1LOFA

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
molecule tags Lectin
total genus 27
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofA00
2E6VA 2ZKNA 1LOEA 1I3HA 1OFSA 1FNZA 1JXNA 3ASIA 1MS8A 1AX2A 2VW2A 3M3OA 5L73A 4CZSA 1W6OA 2A5ZA 4BLIA 5GLWA 4XDQA 1GSLA 1SCRA 3UL2A 5EYYA 1ONAA 2ZHNA 4OZXA 2D6OX 3ILFA 1QMJA 3JU9A 1HKDA 4JC1A 4M00A 2E53A 1KJLA 4XBNA 4YZ3A 3O0XA 4NOTA 4L8QA 5DUUA 4CRQA 4Z8BA 3HMYA 1BJQA 1KJRA 1SLBA 3NV2A 2ZGKA 3AJYA 3AZWA 4ISRA 5JMCA 3SH4A 1DQ4A 1QOOA 2EXKA 1CVNA 1G86A 2DWRA 2JE9A 1C1LA 3AFKA 2Q5TA 4FPEA 2KM2A 4TYSA 2RHPA 1WW4A 1HDKA 1UZZA 1WBFA 4Q26A 4XJ8A 1MACA 5H9QA 1R1ZA 1ULCA 1GZWB 2CWMA 3OBTA 5FRAA 1W6NB 2WSVA 1MVEA 2YY1A 4KBBA 3USUA 1ENSA 4DPNA 2PHRA 4Q1RA 5T54A 1S0BA 5DXDA 5GLVA 1YI7A 1JUIA 4Y20A 4YW2A 4BMBA 2ARBA 4YFWA 3ZSMA 1LHWA 3D5OA 2I2SA 1DYKA 2JECA 3MPPG 1FYUA 1QDCA 3V0BB 4XHXA 2GNMA 2EIGA 1VLNA 2EAKA 1QGLA 1Z0HA 2DU1A 1UN1A 2GNTA 1LCLA 2TEPA 3R4UA 3ZXJA 1GV9A 3ZSKA 1WD3A 4NO4A 3ZXLA 4FPCA 1KITA 2AREA 4YGBA 4XIOA 1N1VA 4UW3A 2EF6A 4GXLA 5EWSA 2VW0A 1CN1A 5GZEA 4C1WA 2ZGMA 3WDVA 1MS3A 1W0OA 1H9WA 1LODA 3AP4A 2P3IA 4U2AA 4XOGA 4BPZA 4WV8A 4PF5A 3KM5A 1W6QA 4ISQA 2ZHLA 4JCKA 4YG3A 2UWBA 3OYWB 1C4RA 2A6YA 2ENRA 4Q8KA 3FLRA 1Y7BA 3AZZA 3PJQA 1MR5A 2D6PA 2VU9A 4P9YA 4UW5A 1RITA 1I1EA 1AX0A 1S1AA 3LSEA 4R9BA 3ILRA 1HQWA 3WUCA 5E88A 4Q27A 1QDOA 5GALA 3OBRA 5F9TA 1PZ9A 4LBQD 2UURA 3ZYPA 3UJQA 5GJ6A 3WZ1A 3VKLA 1SBFA 2ZGLA 3RMYA 4Q2FA 1F9KA 1AJOA 1QNWA 1BZWA 2JDZA 3N7LA 3N36A 3OY8A 5H9SA 3WG4A 1LULA 1WW5A 4R9DA 1CJPA 2DVDA 4K21A 5DG1A 3B9CA 5T5JA 4M3CE 3WV6A 4FP2A 4P14A 5E8AA 4XYXA 4D69A 2WJSA 2YMZA 1GZ9A 2SBAA 3AYEA 3T1MA 3IPVA 1FATA 2VH9A 2GNBA 2ZGUA 4YGCA 3WDXA 5CAZA 2D3SA 3I4IA 4C1XA 4M01A 3MW3A 3WDUA 4F83A 3VKOA 2ZAAA 2FHRA 3N7MA 4ZXKA 2D3RA 4R9CA 2PHWA 1O4ZA 1Q8VA 2DYCA 2G4IA 2CYFA 3FFZA 5H9PA 2VY0A 1N1SA 1JHNA 3ZSLA 1DFQA 2BQPA 2VXRA 2D3PA 1S0IA 3NV1A 2CTVA 2DV9A 3WCRA 3M2MA 1D2SA 1KDKA 1Q8PA 2NN8A 3HN1A 3O5SA 3T2TA 3V0AB 1MZ5A 2DUQA 2A6XA 1ULFA 1LOAA 2EXJA 2PHUA 4M3CA 1N3PA 5KXCA 1Q8QA 3D4KA 4XMIA 5DG2A 4FOWA 4TZDA 2GALA 1YIFA 1N3OA 4FPGA 3B3QE 4XJ9A 1DQ1A 3VKFC 1G9BA 4BQ1A 1GNZA 1KRIA 1DYPA 1CPMA 2C9AA 1ULDA 2ZGPA 5JOZA 4XBLA 1SBEA 3B01A 4LBQB 5GLTA 4LBJA 2DVBA 1LGBA 3SH3A 4LBMA 3WG2A 3RQ0A 1UX6A 2JD4A 2ZGRA 3FBYA 3WDTA 3ZXKA 3WG3A 3N7KA 1S0GA 3N3HA 2AUYA 2D43A 2JKBA 5JVVA 2A75A 3M3EA 1IOAA 1F5FA 4WZFA 4YM1A 1OKQA 2PHXA 5DZEA 1UMZA 1JYCA 1DQ5A 2R0FA 2B7YA 1S0EA 3AXDA 1UKGA 1S0CA 3OGGA 4XJZA 5GZDA 2YZ4A 2AYHA 1CESA 1V6KA 2ZMKA 1BXHA 1LHNA 1MS5A 3APBA 4LBQA 4XTMA 2A6WA 3BIWE 3SNMA 3M1HA 3OPZA 2ZBJA 5DUVA 2JE7A 2GMEA 4Y22B 1AJKA 1LESA 2P37A 2P34A 1N1TA 2W39A 4I30A 5LK5A 2A3XA 3LCPA 1G8WA 3RMXA 1LENA 4LBKA 1SLIA 3OJBA 3A0NA 3AYDA 1N3QA 4YM0A 5EXOA 3IN9A 1W6PB 2JJ6A 3V65A 2E7TA 4AVTA 4XILA 1TEIA 1WBLA 2R1BA 2R1DA 3AYAA 1LU2A 4PQ9A 1A8DA 1AF9A 1FX5A 3AZVA 2WT2A 1V6OA 3BOPA 3POSA 4YGDA 4YW3A 1GZWA 5JDBA 1W6NA 4Y1XA 5JOYA 2R49A 1ENRA 4Y24A 3AZYA 4XXPA 1H30A 2C5DA 3AP9A 4PBOA 1LHVA 2OUJA 1DGLA 2XB6C 5JOWA 4K1ZA 4ITCA 3VKNA 1DHKB 4DRVA 2ZGTA 1SFYA 1CR7A 1LOFA 2A7AA 4YZ2A 3L2YA 1SLAA 3V0BA 2WT1A 5IUQA 4FOYA 1SLCA 1WUVA 1LECA 1WW7A 1WW6A 2DTWA 4FQZA 1FNYA 5GLUA 3ZPYA 3WOGA 1UAIA 1MS9A 1GKBA 2DUOA 4P9WA 5DUWA 2WLQA 3FUOA 3FUQA 5KXBA 4LBNA 3ZSJA 2EALA 2DUPA 4P9XA 1IS4A 2OVUA 3R05A 1LGCA 3AP7A 4XMAA 4PCRA 3U4XA 1KQRA 3IKWA 1DZQA 3NV3A 2OUHA 1FAYA 5SV8A 3I8TA 4K1YA 4BM8A 1BQPA 4XXAA 1DQ0A 2A3WA 1W6MB 2ZACA 4M3CF 2WKKA 1FV2A 2WNEA 3B69A 4GWMA 1DBNA 4Y26A 1WLCA 1X50A 1SACA 1BYHA 3OYWA 2W08A 1V6JA 3N7JA 1SBDA 1DQ2A 3M3CA 5CB7A 1PZ7A 2VUAA 4PBPA 5T52A 3PVEA 3DUIA 5FREA 4AGVA 4UW4A 1B09A 3QCWA 5EYXA 4Y1UA 1UZYA 3GNEA 2WQZC 4YZ5A 2NYYA 3AK0A 4XE9A 2A3YA 1PZ8A 1SLLA 4XTPA 3RS6A 2NZ9A 1DLLA 3UK9A 1D0HA 4AYUA 5T50A 5IK5A 1Q8SA 1HLCA 4H55A 5E89A 1V6MA 3SITA 1CQ9A 1W6MA 4RA0A 2CL2A 1A78A 2ZHMA 3Q9OA 2YV8A 1GANA 3ENRA 5JLVA 4CTEA 3ZXFA 2YROA 3RRDA 4XBQA 4YG0A 1G9CA 3UJOA 2ZA9A 5KXDA 1W6OB 1HQLA 5T5LA 3WDYA 1SLTA 4LBOA 4YZ4A 3SLIA 5IK4A 5HCAA 3TB0A 2EXIA 5CBLA 1GICA 1UL9A 1Q56A 2UU8A 2D6KA 4XHBA 5CA6A 5GM0A 1F31A 2WT0A 4DFSA 2ZGSA 3ZYRA 5IK7A 1LOGA 1ULEA 4Q1PA 2E51A 3IM0A 2W68A 1G9FA 2NMNA 2ZABA 3AZXA 4FPYA 3R4SA 1H9PA 3AYCA 4FOQA 4YZ1A 3WLUA 1Z78A 1GZCA 1V6NA 2ZMNA 5F5QA 2ZGNA 1APNA 1C57A 1C1FA 2VW1A 4RL7A 5AVAA 4Y1YA 4YW5A 1LHUA 4FPOB 4GKYA 4YG6A 5DZGA 3WDWA 3V0AA 3RG0A 1VAVA 2LALA 1S0DA 1GBGA 4XJAA 4ASMB 4FPKA 3WG1A 4GALA 4ATFA 2R16A 3IMNA 2WSUA 2UWCA 4FOVA 5H9RA 3WHUA 3CNAA 4HANA 3WUDA 1GYKA 3USUB 1DQ6A 1JYIA 1BKZA 1AXKA 3AX4A 2H0BA 1YO8A 1LEDA 2D6LX 2P3KA 4W65A 4GWNA 3FLTA 2R0HA 3D6EA 2UWAA 2AH2A 4WVVA 3VV1A 3W58A 1ULGA 1MVQA 2HYKA 4XJUA 2P3JA 3PMEA 4Y20B 4YM2A 2EXHA 1LGNA 1QNYA 1ENQA 1AXZA 1V6IA 2GN7A 5JOXA 3AP6A 2ARXA 4AGRA 4FQ4A 1AX1A 1IS3A 1S0FA 1XQNA 1EPWA 3O0VA 3VUOA 2D44A 1ZM1A 4UW6A 1VAMA 2DVAA 1IKPA 3MW4A 5T5PA 3MW2A 3V64A 1V6LA 3POWA 1JBCA 1KDMA 2ZGOA 4YW1A 1GLHA 1IS5A 1OQ1A 2D6MA 1AVBA 1YYNA 1MS1A 1W0PA 1CONA 4R9AA 1MS0A 2AGSA 3WVJA 3A0KA 5DZFA 4K20A 1A3KA 1WCSA 2GMPA 2PELA 3PVNA 1YXWA 1SCSA 3T1LA 4GKXA 1S0JA 4Y22A 1QOSA 1W6QB 4YW4A 2P2KA 3GALA 5DUXA 4DRRA 1JOJA 2ERFA 3KQRA 4YM3A 3O0WA 2GN3A 1N47A 4WVWA 3AXEA 5BYNA 2A71A 2ES3A 4DS0A 1VALA 1W6PA 4GA9A 2D6NA 4HL0A 1YRZA 1ZA4A 2CY6A 2V5YA 4ZKTB 2DVGA 1RINA 5GZFA 1WLDA 4MYEA 2AENA 5T55A 3ATGA 3BODA 2YXSA 2GNDA 4FPJA 1WLWA 1U0AA 3LSDA 1QKQA 3AJZA 3WHTA 3HR9A 3N35A 2OW4A 4DQAA 4FPFA 2DURA 2A6ZA 2DTYA 1CIWA 1LU1A 1MS4A 3A4UA 5GZCA 1IKQA 1G9DA 3W59A 5IT6A 4BLJA 2GDFA 3WCSA 4FP3A 1NLSA 1AXYA 3M3QA 1LJ7A 3OY8B 1MZ6A 2W52A 1FV3A 5KXEA 4IQPA 2ZMLA 4ATEA 3O12A 4SLIA 4AWDA 2E7QA 1CPNA 1QF3A 5HCFA 1LOBA 4Q8LA 1JW6A 3ILNA 3IPVB 4LBLA 4BOWA 2DVFA 5IK8A 3SH5A 4XZPA 1LHOA 3ZXEA 4FPHA 1URXA 3JUUA 3SISA 1QOTA 2NMOA 3FLPA 3QLQA 5T5OA 1N1YA 2A70A 2SLIA 3ZVXA 2LTNA 4AVSA 1JN2P 2CWSA 3NV4A 1RIRA 2PHFA 1WD4A 4YFZA 3NWKA 4YGEA 3DGTA 1QU0A 1G7YA 2XG3A 3VKMA 3WNXA 1UPSA 2NM1A 3PVOA 4Y1VA 5GZGA 1J1TA 1LOFC 1NXD1 3AP5A 2NP0A 2D7FA 1AZDA 1DIWA 2ZHKA 3TAYA 2A6VA 1LOCA 3C2UA 1LTEA 4M3CB 2Z42A 2GMMA 3MEPA 3B00A 1VIWB 4AGGA 4U36A 3INAA 2AR6A 1IS6A 4Y1ZA 4FPLA 4XJWA 4AVVA 1G9AA 3RSJA 2FMDA 1Q8OA 1V00A 2CNAA 1O4YA 3POYA 1GNHA 2DU0A 5GLZA 4FVVA 2ZGQA 4YLZA 4XIKA 5CNAA 1LEMA 2V73A 5HCBA 4JRAA 2PHTA 2ZZJA 4BMEA 3H0OA 3BTAA
chains in the Genus database with same CATH superfamily
1R1A1 2VUJA 3NKTA 3O1RA 4S2FA 4LO6B 1BMV1 1MS8A 2RS32 2X10A 5FP9A 5KHKA 4NIDA 2WQ4A 4AEDC 4EN6B 3GGLA 4CZSA 1W6OA 4CCJA 4CDWC 3PURA 1AR93 4XDQA 5BNNB 3UL2A 1UX7A 2G9ZA 2V72A 2Y34A 3QACA 4H7MA 3GBGA 4FAGA 3ILFA 1VBC3 2XJPA 1OLMA 1GOGA 3GJBA 3J7LA 1PNGA 1QMJA 1AR92 2UY8A 3G6JB 3KV5A 4JGZC 4KGGA 1J3QA 4QAWA 4BZ4A 4COZA 2MEV1 1O5UA 1VMJA 5FZOB 4M00A 1VBC2 4XUTA 3WNOA 2E53A 4YZ3A 2VJXA 4DUVA 4ZZ8A 5JZGA 3OGVA 1OVPA 2LROA 3WR0A 2VC9A 4EWEA 1XOYA 1XU1A 2GZWA 2ZGKA 5JMCA 2EXKA 1QOOA 3WX5A 1CVNA 1G86A 2ARAA 1XYNA 2DWRA 3L9JT 4JKMA 5FZMA 2QNKA 5JCTA 2KM2A 5KHGA 1WW4A 4Q4V1 1JYXA 1WBFA 5FLHA 4Q26A 1BHGA 1UZWA 1W8TA 3NNFA 1DLCA 3SEEA 4BQ5A 1R1ZA 1CAWA 1ND2A 3EMRA 1H6YA 3H9AA 2RDSA 1GZWB 2CWMA 3K3OA 3OBTA 4J1WA 1MZEA 1MVEA 2YY1A 2TBVA 4KBBA 1ENSA 1RUF3 3T30A 1O91A 2PHRA 1NLQA 4KWKA 4EZ4A 4AI1A 4X8PA 5EJ1B 2HWD1 5DXDA 3S7EA 2YC0A 2DCYA 4BB3A 1CIYA 2JX9A 2XMLA 2YBPA 3I3DA 4NRMA 4LORA 5FYCA 4BMBA 3D5OA 2I2SA 3EXUA 4XF9A 3VBSB 1DYKA 2OA2A 5IHRA 4XZUG 4AAPA 2I07B 1XRUA 3CZJA 4CUGA 1UN1A 1W0NA 4KGQA 4IE0A 1XNBA 3R4UA 1ZZ8A 3ZXJA 3HBKA 1WD3A 4WM8A 4NO4A 1AR61 4MGZE 3THCA 1KITA 3BKZA 5L7OB 5FYTA 4LK7A 2NPIA 1UMHA 1POQA 1RTVA 5IVYA 1O4TA 3WF1A 5ACA3 3C7GA 4GXLA 2QDRA 5FWJA 2ZGMA 3NRUA 1MS3A 3P6BA 4V1PA 1R1A3 5BNOC 1KGYA 1WMXA 1D0GA 1QJY3 2Y60A 4I01A 5ACA2 4XOGA 1LODA 4XPVA 3IBMA 4MV2A 2CV6A 4PF5A 1W6QA 5FYYA 1R1A2 2AEZA 4IV3B 4ISQA 4Z2WA 1QJY2 2Q8DA 4I0WB 2UWBA 4BYYA 5JWPA 2TUNA 3ZYJB 1WKYA 2QZ2A 4EN9B 1BMV2 1OD5A 3I3EA 5JXHA 5F8PA 1HIXA 1YQ2A 1VAKA 1BK1A 2Q8EA 1TVGA 3EQEA 3PTYA 3VZNA 1TQ5A 2XJUA 3T0AA 5C3RA 2XLGA 4R9BA 4NHMA 3FZ3A 4QQOA 4BHPA 4Q4W3 4CEWC 1HQWA 3O1UA 4XCBA 4Q27A 3RZKA 1FI2A 3ACFA 3SCGA 5A7WB 3JXSA 3T4VA 4UFKA 5A32B 4UOJA 4Q4W2 1JU4A 4Q0PA 5KHIA 1TNFA 3VD3A 2Q0AA 1NCQB 4XF3A 4G9SB 4Q2FA 3WP6A 1AJOA 1QNWA 3N7LA 1NAEA 1NA1B 3N36A 1LULA 4AVAA 3RYRA 4CXYA 4R9DA 4PJYA 2DVDA 4K21A 4K8FA 5DG1A 2HEYF 5A7PA 1RYYA 5CFCB 4AR2A 1ZBE1 3D0SA 4D7SA 3KD4A 2HWD3 4UI9L 1F15A 1XXNA 2W1QA 2ZEZA 3I4IA 1W3VA 2XHKA 4M01A 3JBG1 4XETA 4XAAA 1SFPA 2HWD2 4INDA 1CAVB 4W6YA 5FPBA 3FMGA 4XDPA 4E4DX 4NIIA 1O4ZA 2DYCA 1QJX3 5H9PA 1MPXA 2RR11 1DFQA 2WL1A 4QHZA 5IVJA 2D3PA 2N7GA 4COVA 4QB2A 1QJX2 1KDKA 3O5SA 2NN8A 3E97A 3OF1A 4QX5A 1MZ5A 1NE4A 3VGIA 4ZU5A 4L99A 1ULFA 2VUCA 1LKNA 2EXJA 4RR3C 4QD2A 1N3PA 5IATA 5DG2A 3J9SA 4B8EA 3CQOA 2HYXA 1W28A 4QQ2A 3B3QE 3NNLA 4Z1VA 5FP7A 3RJRA 4BQ1A 2VVEA 1BBT3 2Y33A 1L7QA 5FZIA 4YPJA 2HWE1 2ZGPA 2YG0A 3B01A 2NQYA 4Y5TA 3B5LB 4CDUB 3SH3A 1VRH3 2Z69A 4LBMA 4P02B 1BBT2 1UOGA 1UX6A 5FPZA 2ZGRA 5F5IA 1PIV1 4UF0B 3WDTA 3ZXKA 3ACLA 4IUGA 3H3UA 3FBMA 1VRH2 3ZN4A 1IPKA 1WMFA 3RI8A 4KNCA 3C7EA 1B35C 4N43A 1F5FA 1OKQA 2BFUL 3IB3A 4RGGA 1UMZA 1RUE1 5FZFA 4EN0A 4A41A 4TWTA 4JKLA 2VCBA 3AXDA 4MO3M 2IXJA 3OGGA 4IEWA 2RS11 4XJZA 5GZDA 4C90A 5F37A 3KHCA 2ZMKA 5FYZA 4D8MA 5JUVA 1KXGA 2A6WA 3GDBA 5DUVA 5EQUA 5A1FA 2GMEA 3GYDA 1LESA 3J7MA 5DAPA 5I8YA 1GZTA 2FQPA 4UWDA 2YU1A 5LK5A 4Y33A 1G8WA 2JG9B 3ZIXA 1CGPA 2O8OA 3DXTA 4IETA 4YVSA 4AQTA 1SLIA 1JZ7A 3A0NA 3AYDA 4KG8A 4QT6A 3OEBA 1W6PB 1ZBE3 4XFGA 2UY9A 2E7TA 2YHJA 3LEIA 3ZX7A 3WF3A 4AI3A 4AVTA 3KQ4B 5F5AA 1TEIA 1WBLA 5KHJA 4OQ8A 2YC2A 1YFUA 3JBG3 4BE3A 4QU1A 1ZBE2 5FO7B 5FK8A 5JDBA 3K77A 4Y1XA 5JIUA 2R49A 3K4ZA 3AZYA 1ZX5A 5C4WB 5E16A 2JB8A 3MICA 1R081 2C5DA 3NL1A 4AHXA 4CXXA 4DEQA 2I45A 2RR13 4LHNA 1LHVA 3HPNA 4PBOA 4TSVA 1KD7A 4HKOA 3AKSA 3BTZA 4NPMA 4QHOA 4ITCA 3CJXA 4AK3A 4SBVA 4QPYA 2JG8A 1EV13 2RR12 3UKTA 1L7LA 1CR7A 3WD5A 5C8CC 5FR3A 1CJDA 4NIAA 3MIBA 4COYA 1SLAA 3V0BA 4GAZA 2VBDA 1EV12 1IG0A 1OA4A 3J7NA 3PUQA 4AEDB 4CDWB 1NQDA 2DTWA 3C7HA 4FQZA 4N9HA 5HCHA 1UAIA 1GKBA 3POBA 4JHZA 5F2WA 3ZMNA 2E63A 4Q0VA 4CP1A 5DUWA 2WLQA 3FUOA 3FUQA 4JGZB 3BOWA 4GD4A 1U5IA 4P9XA 1IS4A 1HB2A 4DINB 3L2HA 3N9LA 3R05A 3HQUA 3AP7A 2DCJA 1PIV3 3U4XA 3IKWA 4A3ZA 1U5XA 3NMBA 4CDXB 2VR4A 3TN91 5A3LA 3NVCA 4M3CF 1PIV2 2VTXJ 4HVOA 3WQBA 3POEA 3B69A 4GWMA 4Q0QA 4A7KA 4Y26A 1U12A 1WLCA 5C33A 2IUWA 2W3JA 4META 1X50A 1YFWA 1QHDA 1NUKA 1RUC1 1V6JA 3AL6A 4FO9A 3VBUA 3FHIB 4I0BA 4PBPA 1HN0A 4MXWA 3EJKA 5DABA 2RS13 1O5LA 3MIHA 4QKNA 3QCWA 4UBGA 4UW4A 1AHSA 1UZYA 1NYWA 5FWEA 4NIGA 5DN2A 3VDDA 5K8SA 2WQZC 4YZ5A 1PZ8A 4IL7A 1TME1 4HN0A 1D0HA 3ACIA 1EUUA 5T50A 1Q8SA 4EYUA 5BY5A 1V6MA 1CX4A 1NY71 5EV7A 3J4UH 4ES9A 4PLOA 1F8VA 2DF7A 5BV6A 4Y4RA 3I2HA 2W46A 1ZZ6A 4BU2A 5HBAA 4AXOA 3QH7A 4LA2A 1G9CA 2XLAA 2ZA9A 4M0NA 1L7RA 4BH9A 4J25A 1HQLA 4K7JA 2D40A 4MGTA 1VRBA 5IK4A 3TB0A 4FXGB 1GICA 4EN7B 2UU8A 4IESA 3POFA 2WAAA 2RMU1 4D6RA 5BNOB 2VCMA 2CGNA 3MGUA 3QD6A 3WW2A 3H3ZA 4IEQA 4S2GA 2ZABA 1DGWX 2FDKA 3R4SA 3BPZA 3VBHA 2QKDA 1UU6A 4KU7A 1VBD1 3WSOA 3WNKA 4CEYA 4EZHA 4DXRA 4ZZ5A 3AMQA 2ZMNA 2CU5A 4JZRA 4LMFA 4RL7A 2RDQA 3U0ZA 4I2OA 1C5HA 1PMHX 3KT7A 4FPOB 4XFHA 4YG6A 3WDWA 3U10A 3O1TA 1S0DA 4XJAA 4ASMB 5JXJA 4NR1A 4OI4A 5FY5A 2J1RA 1ACCA 1ST8A 1S2BA 1ULPA 4UT5A 4C0HA 1PK6A 3ZFGA 1W2OA 1GYKA 3USUB 1DQ6A 2W91A 4CEWB 5LA2A 3VZKA 3AX4A 2XUEA 4OQ9A 3FHQA 2YB7A 4NPRA 3HAGA 4RGAA 2X09A 4WVVA 4GWNA 5LASA 3D6EA 2AH2A 3CU7A 1KFUL 3MO4A 4Y20B 4XJUA 4FXKB 1RUC3 4YM2A 3ZYIB 5EFUA 4LHKA 1V70A 1QNYA 1ENQA 3JZVA 1DGRA 2BDRA 1OOPC 1KS5A 3C8XA 4JVAA 5D8AC 2ZAHA 3TNPB 3ZKUA 2PHLA 1AX1A 1IS3A 1CAUA 3O0VA 3VUOA 1PM7A 5FZBA 1YQCA 1ZM1A 1VAMA 1IKPA 3GJAA 5FOBB 1H2NA 5T5PA 1WA4A 4UAPA 3V64A 1X8MA 2YBSA 1TME3 2JDNA 1SDDB 5L9RA 4EWDA 1JBCA 3IAQA 1KDMA 2ZGOA 2ZX3A 5LEKA 1SZBA 4JQTA 4YW1A 2OQ6A 4AHZA 1GLHA 5A33B 3MBWA 1TME2 2EIBA 2J7MA 1CONA 4R9AA 2JDKA 1W03A 4JQRA 4XUNA 3WNLA 1RUJ1 4RS5C 5DZFA 2ZCWA 1MQTC 1A3KA 1DCSA 3S57A 2EAAA 1F2NA 1W06A 1GWLA 1ENXA 2OZJA 4AI9A 1GR3A 4MOAA 3MYXA 2ERFA 3KQRA 4YM3A 3CIHA 1OF3A 3AXEA 4GWJA 2ES3A 4DS0A 1VALA 4LE4A 2B5HA 4AFAA 4RR3B 3ZYHA 2AEYA 1YRZA 2RMU3 3GZAA 1ZA4A 3KCXA 4OHYA 2CGOA 4KH9A 2FDIA 4LT5A 1RINA 1UZ0A 3I59A 3U78A 2YXSA 4FPJA 1WLWA 1U0AA 3VBFA 2RMU2 4DQAA 1VBD3 2Q1MA 5FY1A 3N35A 1OH3A 4H14A 2A6ZA 1CIWA 2ZX4A 5CIRA 1J58A 3OGSA 3IDBB 2IZWA 1OT5A 4KWLA 5I93A 1IKQA 5J37A 2Q30A 1VBD2 2C6SA 1ND3A 4E2GA 3C3VA 1NT0A 3UGFA 2WINB 3PTRB 1DGRN 1RUOA 1PO21 1EUTA 1EPZA 1JS9A 3OUIA 2QDNA 1B35B 5HV0A 4MGSA 1ZBA3 1VR3A 2EA7A 3ZFEC 2FDGA 1E5IA 3LEKA 1BVP1 3WP4A 1QXPA 1ZBA2 4LBLA 3LFIA 4XZPA 4OYUA 1LHOA 5EIYB 4LO7A 1W8WA 3UKVA 4XQDA 4HKLA 2ZJCA 2NMOA 5I0TA 4QGLA 3FLPA 4E4ZA 4ET7A 5AFEA 2LTNA 3WF2A 5J1XA 1UYXA 4OHXA 3WW3A 3I3QA 1C8M1 4LKFA 3NWKA 1GWMA 4OUEA 1QU0A 1JZ4A 5FZ7A 3PU8A 1UPSA 3I2DA 1J1TA 4YW7A 1GQPA 1DF0A 1NXD1 3ZR6A 2NLRA 1LTEA 3I54A 1UWWA 3HNBM 3LZZA 3LAGA 4M3CB 2GMMA 3MEPA 4WM7A 1VIWB 1P8JA 5FP8A 3I49A 4FBFA 1RUJ3 2RJ2A 2RDNA 3INAA 3LA2A 1IS6A 4XJWA 1RL3A 3MUY1 1DZRA 2BOIA 2CNAA 4AQ2A 2YU2A 1RUJ2 5GLZA 1YJKA 4JHTA 5JR2A 3ZSEA 2B46X 3PUHA 1O8PA 5HCBA 2PHTA 4Z82A 5FUNA 3PIJA 5C8CB 4QM8A 3UV9A 1I3HA 2BOJA 2DFBA 4GMP1 5DAWA 1FNZA 2XKOA 4IV3C 3ASIA 4N90A 1UOJA 3RVHA 1PX3A 2IXKA 1UO9A 1OPMA 1OLQA 2IVJA 4JKKA 4LHSA 1X8EA 3KZ4C 1SCRA 4RN5A 3GBWA 3ZPOA 5L9VA 5J36A 5FY9A 4EN8B 4CCOA 4QXCA 2WAOA 4NROA 3MDPA 2XJSA 5CKNA 4HXCA 3N9PA 1W8FA 4JC1A 3VBRC 4XW3A 4ZONA 4URAA 5HXVA 4NOTA 1H2KA 5IW0A 4A42A 4CRQA 3HMYA 1QQP3 3NV2A 1J3PA 3AJYA 3AZWA 3SH4A 3VBOB 1PHMA 4Q29A 1NCRC 2JE9A 2WS91 4RSUA 2Q5TA 2VXJA 4D0QA 1ULOA 1QQP2 3OSDA 4BA6A 1HDKA 1UZZA 3H7JA 3OPTA 2WRAA 2QQIA 5BNNA 2P17A 1MACA 5H9QA 3SMHA 4FSJA 4OVEA 2ZTNA 1ULCA 4MUVA 5FRAA 1GQGA 1PVC1 4PQQA 2VOKA 5CFCC 4DNYA 5LEJA 1C8M3 1DU3D 1JUIA 2OPWA 3KF5A 1W9TA 3OD0A 1K42A 1J83A 1RXGA 2R073 1C8M2 1GWKA 2KXLA 1C8NA 3TEWA 3KV6A 1H4HA 2QZ3A 4MSVA 4XHXA 2GNMA 2EIGA 1VLNA 5EZWA 1WA6X 2R072 2W1WA 4TXWA 4PI2A 1Z0HA 1EY2A 2RS31 2DU1A 3ACGA 3AKQA 2B45X 3PLQA 1FPN1 5FYUA 3RYKA 2V5DA 1EAH1 1I5ZA 2XONA 1NZIA 4FPCA 4QPIC 2AREA 2QQPA 1Y9GA 1PGL1 2BV4A 2E33A 1C28A 4UW3A 2OKXA 5ABJA 4QX2A 5GZEA 1CN1A 3OB8A 3CL1A 4D6QA 3WDVA 1W8OA 5CZKA 2MHFA 2ILMA 4GMP3 3OGRA 1XU2A 1VBC1 3EHKA 4CUAA 5A6YA 4BPZA 1J59A 3U11A 1XNAA 5KHHA 1W9YA 4ZU4A 2MPFA 4JCKA 5DMYA 4LEJA 2J1EA 1BEV1 2XR4A 3CO2A 2A6YA 3OYWB 1HN1A 1K5JA 4Q8KA 5K7PA 3FLRA 1Y7BA 3R4DB 4QDRA 3PJQA 3Q8AA 5FPLA 2GC2A 1XSQA 2IFWA 1AR71 2J1UA 5IFTA 3RWKX 2D6PA 2VU9A 2WNVA 3MLKA 1RITA 3MIDA 2Y38A 1AX0A 5FXWA 5L7OA 5CKMA 5IVFA 2FCUA 4JX0A 2R7EB 3EBRA 2P3YA 2A1XA 3ETQA 2GC1A 3ILRA 3KS7A 2XJQA 2OS2A 2IXIA 3KLSA 4A45A 1CWPA 3CF6E 1W2UA 1HB1A 2HWB1 3I3MA 2WLPA 3WZ1A 1YIPA 1W2NA 4ASKA 3MIEA 1OOPB 5K4LA 3VN4A 1CZVA 5D8AB 5F32A 4IE4A 3OPWA 2JDZA 2D93A 2VOTA 2Q1ZB 4R4ZA 1WW5A 5SV5A 3AMMA 5IJRA 4OI2A 3M8LA 5F3IA 1CJPA 5T5JA 3KB5A 3SC7X 3P3PA 3OG2A 4KL1A 1OUXA 1PVC3 2PN5A 4M3CE 3LOIA 2WJSA 4BJ0A 2YMZA 2SBAA 3CJIB 5EHDA 5JXGA 1PVC2 2VH9A 2GP5A 2GNBA 3WDXA 2D3SA 4RS5B 1W39A 3A7QA 3MW3A 3WDUA 4B4PA 5A3PA 4PF1A 5A7WA 5A32A 3ZKYA 3N7MA 2VZUA 2Z79A 3BB6A 3TEYA 2G4IA 1VE0A 2QQVA 2R30A 5DAVA 5JSPA 4G4FA 3K4AA 1JHNA 1IHMA 3ZSLA 2BQPA 2RS33 4RYDA 3NV1A 1NA1A 1H1MA 1FPN3 1QJY1 1W3XA 2CTVA 3FJSA 4AI2A 4PDWA 3SCFA 3WCRA 4C0BA 2PYTA 1EAH3 2WO3A 3M2MA 2OXBA 3POIA 3KT1A 3T2TA 1NLRA 2ETEA 1UIKA 4YSFA 2BGCA 3DPRB 2A6XA 1FPN2 5FJKA 3Q8CA 3KHBA 3OOXA 3Q8FA 2PHUA 1EAH2 3B93A 3AL5A 4XMIA 5F2SA 1VJ2A 2GALA 1W99A 4K6BA 3AMPA 1PGL2 2X05A 3NJZA 4XJ9A 1G9BA 1QY4A 1TE1B 3VKFC 2HH9A 3FWEA 5A6XA 1KRIA 5C9AB 1RB8G 2C9AA 3H8RA 3LB9A 3DV8A 4XBLA 1S2EA 3CKHA 4LBQB 2WZR1 1BEV3 2XJTA 1LGBA 1J3RA 4Q4W1 5FZEA 2JD4A 4CDXC 5FFOC 3WG3A 1AR73 3X29B 1BEV2 5I0DA 1A8MA 3HT2A 3N3HA 1R64A 2D43A 1KFXL 4K40A 4XCAA 1PVXA 3ZFEB 5FZ6A 1CAXB 3M3EA 1AR72 2D97A 4QX0A 4WZFA 4IEPA 3B02A 4YM1A 2PHXA 3M70A 5JAXA 1JYCA 1DQ5A 3K4DA 2R0FA 1RJ7A 2B7YA 2VCAA 5FZLA 3ZN5A 1S0EA 5LBEA 2QJVA 1UKGA 3I2FA 1S0CA 4OZOA 3ZFFA 2HWB3 4GJZA 5FP3A 1CESA 3C7FA 1AL0G 4L11A 1LHNA 5FY4A 3N9NA 2E7AA 3SNMA 2VE1A 4BXFA 3M1HA 2HWB2 4Y22B 5DPNA 2P37A 2P34A 3ZO0B 1RXFA 2W39A 4A7ZA 3LCPA 4CA9A 5F1RA 3RMXA 5J96B 4PIYA 1LENA 4LBKA 3SHRA 1W9WA 1N3QA 1UY4A 2X8KA 3B7MA 5KC5A 1QJX1 4OMDA 2IFRA 4B7KA 4P9GA 4XQ4A 5BNQA 4XFBA 5F3GA 3NAPC 4S2HA 2R1BA 2R1DA 3AYAA 1LU2A 4LNVA 5IK5A 1AF9A 4XQWA 3BOPA 4I3PA 4YGDA 5FZ4A 1OFNA 4YW3A 1W6NA 5JOYA 4Y24A 5K0UA 4MG2A 5FYSA 5FMCA 3Q8EA 4ASLA 4N7UA 5KWRA 2PXJA 2XB6C 3NQHA 3A22A 2PFWA 5JOWA 3ZDSA 4K1ZA 2VQ0A 3J8F1 2JIJA 3T4HB 2Q8OA 4DRVA 3QH6A 4XUOA 1BBT1 5KBFA 1UXXX 4L0PA 1SFYA 1LOFA 2QVSB 3K75B 1K5MA 2FDJA 3BU7A 4CDQB 3LPGA 2MNGA 4WBBA 2RVAA 1IQDC 5HPOA 5IUQA 1VRH1 4JGYA 4FOYA 4HETA 1WUVA 1QJZA 1WW7A 3DN7A 1FNYA 2DUOA 3WNMA 5EPAA 2IVIB 4LBNA 1RGSA 2EALA 2DUPA 2WZR3 2ZEYA 3E5QA 5C4WA 4D3WA 2AZ5A 4G3YC 1LGCA 3VBRB 1F35A 4CXWA 1RVF1 3FFQA 1ZZBA 4PCRA 1KQRA 4IV1A 1DZQA 2WZR2 3IT8A 3NV3A 2OUHA 1FAYA 4P9LA 4BIFA 1BQPA 2A3WA 1W6MB 1FV2A 2JDMA 5BUVA 2FDFA 1NCRB 5FP4A 1UPIA 1BYHA 5FAXA 2XL7A 3LDRA 4B3NA 2W08A 4NN0A 4YVSC 1DQ2A 5CB7A 2VUAA 3B9IA 4W50A 2GH2A 4DUXA 1B09A 4BISA 3GNEA 2WC2A 1STMA 4TLFA 5ERLA 4F8AA 1SLLA 4XTPA 2GSYA 1JZ6A 1DLLA 4FFIA 2BUKA 3ZYBA 3UK9A 4AYUA 2OT7A 1ZZCA 2RM22 1HLCA 3KMHA 2W95A 3H3LA 3W20A 2BBVA 4QKFA 4RA0A 1VB4A 4M4PA 1A78A 5LW9A 1J84A 5F6KA 2YV8A 1GANA 2JG8C 3OUJA 3MFCA 4Q0SA 3ES4A 2OX0A 2K46A 3CEWA 3ZXFA 4E4SA 3U75A 3DKWA 2YROA 4RGKA 3RRDA 3WT3A 3RZJA 5FUPA 3UJOA 3SQOA 1EV11 1W6OB 1Z7S1 1GOFA 2W47A 5T5LA 3WDYA 4D6SA 4LBOA 2Y0IA 3TNQA 5HCAA 4I09A 4QPIB 3O1VA 2EXIA 3NJYA 3RFRA 1ZRDA 5AC93 4FTSA 1Q56A 2FCTA 3UNPA 2W5FA 4LKEA 5FPVA 4EWAA 5CA6A 3OEAA 3J8F3 1F31A 4WVMA 3ZYRA 3HJRA 1LOGA 2C9KA 1ULEA 2KR2A 3JQWA 5AC92 2E51A 3IM0A 4LKDA 2W68A 3RYPA 2NMNA 5JR7B 2Y6KA 3J8F2 2VZPA 1OXCA 2BERA 5JZGB 4Z92B 3VZJA 4MGQA 3FX3A 5A6ZA 3TEZA 4QDSA 1Z78A 4QGNA 4AFDA 2ZGNA 3BI3A 1APNA 4I02A 2BBAA 2VW1A 4Y1YA 4QM9A 2R6QA 3VBUC 3WQ1A 3V0AA 3RG0A 1VAVA 2WBKA 3VKMA 1CAWB 4ATFA 2R16A 1PGW1 4FOVA 1RVF3 4AFCA 3TYJA 1FMD1 2CHHA 2YUEA 1WMEA 4GH4A 1HQNA 3N4MA 2CGPA 1YWKA 2H0BA 1LEDA 1RVF2 3WP3A 3ZXAC 1ZREA 3W58A 5CFDC 4C91A 1ULGA 2HYKA 3PMEA 5FQ0A 4CYDA 3BCWA 2W2IA 5IVCA 1V6IA 3AP6A 3DEMA 4KG0A 3P1IA 2BTVC 4FQ4A 1YQ8A 3HQXA 3HWJA 2QBXA 2BW8A 3KCCA 4UW6A 4QB6A 5FMBA 3H8OA 5A1AA 1RHI1 2QQWA 3KVBA 4JDOA 4O7XA 2VAUA 1V6LA 4QWNA 1D7PM 1H8TA 3POWA 4R52A 1E57A 1H8VA 4AVCA 2VMDA 3LA7A 4XUQA 4F3JA 3A23A 4CCDA 2O14A 4CEWA 1IS5A 1OQ1A 1HV0A 4AG4A 1QXJA 1W0PA 1MS0A 5FZHA 1YJLA 1ZNPA 2RJLA 3RWNA 1S0JA 1W6QB 4YW4A 1JZ8A 2B42B 4V2VA 1Z7S3 2VMFA 5FXXA 4HMZA 4DRRA 1JOJA 5FYIA 5FYHA 5IYYA 3MUZ1 5LA0A 2CAUA 4Z07A 4CCLA 4QHBA 1Z7S2 2P6HA 2O1QA 1GUIA 4GA9A 4B7EA 3ZN6A 3FL7A 2CY6A 5BNPC 2QCSB 1LB2A 1OF4A 4MGIE 4HFSA 1XE0A 3IIIA 2DCKA 3BODA 3S5AA 1CX1A 4OMCA 2Z2SB 4TLGA 3MZHA 3HT1A 3WHTA 3HR9A 4RQPA 1HB4A 1RJ8A 2DTYA 2E9QA 4YVWA 3VHNA 4CUBA 1LU1A 3RZHA 3A4UA 4LO4B 5GZCA 2WWSA 4NUBA 4XUPA 3ROUA 5IT6A 4BLJA 1G9DA 4O65A 5FTTC 5FPAA 3M3QA 1BLZA 1LJ7A 2W52A 5KXEA 2JDYA 3BN6A 5LZ6A 3NO8A 4ATEA 5FDBA 1FMD3 5FKCA 3VBOC 1W2TA 1JTZX 3VL9A 4YRDA 1WMDA 1VMHA 1XNDA 4XF0A 5HCFA 1PGW2 3P5BA 4DXZA 2F4PA 1JW6A 5C9AA 1FMD2 4CU6A 3VD7A 2HKXA 2VNRA 2BU9A 3JD73 5A3NA 2VZVA 5IK8A 3PUSA 3ZXEA 2JEMA 4R8HA 1QOTA 2ZX0A 5FZDA 3JD72 3KGLA 1N1YA 2SLIA 5JIAA 3HBZA 4Y3OA 4AVSA 4GMP0 4QX1A 2PAKA 3NV4A 2PHFA 1WD4A 3H50A 4QPGA 1RHI3 4YGEA 3R6SA 2RJKA 2XG3A 5CG8A 4HPKB 4ZPIA 3T09A 2ZZQA 3LE0A 4OCTA 1AZDA 3AFGA 2ZHKA 1RHI2 3NAPB 4PHZA 3TAYA 3U14A 2CSGA 2VZ3A 2X5IA 1S4CA 3B00A 4IEZA 5IAVA 2LM3A 5FZCA 5CISA 2AR6A 3WF4A 2WWJA 5FY7A 4LPLA 1EYBA 2XVKA 4AVVA 4EJRA 1G9AA 3VBFC 2EICA 1V00A 5G05L 4HLTA 3ON7A 1UYPA 2DU0A 2JD9A 2G1MA 3RI9A 4COUA 1LEMA 3VZOA 1OSGA 5GKAC 2BP6A 4JRAA 3H7YA 4X8NA 3H0OA 5JXIA 1JHJA 5A7QA 2ZKNA 1LOEA 1OFSA 4GULA 1OMIA 2RS51 5J3UA 1JXNA 2P6CA 3TOJA 3WINE 1Y4WA 4E9KA 5IVEA 4BLIA 4ZHNA 2WFPA 1GSLA 2FZ1A 5EYYA 1NXMA 1ONAA 2ZHNA 2VOVA 1O59A 2CDOA 1XBFA 1ZBA1 2YPDA 2XUMA 3K46A 3DYPA 1HKDA 5E6HA 4NJ4A 5A7SA 1X33A 2WR9A 4QDQA 4XBNA 3BUCA 2IC1A 2HEVF 3NJXA 4AI0A 5DUUA 1VBE1 2D98A 4Z8BA 1BJQA 1SLBA 4ISRA 5F6LB 5I0SA 4YVSB 1DQ4A 3E6DA 4ZY9A 4YW6A 4CU7A 4FPEA 1C1LA 4A7YA 4TYSA 1ZRIA 2RHPA 1AR83 5FMOL 4LKSA 5DQ0A 4LA3A 4XJ8A 4E2QA 5TSWA 4WM7C 1YFYA 1AR82 2PQSA 2B9VA 2WSVA 3CJIC 1ZRFA 4Q1RA 4AEJA 3UGGA 1S0BA 4AVBA 2VBBA 5GLVA 1NZCA 3SEPA 4B1LA 2VM9A 1E5RA 1TG7A 4YW2A 1UYYA 4B1MA 4UFJA 4DIQA 5B4NA 2O0OA 2JG8B 4YFWA 1GP4A 5FZ1A 3ZSMA 4CSWA 5A70A 4LLFA 1W9FA 1YC61 4JTOA 1UY3A 1A6CA 2B9UA 1UZVA 1FYUA 2VECA 3NNMA 3V0BB 2EAKA 2Q4SA 3CMGA 3MF9A 4AOCA 1E5SA 1UMIA 2WN2A 1W9SA 1G6NA 1JU3A 1CD3G 2GNTA 1LCLA 2JENA 5I0RA 3KCYA 1HRV1 2XPJA 1GV9A 3ZSKA 3WXPA 3DPRC 3BGAA 4TN7A 4DEVA 3RZGA 4A3XA 4IE7A 2BGOA 4R4XA 1N1VA 4XIOA 5EWSA 2FD8A 2VW0A 4C1WA 5I91A 1U5YA 2WIIB 1W0OA 2GC3A 5DDJ1 4MGKE 4V2WA 5C9AC 1H9WA 2RS53 1UCXA 3AP4A 3D82A 3JB4C 4H7LA 4U2AA 2PQQA 4WV8A 3V56A 3RJ2X 2R061 3DF0A 4MZUA 1TNRA 4I0AA 2ZHLA 4YG3A 2RS52 1PO13 2Y26A 5IAXA 3VBUB 1AL21 3WW1A 4GQ7A 1XPWA 3U07A 1QQP1 1PO12 4P9YA 2QQJA 1LAJA 4AFBA 3VDDB 1Y9QA 3BPSA 2WNUA 1PX4A 3LSEA 1F4AA 5C3OA 3IDAA 1BVVA 1X9TA 1FT9A 1SMVA 2QQUA 3WUCA 1QDOA 2JXAA 1K12A 1VBE3 3CZUA 5GALA 3U37A 3DCQA 5CFDB 2VCCA 4LBQD 4BWOA 3OBZA 3UJQA 5C3QA 3O1SA 1RUNA 1WCQA 4LR4A 1VBE2 3VKLA 1IG3A 2ZGLA 5FK7A 4QKBA 2CAVA 5C7GA 5H9SA 3OY8A 1BZWA 1OH4A 1QH6A 2ZX2A 3GXUA 3I3BA 3MV11 3WG4A 4B29A 4Q4X1 4LUMA 2R071 1HW5A 3NSTA 4PIZA 4FP2A 4P14A 3WV6A 1W8HA 5JPNB 2OZ6A 4BQ2A 2H0VA 3IPVA 1FATA 2R32A 3ZLIA 5ABJC 5D1IA 3D0JA 3IDCB 4RHV1 2Y6HA 4F83A 3F95A 4MH0E 2ZAAA 1QWRA 2FHRA 2KD7A 2VZQA 3VBHB 3HD8B 2D3RA 2P5BA 2PHWA 1YI9A 2B39A 4LQRA 4R9CA 2WO1A 4CEYB 2CYFA 4BQWA 3FFZA 4O9GA 1QEXA 1OOPA 2Q1FA 1N1SA 1XB9A 3CHXA 4HBNA 2BVVA 4HK9A 3WW4A 3USSA 5LRRA 3QBQA 4IW3A 1HRV3 1QJU1 4HZFA 4P5HA 1O3TA 1XNCA 1D2SA 3H8UA 2VMHA 2WN3A 4JRLA 4CDQC 5FZ3A 5L36A 2ARCA 2Y6JA 3E1F1 3I2GA 5BNPB 3AVSA 2HBTA 1HRV2 1LOAA 1LR5A 5KXCA 3ETPA 4TZDA 3D4KA 3ZFGB 4FOWA 4LTAA 4X6QB 4CCCA 2WFF1 5DDJ3 5C5UA 4CP2A 2ZOEB 4FPGA 4W6WA 1X36A 5EP9A 4K3UA 2FCVA 4H2AA 1MQTA 1MZFA 3H42B 1ULDA 2C4XA 2R063 5DDJ2 4OUMA 2E32A 3N9MA 4LBJA 2DDUA 5JSOA 1AL23 1X82A 3RQ0A 4COWA 2R062 4ONUA 5J7MA 1VB2A 4LOSA 3C7OA 1EP0A 4OFGA 1AL22 3LFMA 1CAUB 2JKBA 1UNBA 1IOAA 2ZS6B 3WNNA 1UU4A 1GQHA 4N9IA 4E27A 2WWUA 5AFBA 2JDPA 4BK4A 2PA7A 5FY0A 3T0BA 3NNGA 2OPKA 4AL9A 1H2LA 1BXHA 4N53C 2VQTA 4HVRA 4LBQA 5FZOA 1I9RA 5T3NA 2VGDA 3SCHA 4OI1A 1UOBA 3OPZA 2ZBJA 3PIGA 2JE7A 1GMMA 3THPA 3ZOIA 1SFNA 1RUG1 4Q4X3 2ORZA 3OGJA 4HOOA 2A3XA 3D3AA 2WNOA 3LIHA 3FE5A 4D7YA 1PM4A 4LO5B 1XNTA 2GAUA 2W87A 4KWUA 3WF0A 4Q4X2 2J42A 3ZFEA 4BQ4A 3E6CC 3BVCA 4X6RB 5FKBA 3V65A 3SXWA 4AAXA 2WZ8A 2R042 1US2A 2PAMA 1OVSA 4PQ9A 2QQMA 3MV01 1A8DA 1FX5A 3WY6A 3AZVA 4RHV3 1V6OA 3I59B 3LDKA 3N9QA 1GZWA 3VBFB 1ENRA 3OTFA 1YQ5A 4RHV2 3NNJA 4XFAA 3T08A 3AC0A 1DGLA 1OPOA 2VMCA 3KV4A 4Q5OA 4IDZA 1QJU3 2QQKA 1GP6A 1ND3B 5K9YA 2ZGTA 2G9FA 3SKJE 3MPBA 4GB31 5JZGC 1POV0 2FZ2A 2A7AA 3VBSA 4AI8A 4WVZA 5FZ8A 1QJU2 3L2YA 1JMUB 2WT1A 4ZU7A 2V09A 2Y64A 5FMOS 2H6CA 1SLCA 2WFF3 4CP9B 1LECA 1JYVA 1WW6A 2O8QA 5GLUA 4Y4YA 5F5CA 1MS9A 2B4KA 2ZXQA 3A21A 3LD8A 3MIFA 4P9WA 5L9BA 5FYMA 2WFF2 5KXBA 2ZX1A 1ND2C 3PU3A 4XVHA 4P00B 1YLLA 1NX9A 4IEXA 1OLRA 5ISLA 1WZXA 3U4SA 4MADA 1AYN1 1UY0A 2J22A 2X29A 3I8TA 2F4LA 4XXAA 2BJSA 2ZACA 2RV9A 2WNEA 1DBNA 4IV3A 3D8CA 3ME2A 1UW8A 3ZMOA 2WQ8A 1LRHA 1SACA 2YFZA 1AUYA 3AVRA 2WDBA 3N7JA 4XF4A 1SBDA 2FDHA 1JYWA 4J6GA 2OIIA 5T52A 3JB8A 3PVEA 4RFT0 5FREA 4WM7B 4AGVA 5JSRA 2VUDA 5FBZA 5EYXA 2YBKA 4PLNA 4Y1UA 4EQVA 2JDHA 1S55A 4ZS2A 4CPBD 2L9LA 3AK0A 4XE9A 2A3YA 4WM8C 2WZPP 3H1WA 4CCNA 1QXRA 1O7FA 1US3A 3RS6A 2NZ9A 1RUG3 2XL9A 4NWWA 3VBRA 1WGPA 1H4GA 5FPUA 2WA4A 4H55A 2ET1A 3SITA 1RUG2 1W6MA 3JCIA 1SDWA 4JTNA 5HV4A 5M0TA 2PLV1 2ZHMA 1QIQA 1NCQA 4XACA 4UFMA 3LDBA 3W9AA 4NE9A 5F3CA 4P08A 3KSCA 3AKPA 4XBQA 2JDAA 3PUIA 4JGYC 5EJ3A 2VNGA 2WA3A 2YC4A 3MIGA 5A3MA 3VD9A 1OQDA 1H2MA 3T0DA 3E6BA 5CBLA 1UD1A 3K2OA 1VMFA 5CFCA 1UL9A 4XFIA 1BK0A 4XURA 4HVQA 2WT0A 5BPXA 2ZGSA 1VBA1 1Y43B 2Y6LA 2LRPA 4GB33 3VDBA 3AZXA 4IV1C 4GJYA 2EVXA 1CAVA 2K9ZA 5LK7B 4PI0A 4ARXA 1M4WA 1JUHA 4YZ1A 4K9SA 4W4ZA 4GB32 3WLUA 3F2ZA 4JDNA 1SHWB 1GZCA 1CZTA 1V6NA 4FT8A 1XSRA 2H6BA 2XQRA 4HG6B 1C57A 4IEUA 3FC0A 5FZGA 1C1FA 5AVAA 4YW5A 4PIXA 4UFLA 1LHUA 4GKYA 3DKQA 2JWPA 5DZGA 4D7TA 2YFUA 5HI0A 3VZLA 2LALA 4IEYA 3GHMA 5D21A 3ES1A 4QPIA 3H1YA 2WSUA 2UWCA 5H9RA 3WHUA 4M4RA 2TNFA 1AYN3 4HANA 4IERA 5FCCA 4YYOA 3WUDA 4YARA 1BKZA 1AXKA 1T2XA 4AEMA 4W65A 1YO8A 2P3KA 5G04L 4BQXA 1W2AX 1AYN2 5A7NA 1TMF3 1SPPB 2UWAA 3VV1A 5FPXA 1U5ZA 5LATA 1O3SA 2RM21 2RG4A 5FIXA 2VZ1A 4CDUA 2EXHA 3I2KA 4BQYA 1LGNA 1TMF2 4OI0A 4UF0A 1X7NA 1RUH3 2PTMA 4B4RA 2HWC1 1JZ2A 3BALA 5F3EA 5J09A 2ARXA 1S0FA 4AZZA 1FXZA 2D44A 1O8SA 3POGA 4LUKA 1RUH2 4W8JA 3MW2A 4JV4A 1C5IA 5CADA 4KWJA 2WO7A 2DBIA 4L97A 4LIVA 4CPBA 4QPWA 5I8TA 1YEWA 2D6MA 1W8NA 1AVBA 5ABJB 2ZKLA 1MS1A 1OI6A 2AGSA 2PLV3 1NOVA 3OUHA 2JICA 4OHZA 1RUF2 3MLJA 1WCSA 5AC91 2GMPA 2PELA 1YXWA 1DG6A 4GKXA 1YUDA 2PLV2 1ALYA 1PMJX 4QQHA 3T2QA 1Y9MA 5L19A 2JG9A 5LB6A 1IGOA 5DUXA 3MFAA 1NE6A 3O0WA 2YGMA 2GN3A 1N47A 1XE7A 5FUIA 2ATFA 2A71A 3MLLA 5BYNA 1W6PA 3KF3A 4NHYA 2WNVB 2P4EA 2BNNA 4N43C 4NAOA 1VBA3 2CDPA 4QMAA 4ZKTB 5GZFA 2AENA 5T55A 3ATGA 2GNDA 4GH4C 4OHWA 4FAHA 1VBA2 3AJZA 2OW4A 4FPFA 2DFCA 2BWCA 1TZOA 1MS4A 2V4AA 4XFCA 2IXCA 4AFMA 3I2OA 2GDFA 1UY2A 4BQ3A 2D5HA 1NLSA 2BZDA 4RFRB 2VMIA 1AXYA 1MZ6A 5LA9A 1FV3A 4AQ6A 4IQPA 1GOHA 4AHYA 4TTGA 1POV1 3O12A 5FLJA 4AEDA 2IXHA 4XFFA 1WCKA 2W0XA 1QF3A 4CDWA 2VZOA 1RMU1 3DYOA 4MHUA 2MEV3 1RUI1 4QKDA 2PHDA 1H8TC 4ES8A 4Q8LA 3LOBA 2G19A 3H1MA 4BOWA 3IDEA 2IWGB 4JGZA 2HJIA 2UYAA 4LK6A 3S7IA 1REEA 1JOBA 2MEV2 2RM23 1Q5OA 2VMEA 2Y8KA 3HQRA 4FPHA 4N53B 3VHPA 1XC6A 3JUUA 5A3UA 3W5MA 4QX7A 3KVAA 1YCIA 4A6SA 4DY5A 5T5OA 2HWC3 4BIOA 1OKOA 3GZUC 1UY1A 1X9PA 4IGPA 4CDXA 5CEHA 1ZRCA 2XWBB 3POJA 4Q4V3 3W21A 4UXAA 3GZTB 3W5NA 1RIRA 4AE2A 4YFZA 2HWC2 5LBFA 3DGTA 3WNXA 5KR7A 4PDWB 3WP5A 3PVOA 5GZGA 4Q4V2 3AP5A 2LUWA 2D7FA 5FO8B 2NP0A 1DIWA 2GC0A 1HB3A 2A6VA 1LOCA 2BNMA 4EROA 3EYPA 3O1PA 1ZZ9A 4U36A 2W94A 4HK8A 2JKXA 4FPLA 3IZOA 3RSJA 2FMDA 1Q8OA 2AACA 2WYSA 1DGWA 2DCTA 1O4YA 1W04A 2VZTA 1GNHA 3LPFA 3POYA 3UGHA 4FVVA 1ZYBA 4RQPC 5KC6A 1DDLA 1JOPA 4YVWC 5IFPA 2BWAA 5HXMA 2V73A 4L92A 2ZZJA 4BMEA 4DZGA 1HJGA 4GWIA 3BTAA 2E6VA 1PNFA 2OQ7A 3HVDA 4HPKA 1AR63 1AX2A 2VW2A 3M3OA 3NAPA 5CYYA 3K51A 5L73A 3H8XA 5IVBA 2A5ZA 5GLWA 1AR62 5FZAA 1YQ6A 1ND2B 3R0RA 4OZXA 2D6OX 4URTA 5IWFA 3VDDC 3ZFFB 3I97A 5BNOA 3JU9A 4D94A 3IWZA 3BIEA 3LEGA 1KJLA 4CVUA 3JD71 2P1BA 4XDOA 3LWCA 3O0XA 4L8QA 3AB0A 1POV3 1KJRA 5FYVA 2VD7A 1I5PA 1RMU3 4QPGC 1RUI3 2HEWF 5FOJB 3BTXA 4QB1A 3AFKA 1UKRA 3CLPA 5FY8A 3J26N 3UKNA 1UIJA 1RMU2 2HBUA 1RUI2 2W92A 4CCMA 3RGBA 1HX6A 2X5IC 4MXVA 4WM8B 4A6OA 1W6NB 1XYOA 5K0UB 3USUA 4DPNA 5T54A 3MI8A 4NMIA 4FFHA 4IEOA 1C3HA 2QE3A 1JODA 1YI7A 3FHAA 2HWF1 3NJVA 4Y20A 2WYFA 2ARBA 3ZXDA 3AMHA 3VBHC 2BNOA 1LHWA 2VVFA 4CEYC 3ECQA 2WZEA 1IQAA 1K5MB 2JECA 3MPPG 3LIGA 1QDCA 5I0UA 4JGYB 4Y5Z0 1QGLA 3PUAA 4S2DA 3RZMA 2HLEA 3BYWA 2TEPA 4DY3A 1JYNA 3UETA 3ZXLA 2AC1A 3G7DA 4B4QA 5LA1A 4YGBA 1PK6C 5A33A 3AM2A 4RD7A 3ZFGC 4XABA 1AYM1 2EF6A 3JBG2 3U1XA 1D2QA 3CDZB 5FJHA 5FZ0A 1OQEA 3DXUA 4IV1B 5FXZA 1W05A 4K8RB 3VL8A 3EB7A 5FV3A 5LCWL 2P3IA 4CUCA 4HKWA 4GZ9A 3KM5A 2BYVE 5JI9A 3THTA 3M3IA 1YNAA 4HSJA 4ARYA 1C4RA 2ENRA 3LA3A 1M06G 3PJYA 4O9EA 2VTXA 2EIDA 3AZZA 1MR5A 3GCWA 5LY2A 4RR3A 4UW5A 2HWE3 1I1EA 2RE9A 1NQJA 1QH7A 1ZA7A 4QX3A 1S1AA 3RPQA 1AR81 2XJRA 5C3PA 4NPLA 1ZVFA 2HWE2 4IE6A 2GU9A 5AVPA 5E88A 4XC9A 1ODMA 4ZXEA 1WCDJ 3OBRA 5FMDA 1PZ9A 5F9TA 3TBDA 2YDEA 2UURA 1OA3A 2J1TA 3ZYPA 4FCAA 5GJ6A 1Q3EA 1IPJA 1SBFA 1QJEA 3ITQA 4KU8A 3RMYA 3UESA 1F9KA 2GP3A 2GH8A 4MGYE 4P5YA 3T3YA 1RUE3 5LRSA 1KEXA 1B35A 3KWVA 3ABZA 4DMIA 4E8CA 5LY1A 1D4M1 3B9CA 4J1XA 4AEKA 3VD4A 5E8AA 1RUE2 1T6GC 2YPJA 4XYXA 4D69A 1GZ9A 3AYEA 3T1MA 3VD5A 2RS12 1OLME 4DXSA 1H0BA 4NHKA 2HWF3 2XGXA 4WVMB 2ZGUA 2XVGA 3Q8BA 4YGCA 5CAZA 4C1XA 1V9U1 5CFDA 2XLFA 4LITA 4UBHA 3WEZA 3VKOA 2HWF2 1GU3A 1VPHA 4ZXKA 5EJZB 1Q8VA 3IAPA 3VZMA 2QQOA 4Y5SA 2VY0A 4XEZA 1ASJ1 1ND3C 1S0IA 2VXRA 5C3SA 1FOD1 2DV9A 1Q8PA 3V0AB 3HN1A 3MF6A 2DUQA 2ADDA 4GIQA 1K45A 4N43B 3VDCA 4E8DA 1AYM3 5J98B 4M3CA 1R083 4CU9A 1PO11 2C26A 4LE3A 1Q8QA 4GH4B 2WNUC 3LQCA 1YIFA 1N3OA 1AYM2 2J1SA 1DQ1A 3OCPA 1R082 2F17A 1GNZA 3EO6A 5E1RA 1DYPA 4F7ZA 1CPMA 2XKPA 3P3NA 1HXS1 5JOZA 1SBEA 4MLOA 5C70A 2KA3A 3I7DA 5FQ0B 4LLOA 5GLTA 2DVBA 3WG2A 1S2KA 2VZSA 1YFXA 3ST7A 3FBYA 2ZPXA 2WUHA 5C8CA 1JYTA 4H3WA 4LO8A 3S0MA 3N7KA 3HNMA 4AW7A 5LBCA 4XAEA 1S0GA 2ADEA 2PAEA 2AUYA 5JVVA 2A75A 4NVPA 2VL4A 2XJVA 5BNPA 1OUSA 1H8TB 5DZEA 1R091 3PL0A 2C1FA 3HOBA 2VMGA 4FFGA 3B94A 1ODNA 2XH6A 3TN93 3VB9A 2WO2A 2YZ4A 2AYHA 3S5QA 1CZSA 1V6KA 4L2NA 4XTMA 3APBA 1MS5A 3BIWE 3TN92 1WLTA 1UQXA 4YNIA 1AJKA 4FI9A 1A34A 1QJFA 1N1TA 4AQSA 4I30A 3PDQA 2K2SA 4Z2AA 1D4M3 3VLBB 3TWIA 1HRI1 1I6XA 1RUD1 1RUC2 3T2OA 3T2PA 3OJBA 3VBOA 5EXOA 1T6BX 4YM0A 3ZDVA 5FBJA 3IN9A 3BU0A 1D4M2 2JJ6A 5A3OA 5JI7A 5I8SA 3ZN6B 4XILA 5FZKA 4JDMA 3WQ7A 5C71A 1V9U3 3POSA 4E2SA 2WT2A 3DECA 2JIGA 2ORXA 5C6CA 5F7UA 2E26A 5C5TA 5ANQA 1JZ5A 3RNSA 1V9U2 4RQPB 4XXPA 4YVWB 1H30A 2ZEXA 2JE8A 3AP9A 3I2IA 4KMQA 5A3WA 4YWAA 1NY72 1ASJ3 1SQ4A 2OUJA 3FN9A 4QX8A 3THDA 1FOD3 3VKNA 1DHKB 4HSLA 1OHFA 4A4AA 3NKGA 3AKTA 1ASJ2 1COV1 4L9BA 2OYZA 1JZ3A 4YZ2A 1FOD2 1NG0A 2K0GA 4HONA 3O1MA 2ET7A 3GZEA 2BFUS 3E5UA 1K3IA 2VVDA 4MXWB 1JH5A 5CU1A 3ZPYA 3WOGA 2WABA 5BNNC 1UF2C 2G9GA 1HXS3 2XDVA 4QQLA 3K3NA 3ZSJA 4NAMA 2OVUA 1H6XA 2QQNA 2W1UA 5BXXA 5LWBA 4LHLA 4CCEA 2QQLA 1O3RA 1OD3A 2F6BA 1GNYA 1HXS2 4XMAA 1XYPA 1GP5A 3LKJA 4M0HA 1JI6A 2W9XA 4K1YA 5SV8A 4UFIA 3VDAA 2VG9A 4BM8A 1DQ0A 5FLIA 3URFA 5J48A 1ZRRA 2WKKA 4KQ7A 2YGLA 1HV1A 4QPGB 1Q43A 3O1OA 3UT0A 1VP6A 3GCXA 3OYWA 1R093 4UYBA 3M3CA 3KV9A 4CP9A 1PZ7A 4EE2A 1OC1A 2X5IB 3DUIA 1PMIA 3BTYA 1R092 1E5HA 5FO9B 2R041 2NYYA 3E5XA 4XF1A 1UOFA 3N9OA 4IXLA 4ZS3A 4AF9A 5C8WA 2XOMA 4CP0A 4UFHA 2VQAA 5ANNA 2XQXA 1HRI3 2XBO1 1RUD3 1V0AA 4QGMA 2VULA 5E89A 4BDVB 1CQ9A 1NKGA 1WWYA 3J7HA 3ZR5A 4BXSV 2JB4A 2CL2A 1YHFA 4IGQA 3AMNA 4OHVA 3Q9OA 2XVLA 1HRI2 1RUD2 5D8AA 4CE8A 2DCZA 3ENRA 5JLVA 4CTEA 3VBSC 3WQ0A 4Q4Y1 4DB5A 4MVTA 4YG0A 5B2GB 4N8MA 5KXDA 4IGOA 3S30A 4IE5A 3RDIA 1SLTA 4YZ4A 3SLIA 4O61A 5A80A 2WNVC 1PK6B 3CJIA 3VHOA 3IMMA 2QTWB 3ZYFA 2D6KA 4XHBA 2VTFA 5GM0A 5L7OC 4FTBA 4DOUA 1H1IA 1OA2A 2IXLA 4DFSA 2Q8CA 5IK7A 4RS5A 3NW4A 4LULA 4Q1PA 1COV3 1G9FA 4NIHA 4FPYA 4HT1T 1H9PA 3IIAA 1VBB1 3AYCA 1UU5A 4FOQA 4A2UA 5DAXA 1COV2 4P9JA 2BGPA 1J1LA 5F5QA 1O3QA 1REFA 1OBNA 1IZ3A 4NRQA 2V4VA 5B4XA 5DAQA 3CBNA 3JQXA 3RZZA 1GBGA 4FPKA 3DPRA 3KGZA 3WG1A 3ZXGA 2JDUA 4GALA 1Y3TA 3IMNA 1W8ZA 3DL3A 3CNAA 3ORJA 3GF6A 3WNPA 3PHMA 1JYIA 2Y6GA 2A73B 2XXZA 2XWJB 2D5FA 3HN3A 2D6LX 3OBAA 2BVBA 2BRTA 2R0HA 1PO23 1XJAA 2E31A 3FLTA 3GM8A 4Q0UA 4IEVA 2BPA2 1MVQA 2P3JA 3QOPA 2QFEA 2FMYA 1BCXA 3ALQA 1PO22 1XE8A 2X53S 1AXZA 1NCQC 3O14A 2GN7A 5A3TA 5JOXA 4PLMA 4E4HA 5IVVA 4AGRA 1D4VB 1XQNA 2R043 1EPWA 1NA1C 2RDRA 2DVAA 3MW4A 4PDWC 3HIFA 1CAXA 2UYBA 1MEC1 3M7AA 2BEOA 4LOTA 3ZIWA 2I74A 2QUOA 3O7OA 1REDA 4PT6A 5FZ9A 2LS6A 2XBO3 5JMOA 1UYZA 4QXBA 1YYNA 5CVRA 3GHNA 3PMSA 4FTEA 3WVJA 3A0KA 3PNAA 2XHNA 1SPPA 4K20A 2J1AA 2XBO2 4WZCA 3PVNA 1W8UA 4I3GA 2C24A 1SCSA 3T1LA 5CKQA 1OURA 4Q4Y3 4Y22A 5A1LA 1QOSA 4P9IA 2P2KA 2ID4A 1IPSA 3TRSB 4JAAA 3GALA 2B8MA 3HEIA 4Q4Y2 3LF7A 4LIUA 4WVWA 4KI5M 2VNOA 2ZEWA 5F39A 4MHRA 2D6NA 3GBFA 4HL0A 3ZYGA 3MHZA 2FBEA 3DYMA 3VHRA 2V5YA 2VQUA 3AKRA 2WNUB 2DVGA 1WLDA 4MYEA 2VO5A 2VZRA 5CG9A 1H1AA 1F4HA 4N7IA 1AR91 3LSDA 1VBB3 1QKQA 2W1SA 3OD4A 3ZFFC 2DURA 2LW8A 4AHWA 3W59A 4NWVA 1VBB2 4CDUC 3WCSA 4FP3A 4DO0A 2VNVA 3OY8B 1TMF1 1XNKA 4CDQA 4ORFA 4MX3A 3KT4A 2ZMLA 4SLIA 4AWDA 2E7QA 4BK5A 2DBNA 5JPMB 1CPNA 1RUH1 4DUWA 4LJHA 1LOBA 4HN1A 3ILNA 3IPVB 1UXZA 2DVFA 4EV0A 1ZZ7A 1WCUA 2PMWB 3SH5A 5FYBA 5A6QA 3TEXA 1URXA 3I2JA 4QQPA 1LNSA 1SEFA 5K0UC 4OULA 3SISA 2VPVA 1HJFA 3QLQA 4NHLA 2VBPA 1DYOA 2A70A 4QXHA 1RUF1 2WS93 3ZVXA 4C8DA 3UYJA 1JN2P 2CWSA 2Z4FA 4NHXA 1F5JA 1L3JA 1MEC3 2VOXA 1G7YA 2JG9C 2WS92 1NCRA 2Z5WA 2NM1A 1GFF2 4Y1VA 1W90A 5FXVA 1LOFC 2C0ZA 4BCUA 1K5MC 3LGRA 3ACHA 4CU8A 2VOWA 3PVBB 1MEC2 1RC6A 3C2UA 1DZTA 4A44A 3LEMA 2Z42A 3ZM8A 4NRPA 5D2AA 4AGGA 2YYOA 4LXLA 1KS4A 2Y6FA 5APAA 4DXTA 3S6PA 4Y1ZA 3M4FA 4CCKA 4W6XA 2Y0OA 3RZLA 4KBZA 4N53A 1MQTB 5LBBA 3HNYM 1SG3A 5C4WC 4OLLA 1O6UA 1DP0A 2ZGQA 4FFFA 4YLZA 4XIKA 2EIEA 5CNAA 3SKVA 4QXKA 5ACA1 4QU2A 1PGSA 3K48A 4OUSA 5A7OA 3ELNA 2J1VA
chains in the Genus database with same CATH topology
1R1A1 2VUJA 3NKTA 4S2FA 4LO6B 1BMV1 1MS8A 2RS32 5KHKA 2WQ4A 4AEDC 4EN6B 4CZSA 1W6OA 4CDWC 5BNNB 1AR93 4XDQA 3UL2A 3QACA 4H7MA 3GBGA 4FAGA 3ILFA 1VBC3 2XJPA 4JGZC 1PNGA 1QMJA 1AR92 2UY8A 3G6JB 4KGGA 4COZA 4BZ4A 1J3QA 2MEV1 1O5UA 4M00A 1VBC2 2E53A 4YZ3A 5JZGA 4EWEA 3WR0A 1XU1A 2GZWA 2ZGKA 5JMCA 2EXKA 1QOOA 3WX5A 1CVNA 1G86A 2DWRA 1XYNA 3L9JT 5JCTA 2QNKA 2KM2A 5KHGA 1WW4A 4Q4V1 1WBFA 5FLHA 4Q26A 1R1ZA 1CAWA 1ND2A 3H9AA 1GZWB 2CWMA 3OBTA 4J1WA 1MZEA 1MVEA 2YY1A 2TBVA 4KBBA 1ENSA 1RUF3 1O91A 2PHRA 4KWKA 4AI1A 4X8PA 2HWD1 5DXDA 3S7EA 2YC0A 2DCYA 2JX9A 4BMBA 3D5OA 2I2SA 3EXUA 4XF9A 3VBSB 1DYKA 2OA2A 2I07B 1XRUA 1UN1A 4KGQA 1XNBA 3R4UA 1ZZ8A 3ZXJA 1WD3A 4WM8A 4NO4A 1AR61 4MGZE 1KITA 5L7OB 2NPIA 1RTVA 1O4TA 5ACA3 4GXLA 2QDRA 2ZGMA 1MS3A 4V1PA 5BNOC 1R1A3 1D0GA 1QJY3 4I01A 5ACA2 4XOGA 1LODA 4XPVA 3IBMA 4MV2A 2CV6A 4PF5A 1W6QA 4Z2WA 1R1A2 4IV3B 4ISQA 1QJY2 4BYYA 4I0WB 2UWBA 5JWPA 2TUNA 3ZYJB 2QZ2A 4EN9B 1BMV2 1OD5A 1HIXA 1VAKA 1BK1A 3EQEA 3PTYA 3VZNA 1TQ5A 2XJUA 2XLGA 4R9BA 4NHMA 3FZ3A 4QQOA 4BHPA 4Q4W3 4CEWC 1HQWA 4Q27A 1FI2A 3SCGA 5A32B 4Q4W2 5KHIA 4Q0PA 1TNFA 2Q0AA 1NCQB 4XF3A 4G9SB 4Q2FA 3WP6A 1AJOA 1QNWA 3N7LA 1NA1B 3N36A 1LULA 4AVAA 3RYRA 4R9DA 4PJYA 2DVDA 4K21A 4K8FA 5DG1A 2HEYF 5CFCB 1ZBE1 3D0SA 4D7SA 3KD4A 2HWD3 1XXNA 3I4IA 2XHKA 4M01A 3JBG1 4XETA 2HWD2 4INDA 1CAVB 4W6YA 3FMGA 4E4DX 1O4ZA 2DYCA 1QJX3 5H9PA 2RR11 1DFQA 2WL1A 2D3PA 2N7GA 4COVA 1QJX2 1KDKA 3O5SA 2NN8A 3E97A 3OF1A 4QX5A 1MZ5A 1NE4A 3VGIA 4ZU5A 4L99A 1ULFA 1LKNA 2EXJA 4RR3C 4QD2A 1N3PA 5DG2A 3J9SA 4B8EA 4QQ2A 3B3QE 4Z1VA 3RJRA 4BQ1A 2VVEA 1BBT3 2HWE1 2ZGPA 3B01A 2NQYA 3B5LB 4CDUB 3SH3A 1VRH3 2Z69A 4LBMA 1BBT2 1UX6A 5FPZA 2ZGRA 1PIV1 3WDTA 3ZXKA 3ACLA 3H3UA 3FBMA 1VRH2 3ZN4A 1IPKA 1WMFA 3RI8A 4KNCA 1B35C 4N43A 1F5FA 1OKQA 2BFUL 4RGGA 1UMZA 1RUE1 4EN0A 4TWTA 3AXDA 2IXJA 3OGGA 4IEWA 2RS11 4XJZA 5GZDA 4C90A 2ZMKA 1KXGA 2A6WA 5DUVA 2GMEA 3GYDA 1LESA 5I8YA 2FQPA 5LK5A 3ZIXA 1G8WA 2JG9B 1CGPA 2O8OA 4IETA 4YVSA 4AQTA 1SLIA 3A0NA 3AYDA 4KG8A 4QT6A 1W6PB 1ZBE3 4XFGA 2UY9A 2E7TA 2YHJA 4AVTA 3ZX7A 4AI3A 1TEIA 1WBLA 5KHJA 4BE3A 1YFUA 3JBG3 1ZBE2 5FO7B 5JDBA 4Y1XA 5JIUA 2R49A 3AZYA 1ZX5A 5C4WB 5E16A 3MICA 3NL1A 1R081 2C5DA 4AHXA 2I45A 2RR13 4LHNA 1LHVA 4PBOA 4TSVA 1KD7A 4HKOA 3AKSA 4ITCA 3CJXA 4AK3A 4SBVA 4QPYA 2JG8A 1EV13 2RR12 3UKTA 3WD5A 1CR7A 5C8CC 1CJDA 3MIBA 4COYA 1SLAA 3V0BA 1EV12 1OA4A 4AEDB 4CDWB 1NQDA 2DTWA 4FQZA 4N9HA 1UAIA 1GKBA 3ZMNA 2E63A 4Q0VA 4CP1A 5DUWA 2WLQA 3FUOA 3FUQA 4JGZB 3BOWA 1U5IA 4P9XA 1IS4A 4DINB 3L2HA 3R05A 3AP7A 2DCJA 1PIV3 3U4XA 3IKWA 1U5XA 4CDXB 3TN91 5A3LA 3NVCA 4M3CF 1PIV2 4HVOA 3B69A 4GWMA 4Q0QA 4A7KA 4Y26A 1U12A 1WLCA 5C33A 4META 1X50A 1YFWA 1QHDA 1RUC1 4FO9A 1V6JA 3VBUA 3FHIB 4I0BA 4PBPA 4MXWA 3EJKA 2RS13 1O5LA 3MIHA 4UBGA 3QCWA 4UW4A 1AHSA 1UZYA 1NYWA 3VDDA 5K8SA 2WQZC 4YZ5A 1PZ8A 4IL7A 1TME1 4HN0A 1D0HA 5T50A 1Q8SA 5BY5A 1V6MA 1CX4A 1NY71 5EV7A 3J4UH 4ES9A 4PLOA 1F8VA 2DF7A 5BV6A 1ZZ6A 5HBAA 4AXOA 3QH7A 4LA2A 1G9CA 2XLAA 2ZA9A 4M0NA 4BH9A 1HQLA 4K7JA 2D40A 5IK4A 3TB0A 4FXGB 1GICA 4EN7B 2UU8A 4IESA 2RMU1 5BNOB 2CGNA 3MGUA 3QD6A 3WW2A 3H3ZA 4IEQA 4S2GA 2ZABA 1DGWX 3R4SA 3BPZA 3VBHA 2QKDA 1UU6A 4KU7A 1VBD1 4CEYA 3AMQA 2ZMNA 4RL7A 3U0ZA 4I2OA 1C5HA 3KT7A 4FPOB 4YG6A 4XFHA 3WDWA 3U10A 1S0DA 4XJAA 4ASMB 4NR1A 4OI4A 4C0HA 1S2BA 1PK6A 3ZFGA 1GYKA 3USUB 1DQ6A 4CEWB 3VZKA 3AX4A 4NPRA 3HAGA 4RGAA 4WVVA 4GWNA 3D6EA 2AH2A 3CU7A 1KFUL 4Y20B 4XJUA 4FXKB 1RUC3 4YM2A 3ZYIB 5EFUA 4LHKA 1V70A 1QNYA 1ENQA 3JZVA 1DGRA 1OOPC 1KS5A 3TNPB 4JVAA 5D8AC 2ZAHA 2PHLA 1AX1A 1IS3A 1CAUA 3O0VA 3VUOA 1PM7A 1ZM1A 1VAMA 1IKPA 5FOBB 1H2NA 5T5PA 1WA4A 3V64A 1X8MA 1TME3 4EWDA 1JBCA 5LEKA 1KDMA 2ZGOA 2ZX3A 4YW1A 4AHZA 1GLHA 5A33B 1TME2 4R9AA 1CONA 4JQRA 1RUJ1 4RS5C 5DZFA 2ZCWA 1MQTC 1A3KA 2EAAA 1F2NA 1ENXA 2OZJA 1GR3A 3MYXA 2ERFA 3KQRA 4YM3A 3AXEA 2ES3A 4DS0A 1VALA 4LE4A 2B5HA 4AFAA 4RR3B 1YRZA 2RMU3 3GZAA 1ZA4A 3KCXA 4OHYA 2CGOA 4KH9A 4LT5A 1RINA 3I59A 2YXSA 4FPJA 1WLWA 1U0AA 3VBFA 2RMU2 4DQAA 1VBD3 2Q1MA 3N35A 4H14A 2A6ZA 1CIWA 2ZX4A 5CIRA 1J58A 4KWLA 3IDBB 2IZWA 5I93A 1IKQA 5J37A 2Q30A 1VBD2 1ND3A 4E2GA 3C3VA 2WINB 1RUOA 1DGRN 1PO21 1EPZA 2QDNA 1B35B 1ZBA3 1VR3A 2EA7A 3ZFEC 1BVP1 3WP4A 1QXPA 1ZBA2 4LBLA 4XZPA 1LHOA 4LO7A 3UKVA 4XQDA 4HKLA 2ZJCA 2NMOA 5I0TA 4QGLA 3FLPA 4E4ZA 5AFEA 2LTNA 4OHXA 3WW3A 1C8M1 3NWKA 1QU0A 1UPSA 3I2DA 1J1TA 1NXD1 1DF0A 2NLRA 1LTEA 3I54A 4M3CB 3LZZA 3LAGA 4WM7A 2GMMA 3MEPA 1VIWB 4FBFA 1RUJ3 3INAA 3LA2A 1IS6A 4XJWA 1RL3A 1DZRA 4AQ2A 2CNAA 1RUJ2 5GLZA 1YJKA 3ZSEA 2B46X 5HCBA 2PHTA 4Z82A 5C8CB 4QM8A 3UV9A 1I3HA 2DFBA 4GMP1 1FNZA 2XKOA 4IV3C 3ASIA 4N90A 2IXKA 1OPMA 1OLQA 1X8EA 3KZ4C 1SCRA 3GBWA 5J36A 4EN8B 3MDPA 2XJSA 4JC1A 3VBRC 4XW3A 5HXVA 4NOTA 1H2KA 4CRQA 3HMYA 1QQP3 3NV2A 1J3PA 3AJYA 3AZWA 3SH4A 3VBOB 1PHMA 4Q29A 1NCRC 2JE9A 2WS91 4RSUA 2Q5TA 4DB5A 1QQP2 4BA6A 1HDKA 1UZZA 3H7JA 5BNNA 2P17A 1MACA 5H9QA 3SMHA 4FSJA 4OVEA 2ZTNA 1ULCA 4MUVA 5FRAA 1GQGA 1PVC1 5CFCC 2VOKA 4DNYA 5LEJA 1C8M3 1DU3D 1JUIA 3OD0A 2R073 1C8M2 2KXLA 1C8NA 1H4HA 2QZ3A 4MSVA 4XHXA 2GNMA 2EIGA 1VLNA 5EZWA 2R072 1Z0HA 1EY2A 2RS31 2DU1A 3AKQA 2B45X 3PLQA 1FPN1 3RYKA 1EAH1 1I5ZA 4FPCA 4QPIC 2AREA 2QQPA 1PGL1 1C28A 4UW3A 5ABJA 5GZEA 1CN1A 3CL1A 3WDVA 2MHFA 2ILMA 4GMP3 1XU2A 1VBC1 3EHKA 4BPZA 1J59A 3U11A 5KHHA 4ZU4A 2MPFA 4JCKA 4LEJA 1BEV1 3CO2A 3OYWB 2A6YA 4Q8KA 5K7PA 3FLRA 1Y7BA 3R4DB 3PJQA 2GC2A 2IFWA 1AR71 2D6PA 2VU9A 2WNVA 3MLKA 1RITA 3MIDA 2Y38A 1AX0A 5L7OA 3EBRA 3ILRA 3ETQA 2GC1A 3KS7A 2XJQA 2IXIA 3KLSA 3CF6E 1W2UA 2HWB1 2WLPA 3WZ1A 1YIPA 3MIEA 1OOPB 3VN4A 5D8AB 2JDZA 2D93A 2Q1ZB 4R4ZA 1WW5A 5SV5A 3AMMA 4OI2A 3M8LA 1CJPA 5T5JA 3KB5A 3P3PA 4M3CE 4KL1A 1PVC3 2PN5A 3LOIA 2WJSA 2YMZA 2SBAA 3CJIB 1PVC2 2VH9A 2GNBA 3WDXA 2D3SA 4RS5B 1W39A 3MW3A 3WDUA 4B4PA 5A32A 3N7MA 3BB6A 2Z79A 2G4IA 2R30A 5JSPA 4G4FA 1JHNA 1IHMA 3ZSLA 2BQPA 2RS33 3NV1A 1NA1A 1H1MA 1FPN3 1QJY1 2CTVA 3FJSA 4AI2A 4PDWA 3SCFA 3WCRA 4C0BA 2PYTA 1EAH3 3M2MA 3T2TA 3KT1A 1NLRA 2ETEA 1UIKA 4YSFA 2BGCA 3DPRB 2A6XA 1FPN2 2PHUA 1EAH2 3B93A 4XMIA 1VJ2A 2GALA 4K6BA 1PGL2 3AMPA 3NJZA 4XJ9A 1G9BA 1QY4A 1TE1B 3VKFC 3FWEA 1KRIA 5C9AB 1RB8G 2C9AA 3LB9A 3DV8A 4XBLA 4LBQB 2WZR1 1BEV3 2XJTA 1LGBA 1J3RA 4Q4W1 2JD4A 4CDXC 5FFOC 3WG3A 1AR73 3X29B 1BEV2 1A8MA 3HT2A 3N3HA 2D43A 1KFXL 4K40A 1PVXA 3ZFEB 1CAXB 3M3EA 1AR72 2D97A 4WZFA 4IEPA 3B02A 4YM1A 2PHXA 3M70A 5JAXA 1JYCA 1DQ5A 2R0FA 1RJ7A 2B7YA 3ZN5A 1S0EA 2QJVA 1UKGA 1S0CA 3ZFFA 2HWB3 1CESA 4L11A 1AL0G 1LHNA 2E7AA 3SNMA 3M1HA 2HWB2 4Y22B 2P37A 2P34A 3ZO0B 2W39A 4A7ZA 5F1RA 3LCPA 3RMXA 5J96B 4PIYA 1LENA 4LBKA 3SHRA 1N3QA 2X8KA 3B7MA 5KC5A 1QJX1 2IFRA 4B7KA 4P9GA 4XQ4A 5BNQA 4XFBA 3NAPC 4S2HA 2R1BA 2R1DA 3AYAA 1LU2A 4LNVA 5IK5A 1AF9A 4XQWA 3BOPA 4I3PA 4YGDA 1OFNA 4YW3A 1W6NA 5JOYA 4Y24A 5K0UA 4ASLA 4N7UA 5KWRA 2XB6C 5JOWA 2PFWA 3ZDSA 4K1ZA 2VQ0A 3J8F1 2Q8OA 4DRVA 3QH6A 1BBT1 5KBFA 1SFYA 1LOFA 2QVSB 1K5MA 3BU7A 4CDQB 2MNGA 4WBBA 5IUQA 1VRH1 4JGYA 4FOYA 4HETA 1WUVA 1QJZA 1WW7A 3DN7A 1FNYA 2DUOA 4LBNA 1RGSA 2EALA 2DUPA 2WZR3 4D3WA 3E5QA 5C4WA 2AZ5A 4G3YC 1LGCA 3VBRB 1RVF1 3FFQA 1ZZBA 4PCRA 1KQRA 4IV1A 1DZQA 2WZR2 3IT8A 3NV3A 2OUHA 1FAYA 4P9LA 4BIFA 1BQPA 2A3WA 1W6MB 1FV2A 5BUVA 1NCRB 1UPIA 1BYHA 5FAXA 2XL7A 4B3NA 2W08A 4NN0A 4YVSC 1DQ2A 5CB7A 2VUAA 3B9IA 2GH2A 1B09A 3GNEA 2WC2A 4TLFA 4F8AA 1SLLA 4XTPA 2GSYA 1DLLA 2BUKA 3UK9A 4AYUA 1ZZCA 2RM22 1HLCA 3KMHA 2BBVA 4RA0A 1VB4A 1A78A 5F6KA 2YV8A 1GANA 2JG8C 3MFCA 4Q0SA 3ES4A 3CEWA 3ZXFA 4E4SA 3DKWA 2YROA 3RRDA 3WT3A 3UJOA 1EV11 1W6OB 1Z7S1 5T5LA 3WDYA 4LBOA 2Y0IA 3TNQA 5HCAA 4I09A 4QPIB 2EXIA 1ZRDA 5AC93 1Q56A 4EWAA 5CA6A 3J8F3 1F31A 4WVMA 3ZYRA 1LOGA 1ULEA 3JQWA 5AC92 2E51A 3IM0A 2W68A 3RYPA 2NMNA 5JR7B 3J8F2 5JZGB 4Z92B 3VZJA 3FX3A