E53A 2E7TA 3ENRA 1UL9A 5HCFA 3A0NA 5CNAA 3MW3A 1LGBA 2SBAA 4KBBA 3WCSA 2A3WA 3ZVXA 4ATEA 4YM3A 1S1AA 1Y7BA 4LBJA 5T5PA 1G9CA 1QKQA 1ENRA 1WCSA 1JHNA 4XHXA 1RINA 3AXEA 1AX0A 2ZGQA 4FPCA 1YYNA 4YG6A 1G9BA 1PZ7A 4FOVA 5GZEA 1V00A 3WG3A 1OFSA 1MVQA 3UK9A 1V6IA 2ZMNA 5LK5A 5T5LA 5DG2A 1BXHA 1DZQA 2DVGA 3SITA 1QNYA 1AX2A 4IQPA 4PBPA 1SBEA 3N35A 4YW5A 3W59A 3QLQA 3WDWA 3FBYA 4UW3A 1CJPA 2ZGTA 4PBOA 3AP6A 3AX4A 4XJWA 1QOOA 2ZGMA 2D3SA 1H30A 2OUJA 1SCSA 2JDZA 2UWBA 4TZDA 1JW6A 1QDOA 3AZZA 4FPGA 3WDYA 1LENA 3RQ0A 3ZXFA 1DQ4A 2JKBA 1IS4A 1VAMA 1VAVA 2D3RA 1D2SA 1GANA 2DYCA 2GNDA 2UURA 3B00A 1GSLA 2ZAAA 4Q26A 1FNZA 1S0BA 1GYKA 5FRAA 1WLDA 5KXEA 2EXIA 4WV8A 3WOGA 4YG3A 4DRVA 4FPFA 1KDMA 4Y22A 1DYPA 4FP2A 2GNTA 3N7KA 1I3HA 5F5QA 4C1WA 1WBLA 1JUIA 3IMNA 5H9SA 5JVVA 4K21A 1GBGA 3B3QE 1TEIA 3UJOA 4YZ5A 2XG3A 1UAIA 1UX6A 1BJQA 1LULA 1DGLA 1W6QA 4R9DA 4U2AA 3U4XA 3MEPA 4CZSA 3T1MA 1PZ9A 2JE7A 4XJAA 2D6OX 4YFWA 5H9PA 1V6OA 2OUHA 5BYNA 3V0BA 4ASMB 4XJ8A 3OY8A 1G86A 2ZGPA 3POYA 4GKYA 5T55A 3AJYA 4XDQA 1A3KA 3HN1A 1Q8SA 4HL0A 1JN2P 1W6MB 2DVFA 4XTMA 3WHTA 1A8DA 2P3KA 3WHUA 4Y20B 1VALA 3ZSMA 2EXKA 1YIFA 5EXOA 2YXSA 1N3PA 5E8AA 4Y1ZA 3ZXJA 1V6LA 1CN1A 1A78A 1GZCA 2WSVA 2Z42A 3TB0A 1WLWA 3KQRA 3LSDA 1N1YA 1CR7A 4M3CA 1FV3A 1R1ZA 2D3PA 3BODA 3FLPA 4FPOB 4JC1A 4ZKTB 1GV9A 1KDKA 2ZGLA 2WJSA 1UN1A 3WDXA 2NMOA 3USUA 4U36A 1FAYA 4XBLA 1W6OA 4Y24A 1SLBA 4YM1A 1XQNA 2UWAA 4P9XA 2A6VA 4XTPA 3WVJA 4XXAA 5IT6A 3R4UA 2G4IA 3RMYA 2YROA 2JECA 2DU0A 2JD4A 1RITA 4AVVA 3V0AA 4XIKA 1LU1A 2ZABA 1Q8QA 4AGVA 1KJRA 4Q1RA 2VUAA 3OPZA 1FX5A 2A5ZA 2D7FA 4R9CA 1N3QA 4DFSA 5T5OA 5GLTA 1LOCA 3SLIA 5KXCA 1UZYA 2LALA 2RHPA 4GWNA 3AFKA 3M1HA 1ULCA 2R0HA 4YM0A 1AXYA 2A7AA 1G7YA 4AWDA 3MPPG 3O0XA 1C1LA 1MZ6A 3M3CA 4TYSA 1UZZA 3ZYRA 4BPZA 4P9YA 4DS0A 1JXNA 1W0OA 2GMEA 2P3JA 2EF6A 4HANA 3AJZA 5AVAA 3WUCA 3IPVA 1C1FA 2DTWA 4H55A 5CAZA 2DVBA 4WVWA 4XE9A 4GKXA 4I30A 4LBLA 4Y22B 2DVAA 1MS4A 4WZFA 1QOSA 2ZGNA 4ISRA 4F83A 1N3OA 4YZ1A 1APNA 2YY1A 1W6NA 3AK0A 2NZ9A 3JUUA 5CB7A 3V65A 3AYCA 3PMEA 1S0DA 3GNEA 1RIRA 3AP4A 3T2TA 3WUDA 4W65A 4YW4A 4DRRA 3NV2A 4K1ZA 4P9WA 3WZ1A 1AXKA 2ZHMA 1QU0A 3POWA 1BQPA 3A0KA 2AR6A 2YMZA 1QNWA 1KRIA 1DQ1A 2C9AA 3C2UA 3SH5A 2PELA 1W6PA 1MS9A 2ZGRA 1DQ6A 4XJ9A 1DIWA 3D4KA 3NV4A 1LGCA 2EALA 4LBKA 5DUUA 1Q56A 3JU9A 5H9QA 1LOAA 3WLUA 5JDBA 3Q9OA 1MS0A 4XILA 2GMPA 1IKPA 1LEMA 2AREA 1ZA4A 2ENRA 3RS6A 3IKWA 1ONAA 5KXBA 4BLIA 1LECA 4YW1A 3RG0A 1LHNA 1QOTA 1DBNA 4Y1UA 4RL7A 3NV1A 1UPSA 1V6MA 5IK7A 2ZHKA 2C5DA 4FOWA 1GLHA 1LOGA 1YRZA 4R9AA 1IOAA 5CBLA 2WT1A 2AENA 1URXA 3AP9A 4MYEA 1W6OB 4GXLA 4LBQA 3SH3A 1MACA 4D69A 3OBTA 1ULGA 2PHFA 4XMAA 4YW2A 3ZSKA 2AUYA 3AYEA 3AP7A 4XIOA 1ENQA 3V0AB 3IM0A 5GALA 3T1LA 1VLNA 2EIGA 2ZA9A 1KJLA 3OYWA 1SCRA 3VKLA 4JRAA 1WW5A 3WV6A 3IN9A 2D44A 2E7QA 3AZYA 5GZFA 1LGNA 3APBA 1W0PA 2ZGUA 1LESA 1DHKB 3L2YA 1MVEA 1V6KA 4YG0A 1V6JA 2P3IA 2W39A 2D6MA 2WT0A 3ILFA 1AF9A 1X50A 3M2MA 1JYIA 1ULEA 3N3HA 3N7JA 1AXZA 1H9PA 1LOBA 2PHWA 3ATGA 3VUOA 4UW5A 3ZPYA 4LBQD 1Z0HA 4AYUA 2VW0A 1JYCA 2XB6C 2JJ6A 1MR5A 2ZGSA 2ZHNA 3MW4A 5EYXA 1DLLA 5IUQA 1UKGA 5DUVA 3ASIA 1SBDA 1W6NB 1SLCA 2GNMA 4OZXA 2V5YA 5E89A 2Q5TA 4ZXKA 4M3CE 5JOWA 1QF3A 4YZ3A 2P2KA 4UW6A 1LEDA 5EWSA 1HLCA 3GALA 4FQ4A 4PF5A 2FMDA 1MS5A 4BMBA 2PHRA 1DQ5A 1G8WA 1W6PB 1WW6A 1LHOA 4NO4A 2A75A 3WDTA 1SFYA 2ZZJA 2P37A 4K20A 2A6WA 2ES3A 3ZXEA 2VH9A 4ITCA 2PHTA 3OBRA 2B7YA 3TAYA 2DUQA 1G9AA 4WVVA 2DTYA 2WNEA 5JOXA 3RMXA 1ULDA 1S0IA 3O0WA 1LODA 3PJQA 2DU1A 3WCRA 1MS3A 2WQZC 1IS3A 3SISA 3AP5A 3M3OA 1IKQA 3FUQA 1SLLA 2DUOA 1WD3A 3M3QA 4YFZA 2A3YA 1PZ8A 2ZKNA 1WW4A 1YXWA 3N36A 4LBMA 3ZSJA 2YZ4A 2CYFA 2DURA 4FPLA 1S0JA 2SLIA 2W52A 4FPKA 2WT2A 4ISQA 4P14A 4XJUA 3WG2A 4XOGA 1BZWA 4FVVA 3FUOA 2HYKA 5H9RA 1ZM1A 3OYWB 1QDCA 5IK5A 2GN7A 3BOPA 4FOYA 1LTEA 2OVUA 5DUXA 5F9TA 5IK8A 4YGEA 1J1TA 2WLQA 3I8TA 1LOEA 3SNMA 2EXJA 5IK4A 1F5FA 2GNBA 4PQ9A 3B9CA 5T54A 4CRQA 1LHVA 1N1VA 2V73A 1C4RA 4YW3A 2ZMKA 5DG1A 5GLUA 1W6QB 5T5JA 1F9KA 2VY0A 2D6NA 3R05A 4L8QA 1CIWA 2TEPA 4FPEA 3AYDA 5GLVA 3V0BB 3B01A 1DQ0A 1Q8PA 2H0BA 2YV8A 3OY8B 1HDKA 3ZXLA 1SBFA 5GZGA 1LHUA 3QCWA 2R49A 1W6MA 1WBFA 1S0EA 2VU9A 2ZMLA 5E88A 2R1BA 2CY6A 4Y20A 2KM2A 1LHWA 5JOZA 1N1TA 3H0OA 3A4UA 3PVEA 2VW1A 4M00A 2A6ZA 1V6NA
chains in the Genus database with same CATH superfamily
3AKPA 3AXDA 1E57A 1ND2A 3LDBA 4YVWB 1NLRA 1NCRA 4AQ2A 5JZGC 2HLEA 2XMLA 1RUH1 1DG6A 4BQ2A 5DQ0A 4KGGA 1GZWA 3FL7A 1RL3A 4NROA 5EZWA 3BVCA 4M4RA 4BMEA 1S0FA 4P9IA 4Z2AA 4NWVA 1KS4A 1CAXB 2NN8A 3EXUA 1W9YA 3J7LA 3QD6A 4KU8A 5AC92 1YI7A 4JTNA 5M0TA 1E5SA 2XBO3 4M3CF 4PDWA 4CCOA 1S4CA 3PJYA 3ROUA 2OW4A 4OHXA 1PMHX 1YI9A 1ZNPA 4NPLA 3V64A 4SBVA 4F7ZA 4W6WA 5JLVA 2VTFA 1NXD1 1EYBA 4QKFA 1VBC1 4N53C 3UKTA 3C3VA 4JKMA 1RUC2 4AVTA 4FQZA 1NAEA 5K4LA 2BVBA 2FHRA 4YVSA 4DY5A 2VG9A 1UKRA 4AVBA 4AZZA 5B2GB 5C3RA 2VOVA 1IPKA 3OPWA 4M0HA 4SLIA 1PO22 1PM4A 4MGYE 1FNYA 5CISA 3LA3A 2VR4A 2W91A 1GNHA 4N8MA 1HXS1 1KITA 3EO6A 1RUJ3 2RDQA 3ZYBA 4XF4A 1HN1A 3P1IA 5GZCA 2QFEA 1QJEA 1O4YA 3DUIA 3I4IA 4Q4W2 1NZIA 1TMF2 2Z4FA 3B69A 1EP0A 2PHUA 5E1RA 5JZGA 3IIAA 2WFF3 3DKQA 4GULA 2EICA 4I01A 5FYUA 4E8CA 2DCTA 3PVOA 4PLMA 2YYOA 3O5SA 2ZGOA 4AVSA 2QDRA 4DPNA 1FYUA 5FPLA 1XE7A 5FMBA 4HVQA 2DBIA 5I93A 1OFNA 1QMJA 2ERFA 2HWB3 2BV4A 4Q29A 5I0RA 1JOBA 2VCMA 1SFNA 3FHIB 3T08A 1HN0A 3PIGA 2DFCA 3RI9A 2HWF1 1ND2B 2W08A 4N53A 1X36A 4QXHA 4IGPA 1YO8A 5A6QA 1JYWA 1NCRB 2WDBA 4BLJA 2VW2A 2CGNA 4TWTA 2ZBJA 3EBRA 1QHDA 3SCHA 3VHPA 1GZWB 2D5HA 2WNUC 4P9JA 3ACGA 1CVNA 1HB3A 5JI9A 3TEYA 4QX8A 4AGRA 1SEFA 2I2SA 5LASA 3ZFFC 2DWRA 3KZ4C 1X7NA 3QBQA 4I3PA 3T09A 3HR9A 1TME2 1PVC1 1Y4WA 3HQXA 5BNOC 3RSJA 1Q43A 3CBNA 1W2UA 3H1WA 1HIXA 3N7LA 4XFFA 5LWBA 3BALA 1IS6A 1WD4A 4AEMA 3DYOA 3ZYPA 3AZWA 2LUWA 2XVGA 1I5ZA 4BQ4A 1C28A 1AJOA 1K42A 3EJKA 2HWD1 1FATA 4YVSB 4CE8A 2AYHA 4FOQA 3EHKA 3BB6A 1RTVA 3MO4A 1BKZA 4QB1A 3B02A 4XHBA 3WQ1A 3V56A 3B94A 1JYVA 4QPWA 3NKGA 4NN0A 1PK6C 3LCPA 4H14A 1UWWA 2G9ZA 1PNFA 4Q8LA 4CPBD 1J3PA 2VXRA 4BYYA 3T2QA 5KC6A 3CU7A 5FZFA 5JWPA 3KWVA 2VQAA 2VVEA 2WAOA 5JZGB 3N7MA 2K2SA 4IETA 4CU6A 3AL6A 2GAUA 1OUXA 2WNUA 3KT1A 1AZDA 1UIKA 1X8EA 5FQ0B 5IATA 1UL9A 5I91A 2FZ2A 5CNAA 5LBEA 3ZFFA 4ES9A 4A7ZA 4L0PA 1ZBA2 4GMP3 1QJZA 2OXBA 4JV4A 4QQHA 5LBCA 4YM3A 1Y7BA 4LBJA 5T5PA 4QPGC 5ABJC 3HBKA 5K0UC 4R4XA 2ZGQA 3HNYM 4YG6A 1G9BA 2ZXQA 1PZ7A 4FOVA 4D6SA 3ABZA 4XUPA 4HMZA 1XB9A 1V00A 1LKNA 4V1PA 1OFSA 1MVQA 1VBE1 3UK9A 2RR13 5ACA3 3MIGA 5I8SA 2Y60A 5LK5A 4BJ0A 2Q8EA 3H9AA 3MICA 2DVGA 3OTFA 4OHZA 4MADA 2ATFA 4X8PA 4YW5A 1WMFA 1FI2A 2JB4A 2XKPA 1GWLA 3Q8BA 4XJWA 4PBOA 2JB8A 3AX4A 4LHKA 1UPIA 1YIPA 2R32A 2JDZA 1QH7A 1QDOA 2ZX3A 3U75A 5FTTC 5C33A 2F4LA 1VRH3 4OZOA 5JPNB 4JTOA 1PK6A 2PA7A 3RQ0A 3TN93 3ZXFA 1DQ4A 1Z7S3 2D3RA 3B00A 2V4VA 1W03A 4Q26A 1BEV1 2C1FA 2RMU2 4AHWA 2EXIA 3DPRC 4XETA 4YG3A 4DY3A 4FPFA 1JZ2A 2PLV1 3KD4A 3D0JA 1KDMA 1Q5OA 4Y22A 1DYPA 1SDWA 1W06A 2GNTA 3N7KA 3WSOA 1I3HA 5F5QA 3GYDA 4GH4C 2OKXA 3WP3A 5A7QA 2ZS6B 4CEWC 5HXMA 2RV9A 3B3QE 3UJOA 5ABJA 5K0UA 3H8RA 1HW5A 1UAIA 1UX6A 1LULA 1HRI3 1W6QA 4U2AA 4XFGA 4BISA 4DUXA 1AYN1 3T1MA 4XJAA 2D6OX 1AR93 4MXWB 1CGPA 3K4DA 2IWGB 1R091 4XJ8A 2DCZA 3PUIA 4NHLA 1QY4A 2ZGPA 4GB32 4GKYA 5FZ3A 3AJYA 1Q8SA 1RUD1 2YGLA 4XTMA 3KB5A 1OA4A 4JX0A 5FZHA 3PDQA 4LKFA 5JI7A 4Y20B 3VBRB 4EN6B 5EXOA 2YXSA 1GU3A 1RUF3 3ZXJA 3A21A 1RC6A 2Z42A 3HNBM 1JTZX 4HSJA 4BMBA 1FV3A 1RXGA 3BODA 1GV9A 2JEMA 1UN1A 3USUA 1ENXA 4U36A 5F32A 5FPXA 4XBLA 4UFLA 2VZOA 3A23A 5HV4A 1VPHA 3DPRA 4UFMA 2YBPA 1GP5A 1X9PA 1RVF2 4MHRA 4QM8A 4P9XA 1L7RA 4XTPA 3VLBB 4CPBA 5FPVA 3RWNA 2IXKA 5C3PA 1P8JA 1ZYBA 2WINB 3RMYA 2JECA 4QM9A 2Y0IA 3S5AA 5DAQA 1R64A 2VMHA 4IE7A 4GH4A 4KWJA 4Q5OA 5FFOC 4CEWA 2ZABA 1Q8QA 2GH2A 5FZCA 4K6BA 1IG0A 2VUAA 2CV6A 5J7MA 3LD8A 3ZX7A 5T5OA 4HN1A 3VD3A 4NR1A 1LOCA 2LALA 4YSFA 2RHPA 4YM0A 2HEYF 3AFKA 5F3CA 1AR62 4L9BA 3P3PA 1O59A 5CFDA 1C1LA 5G04L 1PK6B 4LR4A 3BTZA 4BPZA 2H6CA 1V9U2 2XHNA 1UMIA 4HANA 4UI9L 3WUCA 4UWDA 1NY71 3AC0A 4LORA 4LJHA 4CUGA 4AFMA 4AI3A 3IT8A 3PUAA 4XFAA 4I30A 4KH9A 1ZVFA 4Y22B 3VD7A 4JDMA 5I0UA 2ZGNA 4AEDB 4AHXA 1N3OA 1OH3A 2RJKA 3D82A 3JQWA 4Q4V2 5C3SA 4W50A 4ZS3A 2PAKA 1RXFA 1VR3A 3AYCA 2EAAA 3DYMA 5ABJB 3GNEA 3IDCB 3WUDA 1GWKA 3LF7A 3DF0A 4YW4A 4LULA 4D7SA 3N4MA 4K1ZA 2W46A 2ZPXA 3KV9A 2E9QA 2X5IC 4LA3A 3FHQA 1C5HA 3POWA 1EAH3 2AR6A 3A0KA 1DQ1A 3SH5A 1H2MA 2ZGRA 4XJ9A 5D2AA 3RZZA 4IV1B 5FPAA 3E6CC 5I8TA 3WF0A 3LEIA 1LGCA 3K2OA 1PO11 1DZRA 3ZIXA 3WLUA 2YU2A 1LOAA 1J3RA 5J09A 2XPJA 3HN3A 4FTBA 1S2EA 1OA3A 2HH9A 4XILA 4OUEA 1ZRFA 5FBZA 4KU7A 5FJHA 1ZA4A 1AR82 5FUIA 3IKWA 4QPIC 1ONAA 4NIHA 1RUH3 1VBA2 3RG0A 4B4RA 2XBO1 3DEMA 4V2WA 2FDGA 1V6MA 3KSCA 1REDA 4FOWA 1GLHA 1LOGA 1PGW2 4AXOA 1YRZA 1KS5A 5CBLA 3U4SA 2AENA 3NAPC 4X8NA 1KEXA 2XJRA 2WWJA 2BTVC 4D69A 4YW2A 1J84A 3AYEA 3AL5A 3ES4A 3HOBA 3LIGA 3RZLA 3IM0A 3LPFA 5CKMA 4BIOA 5GALA 3T1LA 3I59B 2VMCA 2IC1A 4QHBA 1KJLA 3T0BA 1OOPB 2DBNA 4OYUA 5C71A 2D44A 5ISLA 2N7GA 5GZFA 1UYXA 1LGNA 3APBA 3OSDA 5CFDC 2X5IA 2BU9A 4MHUA 1U5IA 4COZA 4EZ4A 3L2YA 1V6KA 4AVAA 4HKWA 2JG8B 2P3IA 2W9XA 1AR72 3M2MA 5FZ6A 1HXS3 3N7JA 4AI1A 2QZ2A 4CP2A 5J96B 3JBG1 5D8AC 1AL21 4AEJA 5F8PA 3VUOA 3VD5A 4Z2WA 4LBQD 4AYUA 1W0NA 2A1XA 4DUWA 1CAUA 1JYCA 2ZHNA 2ZGSA 3IDAA 3MW4A 4YW7A 5EYXA 1DLLA 4BCUA 5CFCA 1UKGA 2OT7A 3CJIC 3LOBA 2V5YA 1F5JA 2Q5TA 1CAVA 2VECA 5E89A 5JOWA 2UY8A 4GMP0 2HWB1 2XJQA 5FY8A 4N90A 5FXWA 3DXTA 4UW6A 4BK4A 1RUE2 2HWE1 1F4AA 3NAPA 5CVRA 4XQ4A 1ULPA 4FQ4A 4NHXA 3MIDA 4K40A 1KGYA 1W8HA 2O8QA 4PLNA 4FTEA 1R081 3BN6A 2X8KA 3WF2A 2G9GA 2XR4A 3WP4A 3F95A 2BP6A 4AG4A 2VH9A 2HWF3 5A3PA 2X10A 5JPMB 3OBRA 5A7OA 2B7YA 3EB7A 1XYNA 3TAYA 4CUAA 5BNQA 4WVVA 5LCWL 5DDJ2 1O8SA 2JX9A 1EV12 1NXMA 1S0IA 1ULDA 2BWCA 2XLGA 3IAQA 3NNMA 1DGRA 3O0WA 4FXKB 1LODA 3NVCA 3T30A 2DU1A 4IEUA 1GWMA 4ORFA 4AFAA 1NCQC 3M3OA 3HQRA 1XE8A 3K3OA 4FFFA 4RQPB 4YW6A 2Y6JA 3CZJA 1WD3A 3NRUA 3UKNA 5F1RA 1RGSA 5LA0A 3O1SA 3RJRA 3ZN4A 3HWJA 5J36A 4CYDA 5D8AA 3KVAA 3N36A 3ZSJA 4DINB 2QZ3A 2VM9A 5LEKA 1ASJ2 1PVC3 5HBAA 2YZ4A 4XC9A 3I3DA 4WZCA 4FPLA 3WG2A 4ISQA 2W52A 2WT2A 1ODNA 1MQTA 3K46A 4XUQA 3CJIA 4XF3A 5H9RA 2XH6A 1ZM1A 1H8TC 5FYHA 1ZRRA 1AYM1 1QJY2 4FOYA 3ZPOA 1OT5A 2OVUA 5F9TA 5IK8A 4AI0A 3LEMA 2HWD3 2WLQA 1V0AA 3W21A 1H6XA 1W9WA 2BUKA 2IXCA 2X5IB 4N43A 4QDRA 3ME2A 2GNBA 4PLOA 3ZSEA 1LHVA 3GDBA 4IEXA 4YW3A 2ZMKA 5DG1A 3LQCA 5GLUA 3KHCA 2E7AA 1GMMA 3AFGA 1ZBE2 4FPEA 4NRPA 4RHV1 3AYDA 5GLVA 3V0BB 3B01A 1DQ0A 4X6QB 4LE3A 2BZDA 3OY8B 2WR9A 5A7PA 4BE3A 4IL7A 1CAUB 1H4HA 1RMU2 2WLPA 1US3A 4K7JA 5CFCB 1XC6A 3QCWA 5C4WB 3WNKA 5FZLA 2R49A 3U11A 1W6MA 4YNIA 1NCQA 2WS93 3P3NA 3ELNA 2VU9A 1CAVB 1UXZA 2WYFA 2ZMLA 3NQHA 5E88A 3BPZA 4EE2A 4EZHA 5JOZA 1ZZ6A 2WA4A 5BUVA 4QD2A 3A4UA 4IV3C 1YCIA 3NAPB 3T3YA 1UU4A 1Y9QA 3WW3A 3IBMA 2FDJA 2DCKA 3BTAA 3ILNA 4QGMA 2VZ1A 4LO7A 5KXDA 2CL2A 3POIA 1S55A 3HMYA 1SZBA 4L2NA 4OUSA 4YLZA 4B1MA 1VBE3 3FLRA 2RS12 4J25A 1HRV1 1VBD2 1WA4A 5BPXA 3TNQA 1H8TA 3FWEA 2O0OA 2O1QA 2UWCA 3KV5A 4XDOA 4BQ1A 5E16A 1NA1C 2LTNA 3LB9A 1UZ0A 4Q4X2 4HFSA 1W9SA 2IXLA 4LK6A 5FY1A 1UYYA 5J1XA 4FPYA 4CCLA 3CEWA 3KCYA 5FY4A 2LM3A 1YQ5A 2R062 2CNAA 3M7AA 4LEJA 1VRH1 4CCCA 5C6CA 1H0BA 4KWLA 1CJDA 2VULA 3NV3A 4UFHA 4XCBA 3RZKA 1YFWA 1BK0A 4HPKB 2VZVA 4I02A 4LNVA 4C1XA 1O5UA 4Y33A 1LCLA 4QKBA 4YZ4A 4NAMA 1ZZBA 3ZFEB 4Y1XA 1PGL1 2DUPA 4HVRA 1QJU1 2WZR1 5FZKA 5HI0A 3I49A 1OHFA 1BEV3 5CKNA 3ACHA 2AH2A 1G6NA 1ENSA 1AJKA 1B35C 1RUI1 2JENA 2KD7A 2VTXA 1MQTB 1D0HA 2PLV3 2W1WA 3ALQA 5IFPA 3IPVB 1CWPA 4O7XA 1WUVA 5L9VA 4BOWA 5SV8A 1G9DA 1FV2A 1AVBA 1BMV1 1DP0A 3AZXA 3FN9A 4CXYA 1HRI1 2QQIA 2DV9A 2UU8A 4IV3A 2VUJA 1REFA 2IUWA 2WO2A 1QXJA 4NHMA 1UU5A 4N43B 3K4AA 4NVPA 4PI2A 1PIV2 3M70A 4PI0A 2VZSA 3D5OA 1AYN3 1GZ9A 3DGTA 5L19A 2WRAA 5A6YA 4DMIA 4I09A 3TRSB 3OG2A 1CQ9A 2QJVA 5FAXA 5FZ1A 1R093 4B1LA 1SLTA 4JHTA 3WDVA 3J8F3 3ZDSA 1GQHA 1QQP2 1RUD3 1NA1A 2XXZA 3AMHA 4Z8BA 4BXSV 5KWRA 2EXHA 2YGMA 2RDNA 3ZOIA 2R072 3WG4A 1JH5A 1RUNA 1YFXA 4E4ZA 5JXGA 3GCXA 1HB4A 5FREA 2F6BA 4KG8A 3SQOA 4RN5A 1KD7A 4RYDA 3T0DA 4E4HA 1CONA 1YQ6A 2MEV2 2QNKA 2UYAA 4RFRB 1XE0A 5GKAC 1US2A 3WW1A 5LBFA 2LW8A 1BYHA 4A41A 4P5HA 5LRRA 4BQ3A 3ZYGA 5FMCA 4XXPA 3FLTA 3KLSA 4FPHA 1IS5A 3LDKA 4NRQA 3VBUC 3E5XA 1CPNA 1Q8OA 3EYPA 4YGCA 5F2SA 5C70A 4JKLA 1DQ2A 3OUJA 1YNAA 2GALA 1B35A 3KGZA 5DXDA 4QU2A 1XXNA 3ZDVA 4XAEA 1OQDA 4FXGB 5IW0A 3P5BA 1SDDB 5T52A 4LBQB 1E5IA 3POBA 1JZ6A 1J83A 1XNTA 1D4VB 1QJX1 2F17A 3VBHC 5A3LA 1FPN2 4MGZE 5JIUA 1UMZA 1AHSA 1C8M2 2W68A 4XF9A 3UV9A 3RZMA 5JR7B 3RNSA 1NLSA 2JDMA 3RRDA 2BNNA 3LE0A 3NNFA 3VDBA 1YQ8A 2JIGA 5EQUA 1R1A2 3GXUA 5DUWA 4LMFA 1N1SA 2EAKA 4WM8C 3EMRA 4IW3A 4UF0A 5FZGA 5JSPA 1ZRIA 4G4FA 4OMCA 1RJ7A 2ZHLA 2JD9A 1XU1A 1VB2A 4QKNA 4Y26A 5FYMA 4CCDA 2YC2A 2GP5A 4DZGA 3POGA 2QQWA 2VCBA 2XONA 2RVAA 4LHNA 4M0NA 1CX1A 1IQDC 3BGAA 5KC5A 5HPOA 4Y1VA 2WNVB 3H7YA 4NUBA 4CXWA 2Y38A 1K45A 4EWDA 5CIRA 2ZOEB 1U5XA 2WNOA 3HVDA 2DVDA 2L9LA 4XBNA 1S0CA 3AVRA 5AC91 5J37A 3D6EA 5FKCA 2DDUA 1OD5A 2A6XA 1LAJA 1AUYA 2XJTA 3VBUA 4R9BA 3ZLIA 1JODA 1HQWA 2WA3A 4GJZA 2XQRA 3BPSA 1Y3TA 4AQTA 2R6QA 4Q8KA 4PCRA 2E63A 4ATFA 1WLTA 3OF1A 5A7WA 5TSWA 5DAWA 4KNCA 3VBHA 1PO13 1T2XA 4ATEA 1IQAA 2A3WA 1RUC1 3ETPA 2VAUA 3PVBB 3FE5A 1J3QA 3Q8FA 4R4ZA 1K5MB 3BCWA 4QX7A 5T3NA 1QKQA 1WCSA 1JHNA 5JR2A 5ANNA 3AXEA 4FPCA 1AX0A 2RS52 3WNLA 1PO21 5L7OA 2G19A 3ZN6A 2ZEZA 3IDEA 1W8UA 1UOFA 3GZAA 3KCXA 3WG3A 1V6IA 4BWOA 1HV0A 1K12A 1T6GC 3B7MA 3CZUA 1FOD2 4UXAA 2W47A 3CQOA 4Q4W1 2J1SA 1BXHA 2RS32 4JAAA 3WXPA 4CUCA 1FT9A 1QNYA 5IVFA 3H3ZA 5A3WA 3W59A 4DEVA 1B35B 3WDWA 2GC1A 3FBYA 4UW3A 4KGQA 2YFZA 4LOTA 3WX5A 4W6XA 1W28A 4N7IA 1SCSA 4CDQB 4C90A 3E1F1 3VDDB 3AZZA 4ET7A 3WDYA 5EPAA 5FZAA 1LENA 4INDA 1VAMA 1PM7A 1VAVA 2DYCA 1GANA 2UURA 4A4AA 2V5DA 4YZ2A 4K8FA 4AI2A 3BUCA 1DDLA 3VBOB 1WLDA 2E26A 5KXEA 3NJYA 2HBUA 5EP9A 4L11A 4RS5C 4UF0B 2XWBB 3CIHA 5FYBA 2CU5A 5FP7A 3K51A 4COVA 2DF7A 1WBLA 2AEZA 3SXWA 3JBG3 1AL23 1CAWA 1TEIA 2LRPA 3HNMA 2FCTA 5CEHA 5FOBB 2JE8A 1DGLA 4QGNA 4MGIE 3MEPA 3PMSA 1PZ9A 2JE7A 4RGAA 2QDNA 4ASKA 3VBSB 4A45A 1O5LA 4DOUA 3ZMNA 2BGCA 2R7EB 3PHMA 1OPOA 4IERA 5T55A 3ACFA 3HN1A 3LGRA 3VGIA 2DVFA 3WHTA 4P08A 3UESA 3OEAA 3GJBA 2HWE3 1TME1 1VALA 3ZSMA 2EXKA 1YIFA 1SFPA 5F6KA 1F2NA 2WQ4A 1YJLA 2RDRA 3SEPA 3WQ0A 5F2WA 4KBZA 1R083 1GZCA 2XHKA 4CCKA 1W8ZA 4RFT0 2PYTA 4YRDA 1DYOA 1WLWA 3TB0A 1VBC2 5LB6A 3TOJA 3VBHB 5FR3A 4M3CA 1R1ZA 2BGOA 2D3PA 4QB2A 1SMVA 4FPOB 4ZKTB 4N9HA 5FO7B 1MEC2 5L7OB 3K75B 3TNPB 2R042 1UD1A 2VGDA 4MGSA 2UWAA 4RS5A 5IT6A 2A6VA 1XBFA 4R52A 3OUHA 1YUDA 4PDWB 4LO8A 3V0AA 4LTAA 1X9TA 4LIUA 5FMOS 3OB8A 5J48A 4N7UA 5FOJB 4Q1RA 1FMD3 1TVGA 1XNAA 3TWIA 1ZZ7A 4DFSA 1XNDA 3MZHA 5KXCA 5EHDA 4AFCA 2KA3A 5JMOA 2FCVA 4CDXC 5FXVA 2A7AA 2XJSA 4D7YA 2B9VA 5E6HA 4CEYC 5FYVA 1F4HA 1AYM3 1JXNA 1W0OA 2GMEA 2WZPP 4CCNA 3AJZA 4D0QA 1HJFA 4NHKA 5FO9B 1WMXA 2VQUA 3KF3A 4ZPIA 1SHWB 2DVAA 5IYYA 4EV0A 1APNA 2JDUA 3R0RA 1IGOA 1BBT2 2YY1A 3R4DB 1L3JA 4ZY9A 4IESA 4RHV3 1XOYA 5CB7A 2EIBA 3PMEA 1STMA 4QXCA 4L97A 4LOSA 1RIRA 5A7NA 5B4NA 2HYXA 2WS91 3T2TA 1VMFA 4W65A 3NV2A 4P9WA 4KQ7A 4NPMA 5LEJA 3JB4C 1GR3A 2C26A 1IZ3A 2OQ6A 2RG4A 2YMZA 3LPGA 4HG6B 2D93A 4UFIA 2Q30A 3S7EA 3VHOA 3GZTB 1W6PA 1MS9A 3FC0A 1DQ6A 4BQXA 3G7DA 5F37A 3D4KA 3C7EA 2Y6FA 3MPBA 3MV11 4QWNA 3Q9OA 2FCUA 1MS0A 5BNOA 2RMU1 1HB1A 4QB6A 4AQ6A 3I2KA 3E5UA 1LEMA 3PTYA 2PTMA 4QX5A 2GC3A 2ENRA 5FZ7A 4N53B 4W8JA 4Q4Y3 5BNNC 5KXBA 4WM7C 4BLIA 3J4UH 1VMJA 5AVPA 3VDAA 4CDXA 1HRV3 4LQRA 3T4HB 1UOGA 4RL7A 4CEYA 4HOOA 2ZHKA 1H1IA 2C5DA 4BQ5A 4UAPA 3ZXDA 3VL9A 1IOAA 2LROA 4TN7A 2VMIA 3POJA 3SH3A 5EIYB 1MACA 3OBTA 1ULGA 4XMAA 3HEIA 2AUYA 4G3YC 4OI2A 3ZSKA 4OLLA 1YQ2A 3AP7A 3L9JT 3NMBA 3O7OA 2ZX0A 4GB31 2G1MA 4XDPA 3V0AB 2YB7A 1PMJX 1NOVA 4LO4B 3I2DA 3FBMA 1TZOA 2WBKA 1SCRA 4S2HA 1CZTA 1WW5A 1QJU3 2CDPA 1XRUA 2WZR3 3PU8A 4AAPA 4LITA 1OI6A 4EJRA 5AFEA 1RUI3 1YQCA 4RD7A 4E9KA 3H8UA 1MVEA 2BJSA 2W39A 1ACCA 2WT0A 4QPGA 2J1RA 5A33A 4QU1A 5C9AC 4EROA 3MF9A 1JYIA 3AB0A 2VCAA 3CDZB 1LOBA 1POV1 1SPPA 2BPA2 1PGSA 1QIQA 2JDPA 1O3TA 1O7FA 2EIEA 4H7MA 2Q8DA 1RVF1 1Z0HA 3UGFA 3ZMOA 4I2OA 3J8F1 1MPXA 1ST8A 2XB6C 5BNNA 3UYJA 4WM7A 1X8MA 3FZ3A 4D6RA 2JDHA 5CZKA 3E5QA 4XUTA 1SBDA 2OZJA 5IHRA 1GOHA 4M3CE 1LR5A 1QF3A 3KCCA 2P2KA 2VZ3A 1ALYA 2BFUS 2WNUB 3CKHA 1LEDA 4AOCA 1HLCA 2ZKLA 4XPVA 1ZRDA 3I97A 3ZFFB 1O3RA 3CF6E 3MLLA 4Y4RA 4D3WA 5JXIA 5KR7A 2OS2A 1AR61 1MS5A 1H8VA 4FT8A 5FPBA 1W6PB 2YUEA 5FYZA 3JD72 4XQDA 4E4DX 5C7GA 3MHZA 4K20A 3ZXEA 5FP3A 2ZCWA 4QHOA 1RUOA 5BNOB 2I74A 3WP6A 2GP3A 3MYXA 5LRSA 2DUQA 3GHMA 2DTYA 5JOXA 5B4XA 1A34A 2GSYA 3C7GA 1UU6A 3PJQA 2YFUA 3M3IA 1JYXA 4CDXB 4Q4V1 3AP5A 2CAUA 4Q0QA 1OLMA 5C9AA 1QJX3 5I0TA 5FBJA 5KHGA 5A70A 1UXXX 4YFZA 1W8NA 4JZRA 2ZKNA 1WW4A 3O1VA 1JZ3A 5JXHA 1A8MA 3GJAA 2XLAA 4EWAA 2DURA 3OPTA 4P14A 5FPUA 4FPKA 4XACA 5DAXA 2Z5WA 2VVDA 2XUEA 2RM22 4XOGA 1XYOA 1COV2 1RUG2 4B3NA 4GZ9A 1JZ8A 3WNNA 2Q4SA 5IK5A 2GN7A 3BOPA 1LTEA 5DUXA 1UOJA 4JGZC 5K9YA 1AR81 4LHLA 4EQVA 2EXJA 4GIQA 5FYYA 3U78A 5IK4A 1TG7A 1RHI2 2CHHA 1VBA1 2VZTA 4CRQA 5A1AA 1N1VA 3LIHA 2V73A 3LA2A 3MUZ1 4IE6A 4GWIA 3LAGA 4QPGB 2CGOA 2P5BA 5A33B 5K0UB 3WD5A 1W6QB 1F9KA 3H42B 2D6NA 3W20A 4AW7A 5AC93 2I45A 4HN0A 1D4M2 3PURA 4MLOA 2P6HA 1VBB2 3WW4A 2QQJA 2H0BA 1Q8PA 1XPWA 2WO1A 4A42A 4BU2A 2JDYA 2VO5A 1LHUA 4QKDA 2QBXA 1MZFA 4DXZA 4C91A 3K4ZA 5BV6A 1WCKA 3NJXA 1WBFA 1J59A 5JSOA 4KI5M 4IEYA 2KM2A 1JI6A 1LHWA 2D97A 1RUC3 3H0OA 1I6XA 2VW1A 4M00A 2A6ZA 1V6NA 1H2KA 5FZOA 1CZSA 3IIIA 3JZVA 2HWC2 5GLZA 5DMYA 5D1IA 3VZJA 1WLCA 1E5RA 1PO23 1W8FA 4Q27A 2ZX1A 1S0GA 1OBNA 1LOFC 1O8PA 3I7DA 1AR71 3USUB 2R0FA 4COUA 2D6LX 2ZX2A 3DPRB 3UT0A 2Y6HA 4Q4W3 2QQKA 1TMF3 1UZVA 4JKKA 3WW2A 4H2AA 4JGZA 4ZONA 1VMHA 5HCBA 4Z82A 3WNXA 4ZZ5A 3TEZA 4CEWB 4GH4B 3UL2A 3THCA 2XJUA 2OQ7A 3ITQA 4O65A 3R4SA 3FHAA 5ERLA 5I8YA 2DCJA 5HCAA 2VD7A 1UMHA 4PHZA 4AEKA 3I3QA 2VMFA 1W05A 3OBZA 1SACA 1GNZA 1WMDA 5F7UA 4AF9A 5DZFA 1C5IA 1RUE1 4E4SA 1XSRA 3ZFGC 3UJQA 1UF2C 3W5MA 3C7HA 3FX3A 4HETA 3W9AA 1NKGA 3A7QA 3O1RA 3IMMA 4GA9A 2MHFA 1LJ7A 3D0SA 1OQ1A 1W9TA 2NLRA 2J1VA 2OPKA 1WWYA 5DAVA 2W1SA 1SLIA 1HX6A 2Z69A 5T50A 4CDUC 4ZZ8A 3I2OA 4NOTA 4UOJA 3O1UA 2EIDA 2P34A 4AGGA 2NP0A 4LKDA 4QPIA 1J1LA 3QACA 5DDJ1 3LA7A 1EV11 1W99A 3POSA 2E6VA 2WO3A 3I3MA 4CDWC 1LU2A 1CPMA 3WF4A 2IVJA 4AVCA 1H9WA 3O0VA 2XBO2 1DGRN 3LFIA 1TE1B 1ZA7A 5L9RA 1LOFA 4FCAA 1ULFA 4IEOA 2ARXA 3J7NA 3TYJA 3KM5A 2VUCA 2D5FA 2Y6GA 3SEEA 4K1YA 4EN9B 3OGGA 5FZEA 1XNBA 3IDBB 1I1EA 5HCHA 2JDKA 2ZX4A 2BW8A 2JE9A 4XF0A 5FZ0A 4M01A 1OD3A 2VZQA 1K5JA 5IVEA 1H6YA 3VKFC 2CWMA 1TME3 1ASJ1 2RJLA 1O4TA 2VOXA 3N9PA 1IG3A 4RR3C 4Z92B 2E51A 5JMCA 2WWUA 4Y5SA 2FDFA 2EVXA 2VBPA 2W92A 3WDUA 3QH6A 2W1UA 4NRMA 4NAOA 1KQRA 1OLME 1A6CA 1QJY1 2PHXA 4UBHA 2Q1FA 5CG9A 3ZFGA 3FFZA 2YDEA 1RUJ2 4BH9A 4GALA 1H2NA 1QGLA 2ZEXA 5FMOL 2ARAA 2K46A 1PX4A 2HJIA 2ZGKA 2A6YA 4G9SB 1Y9MA 2H6BA 3I2JA 4E2SA 3HBZA 1ZBE1 4CDUA 3VD4A 2WFF2 4FPJA 1FMD1 4Q2FA 5LY1A 2VBDA 1RMU1 2VBBA 4BQWA 1MZEA 2NMNA 4LK7A 4CDWA 5FDBA 2AEYA 4AQSA 3T2OA 4XZPA 2PHDA 3I2HA 2HWB2 3GF6A 2D6KA 2QQNA 1QXPA 1ZBA3 4LKEA 2ZTNA 2PXJA 4URTA 3VDCA 4AFDA 5HV0A 1Z78A 5GM0A 2K0GA 3PNAA 1QJFA 4RR3A 4Y4YA 2YC0A 4JDNA 2PQQA 3NNGA 4S2GA 2OYZA 5FUNA 2WSUA 3A22A 3K77A 1W8WA 2RS11 4KWUA 2ORZA 4YYOA 1H1AA 2B39A 4JGYC 4Q4X1 4CTEA 4QPIB 3E6DA 5EV7A 2QQVA 4JCKA 1CESA 3CLPA 4LE4A 2XVKA 2AACA 2R061 5G05L 2NYYA 4OQ8A 2JDAA 1W8OA 1KFUL 1OA2A 2ET1A 3RDIA 5JOYA 2WIIB 4OI1A 4C0HA 2ARBA 2FBEA 2DCYA 3NO8A 4XUNA 4WVMA 4CU8A 5FZMA 2BYVE 2E7TA 1JMUB 3ENRA 3ST7A 4ZU5A 3ZVXA 5FZ8A 1W3XA 2QQMA 2PQSA 1U5YA 1ZZ9A 5FKBA 2D98A 2RMU3 4Q4Y1 1YJKA 1JOPA 1G9CA 1ENRA 4XHXA 1ZRCA 1RINA 4BIFA 1C3HA 4JQTA 5BNPC 3FMGA 3GHNA 2XL9A 3G6JB 5GZEA 5BY5A 1I5PA 4FO9A 5CFDB 2X05A 3VZLA 5A80A 4HONA 2JG9C 5IAVA 4NWWA 2BDRA 1DZQA 1PIV1 2Z79A 1NT0A 4LIVA 2P6CA 1U12A 3RZJA 1SBEA 3H1MA 3QLQA 4PIXA 5FCCA 3AM2A 2VQTA 3N9QA 4XVHA 2FDHA 1CJPA 1Y9GA 3AMNA 4FAGA 3I2IA 1UOBA 3AP6A 3NL1A 5D8AB 4GB33 4D7TA 1QQP1 3POEA 2ZZQA 4FPGA 4IEWA 5LK7B 4JGYA 4MX3A 3WEZA 2R071 5JCTA 1JU4A 1EUUA 2Y8KA 2HEVF 2JKBA 4HKLA 1D2SA 3CJIB 1GSLA 2ZAAA 1FNZA 1GYKA 5FLHA 2V72A 4WV8A 3WOGA 2MEV1 2VJXA 4J6GA 2W2IA 3KT7A 1TQ5A 3WNPA 5J3UA 3MFCA 3D3AA 4B7KA 4ZS2A 3U14A 1WMEA 4EN8B 1DGWA 1OSGA 5ACA2 2RR12 1W3VA 5H9SA 1OQEA 1POV3 1QEXA 1GBGA 2I07B 2W3JA 4K21A 4P9LA 4YZ5A 4AR2A 3CHXA 1RVF3 4CA9A 4R9DA 1BJQA 4D8MA 5BNPA 2H0VA 3SKVA 4E27A 2IVIB 2BFUL 5IVVA 5DAPA 3RWKX 3ZYFA 5BYNA 1FPN1 3AKSA 1EUTA 4EWEA 4XFHA 3QOPA 5F5CA 2JG9A 3ZO0B 1DLCA 1JN2P 1NCQB 1W6MB 1A8DA 1I9RA 4OCTA 3WF1A 1VRH2 1XSQA 2B46X 3TN92 4MGQA 4UBGA 1UY2A 2R30A 1Z7S2 2WYSA 1R1A1 4EN7B 1NE6A 5C8WA 1O3QA 1AR63 2J1UA 1IPJA 1N3PA 3ACIA 5E8AA 1CN1A 1V6LA 2WSVA 5LA1A 4PIZA 5FY0A 3LSDA 1V9U3 1N1YA 3AVSA 1CR7A 5LA9A 3I3EA 2FMYA 2ZGLA 1GOGA 2WZEA 3WDXA 2NMOA 1H8TB 3TEWA 1FAYA 3MLJA 1W6OA 4Y24A 1SLBA 2D40A 3PTRB 4YM1A 2VOKA 1XQNA 1HQNA 4Q4V3 1HRI2 4XXAA 3I3BA 2W87A 4R8HA 5C3QA 3R4UA 2G4IA 4PJYA 2JD4A 1RITA 4AVVA 1AR92 1LU1A 1ND3C 2P4EA 3GBFA 4Y3OA 1KJRA 2JWPA 1WGPA 5A3UA 1HJGA 2WQ8A 5K7PA 2A5ZA 4R9CA 1J58A 4PIYA 5FXZA 2YG0A 4CU9A 1N3QA 3WINE 2VQ0A 4NE9A 5GLTA 3RZGA 4JRLA 3SLIA 2B42B 3OEBA 1ZZCA 4GWNA 1RUF2 3M1HA 1ULCA 2R0HA 1AXYA 1G7YA 3MPPG 3DN7A 3M3CA 1MZ6A 3O0XA 4DS0A 1UZZA 1JHJA 4L99A 2JDNA 2W1QA 5CG8A 2CGPA 4P02B 1O91A 4O61A 3QH7A 1AR83 4GAZA 4MUVA 2RS51 4OMDA 5AVAA 4H55A 3KT4A 5CAZA 2VZUA 1PX3A 5FZ9A 1QH6A 3LFMA 1VBA3 4XE9A 4IV3B 4GKXA 4CCEA 3VZNA 1MS4A 1REEA 4WZFA 4ISRA 4P5YA 1FOD1 2E32A 4YARA 2RS31 3WP5A 1W6NA 1OLRA 4AFBA 3MIFA 4UFKA 2XJPA 4HSLA 2GU9A 3NSTA 1S0DA 5IVBA 3POFA 1XYPA 3AP4A 2ZEWA 2TUNA 4BB3A 4D94A 4DRRA 1NA1B 3WZ1A 3EQEA 1QU0A 1KRIA 4QX0A 2NPIA 1QNWA 2C9AA 3OD4A 4C0BA 2AC1A 4CCJA 2ILMA 1BCXA 1DIWA 1NE4A 3NV4A 5D21A 2EALA 3OD0A 4LBKA 2VNGA 1ND3A 1Q56A 5DUUA 5H9QA 5FO8B 1JZ4A 2KR2A 2J1EA 2O14A 1DCSA 1W2AX 4WM8A 4MSVA 4GWJA 2VOWA 4H3WA 3LEGA 5F5IA 2XKOA 2Y64A 4XZUG 2QQPA 3RYKA 2B8MA 2Z2SB 3AKTA 4DEQA 1TMF1 1WCQA 1AR73 4NPRA 4OI4A 1LECA 3P6BA 1LHNA 2BRTA 3ZR6A 1W9FA 1NZCA 3NV1A 1UPSA 3WR0A 4OQ9A 3WF3A 2VMDA 5BXXA 3OGSA 3AP9A 1W6OB 3HQUA 4OHVA 5CKQA 2B9UA 1DZTA 5C8CC 3I2FA 2BERA 1ENQA 4W6YA 2A73B 1OH4A 1RYYA 4ASLA 1UX7A 1EAH2 2QQOA 1VLNA 1KXGA 2EIGA 2VZPA 3H3LA 1RUE3 3OYWA 1Q3EA 2X09A 4JRAA 3WV6A 2E7QA 4NIGA 1K3IA 1W0PA 3UETA 5I0DA 3Q8AA 4IE0A 1RB8G 1LESA 3K48A 4BQYA 3VB9A 1V6JA 3ILFA 3WQBA 2HEWF 2LS6A 1RUH2 2QE3A 1OVPA 1X50A 2QQLA 2Y6LA 1ULEA 3N3HA 1MEC1 5DDJ3 1AXZA 1EV13 3E6BA 3NNJA 3ATGA 2Y6KA 4FFHA 3T0AA 4UW5A 2R041 4NIAA 3ZPYA 4HXCA 4B29A 4Z1VA 1UY4A 3ZKYA 3FFQA 2JXAA 1MR5A 5IUQA 2HBTA 2OIIA 4I0AA 5IJRA 3VBUB 3PU3A 1W6NB 1SLCA 2J22A 2MPFA 4ZXKA 4URAA 1D0GA 1H4GA 3H50A 4YZ3A 4OVEA 5FZDA 1ASJ3 5EWSA 5A7WB 3NJVA 5FQ0A 1LRHA 3GALA 5C8CA 5JUVA 2J7MA 3RMXA 1DQ5A 1G8WA 1OMIA 4NO4A 2XGXA 1L7QA 2CAVA 5A3MA 1QJY3 3GBWA 4ZU4A 1SFYA 3NJZA 3O1TA 1ND3B 5IVCA 2VCCA 4ZHNA 3PUHA 4WBBA 3OOXA 5LATA 4WM8B 1UY1A 3ZN6B 2B4KA 5J98B 2QUOA 4BHPA 1NLQA 3S0MA 1G9AA 1UZWA 1HXS2 2BOJA 3ZYIB 2YBKA 4YPJA 2XQXA 2UYBA 1IS3A 1BBT1 4B4QA 1ZBE3 2PMWB 2F4PA 2CDOA 1SQ4A 2DUOA 3HPNA 1XU2A 3VBRC 4M4PA 3M3QA 3ZIWA 1RMU3 1YXWA 4LBMA 2RDSA 1VJ2A 2VXJA 4XW3A 1ZBA1 3VN4A 2BNMA 3VZKA 1S2KA 4WVWA 1S0JA 2SLIA 3T2PA 1BZWA 4Z07A 4CCMA 1BHGA 3FUOA 3UNPA 1GP6A 3OYWB 4JHZA 1X33A 3VL8A 1JS9A 1POV0 3ZN5A 4BXFA 1W2NA 4DNYA 4YGEA 3SHRA 4BZ4A 3W5NA 1J1TA 5FWEA 2BBAA 3I8TA 2HWF2 2IXHA 4S2FA 1F5FA 2Y33A 1UY3A 5FXXA 1YLLA 1S2BA 3ETQA 4DXTA 1W39A 2B5HA 2RS13 5T54A 1VBD3 1CAWB 3MFAA 5HXVA 4FFGA 2IXIA 4ES8A 3PUQA 4HLTA 4Q4X3 3MIHA 3R05A 5FK7A 1CIWA 1D2QA 4GQ7A 3IZOA 3M8LA 2BWAA 2IZWA 1HDKA 2R063 3LKJA 4IUGA 4MXWA 5JSRA 1W2OA 3JB8A 1SBFA 4UYBA 5GZGA 3KV4A 4LO5B 1AL0G 4XURA 4I3GA 1PVC2 2ZEYA 3SC7X 2R1BA 2OX0A 4Y20A 5FY5A 5JIAA 1RJ8A 1N1TA 3VBRA 4UFJA 5FP4A 3PVEA 3RI8A 3VD9A 3OJBA 4YGBA 3BTXA 3MF6A 5C8CB 1OPMA 3N9NA 1GICA 4M3CB 4AEDC 3VV1A 3H8OA 2HWD2 3TEXA 3MUY1 4ZU7A 4DO0A 5FWJA 1JZ5A 4OI0A 3B93A 4J1XA 3JXSA 2VPVA 4L92A 4H7LA 1AX1A 1OKQA 1UYPA 4YM2A 2Q8CA 1MS1A 3ILRA 3THDA 5C3OA 1GQGA 2OA2A 2D43A 4FP3A 1MZ5A 4MO3M 3RZHA 2XL7A 4RS5B 5EFUA 3SH4A 1POQA 1PIV3 1JUHA 2WKKA 2GDFA 4Y5Z0 2CTVA 1DU3D 1G9FA 3CL1A 2YPJA 3ON7A 4YGDA 3CNAA 4X6RB 4F3JA 4IV1C 1N47A 4K3UA 4KL1A 1YC61 2PAEA 4NIIA 3AYAA 3RGBA 3W58A 1QQP3 2XOMA 3Q8CA 2XDVA 4IEPA 5GLWA 2R1DA 5DN2A 1NG0A 1LB2A 2WS92 2R073 5EJZB 1DFQA 4E8DA 1O4ZA 1U0AA 1VAKA 1VIWB 4IE4A 4KG0A 3RPQA 3RVHA 4CXXA 4DQAA 4AI9A 1Q8VA 4Y1YA 2R16A 3URFA 2MEV3 4GD4A 4MVTA 2YPDA 4EN0A 3JD71 2WN3A 4RA0A 1D7PM 5KHKA 2QQUA 4KWKA 5DPNA 4QX1A 2XJVA 1VBE2 3BIWE 1JBCA 1F15A 5F3IA 3RYRA 4TTGA 1GQPA 4CSWA 4GWMA 5F3EA 3HIFA 2BGPA 3S5QA 1VE0A 2NQYA 4AEDA 2C9KA 1VRBA 2ZJCA 4IEQA 3KV6A 3Q8EA 2A3XA 2C0ZA 2ZACA 1FPN3 1GKBA 1OOPC 2E33A 2WABA 4QX2A 1YHFA 5L9BA 3X29B 2BBVA 1C8M3 2YHJA 2ADDA 3JQXA 4XJZA 1W8TA 4B7EA 1W90A 3ZXKA 4NJ4A 2GMMA 2IFRA 5A3NA 1R1A3 1V9U1 2JG8C 2WL1A 4IV1A 4LBNA 3RFRA 5FYSA 4COYA 2RM21 2XWJB 1BEV2 4IEZA 5GJ6A 1COV1 4XBQA 1RUG1 5IWFA 1TNRA 4BM8A 2BNOA 3WY6A 2GC2A 1PNGA 2G9FA 2PLV2 1OF4A 4DXRA 3VHRA 4MG2A 1CD3G 1XNCA 4QQPA 4I0WB 4W4ZA 3VKOA 2RJ2A 3MDPA 2NM1A 5A1FA 3J9SA 3ZSLA 3AKQA 1RHI1 5DZGA 4CEYB 3O12A 4QAWA 3SCGA 2BQPA 1EPWA 5KHHA 3MW2A 1F31A 5L73A 3AMPA 3AZVA 4QPYA 1OKOA 1AYN2 2X29A 4FTSA 5EJ1B 3OCPA 1D4M1 4XFBA 1M06G 1VBB1 4IGQA 1R092 1QXRA 3KHBA 1JOJA 4NMIA 4TSVA 1WZXA 4BDVB 4FBFA 2FDKA 3J8F2 2VTXJ 4Q1PA 1EPZA 1RUD2 3VKMA 3KMHA 5IAXA 3BKZA 3PLQA 3KVBA 5A6ZA 4RGKA 5I0SA 1UW8A 3VBFC 1OXCA 1C57A 1PVXA 3S7IA 2VOTA 5IVYA 3I59A 3I2GA 3DV8A 4MXVA 3WG1A 3WNOA 2B45X 3VKNA 4A6OA 2CWSA 5CA6A 4Q0VA 1OOPA 3PVNA 3UKVA 3H7JA 2XUMA 5DZEA 1OVSA 2VUDA 1HQLA 4Q0PA 3U37A 1OC1A 2AGSA 3GZEA 1NYWA 2HWC1 4HT1T 3MLKA 3LSEA 3N9MA 2A71A 2RS53 1HB2A 3INAA 3U1XA 4LBOA 4WVZA 2JG8A 4XYXA 5FY9A 1PGW1 2DFBA 2GN3A 4IDZA 4RQPC 1IPSA 3MBWA 1OUSA 1SLAA 1SPPB 1FOD3 1B09A 2RS33 1BK1A 4CVUA 3IWZA 5BNNB 2A70A 2VVFA 4WM7B 3GZUC 4Y5TA 4A7KA 5EYYA 4MGKE 3U07A 5C5UA 3OBAA 4B4PA 1CIYA 2GZWA 3M3EA 5GZDA 4D6QA 1JYNA 2PN5A 1HKDA 1QWRA 3NWKA 3CMGA 1DYKA 4UW4A 4CP9A 1WW7A 1MS8A 2D6PA 3VHNA 2GC0A 4XMIA 1NQDA 2C24A 4QDQA 4NIDA 2E53A 4XFIA 3WCSA 5HCFA 3HD8B 3A0NA 4MOAA 3MW3A 1LGBA 1V70A 2SBAA 4KBBA 4MGTA 1OURA 1PHMA 1S1AA 4CP0A 2HKXA 4QX3A 3VBFA 5SV5A 5FPZA 5LW9A 1NY72 1UQXA 1YYNA 3HAGA 3UGHA 3USSA 2QCSB 4I0BA 5L36A 1OF3A 5T5LA 3BTYA 3BU0A 2V09A 3DKWA 3LZZA 2ZMNA 4DIQA 4OUMA 3B5LB 4S2DA 5CFCC 5DG2A 1YFUA 5C4WC 4FI9A 4LUMA 3SITA 5C9AB 1AX2A 4IQPA 3MV01 4PBPA 2WZ8A 3BIEA 3N35A 3ECQA 2YBSA 2XLFA 4QHZA 4RQPA 3ZKUA 3O1MA 1GOFA 3CJXA 1WA6X 4KMQA 2ZGTA 1VP6A 2JICA 5A3OA 5JXJA 1CZVA 2W0XA 3DL3A 1QOOA 2ZGMA 5F39A 2D3SA 1H30A 2OUJA 2UWBA 4TZDA 1JW6A 3T4VA 3UGGA 4AL9A 4UT5A 5FYCA 5LY2A 2GNDA 1IS4A 1PO12 3GBGA 4QQ2A 1W2TA 1GNYA 3SMHA 4LA2A 4CUBA 1S0BA 5FRAA 3FJSA 1VB4A 1ODMA 4LUKA 1BVVA 3ES1A 4QDSA 3ZXAC 1VBC3 4XF1A 5FP9A 4DRVA 3MGUA 1T6BX 4FP2A 4FSJA 4C1WA 4BK5A 1MEC3 5FZIA 3VZMA 1JUIA 2WWSA 3IMNA 4NHYA 4Q0UA 5JVVA 1RUJ1 4RSUA 4FAHA 4A44A 3ZXGA 2R043 2IFWA 2WN2A 4IEVA 2XG3A 1YEWA 3IB3A 3J7HA 3U4XA 3K3NA 4CZSA 5A3TA 4YFWA 3C7OA 5H9PA 1V6OA 2OUHA 2WFF1 3ZM8A 3D8CA 1PMIA 3GGLA 5FYTA 4ASMB 2TNFA 4XAAA 3ZFEC 3V0BA 3OY8A 2P3YA 4MZUA 1G86A 3POYA 4XDQA 1A3KA 2Q0AA 4HL0A 3S57A 3B9IA 5C4WA 4P9GA 1MQTC 2P3KA 4XCAA 3TBDA 3WHUA 5F6LB 2WC2A 3NW4A 2J42A 5FZOB 5LA2A 4Y1ZA 1WKYA 4CP9B 3LDRA 2OPWA 1A78A 5CU1A 4DB5A 5A32A 2P1BA 1U5ZA 3KQRA 3KS7A 5LZ6A 5FUPA 4N43C 1C8NA 4A2UA 4JC1A 3FLPA 2VNRA 1UO9A 3H1YA 1KDKA 2WJSA 3PIJA 4LKSA 3S30A 3VBFB 4IE5A 3JBG2 3AMQA 1AL22 2K9ZA 1XJAA 5FV3A 4LLOA 2TBVA 2RE9A 3WVJA 1BBT3 4JGZB 4HK9A 2KXLA 5FJKA 2YROA 2DU0A 4FFIA 4XIKA 5K8SA 3DYPA 3AKRA 3KF5A 3OGJA 1UYZA 3H3UA 2VMGA 4AGVA 2AZ5A 2X53S 2ID4A 1FX5A 2D7FA 3BU7A 3OPZA 4HPKA 2HWE2 5IFTA 3NNLA 4LLFA 3GM8A 1UZYA 4QT6A 3ZFEA 4QGLA 1R082 3ZYRA 4AWDA 4TYSA 4TLFA 4P9YA 2J1AA 2VNVA 4CU7A 4HBNA 5FLIA 3PUSA 4P00B 1VBD1 2EF6A 2P3JA 1L7LA 2W5FA 3U10A 3IPVA 1C1FA 2DTWA 3THPA 4ONUA 2PFWA 1GZTA 2DVBA 1UY0A 4LBLA 2FQPA 3CO2A 1QOSA 4F83A 5C5TA 4HZFA 4YZ1A 4BA6A 3BI3A 2FD8A 3OGVA 4K8RB 3AK0A 2NZ9A 3JUUA 2VZRA 3V65A 4IGOA 5FK8A 3OGRA 2C4XA 2ORXA 5EJ3A 5CYYA 1E5HA 2BVVA 3NKTA 4JVAA 2OZ6A 2VC9A 1AXKA 2ZHMA 1WCUA 1FMD2 1BQPA 1IHMA 3C2UA 2BOIA 2J1TA 2PELA 1Y43B 1JYTA 1BLZA 2IXJA 2XVLA 5F5AA 4XUOA 3JU9A 2WNVC 4LXLA 5FMDA 4QQOA 4Q0SA 4GMP1 3R6SA 5JDBA 3DCQA 1X82A 3ZYJB 1AYM2 2ETEA 2GMPA 5AFBA 1IKPA 2CSGA 2AREA 2Y34A 4XEZA 3RS6A 3ZFGB 1JZ7A 5APAA 3ORJA 5A32B 1OLQA 4E2GA 3I54A 4V2VA 4PF1A 4YW1A 3MIBA 2WAAA 1XNKA 1QOTA 5ACA1 1DBNA 4Y1UA 2RR11 3WQ7A 3H8XA 5IK7A 3F2ZA 2Q1ZB 2YC4A 3VZOA 1ZREA 4R9AA 4ZXEA 2WT1A 4MYEA 1URXA 4RHV2 3OUIA 4CDUB 4E2QA 4GXLA 4LBQA 4YVWC 4META 3HT1A 4AHZA 1DGWX 2PHFA 4AHYA 2FZ1A 2WO7A 4K9SA 4XIOA 2GH8A 5A6XA 4A3ZA 4CDWB 4QXBA 1K5MC 4OULA 2ZA9A 3DECA 4JDOA 3TN91 5A7SA 1GP4A 3HT2A 1Z7S1 3VKLA 3WNMA 2EA7A 4A7YA 3IN9A 3HJRA 1UNBA 3AZYA 1F8VA 3JD73 1DF0A 1JU3A 2ZGUA 3J7MA 4TLGA 4OHYA 4RR3B 3GCWA 4F8AA 1DHKB 2QVSB 4YG0A 3O1PA 4CP1A 2D6MA 3MIEA 4Q4Y2 5LBBA 3RJ2X 1AF9A 1HV1A 1ULOA 4J1WA 1HRV2 2WNVA 5KHJA 1YWKA 1H9PA 4OHWA 2PHWA 2O8OA 2UY9A 1F35A 4YWAA 2V4AA 4CDQC 2VW0A 3J26N 3VDDC 1C8M1 3C7FA 2Q8OA 2JJ6A 2VE1A 5FLJA 4LO6B 1AR91 5DUVA 3ASIA 1UIJA 2GNMA 3JCIA 4OZXA 5DABA 1H2LA 3PL0A 4TXWA 4MV2A 3VBOC 3RYPA 2ZAHA 3SKJE 4WVMB 2Y26A 4YVWA 5CADA 4PF5A 1PGL2 2FMDA 1QJU2 2WZR2 4AE2A 5FYIA 2RM23 5FZ4A 2PHRA 1RUF1 4QXKA 1COV3 2P17A 1RUG3 1WW6A 3AMMA 4ARXA 1NUKA 1LHOA 4HK8A 4PT6A 1RUI2 2A75A 2ADEA 1K5MA 1NX9A 2W95A 2ZZJA 2PAMA 2P37A 3LEKA 3WDTA 2A6WA 4A3XA 2ES3A 2BEOA 4LHSA 5KHIA 2WUHA 4OFGA 1BMV2 4DXSA 4ITCA 2PHTA 4QQLA 2QTWB 4XFCA 3O14A 1CAXA 1LNSA 1RHI3 5F3GA 3VBSC 1TNFA 2WNEA 4XQWA 1UCXA 4HKOA 2ET7A 3ACLA 3M4FA 5IVJA 3WCRA 1MS3A 1GUIA 2WQZC 2VMEA 3SISA 3ZR5A 1IKQA 1D4M3 1YFYA 3FUQA 1VBB3 1SLLA 3L2HA 4HVOA 5KBFA 3N9LA 4O9EA 5FIXA 2A3YA 2ARCA 3MI8A 1PZ8A 1ND2C 3ZYHA 4JGYB 4CDQA 3VDDA 3KGLA 2W94A 2Q1MA 3BYWA 3LWCA 4COWA 4RGGA 1NCRC 2CYFA 3S6PA 4AK3A 4C8DA 5A1LA 4XJUA 2QKDA 3KQ4B 4LPLA 1O3SA 1NQJA 4FVVA 2HYKA 2PHLA 4A6SA 2Y0OA 3BOWA 3VBOA 1QDCA 4AI8A 5L7OC 1O6UA 4MH0E 2HWC3 5FY7A 4LT5A 1WCDJ 2FDIA 2C6SA 2VNOA 4PDWC 1LOEA 4XABA 1ZZ8A 3SNMA 4EYUA 4JQRA 3E97A 4PQ9A 3B9CA 1KFXL 3IAPA 1CX4A 5ANQA 1C4RA 3U0ZA 1EY2A 5FP8A 3WT3A 5T5JA 2VY0A 5BNPB 4IXLA 4L8QA 2MNGA 2TEPA 1GFF2 1H1MA 1SG3A 4DUVA 1QJX2 5JAXA 2YV8A 1W04A 3O1OA 3N9OA 2YU1A 3VBSA 2VL4A 3LOIA 3DXUA 3ZXLA 4ARYA 1ZX5A 2JG9B 4YVSC 4O9GA 4QMAA 4B8EA 2JKXA 1EAH1 4N9IA 2E31A 3C8XA 3THTA 1FXZA 4AAXA 3SCFA 4GJYA 1S0EA 5FZBA 2JIJA 2CY6A 1BVP1 4PQQA 2WFPA 1M4WA
chains in the Genus database with same CATH topology
3AKPA 3AXDA 1E57A 1ND2A 4YVWB 1NLRA 1NCRA 4AQ2A 5JZGC 1RUH1 1DG6A 4KGGA 1GZWA 1RL3A 5EZWA 4BMEA 1S0FA 4P9IA 4NWVA 1KS4A 1CAXB 2NN8A 3EXUA 3QD6A 4KU8A 5AC92 1YI7A 4JTNA 4M3CF 2XBO3 4PDWA 3PJYA 3ROUA 2OW4A 4OHXA 1YI9A 1ZNPA 3V64A 4SBVA 4F7ZA 4W6WA 5JLVA 1NXD1 1EYBA 1VBC1 4N53C 3UKTA 3C3VA 4AVTA 1RUC2 4FQZA 2BVBA 2FHRA 4YVSA 4DY5A 2VG9A 1UKRA 4AVBA 5B2GB 2VOVA 1IPKA 4M0HA 4SLIA 1PO22 4MGYE 1FNYA 3LA3A 1GNHA 1HXS1 1KITA 3EO6A 1RUJ3 4XF4A 5GZCA 2QFEA 3DUIA 1O4YA 3I4IA 4Q4W2 1TMF2 3B69A 1EP0A 2PHUA 5E1RA 5JZGA 3IIAA 2WFF3 4GULA 4I01A 2DCTA 3PVOA 4PLMA 2YYOA 3O5SA 2ZGOA 4AVSA 2QDRA 4DPNA 1FYUA 1XE7A 4HVQA 5I93A 1OFNA 1QMJA 2ERFA 2HWB3 4Q29A 5I0RA 3FHIB 1SFNA 2DFCA 3RI9A 2HWF1 1ND2B 2W08A 4N53A 1X36A 1YO8A 1NCRB 4BLJA 2VW2A 2CGNA 4TWTA 2ZBJA 3EBRA 1QHDA 3SCHA 3VHPA 1GZWB 2D5HA 2WNUC 4P9JA 1CVNA 5JI9A 4AGRA 1SEFA 2I2SA 3ZFFC 2DWRA 3KZ4C 1X7NA 3QBQA 4I3PA 3HR9A 1TME2 1PVC1 3HQXA 5BNOC 3RSJA 1Q43A 3H1WA 1W2UA 3N7LA 1HIXA 4XFFA 3BALA 1IS6A 1WD4A 4AEMA 3ZYPA 3AZWA 2LUWA 2XVGA 1I5ZA 1C28A 1AJOA 3EJKA 2HWD1 1FATA 4YVSB 2AYHA 4FOQA 3EHKA 3BB6A 1RTVA 1BKZA 3B02A 4XHBA 3WQ1A 3V56A 3B94A 3NKGA 4NN0A 1PK6C 3LCPA 4H14A 4Q8LA 1PNFA 1J3PA 2VXRA 4BYYA 5KC6A 3CU7A 5JWPA 2VQAA 2VVEA 5JZGB 3N7MA 2K2SA 4IETA 2GAUA 2WNUA 3KT1A 1AZDA 1UIKA 1X8EA 5FQ0B 1UL9A 5I91A 2FZ2A 5CNAA 3ZFFA 4ES9A 4A7ZA 1ZBA2 4GMP3 1QJZA 4JV4A 4QQHA 4YM3A 1Y7BA 4LBJA 5T5PA 4QPGC 5ABJC 5K0UC 4R4XA 2ZGQA 4YG6A 1G9BA 1PZ7A 4FOVA 4HMZA 1V00A 1LKNA 4V1PA 1OFSA 1MVQA 1VBE1 3UK9A 2RR13 5ACA3 3MIGA 5I8SA 5LK5A 3H9AA 3MICA 2DVGA 3OTFA 4OHZA 2ATFA 4X8PA 4YW5A 1WMFA 1FI2A 2XKPA 4XJWA 4PBOA 3AX4A 4LHKA 1UPIA 1YIPA 2R32A 2JDZA 1QH7A 1QDOA 2ZX3A 5FTTC 5C33A 1VRH3 5JPNB 4JTOA 1PK6A 2PA7A 3RQ0A 3TN93 3ZXFA 1DQ4A 1Z7S3 2D3RA 3B00A 4Q26A 1BEV1 2C1FA 2RMU2 4AHWA 2EXIA 3DPRC 4XETA 4YG3A 4DY3A 4FPFA 2PLV1 3KD4A 3D0JA 1KDMA 1Q5OA 4Y22A 1DYPA 1SDWA 2GNTA 3N7KA 1I3HA 5F5QA 3GYDA 4GH4C 3WP3A 4CEWC 2ZS6B 3B3QE 3UJOA 5ABJA 5K0UA 1HW5A 1UAIA 1UX6A 1LULA 1HRI3 1W6QA 4U2AA 4XFGA 1AYN1 3T1MA 4XJAA 2D6OX 1AR93 4MXWB 1CGPA 2IWGB 1R091 4XJ8A 2DCZA 4NHLA 1QY4A 2ZGPA 4GB32 4GKYA 3AJYA 1Q8SA 1RUD1 2YGLA 4XTMA 3KB5A 1OA4A 5JI7A 4Y20B 3VBRB 4EN6B 5EXOA 2YXSA 1RUF3 3ZXJA 1RC6A 2Z42A 1JTZX 4HSJA 1FV3A 3BODA 1GV9A 2JEMA 1UN1A 3USUA 1ENXA 4U36A 5FPXA 4XBLA 3DPRA 1RVF2 4QM8A 4XTPA 4P9XA 3VLBB 3RWNA 2IXKA 2WINB 1ZYBA 3RMYA 2JECA 4QM9A 2Y0IA 2VMHA 4KWJA 4CEWA 4GH4A 5FFOC 2ZABA 1Q8QA 2GH2A 4K6BA 2VUAA 2CV6A 5J7MA 3ZX7A 5T5OA 4HN1A 4NR1A 1LOCA 2LALA 4YSFA 2RHPA 4YM0A 2HEYF 3AFKA 1AR62 4L9BA 3P3PA 1C1LA 1PK6B 4LR4A 4BPZA 2H6CA 1V9U2 4HANA 3WUCA 1NY71 4AFMA 4AI3A 3IT8A 4XFAA 4I30A 4KH9A 1ZVFA 4Y22B 4JDMA 5I0UA 2ZGNA 4AEDB 4AHXA 1N3OA 2RJKA 3D82A 3JQWA 4Q4V2 2PAKA 1VR3A 3AYCA 2EAAA 5ABJB 3GNEA 3IDCB 3WUDA 4D7SA 3DF0A 4YW4A 4LULA 3N4MA 4K1ZA 2ZPXA 2E9QA 2X5IC 4LA3A 1C5HA 3POWA 1EAH3 2AR6A 3A0KA 1DQ1A 3SH5A 1H2MA 2ZGRA 4XJ9A 3E6CC 3RZZA 4IV1B 5I8TA 1LGCA 1PO11 1DZRA 3ZIXA 3WLUA 5J09A 1LOAA 1J3RA 2XPJA 4FTBA 1OA3A 4XILA 1ZRFA 5FBZA 4KU7A 1ZA4A 1AR82 3IKWA 4QPIC 1ONAA 1RUH3 1VBA2 3RG0A 4B4RA 2XBO1 1V6MA 3KSCA 1REDA 4FOWA 1GLHA 1LOGA 1PGW2 4AXOA 1YRZA 1KS5A 5CBLA 2AENA 3NAPC 4X8NA 2XJRA 4D69A 2BTVC 4YW2A 3AYEA 3ES4A 3IM0A 4BIOA 5GALA 3T1LA 3I59B 2IC1A 4QHBA 1KJLA 1OOPB 2D44A 2N7GA 5GZFA 1LGNA 3APBA 5CFDC 2X5IA 1U5IA 4COZA 3L2YA 1V6KA 4AVAA 4HKWA 2JG8B 2P3IA 1AR72 3M2MA 1HXS3 3N7JA 4AI1A 2QZ2A 4CP2A 5J96B 3JBG1 5D8AC 1AL21 4AEJA 3VUOA 4Z2WA 4LBQD 4AYUA 1CAUA 1JYCA 2ZHNA 2ZGSA 3MW4A 5EYXA 4BCUA 5CFCA 1DLLA 1UKGA 3CJIC 3LOBA 2V5YA 1F5JA 2Q5TA 1CAVA 2VECA 5E89A 5JOWA 2UY8A 4GMP0 2HWB1 2XJQA 4N90A 4UW6A 1RUE2 2HWE1 3NAPA 5CVRA 4XQ4A 4FQ4A 3MIDA 4K40A 4PLNA 2O8QA 4FTEA 1R081 2X8KA 2G9GA 3WP4A 4AG4A 2VH9A 2HWF3 5JPMB 3OBRA 2B7YA 3TAYA 1XYNA 5BNQA 4WVVA 5DDJ2 2JX9A 1EV12 1NXMA 1S0IA 1ULDA 2BWCA 2XLGA 5CFDA 3O0WA 1DGRA 4FXKB 1LODA 3NVCA 2DU1A 4IEUA 4AFAA 4ORFA 1NCQC 3M3OA 1XE8A 4RQPB 1WD3A 3UKNA 5F1RA 1RGSA 3RJRA 3ZN4A 3HWJA 5J36A 4CYDA 5D8AA 3N36A 3ZSJA 4DINB 2QZ3A 5LEKA 1ASJ2 1PVC3 5HBAA 2YZ4A 4WZCA 4FPLA 3WG2A 4ISQA 2W52A 2WT2A 1MQTA 3CJIA 4XF3A 5H9RA 2XH6A 1ZM1A 1H8TC 1ZRRA 1AYM1 1QJY2 4FOYA 2OVUA 5F9TA 5IK8A 4AI0A 2HWD3 2WLQA 2BUKA 2IXCA 2X5IB 4N43A 3ME2A 2GNBA 4PLOA 3ZSEA 1LHVA 4IEXA 4YW3A 2ZMKA 5DG1A 5GLUA 2E7AA 3AFGA 1ZBE2 4FPEA 4RHV1 3AYDA 5GLVA 3V0BB 3B01A 1DQ0A 4X6QB 4LE3A 3OY8B 4BE3A 4IL7A 1CAUB 1H4HA 1RMU2 2WLPA 4K7JA 5CFCB 3QCWA 5C4WB 3U11A 2R49A 1W6MA 4YNIA 1NCQA 2WS93 3P3NA 3ELNA 2VU9A 1CAVB 2ZMLA 5E88A 3BPZA 5JOZA 1ZZ6A 2WA4A 5BUVA 4QD2A 3A4UA 4IV3C 1YCIA 3NAPB 1UU4A 1Y9QA 3WW3A 3IBMA 2DCKA 3BTAA 3ILNA 4QGMA 4LO7A 5KXDA 2CL2A 1S55A 3HMYA 4L2NA 4YLZA 4OUSA 1VBE3 3FLRA 2RS12 1HRV1 1VBD2 1WA4A 5BPXA 3TNQA 1H8TA 3FWEA 2O0OA 2O1QA 2UWCA 4BQ1A 5E16A 1NA1C 2LTNA 3LB9A 4Q4X2 4HFSA 2IXLA 4FPYA 3CEWA 3KCYA 2LM3A 2R062 3M7AA 2CNAA 4LEJA 1VRH1 5C6CA 1H0BA 4KWLA 1CJDA 2VULA 3NV3A 1YFWA 4HPKB 4I02A 4LNVA 4C1XA 1O5UA 1LCLA 4YZ4A 1ZZBA 3ZFEB 4Y1XA 1PGL1 2DUPA 4HVRA 1QJU1 2WZR1 5HI0A 1OHFA 1BEV3 2AH2A 1G6NA 1ENSA 1AJKA 1B35C 1RUI1 2JENA 5SV8A 1MQTB 1D0HA 2PLV3 3ALQA 3IPVB 1WUVA 1G9DA 4BOWA 1BMV1 1FV2A 1AVBA 3AZXA 1HRI1 2DV9A 2UU8A 4IV3A 2VUJA 1REFA 1QXJA 4NHMA 1UU5A 4N43B 4NVPA 1PIV2 3M70A 3D5OA 1AYN3 1GZ9A 3DGTA 5L19A 4DMIA 4I09A 3TRSB 1CQ9A 2QJVA 5FAXA 1R093 1SLTA 3WDVA 3J8F3 3ZDSA 1GQHA 1QQP2 1RUD3 1NA1A 3AMHA 4Z8BA 5KWRA 2EXHA 2YGMA 2R072 3WG4A 1JH5A 1RUNA 1YFXA 4E4ZA 5FREA 2F6BA 4KG8A 1KD7A 1CONA 2MEV2 2QNKA 2UYAA 3WW1A 5GKAC 1BYHA 4P5HA 5LRRA 3ZYGA 4XXPA 3FLTA 3KLSA 4FPHA 1IS5A 3VBUC 3E5XA 1CPNA 1Q8OA 4YGCA 1DQ2A 1YNAA 2GALA 1B35A 3KGZA 5DXDA 4QU2A 1XXNA 1OQDA 4FXGB 5T52A 4LBQB 5A3LA 1D4VB 1QJX1 3VBHC 1FPN2 4MGZE 5JIUA 1UMZA 1AHSA 1C8M2 2W68A 4XF9A 3UV9A 5JR7B 3RNSA 1NLSA 3RRDA 2BNNA 1R1A2 5DUWA 5JSPA 4WM8C 1N1SA 2EAKA 4G4FA 1RJ7A 2ZHLA 1XU1A 1VB2A 4Y26A 4DZGA 4M0NA 4LHNA 5KC5A 4Y1VA 2WNVB 3H7YA 2Y38A 4EWDA 5CIRA 2ZOEB 1U5XA 2DVDA 4XBNA 1S0CA 5AC91 5J37A 3D6EA 1OD5A 2A6XA 1AUYA 2XJTA 3VBUA 4R9BA 1HQWA 2WA3A 1Y3TA 4AQTA 2R6QA 4Q8KA 4PCRA 2E63A 4ATFA 1WLTA 3OF1A 5TSWA 4KNCA 3VBHA 1PO13 4ATEA 1IQAA 2A3WA 1RUC1 3PVBB 3FE5A 1J3QA 4R4ZA 1K5MB 3BCWA 5T3NA 1QKQA 1WCSA 1JHNA 3AXEA 4FPCA 1AX0A 2RS52 1PO21 5L7OA 3ZN6A 3IDEA 3WG3A 3GZAA 3KCXA 1V6IA 4BWOA 1HV0A 5T5LA 1T6GC 3B7MA 1FOD2 4UXAA 4Q4W1 1BXHA 2RS32 4JAAA 3WXPA 1FT9A 1QNYA 3H3ZA 3W59A 1B35B 3WDWA 2GC1A 3FBYA 4UW3A 4KGQA 3WX5A 4W6XA 4N7IA 1SCSA 4CDQB 4C90A 3VDDB 3AZZA 3WDYA 1LENA 4INDA 1VAMA 1PM7A 1VAVA 2DYCA 1GANA 2UURA 4YZ2A 4K8FA 4AI2A 1DDLA 3VBOB 1WLDA 5KXEA 4L11A 4RS5C 2XWBB 3K51A 4COVA 2DF7A 1WBLA 3SXWA 3JBG3 1AL23 1CAWA 1TEIA 5FOBB 1DGLA 4QGNA 4MGIE 3MEPA 3PMSA 1PZ9A 2JE7A 4RGAA 2QDNA 3VBSB 1O5LA 4DOUA 3ZMNA 2BGCA 3PHMA 1OPOA 4IERA 5T55A 3HN1A 3LGRA 3VGIA 2DVFA 3WHTA 2HWE3 1TME1 1VALA 3ZSMA 2EXKA 1YIFA 5F6KA 1F2NA 2WQ4A 1YJLA 3WQ0A 1R083 1GZCA 2XHKA 4RFT0 2PYTA 4YRDA 1WLWA 3TB0A 3VBHB 1VBC2 3TOJA 4M3CA 1R1ZA 2D3PA 4ZKTB 1SMVA 4FPOB 4N9HA 5FO7B 1MEC2 5L7OB 3TNPB 2R042 1UD1A 2VGDA 4RS5A 2UWAA 5IT6A 2A6VA 4R52A 1YUDA 4PDWB 4LO8A 3V0AA 4LTAA 5FMOS 5J48A 4N7UA 5FOJB 4Q1RA 1FMD3 3TWIA 1ZZ7A 4DFSA 1XNDA 3MZHA 5KXCA 4AFCA 2KA3A 4CDXC 2A7AA 2XJSA 4D7YA 4CEYC 1AYM3 1JXNA 1W0OA 2GMEA 2WZPP 3AJZA 4NHKA 5FO9B 2DVAA 4EV0A 1APNA 3R0RA 1IGOA 1BBT2 2YY1A 3R4DB 1L3JA 4IESA 4RHV3 5CB7A 3PMEA 4L97A 1RIRA 2WS91 3T2TA 4W65A 3NV2A 4P9WA 4KQ7A 5LEJA 3JB4C 1GR3A 1IZ3A 2YMZA 3VHOA 2D93A 3S7EA 2Q30A 3GZTB 1W6PA 1MS9A 3FC0A 1DQ6A 3G7DA 3D4KA 3MPBA 3Q9OA 1MS0A 5BNOA 2RMU1 4AQ6A 3E5UA 1LEMA 3PTYA 2PTMA 4QX5A 2GC3A 2ENRA 4N53B 4Q4Y3 5BNNC 5KXBA 4WM7C 4BLIA 3J4UH 5AVPA 4CDXA 1HRV3 4RL7A 4CEYA 2ZHKA 1H1IA 2C5DA 3ZXDA 3VL9A 1IOAA 2VMIA 3SH3A 1MACA 3OBTA 1ULGA 4XMAA 4OI2A 2AUYA 4G3YC 3ZSKA 4OLLA 3AP7A