1LOFA

X-ray structure of a biantennary octasaccharide-lectin complex at 2.3 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
181
structure length
181
Chain Sequence
b'TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUME ISOLECTIN I (ALPHA CHAIN)
publication title X-ray structure of a biantennary octasaccharide-lectin complex refined at 2.3-A resolution.
pubmed rcsb
molecule tags Lectin
total genus 27
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lofA00
2AGSA 4ZXKA 3NV2A 1SLTA 1UAIA 3IPVB 2JD4A 3N7KA 4AWDA 1UZYA 3KM5A 1PZ7A 2WSUA 4XBLA 4XJ8A 4XJAA 1H9PA 4FPFA 1W6QB 3B69A 4LBLA 4YLZA 3WCSA 1Y7BA 1QNWA 5HCBA 3AP9A 4MYEA 5SV8A 2UWBA 2JDZA 4Y1UA 2WSVA 3WHUA 4ZKTB 1IS3A 1JYIA 2NMNA 5GJ6A 1W6PA 2UWCA 1JN2P 2OUJA 3AYAA 3VKFC 1LOFC 2XB6C 3O0VA 4CRQA 4YM3A 4K1ZA 4JCKA 3MEPA 1DQ1A 3NV4A 1UPSA 3HN1A 1MR5A 4FOQA 1ENQA 3N36A 1GBGA 4AVSA 3VKOA 3OPZA 1C1FA 1G8WA 2G4IA 2EXHA 4AVTA 5GLUA 3BODA 4LBNA 2DVAA 3VKLA 2PHRA 1SFYA 1WBLA 1FNYA 3A0KA 1SLIA 2DU0A 1AF9A 5CA6A 1QDCA 1DQ2A 1FV2A 1G9FA 3ATGA 3JU9A 4YGEA 4YW1A 3ZPYA 1V6OA 3AZVA 3WV6A 1C1LA 1LGBA 3ZYPA 4CTEA 4YGBA 2R1DA 2D6MA 3WZ1A 3FBYA 5DG1A 3AZZA 2A70A 5DUVA 3ZSLA 1Q8PA 3OYWA 1QGLA 1KDKA 2A3WA 3WVJA 1SLCA 2A6ZA 4R9CA 3D4KA 2LTNA 1N3QA 1MS4A 2ZGTA 2P34A 2W08A 1MS9A 2H0BA 3FLRA 2CY6A 1S0DA 2GNTA 1Z78A 3WG3A 3WHTA 1W0OA 3POSA 4F83A 3SNMA 1Q8OA 4XIKA 2D6NA 1W6NA 3BTAA 5DG2A 5DZGA 3AYCA 4LBQB 2BQPA 1WW7A 2XG3A 5T5JA 4FOWA 1RIRA 1IOAA 3IKWA 2ZBJA 5L73A 1BYHA 2R16A 1CIWA 4OZXA 1W0PA 2AENA 1Q8VA 3UL2A 4Q8KA 4ATEA 1H30A 3AFKA 4YW5A 2PHXA 1MACA 4AVVA 1D0HA 4LBMA 1ULDA 1N1YA 5CNAA 4XMAA 1G7YA 2OUHA 1TEIA 2GDFA 1YI7A 4GKXA 5DZEA 3RMXA 3DGTA 3RSJA 2D3RA 3H0OA 3A4UA 4YZ4A 1DLLA 2EXJA 3RRDA 1SBFA 4Q1PA 5GLWA 3TB0A 4YFZA 5T50A 1Q8QA 4M3CA 5IT6A 2YXSA 2VXRA 3ASIA 4ISQA 5JDBA 4FPEA 2GNMA 5KXBA 3AXDA 4XBQA 1GZWA 2AH2A 2R49A 4XIOA 1FAYA 1AVBA 1Q56A 4FVVA 4Q26A 1DFQA 4R9DA 4Q1RA 4P14A 1UL9A 4WV8A 3GNEA 1ONAA 4XTPA 2Z42A 3V0AB 3NWKA 2WT1A 1LCLA 3POWA 2CWMA 5JLVA 1XQNA 5GZEA 3UJOA 1VIWB 5T54A 4C1XA 2FHRA 2W39A 3RMYA 4GALA 1R1ZA 3INAA 3MPPG 4YGDA 3V65A 4H55A 3LSEA 4DQAA 1CR7A 5CAZA 5IK7A 1S0EA 1W6OA 4AYUA 3ZXKA 3M3OA 2AYHA 1A8DA 2GN7A 2NP0A 2JE9A 3AJYA 1LEMA 2P37A 2VW1A 2OVUA 1QU0A 2KM2A 4UW5A 2DVBA 2C9AA 1MS5A 3FLTA 4BMBA 3M3QA 3ZXLA 1UZZA 4YG3A 3PJQA 3OJBA 1CJPA 1N1TA 2ZHLA 1IKQA 4FPJA 1AXKA 3APBA 3AXEA 3ZXJA 1DGLA 1V6IA 3SH5A 1FYUA 1WD4A 4XE9A 3M3EA 4JRAA 1MS0A 4NOTA 5T52A 2DYCA 3AJZA 4XHBA 3I4IA 3FFZA 4XXPA 1LOAA 1YXWA 3AK0A 1APNA 5GLZA 3AP7A 3QLQA 3R05A 4D69A 4BLIA 2A6XA 1CPNA 1WUVA 5GLVA 2A5ZA 4FPYA 3WUCA 2RHPA 3JUUA 4YW4A 4Z8BA 3WG2A 2VW2A 3RG0A 4YZ1A 3IM0A 1LJ7A 3CNAA 1S0FA 1QMJA 3O0WA 2NMOA 1JHNA 3NV3A 4BPZA 1FATA 2E7QA 3MW3A 5JOWA 2D3SA 2A71A 2SBAA 4WZFA 2A75A 1MS3A 1URXA 3B00A 3PMEA 3W58A 1SCSA 5HCFA 5HCAA 4DRRA 1AJKA 4PCRA 1GLHA 4SLIA 4YG6A 3WCRA 2ZMKA 2HYKA 1F31A 1OKQA 1IS6A 1KITA 3OY8A 4XTMA 2GN3A 3USUB 1ZM1A 2NM1A 3SISA 4BMEA 2R1BA 4GWMA 5E88A 4YFWA 1S0GA 1WLDA 1N3PA 3WDVA 1GICA 3LSDA 2PHFA 4IQPA 3D6EA 1CN1A 4R9AA 1OFSA 2ERFA 4R9BA 2ZGSA 2WNEA 3V0BA 2R0HA 1ULGA 2P3IA 1VLNA 1LHUA 1ENRA 2ES3A 1G9AA 1N3OA 3L2YA 3SITA 1V6MA 1HLCA 3ZYRA 3U4XA 1ULCA 1GYKA 4XYXA 2A6VA 4UW3A 1B09A 1JXNA 1O4ZA 2DUPA 4Q2FA 1AXYA 2DTWA 2CTVA 2E53A 3RQ0A 2A6YA 5KXDA 1G86A 3IPVA 3OGGA 4C1WA 1GNZA 1VALA 3DUIA 4YGCA 1YIFA 1LESA 4AGRA 2D44A 1Q8SA 1AJOA 1W6QA 3AP5A 2C5DA 4L8QA 1MVQA 4XILA 3ZSKA 4K20A 2CNAA 4P9WA 3GALA 3WDWA 3AZWA 2FMDA 3ILNA 1DHKB 1FV3A 1AZDA 1SBDA 1V6NA 3O12A 4Y22A 2ZHNA 1QKQA 4P9YA 2AUYA 2ZGMA 5JOZA 4I30A 2Q5TA 5JMCA 5DUUA 1KJLA 2ZGUA 5FRAA 3ENRA 2VH9A 4FPLA 4UW6A 2JJ6A 1QOSA 5BYNA 1DQ5A 2CYFA 2ZGNA 4LBKA 2VUAA 5LK5A 2I2SA 3FLPA 1LULA 1AX0A 1HDKA 1I1EA 2P3KA 4Y24A 4W65A 4K21A 2CWSA 1JOJA 1SLAA 5GZFA 2DV9A 1QF3A 2DUQA 1W6MB 5T55A 4NO4A 2ZGPA 4Y20B 1YRZA 5AVAA 1LEDA 4FPGA 3VV1A 1BJQA 1KRIA 2PHTA 1D2SA 4Q8LA 5GM0A 2EIGA 1EPWA 2VU9A 5JVVA 2ARBA 4JC1A 5H9RA 1WCSA 1LODA 2DU1A 1BQPA 1C4RA 5GLTA 2DURA 4U36A 1LOGA 2ZGOA 1CPMA 2ZAAA 3OBTA 3WLUA 1LOCA 1I3HA 3SLIA 4GWNA 2ZZJA 3WNXA 1FNZA 3WG4A 1G9CA 1DQ0A 1WW5A 4P9XA 1WBFA 3RS6A 3WDXA 4ASMB 5IK4A 2EF6A 1LHNA 4M00A 3WG1A 4FP3A 4LBJA 2EALA 4LBQA 5T5OA 3AX4A 1ULFA 4DRVA 2R0FA 3M3CA 4XJUA 2D6OX 3ZVXA 1LHVA 4PQ9A 2V73A 3VKNA 1W6PB 1FX5A 2GMEA 2GNDA 2JE7A 3N7LA 5CB7A 3AYEA 4ATFA 3B01A 2DTYA 1H9WA 1HQWA 5F9TA 1BZWA 4XXAA 3IMNA 3OY8B 1DYPA 4UW4A 3PVEA 3BOPA 1LHOA 1UN1A 2NN8A 2D6PA 3NV1A 3POYA 5GALA 1S0CA 5KXCA 3PVNA 1LHWA 3WOGA 2LALA 5F5QA 3WUDA 2W52A 3IN9A 5EYXA 1S0BA 2W68A 1NLSA 4YW2A 4XBNA 2VW0A 2P3JA 3BIWE 4M3CF 5H9SA 1JYCA 2B7YA 5T5PA 3OBRA 2A6WA 4BQ1A 4M3CE 3M1HA 3V0AA 2PHWA 4PF5A 4TYSA 3AZXA 4CZSA 1OQ1A 1GZ9A 5IUQA 1QOTA 4RA0A 2EXKA 3WDTA 4GA9A 1AXZA 3OYWB 3V64A 1UMZA 1RITA 1LOFA 1KDMA 3HMYA 4AGVA 3UJQA 4GKYA 1MS8A 1AX1A 1G9DA 4HL0A 1LU1A 2GALA 1QDOA 1MS1A 3AZYA 1YO8A 4XHXA 2YY1A 2D6LX 4Q27A 1LTEA 2AR6A 4XJ9A 4WVVA 2DUOA 1JW6A 4WVWA 3ZSJA 1X50A 1GSLA 5GZCA 2UWAA 3B3QE 4YM1A 2ZGLA 3D5OA 1W6NB 2WT0A 4XZPA 5DUXA 4YZ2A 3C2UA 3SH4A 5JOYA 1A3KA 2ZMNA 4Y22B 5DUWA 5H9QA 2D43A 3VUOA 3MW2A 3N3HA 2PELA 5E89A 3MW4A 2UU8A 3HR9A 1UKGA 1PZ9A 3I8TA 3LCPA 4XOGA 4FOVA 1U0AA 1DBNA 2V5YA 1IS4A 5CBLA 1LOBA 1C57A 1GANA 1ULEA 4FOYA 2ZMLA 1V6JA 2YMZA 3AP4A 5DZFA 2YV8A 3N35A 4AGGA 4DPNA 2YZ4A 2WT2A 4LBQD 4M3CB 3O5SA 1V00A 1LGNA 3ZXFA 2YROA 2D6KA 1DYKA 2ZA9A 1GZWB 4XJWA 3N7JA 3W59A 1G9BA 2ZGKA 2DVDA 1KQRA 2EXIA 1MZ5A 2A7AA 2GMMA 1YYNA 2A3XA 3FUOA 1N1SA 3ZXEA 1BKZA 1LECA 2VY0A 4FP2A 2WJSA 4YW3A 1LU2A 2ZHKA 2ZGRA 1PZ8A 3UK9A 2D3PA 4BOWA 1A78A 2PHUA 2DWRA 3AP6A 1GZCA 4K1YA 4M01A 4BM8A 1F9KA 3VKMA 3N7MA 2CL2A 4HANA 2ENRA 1WW4A 3B9CA 3FUQA 1DZQA 5E8AA 4FPHA 1Z0HA 1LOEA 3USUA 5FREA 1W6OB 3SH3A 1JBCA 4Y1YA 4FQ4A 2GNBA 2D7FA 1JUIA 2WQZC 4XMIA 1HKDA 1QOOA 1V6KA 2ZKNA 4FPOB 4BLJA 4ITCA 1GNHA 2JKBA 4YM2A 3T1MA 4YZ5A 1CVNA 1AX2A 3ZSMA 1ENSA 5JOXA 4PBPA 3ILRA 1DIWA 3Q9OA 1SLBA 4DS0A 2NYYA 4TZDA 2P2KA 3TAYA 2OW4A 5IK8A 1KJRA 1WLCA 1WD3A 4GXLA 1DQ4A 1QNYA 1WW6A 2ZACA 1LENA 4PBOA 4XDQA 3T1LA 2WKKA 2DVFA 4FPKA 4XJZA 3ILFA 1BXHA 5EXOA 4FQZA 1S0JA 4LBOA 3M2MA 5DXDA 1CQ9A 1VAMA 1SACA 2AREA 1CONA 2JECA 4FPCA 3WDYA 4ISRA 1S0IA 1HQLA 2WLQA 5GZDA 5KXEA 3R4UA 1N47A 1MZ6A 4DFSA 1SCRA 1DQ6A 5EYYA 1IS5A 1LGCA 3QCWA 1CESA 2E6VA 2DVGA 1GV9A 3A0NA 1J1TA 2E7TA 5H9PA 2A3YA 3PVOA 2TEPA 1GKBA 1F5FA 1N1VA 1MVEA 1RINA 1IKPA 2ZHMA 1SBEA 1NXD1 1V6LA 5GZGA 5IK5A 1ZA4A 4YG0A 5T5LA 1WLWA 3V0BB 1W6MA 1SLLA 1VAVA 4Y20A 3T2TA 2SLIA 2NZ9A 4Y1ZA 1S1AA 3O0XA 4RL7A 4Y26A 2ARXA 3R4SA 1UX6A 3WDUA 3AYDA 2UURA 4U2AA 3KQRA 4YZ3A 2EAKA 5EWSA 2ZGQA 1O4YA 2GMPA 4Y1VA 2E51A 4Y1XA 4YM0A 4KBBA 2ZABA
chains in the Genus database with same CATH superfamily
1K5MB 3ES1A 5DN2A 1JODA 2WABA 2XJVA 4GMP0 5JXJA 3FZ3A 1G6NA 1TMF1 1VJ2A 4XJAA 3LEKA 1UO9A 3ZXDA 1H9PA 1GU3A 4FPFA 5C4WA 4Y4YA 3B69A 1HB1A 5FIXA 4QGMA 3OF1A 3PVBB 3DKQA 3UKVA 5A3UA 1W28A 2C1FA 3NNJA 3OGRA 5LEKA 1ST8A 4RS5B 5D2AA 1W8NA 2E63A 3S6PA 1JYIA 4GD4A 1UZVA 1I5ZA 3OGVA 3I59B 3RZHA 4QKNA 3USSA 2AACA 1NAEA 1ULPA 1UPSA 1WMDA 4FOQA 4MGSA 3CJXA 2BGPA 4AVSA 1ZRCA 3VKOA 1EY2A 3S5QA 1C1FA 4B1MA 4BYYA 3BVCA 4JVAA 3C8XA 2EXHA 2J22A 5HPOA 4AVTA 2ILMA 1GP4A 1O59A 2DDUA 3A7QA 5FP4A 3KB5A 5I8TA 1RUC2 2DU0A 4Q4V1 3BUCA 4HLTA 2JB4A 1QDCA 4P5HA 1G9FA 4QHZA 3JU9A 5IVBA 4COZA 1V6OA 5FXWA 3AZVA 1RUC3 4CDXC 1C1LA 4H7LA 1AR91 3ZYPA 2VQ0A 3ES4A 5K7PA 4LPLA 3BTZA 2R1DA 5FTTC 2D6MA 4KWLA 3D8CA 1M06G 3N9QA 3AZZA 5DUVA 3UYJA 1TZOA 2LS6A 2A3WA 2C4XA 1PK6C 3WVJA 1SLCA 2A6ZA 4LEJA 3JZVA 5JMOA 4JGYC 3LEGA 5BXXA 4K7JA 4Z82A 5AC91 3NAPC 5IAVA 2ETEA 1VRH1 1TQ5A 4CDUC 3POSA 4CUGA 2XXZA 4C0HA 4E2GA 1TG7A 4CXWA 4XIKA 1NCQA 3NQHA 1US3A 4NHLA 3AYCA 5J98B 1A34A 2XG3A 2XQXA 1RIRA 4NAMA 4AI9A 1H2LA 3QBQA 2AENA 3NO8A 4PT6A 4J1XA 1MACA 1D0HA 3ZDSA 1ULDA 2CAVA 3SXWA 1CAXA 4EZHA 2WS91 4ARXA 4GKXA 5DZEA 3RMXA 1R1A1 4F7ZA 2OKXA 2J1RA 1XE0A 4PI2A 4QMAA 2JG8B 2EXJA 1O6UA 3EXUA 4XQDA 4OCTA 5JAXA 3CQOA 4IEUA 5FZ0A 4QQ2A 2X5IB 5IYYA 1RVF2 5BV6A 1QQP2 4FPEA 4QQHA 3AXDA 1DGWX 4LUMA 3RZKA 1EAH1 3M7AA 3IDBB 4H7MA 1QQP3 1W2UA 4WV8A 5FCCA 1REEA 4IGQA 1ONAA 3GM8A 4PHZA 3ST7A 2VTXA 1Z7S2 1OFNA 4QGLA 2OA2A 4CEWA 3OD0A 2IXCA 1VPHA 4EYUA 1VIWB 1PVC1 1Z7S3 4C1XA 1HRI2 5FPBA 4GALA 5A6YA 4YGDA 3I2DA 3ZIWA 2HWC2 2VNVA 1CR7A 1HRI3 1S0EA 1W6OA 2VG9A 3OGSA 1NKGA 3M3OA 2AYHA 4KWJA 4GH4A 4MXVA 4JGZB 2HWC3 1ZZBA 4Q4W2 4ASLA 2VZVA 5LBBA 1W2NA 3ZFEA 1OLMA 1PIV2 3DPRC 4Q4W3 3PJQA 4AR2A 3OJBA 5BNPC 3RZZA 3AXEA 3ZXJA 3I54A 1DGLA 1MZFA 1WMXA 1TNFA 2BOIA 2P6CA 3C7EA 1PIV3 3NVCA 4QQLA 4XE9A 3M3EA 3ZMNA 3ZR5A 4AFBA 1MS0A 2Q1FA 5T52A 5L19A 3AJZA 3GYDA 4JV4A 4S2GA 3FFZA 4XXPA 3ZFFC 1YXWA 5D21A 3B9IA 4YVWB 3TNQA 3H3ZA 1IG3A 4S2FA 5F3IA 1W9SA 4AFMA 3L9JT 4FPYA 4NVPA 1GUIA 3VHPA 5CFDA 1BEV2 2RHPA 4IV1C 3IIIA 1ZZ8A 2VW2A 5DAVA 5CFCC 5FMOL 4YZ1A 3IM0A 1BEV3 3WQ1A 2Q4SA 3O0WA 3NV3A 4OMDA 5ANNA 3RVHA 4B4QA 3MW3A 3VBUC 2D3SA 2A71A 1JYVA 3B00A 1MS3A 1O4TA 3K4AA 3VDAA 1SCSA 4XF1A 3TNPB 2J1TA 2IVJA 5I0TA 2V5DA 4MSVA 5IVYA 4A2UA 5EPAA 4K8FA 1GLHA 1YFYA 5C8CA 4P02B 3CO2A 3J7NA 4LLFA 2XJTA 5CEHA 3ON7A 4JQTA 3OEBA 2NM1A 1QEXA 4BMEA 3RYPA 1FOD1 2R1BA 4YFWA 4A7ZA 1AR81 1WLDA 1Y9GA 2ORZA 5CZKA 3WDVA 4BIOA 2Q30A 3FHQA 4FAHA 1ZREA 5JZGB 2IWGB 3V0BA 1H4HA 1SDWA 3BTYA 1EP0A 3ZYJB 1SG3A 2QQMA 4CDXA 2ES3A 2HWD1 3FBMA 5C4WC 3I2KA 4MGZE 4IEPA 5D8AB 3L2YA 4G3YC 2MEV2 4F8AA 1HLCA 1PVXA 1O3QA 5LATA 3SKJE 4XYXA 2A6VA 3K2OA 5DAQA 3THTA 2YDEA 1PK6A 2CTVA 2E53A 2MEV3 3RQ0A 3MICA 3S7EA 5KXDA 2BERA 3IPVA 4I3GA 3S30A 2OX0A 1W2TA 3POBA 4XEZA 4YGCA 3NAPA 2J1EA 4AVBA 1LESA 2YUEA 2BBVA 2RDNA 4GB32 4YVSA 1GP6A 1PHMA 1NG0A 3H42B 5IHRA 2VUCA 4QXKA 1W6QA 4ZY9A 2RS52 4DXRA 4XILA 2Y0OA 4GB33 1AR61 3ZSKA 5DAXA 4AQTA 4N53C 4K20A 3GALA 2QZ2A 2FMDA 3O12A 1GP5A 4Y22A 4COVA 1QKQA 4P9YA 2AUYA 2ZGMA 1GMMA 3RJ2X 3W21A 4XFCA 3PTYA 4Y33A 5DUUA 3S0MA 3UNPA 2ZGUA 3LF7A 4D6SA 1RL3A 4BIFA 4UFMA 1ZRDA 1RUD2 2ZGNA 1JU3A 5LK5A 3FLPA 4RHV1 3TOJA 1AX0A 1HDKA 1AYM1 1RUD3 5CU1A 5FZHA 4RQPA 4LT5A 2I45A 5IJRA 1JOJA 1XXNA 2ZKLA 2DV9A 3NJVA 4CXXA 2MPFA 3ZFEB 2DUQA 4XF3A 3ZN6B 1YRZA 1BJQA 4DXSA 4GWIA 5L7OC 5JVVA 4DB5A 1HB2A 4QX1A 2DU1A 2XL9A 5F6LB 1C4RA 5GLTA 2W2IA 4U36A 5FMBA 2UYBA 2VJXA 1CPMA 1NA1C 1UYPA 1D0GA 4Y5TA 3SLIA 3O14A 5J48A 4GJZA 5DDJ1 1FNZA 3T2PA 2WZR2 2YPDA 4OVEA 3VZKA 3OB8A 3WDXA 5FXZA 3QD6A 4ASMB 2B8MA 1XE8A 1LHNA 2DCJA 2WZR3 3FJSA 4ZXEA 4EN9B 2EALA 1TE1B 4DZGA 4CCNA 3DYPA 5T5OA 2XMLA 2XJRA 3PUSA 2R0FA 1IG0A 1YLLA 4PQ9A 4XDPA 3WNOA 1W6PB 4AVVA 3N7LA 3VKNA 3AYEA 4AHWA 1QY4A 2YC0A 4EJRA 5J96B 1AYN2 2DTYA 1W8HA 1HQWA 4DXZA 5F39A 3H7JA 3MUY1 4KH9A 1BZWA 1JU4A 4I0AA 1AYN3 3BOPA 5L9RA 4L9BA 4Z92B 2D6PA 3NV1A 3POYA 5FZAA 4DUXA 5I8YA 1Y9MA 1S2BA 3RZGA 2LALA 2WFF2 2FCVA 5F5QA 4C91A 3ZYHA 1UKRA 2BZDA 1RUC1 1NLSA 2YBKA 3HQUA 5CFCA 5H9SA 5FOBB 4BDVB 3N9OA 4QPYA 1E5IA 1PM7A 4CP9A 3NL1A 1YQ8A 4Z1VA 3VBUA 2VZPA 4PF5A 5BNOC 3WSOA 2JIGA 3H8XA 3ZPOA 1AXZA 1RITA 1NX9A 1UMZA 1RUG1 5F32A 2W1SA 2YGLA 1WA4A 4P9JA 1B35B 3AZYA 3LA3A 2QQPA 1L7QA 3LPFA 2YY1A 5A6QA 1L3JA 4X6QB 1IPJA 1T6BX 4YVSB 3RDIA 5FZLA 3DYMA 3A23A 4I2OA 4OHWA 4YM1A 4Y4RA 4Q0SA 5DUXA 5HXVA 4XZPA 2LW8A 4J1WA 2GP3A 1PX4A 2XJUA 1UXZA 4XUTA 3JCIA 1KEXA 4Y22B 5DUWA 4JQRA 5FPZA 2PELA 3MW4A 4GZ9A 2ET1A 4XCAA 4FFFA 4LK7A 4LLOA 1YFXA 3I8TA 4PIYA 4XOGA 2WAAA 4FOVA 1J84A 3ZKYA 2ADDA 1NLRA 4K9SA 1QJZA 5CBLA 2ZX4A 4IEZA 3M70A 4XDOA 1W90A 3MZHA 2R043 3HVDA 4ZU5A 5FQ0B 3AP4A 4DPNA 5IVEA 4LUKA 1S2EA 2FCUA 1EUTA 5LA0A 4QD2A 2VOTA 3KZ4C 3WEZA 3U0ZA 1RVF1 1QQP1 2ZA9A 4PDWB 4XJWA 3ZFGA 2DVDA 1KQRA 3GDBA 4PLMA 5ANQA 3ZDVA 4D94A 1HJFA 5C5TA 3FUOA 1N1SA 1OMIA 4YW3A 2WJSA 1LU2A 5FDBA 1VAKA 2W3JA 2ZHKA 2ZS6B 3IDEA 4OUMA 5IWFA 1A78A 1Z7S1 2PHUA 3HNYM 3POIA 4KU8A 3Q8AA 4K1YA 2JDNA 5KHGA 5A7NA 4HANA 1K5MC 4DO0A 4TTGA 3B9CA 2W1UA 2W5FA 4CEYB 4IEOA 1LOEA 4ZZ5A 3Q8BA 5LRRA 3KGZA 1UOGA 3HN3A 3T4VA 4AHYA 3LFIA 5LY2A 4FQ4A 1K45A 4Q4W1 1JUIA 2WQZC 3UETA 1V6KA 1QOOA 2ZEZA 4IV3C 3R6SA 4FPOB 5I91A 2RG4A 3CMGA 1OOPC 2QFEA 4RS5C 1RXGA 2XKOA 1OA4A 1AX2A 2EIEA 1QJFA 1TNRA 4A6OA 2LROA 4NIDA 4BQYA 1H4GA 3GZEA 5FY1A 4AQ2A 4Q4X2 3DYOA 1RUJ2 2Z5WA 3ELNA 1SLBA 3OGJA 2NYYA 4MHUA 1GWLA 1KFUL 2P2KA 2Y6LA 1EPZA 1SHWB 3WQ7A 1C3HA 3DXUA 4CU7A 4HVQA 1RUJ3 2ZOEB 4HKLA 5FYHA 2JDUA 3ME2A 1WW6A 1LENA 2PAEA 5F7UA 4XDQA 1BEV1 1HQNA 3T1LA 2E26A 4LHNA 3LD8A 4FPKA 4XJZA 3ZR6A 1BBT2 2J42A 4BQWA 4XVHA 1H1AA 4LBOA 4QXHA 5DXDA 1VAMA 2P5BA 2AREA 4CP9B 2JG9A 4RGGA 2FD8A 1YIPA 4FPCA 1BBT3 4ISRA 3WDYA 3KF3A 3O1PA 3WP6A 2A73B 4DFSA 2Y6HA 5EYYA 2IZWA 4AEMA 3QCWA 1H2MA 4HPKA 3EO6A 1ND2A 4N7UA 1GV9A 1GQGA 2YC2A 3POGA 2WAOA 3G6JB 3I2HA 2TEPA 3RYRA 5C9AB 1GKBA 1YEWA 3T0DA 4N43B 1F5FA 4DIQA 4B29A 1NXD1 4RGAA 1ZA4A 3BGAA 1RUF2 4AI1A 4YNIA 3WY6A 3T4HB 2HH9A 3WW4A 5I93A 4Y1ZA 4A4AA 1S1AA 4RL7A 4D7YA 1RUF3 2ARXA 4Q29A 1UX6A 4BWOA 5T3NA 5J3UA 2JDMA 4L0PA 3FN9A 4YZ3A 2B4KA 5A3WA 2KD7A 4HN1A 2MEV1 4IE4A 3RGBA 3SCFA 1PO12 4IGOA 4MGTA 3HNMA 2RE9A 2ZABA 1ASJ1 4ZXKA 5CISA 2JG8C 2RR11 4N9HA 3PLQA 5FLJA 1PO13 4IESA 1W99A 2X5IC 3KM5A 4XBLA 1PZ7A 2R32A 2IXHA 2WSUA 3PIJA 2RM22 4GB31 4Q0QA 3S57A 5FXVA 2ZAHA 1Y7BA 1QNWA 1ODNA 3MV11 4XF0A 2RS51 4MYEA 5EZWA 5FPAA 2UWBA 1UU5A 2WSVA 3WHUA 3OBAA 5FZOA 4BQ5A 2FDGA 5AVPA 5GJ6A 2GAUA 4QPIA 2VCCA 4NHMA 2E9QA 1XU1A 4XETA 2XB6C 3EHKA 3VKFC 3ZM8A 4AW7A 5J7MA 2XBO2 3MEPA 3QH7A 1DQ1A 2VVFA 2F4PA 3NV4A 3ORJA 4JDNA 4NHYA 4UFIA 5EHDA 5C33A 5C3RA 3A21A 3RWKX 3LGRA 1YWKA 2AC1A 2XBO3 4G4FA 1MEC3 2G4IA 5GLUA 3BODA 2DVAA 3IBMA 3OUIA 1ULOA 1QIQA 4LMFA 1FNYA 3A0KA 3VL9A 5JWPA 4CDWB 4WM7C 5FXXA 4YGEA 3VD5A 1YQ6A 3ZPYA 1OHFA 2XGXA 3WV6A 3K48A 1RUI2 2Q8OA 1LGBA 3T09A 4CTEA 4JDOA 1F35A 3WZ1A 2OT7A 3FBYA 1EUUA 1PMJX 2WNVC 4P9GA 3ZKUA 3ZSLA 1RUI3 2HBUA 2RDSA 3H3UA 5CKMA 1BK1A 2VNRA 3OYWA 4FAGA 2FDIA 4FTSA 1W9YA 4YVWC 3VBHA 1MS4A 3GBFA 3MYXA 3THCA 3RZJA 2P34A 3DEMA 4BISA 1MS9A 1H2KA 1XB9A 3ACGA 2GNTA 1Z78A 1SPPA 5FYCA 1W0OA 3WHTA 5BNQA 3VBFC 2XQRA 3SNMA 3I3MA 1QXPA 5FP3A 5JR7B 2D6NA 3BTAA 3BYWA 4IV3A 5DG2A 5DZGA 2BQPA 5T5JA 4FOWA 5C7GA 2ZX1A 1BLZA 2ZBJA 1BYHA 2HEWF 3WNLA 3UESA 2RV9A 4FXGB 4Q8KA 4WBBA 4BQXA 3AFKA 5FBJA 2PHXA 2QQIA 3AKPA 5HV0A 3RNSA 1ND2B 2PQQA 5CNAA 4XMAA 5IVJA 2OUHA 3GCWA 1VBA2 2C0ZA 4HONA 1ZZ9A 3T2OA 5FYYA 1D4VB 1DLLA 1VBE1 1SBFA 1W2AX 2PTMA 2XVGA 3D0SA 4Q1PA 4QXBA 4XAAA 1Q8QA 5T50A 3TB0A 5KC6A 5A7WA 4ISQA 4K3UA 2WFF1 1ZX5A 3ZX7A 5KXBA 4XBQA 1GZWA 2AH2A 4I01A 4BH9A 5JZGC 4XIOA 1FAYA 1Q56A 2HBTA 3NKTA 1DFQA 4R9DA 2DCZA 1XJAA 2G19A 5FMOS 3WW2A 3GNEA 5D8AC 1IGOA 4CA9A 4O9EA 1LCLA 3POWA 4XF4A 1ND3C 5HCHA 5JLVA 1YFWA 2JDKA 1NYWA 5T54A 2FHRA 2W39A 1RTVA 3RMYA 1R1ZA 3VB9A 4XZUG 1O5UA 4H55A 4EWDA 3KT4A 1O91A 1S2KA 4CDQA 3UT0A 3ZXKA 4S2DA 2GN7A 2NP0A 2JE9A 3H1MA 3TYJA 4CXYA 1WCKA 1WA6X 3V56A 1XNTA 1QU0A 2KM2A 3E5UA 2DVBA 2X8KA 2C9AA 4DUWA 3FLTA 5BY5A 5FZOB 1UY0A 1HIXA 3ZXLA 4YG3A 2QQJA 5D1IA 4QPIB 1AXKA 3APBA 3HOBA 1W04A 2DCTA 1V6IA 5F8PA 1WD4A 2XUMA 2W91A 2Y6JA 4JRAA 1ZZ6A 4QKDA 1EYBA 4XHBA 1D7PM 1RHI3 2XVKA 5KHJA 2GC0A 1APNA 3QLQA 4D69A 5LA9A 2A6XA 1UYYA 1WUVA 3AL6A 2A5ZA 2OPWA 3U1XA 1RC6A 2DFCA 1WGPA 3E97A 4Z8BA 4J6GA 4QHOA 1AUYA 2HEVF 3AKSA 1X9TA 1EV13 3E1F1 1LJ7A 4AVAA 1QMJA 2NMOA 1JHNA 1FATA 4N9IA 2NLRA 4YW7A 4ET7A 4UOJA 1RMU2 3ZXAC 4OI4A 2BUKA 2A75A 1URXA 3PMEA 1REDA 3GGLA 5B4XA 5FZKA 1AJKA 2ZEWA 1RMU3 3NSTA 3ZYIB 4COWA 4YG6A 2HWF1 5K0UA 2KXLA 1F4AA 2R063 3FHIB 2BVVA 3OCPA 1OKQA 3OY8A 4Z07A 1COV2 1JZ5A 3W5MA 3USUB 4QPGC 1C5IA 1UD1A 2JICA 3SISA 3TN92 1DDLA 2V4VA 1S0GA 4XFAA 2OS2A 5LWBA 4HOOA 1COV3 3BU7A 3CF6E 3AB0A 5F6KA 4AFAA 2PHFA 1CAWB 1PM4A 3D6EA 3TN93 1XYNA 2V09A 1OFSA 2ERFA 2ZGSA 2WNEA 1NT0A 2IXJA 3EQEA 2P3IA 4XURA 1KD7A 3CJIC 1LHUA 1G9AA 2FDHA 1FXZA 2Z4FA 2EA7A 1CAUA 3SITA 2EIBA 3U4XA 4UF0A 4Q4X1 2QJVA 1B09A 1O4ZA 1W39A 3AL5A 3H50A 1AXYA 2DTWA 3WQ0A 1F15A 2UYAA 2FZ2A 1HXS2 4QGNA 5IVVA 3AMMA 3HJRA 3OGGA 2JB8A 4FCAA 4C1WA 3VBRB 3DUIA 1X8MA 2XJQA 5ABJA 1HXS3 4AGRA 3MFCA 5EP9A 4D6RA 2BGOA 3VBFA 3IMMA 3POJA 1AJOA 4FBFA 3BKZA 1HX6A 3UKTA 5DMYA 1XYOA 5DPNA 1H6YA 2OZ6A 5FBZA 1ZA7A 4XUQA 4D7SA 1V6NA 1FV3A 1AZDA 3E5XA 3LDKA 4LOTA 4RR3A 4WM8B 3U78A 4CCCA 3ACFA 1VBC2 1XNDA 2GZWA 5B2GB 4I30A 5IVCA 4M4RA 4LO4B 1POQA 5JI9A 5FRAA 3RJRA 3GJBA 1R082 1VBC3 1QOSA 2JJ6A 3CZJA 1B35C 5BYNA 1ZVFA 4COYA 5FP9A 2QBXA 4XABA 5FZ7A 2I2SA 4FXKB 1LULA 1R083 2HYXA 1I1EA 4Y24A 3MLKA 2ZTNA 1OA2A 2CWSA 1SLAA 3VDDA 4Q5OA 4MX3A 2B9UA 1NCRB 3B94A 5BNNB 2WWUA 4NWWA 4TLFA 5T55A 2ZGPA 5AVAA 4AQSA 1KRIA 5FY5A 2K2SA 4Q8LA 1EPWA 1VMHA 2ARBA 4JC1A 1LODA 2CAUA 2I07B 3GZUC 4XFHA 4LNVA 4HFSA 4AEDA 1BQPA 2VMIA 4LXLA 1LOGA 1PO11 2HJIA 2IXIA 1J58A 1RUH1 4E4HA 2VGDA 5IFTA 1LOCA 3NW4A 4GWNA 4H14A 3K51A 3WG4A 3TEZA 1OF3A 2B46X 2RM21 5C4WB 3BIEA 1WBFA 3RS6A 1UMHA 5IK4A 4ZHNA 3WG1A 4MGIE 3VBOA 3K75B 4AAPA 2Y38A 4LBQA 3I2IA 4P00B 4ZU7A 3PDQA 4KGQA 1CZTA 4NPRA 2VBDA 2D6OX 3ZVXA 4QX8A 1FX5A 2GMEA 5CB7A 2VZRA 3O1OA 4ATFA 4PQQA 1X33A 2B45X 5JXGA 2XBO1 4UFJA 4XXAA 2HWE2 2WNVA 3OY8B 4GJYA 3VHNA 4CEYC 2VMEA 2W1QA 1LHOA 2NN8A 5KXCA 4BCUA 1S0CA 3JBG2 2WNUC 2HWE3 4IDZA 4R8HA 1K3IA 2PA7A 2B39A 5EYXA 1OI6A 4UT5A 3RWNA 5KBFA 3JBG3 4YW2A 4B3NA 1UZ0A 3BIWE 3LEIA 3AM2A 3TEXA 5DQ0A 1RUI1 3M4FA 3M1HA 3V0AA 1VE0A 2PHWA 2BNOA 2RS12 3ABZA 3MFAA 2EXKA 5FYIA 4GA9A 1D4M2 3BALA 3V64A 3VBOC 2Y6KA 4LKFA 1VBD2 2Y33A 3HMYA 2RS32 2RS13 3UJQA 2XH6A 1MS8A 1AX1A 4GKYA 5A3OA 1G9DA 1LU1A 1MS1A 1D4M3 4XHXA 3OD4A 5KR7A 1VBD3 4JZRA 2D6LX 5FZEA 2RS33 4QPGA 2G9FA 1KS5A 2BTVC 4ORFA 5CADA 1JW6A 3RYKA 3ZSJA 1GSLA 1NCQB 1MQTC 2TBVA 2UWAA 1SDDB 2V4AA 4OI2A 4XFIA 1BHGA 4HVOA 4RSUA 4NIHA 1OLRA 1IHMA 4YZ2A 5DABA 4H2AA 4XFBA 4LITA 1ZNPA 5H9QA 2D43A 3TEWA 1V9U1 1RB8G 1OVSA 1WCDJ 2IC1A 3HR9A 4AI2A 4MGYE 4A6SA 3MIBA 3C3VA 4OZOA 1WWYA 4IXLA 2N7GA 3U37A 1DBNA 2VPVA 1CAXB 3PUIA 4Q4Y1 4CCEA 1LOBA 1C57A 2YGMA 4TLGA 1DGRN 3CEWA 4HN0A 3RFRA 5FPUA 1VBA1 1GR3A 1OLME 4Z2WA 1V6JA 5C9AC 1MPXA 4EWEA 4N43C 3N35A 4AGGA 4IE5A 4JGYA 2FDFA 2WNOA 3LIGA 3OUJA 4DOUA 3VBSC 1V00A 1LGNA 3WNKA 3P1IA 4WVMA 4CDUA 1X36A 1Y4WA 3LAGA 3W59A 5C5UA 5JSRA 2XONA 1MZ5A 2GMMA 4Y3OA 1YYNA 4QAWA 1BKZA 1LECA 4CPBA 4COUA 1PZ8A 5IW0A 1VB4A 2KA3A 4BOWA 5I0UA 3U10A 3L2HA 1GZCA 3ZXGA 5FWJA 4CEWB 3P3NA 4CU9A 3VKMA 1VP6A 4OFGA 1WW4A 1QJX2 1UF2C 5FOJB 3FUQA 1YNAA 2HLEA 5E8AA 3HQRA 5JIUA 1H8TC 4M0NA 1NZCA 5FJKA 2WN3A 4YYOA 1QJX3 1JI6A 1W6OB 3NNGA 5C71A 2Q8CA 3EYPA 4GH4B 4HKWA 2GNBA 1JYTA 4CSWA 2D7FA 4LKDA 4ZU4A 4HETA 1HKDA 2WZPP 2ZKNA 1O8PA 3KT7A 3AMQA 3H8UA 3ZYFA 3SCGA 4INDA 1E5SA 3HBKA 4YM2A 4D6QA 2QDRA 3CBNA 3DL3A 3NRUA 1VRBA 3KHCA 2CSGA 2VECA 3IT8A 5A32A 4ZS2A 3CKHA 2WYFA 1QJU2 4XFGA 3VL8A 1DIWA 2QNKA 3ZN5A 2G9ZA 3CU7A 4BZ4A 3TAYA 5FK7A 3U07A 1HV0A 1W8ZA 1QJU3 1WLCA 3KV5A 5FYTA 4DXTA 2WZ8A 1QNYA 4FFGA 5CFDB 1YI9A 1ZYBA 4CUCA 2WKKA 1XOYA 2Q0AA 2DVFA 4CDWC 2RJKA 1BXHA 5EXOA 3TBDA 4FQZA 4E8DA 1UIKA 3BB6A 1HRV2 2BFUL 5GKAC 1S0IA 4L11A 2WLQA 2FBEA 2BP6A 4Q0VA 3DPRA 5KXEA 1N47A 5JI7A 1L7LA 3PURA 1HRV3 1RMU1 4EROA 2YBSA 5BNPA 3KT1A 2BNMA 1DQ6A 5E16A 1LGCA 2WO2A 1K5JA 3FL7A 2X53S 1CESA 5C8CB 1NQDA 4UXAA 5SV5A 1O5LA 2WFPA 3ZFFA 4MGKE 4URAA 1OUXA 3PVOA 3OUHA 4E9KA 4ES8A 3BPSA 4CCLA 5JUVA 1POV3 1SBEA 5A33A 5FKBA 5A3TA 4IV1A 4RN5A 5LASA 3MBWA 1YCIA 4Y5Z0 4LIUA 1WLTA 1PGW2 1W6MA 1K12A 5JXIA 1ZZ7A 4Y20A 3V0BB 3O0XA 4NE9A 1UY4A 3AFGA 4HK9A 3R4SA 3FHAA 4QPWA 4CDXB 3VGIA 5IATA 3AYDA 4X6RB 2UURA 2VE1A 1OQEA 2DCKA 5EWSA 3LOIA 3C7GA 4Y1VA 4YWAA 1PK6B 4MGQA 2K46A 1QJY3 5L36A 2AGSA 3CL1A 3NV2A 5FZ6A 1UAIA 3IPVB 4UFHA 5APAA 1F8VA 3DXTA 1FMD2 3E6BA 3N7KA 3W20A 5CKNA 5LA1A 3NAPB 4RGKA 4AWDA 4WVMB 4YRDA 3PUQA 3PIGA 1FMD3 1W6QB 1S4CA 4FSJA 1TVGA 5LCWL 4MV2A 5FK8A 2VMCA 3WCSA 2BOJA 4OYUA 3GHNA 5HCBA 5SV8A 2X05A 1ALYA 2JDZA 4ASKA 3C7FA 2DBIA 1HB4A 3AMHA 2W95A 2NMNA 4A42A 2UWCA 3SHRA 1JN2P 2OUJA 5G04L 3AYAA 1VBC1 5F5CA 1KS4A 5J37A 2QDNA 1LOFC 4A3XA 4AE2A 3O0VA 2BPA2 4K1ZA 2R042 2O14A 4JCKA 1NXMA 5FWEA 1R081 3NNFA 4BXSV 4I3PA 1ENQA 3AKRA 4NHKA 2E31A 3N36A 1UOBA 3ETQA 4C90A 5IVFA 3LA2A 1G8WA 3AMNA 3URFA 2DBNA 2VZQA 5EIYB 2HWB2 4RQPB 3VKLA 3EMRA 2PHRA 1SFYA 1WBLA 3KCYA 5ACA2 1AF9A 1WMEA 4AQ6A 1DQ2A 2HWB3 3UGFA 2VVDA 4D7TA 1PO22 4IETA 4IE6A 4K8RB 1J3RA 4N53A 4TN7A 1O7FA 5ACA3 4XACA 4YGBA 1J1LA 2WLPA 1W8OA 5KHHA 3A22A 3CIHA 1PO23 3EB7A 1H1MA 2A70A 2Y64A 3K3NA 5JPMB 2H0VA 1C8NA 1RJ8A 1JYXA 3H9AA 4CUBA 4M4PA 4R9CA 2DFBA 2XR4A 3LA7A 5FZ9A 3MF6A 1N3QA 2CV6A 2E33A 1HRI1 3KV6A 2WYSA 2ZGTA 4V1PA 1H8TA 2FDKA 1TMF2 2H0BA 2CY6A 2HWC1 3WG3A 5LBEA 2O1QA 5EJ1B 3HQXA 4F83A 2PYTA 1Q8OA 1NZIA 1TMF3 4FFHA 3I49A 1JYWA 1W6NA 4CCJA 3KD4A 2JDPA 1WW7A 4AVCA 4B8EA 3IKWA 4LO8A 2R16A 3PL0A 1PIV1 1W0PA 5BNPB 4E8CA 3HWJA 5L7OA 3IB3A 4ATEA 1V70A 3WR0A 4IE0A 3VZNA 1SEFA 2LM3A 4LBMA 5FKCA 5FYVA 1G7YA 2GDFA 2VNGA 5TSWA 1CX4A 3ZFFB 3LZZA 1IPKA 3QOPA 3RSJA 4B4RA 2HWE1 1US2A 1NA1A 3A4UA 4YZ4A 4DY5A 3T3YA 3RRDA 1O3TA 3JQWA 5IT6A 4M3CA 4FTEA 2VBPA 2YXSA 2VXRA 3ASIA 3JBG1 3IAQA 4QQOA 4EE2A 5JDBA 4XC9A 2GNMA 4H3WA 5CFCB 2R49A 3GBGA 3K3OA 1AVBA 4FVVA 4Q26A 4YSFA 2GP5A 4P14A 1W8FA 4UFLA 5DAPA 3VBUB 4XTPA 2Z42A 1C8M2 2WT1A 4C8DA 3MPBA 3IWZA 4JHTA 2PLV2 2VQAA 2RS11 4QU1A 1DF0A 2FQPA 5GZEA 1GZTA 3KMHA 1KXGA 1C8M3 3RI8A 3UGGA 3UJOA 4AG4A 2PLV3 2RS31 1PGL2 2YU2A 2WR9A 1GFF2 3INAA 4NRQA 1R092 3VBRC 4DQAA 1OSGA 1VRH2 1X7NA 1DZTA 1FPN2 3LPGA 4FI9A 4XFFA 5A1AA 5IK7A 4AYUA 1W06A 5AC93 1R093 1LEMA 1VRH3 2P37A 4CVUA 1FPN3 1P8JA 3J8F2 2OVUA 2ZX2A 4DEVA 3VZMA 4EN6B 1MS5A 4MG2A 1XSRA 4BMBA 1A6CA 1UZZA 4WM8C 1CJPA 1QXRA 3J8F3 4MUVA 5HBAA 3ZSEA 3SH5A 5KHKA 4N8MA 3X29B 4GAZA 1CZSA 3WNPA 5BNOA 5LK7B 3KS7A 1XPWA 2DYCA 4HZFA 3I4IA 4ONUA 3GXUA 1LOAA 3KVBA 3CZUA 3T30A 3I2FA 1OVPA 2PHDA 5E6HA 5GLZA 2WS93 3R05A 1ZZCA 1YUDA 1CPNA 5GLVA 4AF9A 4BLIA 4A41A 4MOAA 5I0RA 5FZDA 1J59A 4Q0UA 1RXFA 4XAEA 4LA3A 4YW4A 2IXLA 4YARA 3RG0A 3ZFGB 4NHXA 2E32A 2XWBB 4KG8A 2W94A 3CNAA 1S0FA 4N53B 2D98A 4NPMA 5FYSA 2E7QA 3K4ZA 2YFUA 4EZ4A 1A8MA 1CAVA 1JTZX 5F5AA 1LNSA 4L99A 4HG6B 3W58A 1NUKA 5HCFA 5HCAA 4HVRA 4DRRA 4OHZA 2TUNA 3PU8A 5F2WA 4O61A 4O65A 3P6BA 1XBFA 3WCRA 3AVRA 1QJX1 2TNFA 3SKVA 1C28A 1MEC2 5FY7A 4RD7A 4D0QA 1LR5A 3NNMA 1IS6A 1KITA 1RGSA 3PU3A 1RUD1 4XTMA 2GN3A 5A7QA 4UBHA 1ZM1A 1OA3A 1NE6A 2ARAA 3ACIA 3ZMOA 4FT8A 4GQ7A 2RMU2 4GWMA 1ODMA 4D3WA 3GHMA 2OIIA 4IGPA 5FP8A 2VOVA 3I97A 1N3PA 1F5JA 2LUWA 3KSCA 1GICA 1ACCA 4JGZC 1E57A 3WD5A 1CN1A 2RMU3 4QQPA 1QJEA 4R9BA 5FFOC 1M4WA 2EICA 1ULGA 1VLNA 5HXMA 1ENRA 1Y3TA 4AFCA 1UU4A 1UQXA 5HV4A 3P5BA 5CIRA 2RDQA 2GC2A 1T6GC 2YG0A 3FE5A 4LA2A 3ZYRA 4OHYA 1SFPA 1ULCA 1GYKA 4B4PA 4UW3A 2XUEA 2DUPA 4Q2FA 2IVIB 4W6WA 1NA1B 1K5MA 1ZBA2 4KL1A 4E4SA 2ZJCA 4X8PA 5FYMA 1GNZA 5JCTA 2QQWA 1YIFA 1JOBA 1ZBA3 2WZR1 3ITQA 2D44A 1Q8SA 4BK5A 1UY3A 1AHSA 4L8QA 1W3VA 1MVQA 1DYOA 5J09A 2JG9B 1RUE2 1HW5A 1HRV1 3KVAA 4P9WA 1OOPA 3AZWA 1UYZA 3ILNA 1DHKB 1SBDA 4RS5A 1BMV2 2ZHNA 3VN4A 3RPQA 2Y6GA 1RUE3 2PXJA 1YC61 1YJKA 5JMCA 3N9NA 4BE3A 3C7OA 3ENRA 2PMWB 4HPKB 4UW6A 1AYN1 4LKEA 3T0BA 1DQ5A 2CYFA 4A3ZA 4JKKA 2VUAA 2Y8KA 3PMSA 1OUSA 2P3KA 2F17A 3O7OA 4W65A 4K21A 4NUBA 4O7XA 1NCQC 5GZFA 3PJYA 1FOD3 3WF4A 1AR83 4XQWA 3T0AA 3WW1A 4PIXA 1W0NA 4NO4A 1PGW1 4HK8A 1LEDA 4FPGA 1AR72 2PHTA 1W9FA 5GM0A 3JB8A 2EIGA 2OYZA 2O0OA 2VU9A 2YBPA 1AR73 5FMCA 2JDYA 2DURA 2ZGOA 2ATFA 1NY72 2ZAAA 4AL9A 3LIHA 1GOHA 1HB3A 2BYVE 3BCWA 4L92A 1UU6A 1XNCA 2WQ8A 4HBNA 2ZZJA 4JTNA 3WNXA 1FMD1 2VR4A 3KCCA 5LB6A 1V0AA 1G9CA 3WP5A 1DQ0A 3UGHA 2P4EA 1AR62 4M00A 4FP3A 4LBJA 1CJDA 5FZBA 3U14A 2ZZQA 5BPXA 4AEJA 3AX4A 2X09A 4JX0A 2GC3A 1AR63 1Q3EA 2WL1A 4QX2A 2MNGA 3MDPA 4XJUA 3SMHA 3U4SA 2V73A 3K4DA 2JE7A 1OH3A 1NLQA 1XC6A 2G9GA 1AL22 2GNDA 3PUAA 4CEWC 3B01A 1RHI2 4LO7A 4TXWA 3MIFA 2R041 1AL23 2W0XA 3C7HA 4WVZA 1DYPA 3AKQA 2WZEA 2QQVA 5F3GA 1RJ7A 2JG8A 5GALA 3R4DB 5KHIA 3ROUA 3NNLA 2QQKA 3PVNA 1PX3A 1LKNA 4GH4C 5FUNA 1EV12 2FCTA 2X5IA 4XUOA 2W52A 2HWB1 3WUDA 2W68A 5ACA1 2J7MA 2ZCWA 1NE4A 2QQNA 2VW0A 3GCXA 4XBNA 4LJHA 3ZFEC 4DMIA 4GWJA 2B7YA 2ORXA 4LO6B 2YB7A 3VD9A 3NKGA 3OBRA 4O9GA 3HNBM 4FFIA 4BQ1A 4QDRA 5FUPA 3AZXA 4MHRA 4CZSA 1IQAA 3IIAA 2ADEA 4RA0A 1UY1A 2OQ6A 3AVSA 3OYWB 2OXBA 2R062 2Z2SB 3D0JA 1KDMA 2G1MA 2PFWA 2VO5A 3WQBA 1WZXA 4HL0A 2GALA 1QDOA 5DDJ2 3VBHB 3ZLIA 3I7DA 1CWPA 1PGSA 4UI9L 4W6YA 2P3YA 5IAXA 5CFDC 2VL4A 4IEQA 1SPPB 5DDJ3 4WVWA 3H1WA 3SCHA 4JGZA 1YHFA 3B3QE 3IZOA 4AI8A 5FZ8A 3D5OA 2WT0A 4IV3B 3VLBB 3MV01 2KR2A 4WM7A 1OOPB 4CP0A 2E7AA 2XHKA 1A3KA 2ZMNA 4NAOA 3SH4A 5JOYA 2NPIA 3VUOA 3MW2A 4V2VA 3N3HA 5JIAA 1O3RA 5E89A 3VD4A 2RJ2A 4PF1A 1DLCA 3G7DA 4I09A 4K6BA 3WF1A 4E2QA 1U0AA 2WDBA 2JX9A 5C8CC 3W5NA 1VMFA 1IS4A 1XNBA 2XLAA 3H8RA 1RUJ1 1GANA 2CGNA 3BU0A 5CG8A 4GMP3 4QT6A 4NPLA 4YVWA 2W1WA 3ACLA 5DZFA 2YV8A 1Q43A 3EJKA 2WT2A 2VD7A 1CGPA 5A7WB 3B7MA 3O5SA 3EBRA 5C3OA 4ZPIA 1AL0G 1GZWB 3N7JA 1G9BA 2ZGKA 2BEOA 1BBT1 1Y9QA 2A3XA 3J9SA 2XDVA 1UW8A 2BFUS 2L9LA 1UX7A 4W6XA 3CHXA 2ZGRA 1C8M1 2D3PA 2PLV1 4KWUA 1QH7A 4B1LA 1RUG2 4M01A 4BM8A 2PQSA 1F9KA 1H6XA 2WA4A 1U5IA 3N7MA 3ZOIA 3WF3A 2QQUA 1REFA 2CDPA 2X10A 1BVVA 3ZYGA 1RUG3 1W8WA 5A1FA 1PGL1 3IAPA 1Z0HA 1H2NA 4V2WA 1UZWA 5LBCA 1R091 4CDQB 4OQ8A 2Z69A 5FREA 1FPN1 2WO7A 4YVSC 5FPXA 3N4MA 1JBCA 4Y1YA 4UBGA 5C8WA 5C6CA 4Q0PA 4XMIA 1O3SA 2JWPA 3J8F1 1RUF1 5JZGA 2CHHA 4NIIA 5FLIA 2OZJA 5LZ6A 4YZ5A 2VAUA 1YQ2A 2FDJA 1SMVA 3T1MA 1ENSA 3ZSMA 5JOXA 5EV7A 5D8AA 4FTBA 5FV3A 4EN0A 5DAWA 4HT1T 1ND3A 2WQ4A 3O1UA 5LY1A 4LHKA 4DS0A 1YFUA 3MF9A 4TZDA 2CU5A 2OW4A 4LR4A 5IK8A 1GWMA 3LFMA 5A3LA 2VULA 4GXLA 4CCOA 3VDBA 3NMBA 2O8OA 2XHNA 1Y43B 4RQPC 2ZACA 4BXFA 1LAJA 4OULA 4PBOA 5A1LA 1X8EA 4PDWC 1CZVA 4JHZA 2CGPA 3ILFA 1RVF3 1S0JA 2Q1MA 3M2MA 3MLJA 1CQ9A 4AEKA 1SACA 3OEAA 1CONA 2QQLA 2W92A 4URTA 4YW6A 1HQLA 3KF5A 2WINB 2WO3A 4CE8A 5JR2A 4KMQA 3OTFA 5FZCA 2Q1ZB 1SCRA 4LK6A 4QB2A 5K9YA 5FLHA 3DF0A 2IXKA 2RVAA 2E6VA 4MADA 2OPKA 2DVGA 5K0UB 3A0NA 1OXCA 4IW3A 1J1TA 2E7TA 3O1TA 4OLLA 1MEC1 4DEQA 1W9TA 2J1UA 2UY9A 4BHPA 1GQPA 1N1VA 1UOFA 1X9PA 1MVEA 1RINA 1KFXL 2VOKA 5FJHA 2RMU1 2GU9A 4K40A 4PLOA 3VHRA 3POFA 4OQ9A 5GZGA 4N7IA 5AFEA 1J3QA 2JD9A 1UWWA 4WM7B 4AHZA 4E4ZA 4OI1A 1SLLA 3ZN6A 1GOFA 2SLIA 2Y60A 4CUAA 2NZ9A 4Y26A 4A45A 5KWRA 4KQ7A 2VUJA 2K0GA 3WDUA 2VC9A 2OQ7A 2XPJA 1CAUB 3DCQA 4R4XA 4HSLA 2Q8DA 3KQRA 5HI0A 2EAKA 1JZ3A 2ZGQA 4Z2AA 3N9MA 4UF0B 2GMPA 4QX5A 4AAXA 3WNMA 1OBNA 1XYPA 1VMJA 4Y1XA 4YM0A 5FY4A 5EJ3A 1XSQA 1ZBA1 1SLTA 1VBB2 3OOXA 2JD4A 2A1XA 5F2SA 5K8SA 1STMA 2D93A 1HJGA 2WA3A 1UZYA 3F2ZA 4YFZA 5ABJB 4XJ8A 1VBB3 5J1XA 3VBFB 2R7EB 4AXOA 4LBLA 4YLZA 3AP9A 2AEYA 1RUE1 2FZ1A 4JAAA 3HEIA 4Y1UA 2Q8EA 4LKSA 4RR3B 1IS3A 2O8QA 2QCSB 3CJIA 3OPWA 4ZKTB 3E6CC 1BMV1 1SZBA 1W6PA 1DGWA 2VZ3A 2VNOA 2D97A 5FZIA 4AI3A 4CRQA 3PHMA 4YM3A 5ISLA 3H8OA 5FY9A 1WCUA 3HN1A 1MR5A 3LWCA 3I2JA 1VB2A 1RYYA 1GBGA 2AEZA 3K77A 5FO7B 4BU2A 2JENA 3OPZA 4B7KA 2BGCA 3I3EA 2VVEA 1OLQA 4UFKA 2Y6FA 4LBNA 1ZBE2 3VDDB 1QXJA 1SLIA 3JD72 5CA6A 2AZ5A 4LULA 1FV2A 1W8TA 3ATGA 4YW1A 1ZBE3 5A7OA 2YPJA 1D2QA 1AR71 3JD73 4KBZA 2BW8A 5A3MA 4QHBA 3DV8A 1PNFA 3CLPA 3I3BA 5DG1A 1CD3G 3J7LA 1ND3B 1W2OA 1Q8PA 2YFZA 4AEDB 1QHDA 1QGLA 1KDKA 1ASJ2 4L2NA 3I2OA 4NIGA 3MIGA 3FC0A 4IEYA 2B9VA 2RR12 1NY71 1GOGA 2LTNA 3D4KA 4QM9A 3CDZB 2EIDA 1B35A 4R52A 3F95A 4W8JA 3PUHA 4QU2A 2W08A 1OH4A 1ASJ3 1S55A 3FLRA 2ZX0A 5F3EA 1S0DA 4AFDA 4DUVA 1UCXA 1UY2A 2RR13 1CIYA 2VTXJ 3AKTA 4NMIA 1JZ2A 2VCBA 2F4LA 1DCSA 4PI0A 3ZFGC 2WBKA 1U5ZA 2NQYA 3VBOB 3WT3A 4LBQB 4AOCA 2ZX3A 4NR1A 1IOAA 3MO4A 5L73A 2RS53 1CIWA 4OZXA 1I9RA 2BBAA 1Q8VA 4UWDA 4D8MA 1PMIA 3UL2A 5L9VA 1AL21 1H30A 2GH2A 4YW5A 3THPA 1RHI1 3BPZA 5T5LA 1N1YA 4BB3A 4KNCA 1TEIA 1YI7A 4YPJA 2WNVB 3DGTA 2D3RA 3H0OA 4KI5M 4BQ2A 5C3QA 3KWVA 3OSDA 5FQ0A 1UXXX 5GLWA 1XNAA 5A70A 3ZN4A 2HKXA 2LRPA 5FMDA 1EV11 4UAPA 1POV0 4NRMA 4PDWA 3MI8A 2DCYA 4Q1RA 3HBZA 3IDCB 2VXJA 1WMFA 2VOWA 3SEEA 4EN8B 1UL9A 1JZ8A 1OKOA 3FFQA 4QM8A 1BK0A 1IPSA 4KWKA 3NWKA 4WZCA 3V0AB 5KC5A 5F5IA 2PAMA 2VZTA 3ALQA 4MZUA 2XJSA 2VZOA 2CWMA 5CYYA 1XQNA 1PMHX 4E4DX 3E5QA 1C5HA 2R061 3HD8B 1XE7A 3V65A 1T2XA 3MPPG 3O1SA 1CX1A 3LSEA 2CGOA 4CEYA 5LW9A 4QPGB 5CAZA 1COV1 3MUZ1 1TME2 2JEMA 1A8DA 4ZZ8A 2WNUA 2J1SA 4GULA 1HN0A 3TN91 2W47A 3AJYA 3MGUA 4OI0A 2X29A 5A6ZA 3AC0A 2VW1A 4LOSA 2CDOA 4UW5A 3ZO0B 2JG9C 1TME3 4BK4A 4DY3A 3PNAA 3OBZA 3M3QA 3KCXA 3CJIB 4ZONA 2QKDA 4RFRB 2PN5A 1N1TA 2ZHLA 1IKQA 1U12A 3ACHA 2HEYF 4FPJA 5AFBA 4TWTA 1FYUA 4GMP1 1QJY2 3LDRA 3MIEA 4NOTA 1ND2C 4I02A 4HKOA 2R072 4L97A 3WP3A 4PLNA 1VBE2 3AK0A 1OD3A 1ZRIA 3ECQA 3AP7A 1HXS1 4JGYB 4QKFA 4NIAA 2R073 5A80A 4MXWA 1F4HA 3OG2A 1JMUB 5FYUA 3WUCA 1VBE3 1UNBA 3JUUA 4CDUB 3J4UH 5K4LA 3UKNA 3PTRB 4R4ZA 2GC1A 3WG2A 3FX3A 2JIJA 2WFF3 1MQTA 4LHLA 4PJYA 5JPNB 3T2QA 4BPZA 1W3XA 5JOWA 5FZMA 2B42B 2SBAA 1J83A 4WZFA 4NJ4A 2ZEXA 1OPMA 4PCRA 4SLIA 5CG9A 5FPVA 3QACA 2ZMKA 2HYKA 1F31A 4E27A 3O1VA 3TEYA 2Y0IA 2WO1A 3NJYA 5C9AA 5LEJA 4LORA 4N43A 5E88A 3GBWA 3VBSA 2XLFA 4I0BA 4XW3A 3LSDA 4CU8A 4IQPA 4M0HA 1DP0A 1QH6A 2XVLA 3P3PA 2IUWA 1KGYA 2VCAA 4R9AA 5CKQA 2R0HA 2VBBA 4JRLA 4XUNA 1JH5A 1DU3D 3J7MA 5FP7A 3WF0A 4QPIC 1N3OA 3HT2A 4LQRA 1V6MA 3KLSA 1MZEA 5A32B 1HV1A 1JZ6A 2C9KA 5I0DA 1JXNA 3BI3A 2C6SA 4XUPA 5B4NA 4AZZA 3VHOA 2A6YA 2WN2A 2ZPXA 4KGGA 2VZ1A 4F3JA 1G86A 4QKBA 1J3PA 2D5FA 2ID4A 4OHXA 1VALA 3MIHA 5F3CA 1IQDC 3R0RA 1ENXA 4A7KA 4QX3A 2C24A 4NROA 1JYNA 2JKXA 5L9BA 3WINE 2BWAA 1SQ4A 3AP5A 2C5DA 1NOVA 3AMPA 3KGLA 2EAAA 4Y5SA 5EQUA 1JZ4A 2CNAA 1FT9A 1GWKA 3WDWA 1OC1A 1W8UA 3DPRB 4J25A 1XNKA 3GZTB 4ES9A 4JKMA 2GSYA 5JOZA 3H3LA 3HPNA 2Q5TA 5FZ4A 1KJLA 5FAXA 2HWF2 1W9WA 4CCKA 2VH9A 4FPLA 3RZLA 3VBHC 1RUOA 3VD7A 1H0BA 3KV9A 4LBKA 4A7YA 5I0SA 2HWF3 4RFT0 1I5PA 3I3QA 4BJ0A 1YQ5A 2JE8A 3GF6A 5FZGA 2WNUB 2EVXA 2XL7A 5A33B 2D5HA 4GIQA 5M0TA 3WF2A 4OUSA 4IV1B 4Q4V2 1U5XA 2P17A 1QF3A 2YYOA 4CDWA 4QB1A 1W6MB 4LHSA 5FR3A 1DG6A 4Y20B 2VOXA 3LE0A 3VV1A 4Q4V3 1AR92 1D2SA 3D82A 1BCXA 3N9LA 4HXCA 2VMDA 1LB2A 2VM9A 4RYDA 5H9RA 1WCSA 3Q8CA 3TWIA 1AR93 4P08A 1W03A 3TRSB 4OHVA 1D4M1 1E5RA 1JOPA 4BQ4A 1VBD1 3OBTA 4Q4X3 4AHXA 3WLUA 5G05L 3SC7X 2H6BA 1O8SA 4PIZA 1I3HA 1VBB1 3ETPA 4MXWB 4EV0A 5AC92 1LRHA 2R6QA 1OQDA 2YC4A 2ZXQA 4P9IA 3VDCA 4MLOA 2BWCA 3MHZA 1WW5A 4P9XA 3WXPA 2K9ZA 3DECA 1MQTB 5C70A 2EF6A 3B02A 2BNNA 4AK3A 3POEA 5JSPA 3D3AA 4JTOA 3U11A 4LTAA 5IFPA 1ULFA 2XWJB 2WWSA 1GQHA 2W46A 3BOWA 3M3CA 5FPLA 4CCMA 4DRVA 2F6BA 1LHVA 3OPTA 2UY8A 1H8VA 5FO9B 4CU6A 2RJLA 5F37A 3SEPA 1H9WA 2C26A 3FMGA 3Q8EA 4IL7A 2WS92 3BN6A 3GJAA 2BVBA 3K46A 5EFUA 5F9TA 1R1A2 3H7YA 1DZRA 3IMNA 4UW4A 1JUHA 1ZRRA 3PVEA 2B5HA 2WUHA 1UN1A 4CDQC 1H1IA 1R1A3 1OT5A 4E2SA 4DINB 1LHWA 3VBSB 3WOGA 2JDHA 5J36A 3IN9A 3KQ4B 1PNGA 4QB6A 1ZBE1 2ARCA 1S0BA 1EAH2 3JD71 1NCRC 2P3JA 4XCBA 4M3CF 5BNNC 1JYCA 4JKLA 1X82A 1UIJA 4I0WB 4LO5B 5EJZB 5T5PA 2A6WA 4LE4A 1EAH3 2I74A 4M3CE 1E5HA 5I8SA 3I2GA 2JDAA 3HAGA 3HT1A 4NRPA 4OMCA 1OQ1A 1GZ9A 4TYSA 5IUQA 1QOTA 3U75A 3WDTA 5FZFA 1I6XA 1R64A 1RUH2 1LOFA 1PVC2 2BDRA 4AGVA 1XU2A 1SFNA 2BV4A 3M3IA 1YO8A 5LRSA 1H8TB 1RUH3 1PVC3 2WC2A 4Q27A 3WW3A 1LTEA 3LOBA 2AR6A 4XJ9A 3VZOA 4WVVA 2DUOA 3JB4C 1VR3A 1X50A 3ZIXA 2VQTA 5FO8B 5GZCA 4X8NA 4IE7A 2DF7A 2Y26A 3RZMA 2VCMA 2ZGLA 4IUGA 1W6NB 4A44A 5CVRA 2RM23 3ZYBA 3C2UA 2Y34A 1DGRA 4XF9A 1NQJA 2W87A 2PHLA 2UU8A 4N90A 2WWJA 5A7PA 1YJLA 1IZ3A 1UKGA 5L7OB 1PZ9A 2XJPA 2ET7A 3LCPA 3I3DA 2MHFA 2V5YA 5K0UC 1QJU1 1ULEA 4FOYA 1U5YA 2ZMLA 3O1MA 1WKYA 2D40A 2YMZA 5FUIA 2P1BA 4ARYA 3FWEA 4BA6A 1OD5A 3LB9A 2YZ4A 2VTFA 4LBQD 5A7SA 4M3CB 4IERA 5A6XA 3ZXFA 3WX5A 2YROA 2D6KA 1DYKA 1UYXA 3GZAA 3S5AA 2EXIA 3JXSA 4IEWA 3LDBA 4BQ3A 2A7AA 2QTWB 2VZUA 2YU1A 3DN7A 1Q5OA 3QH6A 3ZXEA 1HN1A 2VY0A 4FP2A 5FY0A 4XQ4A 3UK9A 3B93A 4G9SB 2BU9A 5FYZA 2ZEYA 2DWRA 4P9LA 3W9AA 3AP6A 3H1YA 4MVTA 5ERLA 2QVSB 3I59A 2CL2A 4QXCA 2IFRA 2ENRA 1XRUA 3MLLA 4HMZA 2WRAA 4JDMA 4CYDA 1DZQA 2VMFA 4P5YA 2QE3A 4FPHA 1RUNA 1ZRFA 1POV1 3HIFA 1OPOA 3USUA 5ABJC 4XPVA 1FOD2 5FZ1A 2JXAA 1AR82 3SH3A 1TME1 4KU7A 4CP1A 1JHJA 3BTXA 4MH0E 1CAWA 4CCDA 2IFWA 2J1VA 2FMYA 1WCQA 2QQOA 4TSVA 4BLJA 1V9U2 3THDA 4ITCA 4RR3C 2HWD2 1GNHA 2JKBA 3IDAA 4HSJA 4W4ZA 1CVNA 4EN7B 5JXHA 2PAKA 2WIIB 4PBPA 4C0BA 1BVP1 1V9U3 2RDRA 2W9XA 3E6DA 3WNNA 1FI2A 2HWD3 4Q4Y2 5BNOB 4SBVA 1QJY1 3ILRA 4QWNA 3LQCA 3NJXA 2P6HA 1F2NA 3Q9OA 2YHJA 5LA2A 3JQXA 2J1AA 2R071 3J7HA 4UYBA 1JZ7A 3O1RA 1KJRA 4Q4Y3 3VZLA 1WD3A 1DQ4A 1VBA3 3VD3A 3J26N 2Z79A 5FY8A 3UV9A 3VBRA 5JSOA 4QX0A 4LE3A 1K42A 1QWRA 4S2HA 3VDDC 1JS9A 1L7RA 5FZ3A 1GNYA 3MIDA 3T08A 2VZSA 3S7IA 4EQVA 2JECA 3LEMA 3SQOA 4KG0A 5GZDA 3R4UA 5A3PA 4WM8A 3B5LB 1MZ6A 1CAVB 3M8LA 3KHBA 4QX7A 1UPIA 4AEDC 5C3SA 1IS5A 4CP2A 3RI9A 2QUOA 5E1RA 2R30A 5H9PA 4IEVA 2A3YA 4QDSA 4FO9A 4RHV2 4ZS3A 1W05A 1AYM2 4AI0A 1YQCA 1IKPA 2ZHMA 4DNYA 1V6LA 4RHV3 4CPBD 5IK5A 5C3PA 2XLGA 1UMIA 2V72A 3DKWA 4IEXA 1AYM3 2BRTA 4NWVA 4QDQA 4YG0A 1NCRA 1WLWA 5BNNA 4EWAA 1VAVA 3NJZA 2XKPA 3T2TA 4W50A 2VMHA 4B7EA 2QZ3A 4MO3M 1OURA 5LBFA 5A3NA 1PO21 3VZJA 1UOJA 3KV4A 4U2AA 2VUDA 5FYBA 4OUEA 2XOMA 4LIVA 2GH8A 2VQUA 5F1RA 3N9PA 1O4YA 2VMGA 3WP4A 5BUVA 2E51A 2BJSA 3Q8FA 4NN0A 1OF4A 4KBBA 2H6CA 4META 3LKJA
chains in the Genus database with same CATH topology
1K5MB 3ES1A 2XJVA 4GMP0 3FZ3A 1G6NA 1TMF1 1VJ2A 4XJAA 3ZXDA 1H9PA 4FPFA 5C4WA 4Y4YA 3B69A 4QGMA 3OF1A 3PVBB 3UKVA 2C1FA 5LEKA 4RS5B 1JYIA 2E63A 3S6PA 1I5ZA 3I59B 3USSA 1UPSA 1WMDA 4FOQA 3CJXA 4AVSA 1ZRCA 3VKOA 1EY2A 1C1FA 4BYYA 4JVAA 2EXHA 4AVTA 2ILMA 3KB5A 5I8TA 1RUC2 2DU0A 4Q4V1 4HLTA 1QDCA 4P5HA 1G9FA 3JU9A 4COZA 1V6OA 3AZVA 1RUC3 4CDXC 1C1LA 4H7LA 1AR91 3ZYPA 2VQ0A 3ES4A 5K7PA 1M06G 2R1DA 5FTTC 2D6MA 4KWLA 3D8CA 3AZZA 5DUVA 2A3WA 1PK6C 3WVJA 1SLCA 2A6ZA 4LEJA 3JZVA 4JGYC 5BXXA 4K7JA 4Z82A 5AC91 3NAPC 2ETEA 1VRH1 1TQ5A 4CDUC 3POSA 4C0HA 4E2GA 4XIKA 1NCQA 4NHLA 3AYCA 5J98B 2XG3A 1RIRA 1H2LA 3QBQA 2AENA 3NO8A 4J1XA 1MACA 1D0HA 3ZDSA 1ULDA 2CAVA 3SXWA 1CAXA 2WS91 4GKXA 5DZEA 3RMXA 1R1A1 4F7ZA 4QMAA 2JG8B 2EXJA 3EXUA 4XQDA 5JAXA 4IEUA 4QQ2A 2X5IB 1RVF2 5BV6A 1QQP2 4FPEA 4QQHA 3AXDA 1DGWX 4LUMA 1EAH1 3M7AA 3IDBB 4H7MA 1QQP3 1W2UA 4WV8A 5FCCA 1REEA 1ONAA 3ST7A 1Z7S2 1OFNA 4QGLA 2OA2A 4CEWA 3OD0A 2IXCA 1VIWB 1PVC1 1Z7S3 4C1XA 1HRI2 4GALA 4YGDA 3I2DA 3ZIWA 2HWC2 1CR7A 1HRI3 1S0EA 1W6OA 2VG9A 4X6QB 3LOBA 3M3OA 2AYHA 4KWJA 4GH4A 4MXVA 4JGZB 2HWC3 1ZZBA 4Q4W2 4ASLA 3ZFEA 4Q4W3 1PIV2 3DPRC 3PJQA 3OJBA 5BNPC 3RZZA 3AXEA 3ZXJA 3I54A 1DGLA 1MZFA 3NVCA 1TNFA 3VL8A 4QQLA 1PIV3 3ZMNA 4XE9A 3M3EA 4AFBA 1MS0A 5T52A 5L19A 3AJZA 3GYDA 4JV4A 4S2GA 3FFZA 4XXPA 3ZFFC 1YXWA 3B9IA 4YVWB 3TNQA 3H3ZA 4S2FA 4AFMA 3L9JT 4FPYA 4NVPA 3VHPA 5CFDA 1BEV2 2RHPA 4IV1C 1ZZ8A 2VW2A 5CFCC 5FMOL 4YZ1A 3IM0A 1BEV3 3WQ1A 2Q4SA 3O0WA 3NV3A 4B4QA 3MW3A 3VBUC 2D3SA 2A71A 3B00A 1MS3A 1O4TA 1SCSA 4XF1A 3TNPB 5I0TA 4MSVA 4A2UA 4K8FA 1GLHA 1YFYA 5C8CA 3CO2A 4LLFA 2XJTA 2NM1A 4BMEA 3RYPA 1FOD1 2R1BA 4YFWA 4A7ZA 1AR81 1WLDA 3WDVA 4BIOA 2Q30A 4FAHA 1ZREA 5JZGB 2IWGB 3V0BA 1H4HA 1SDWA 1EP0A 3ZYJB 4CDXA 2ES3A 2HWD1 3FBMA 4MGZE 4IEPA 5D8AB 3L2YA 4G3YC 2MEV2 4F8AA 1HLCA 1PVXA 1O3QA 4XYXA 2A6VA 3THTA 2YDEA 1PK6A 2CTVA 2E53A 2MEV3 3RQ0A 3MICA 3S7EA 5KXDA 3IPVA 4I3GA 3S30A 4XEZA 4YGCA 3NAPA 4AVBA 1LESA 2YUEA 2BBVA 4GB32 4YVSA 1PHMA 1NG0A 4QXKA 1W6QA 2RS52 4XILA 2Y0OA 4GB33 1AR61 3ZSKA 4AQTA 4N53C 4K20A 3GALA 2QZ2A 2FMDA 3O12A 4Y22A 4COVA 1QKQA 4P9YA 2AUYA 2ZGMA 3RJ2X 4XFCA 3PTYA 5DUUA 3S0MA 2ZGUA 1RL3A 4BIFA 1ZRDA 1RUD2 2ZGNA 5LK5A 3FLPA 4RHV1 3TOJA 1AX0A 1HDKA 1AYM1 1RUD3 5CU1A 4RQPA 4LT5A 2I45A 1JOJA 1XXNA 2ZKLA 2DV9A 2MPFA 3ZFEB 2DUQA 4XF3A 3ZN6B 1YRZA 1BJQA 5L7OC 5JVVA 4DB5A 2DU1A 2XL9A 5F6LB 1C4RA 5GLTA 4U36A 2UYBA 1CPMA 1NA1C 1D0GA 3SLIA 3O14A 5J48A 5DDJ1 1FNZA 2WZR2 4OVEA 3VZKA 3WDXA 4ASMB 3QD6A 2B8MA 1XE8A 1LHNA 2DCJA 2WZR3 3FJSA 4EN9B 2EALA 1TE1B 4DZGA 5T5OA 2XJRA 2R0FA 1YLLA 4PQ9A 4AVVA 1W6PB 3N7LA 3AYEA 4AHWA 1QY4A 2YC0A 4EJRA 5J96B 1AYN2 2DTYA 4DXZA 1HQWA 3H7JA 4KH9A 1BZWA 4I0AA 1AYN3 3BOPA 4L9BA 4Z92B 2D6PA 3NV1A 3POYA 5I8YA 1S2BA 2LALA 2WFF2 5F5QA 4C91A 1UKRA 1RUC1 1NLSA 5CFCA 5FOBB 5H9SA 4QPYA 1PM7A 3NL1A 4Z1VA 3VBUA 4PF5A 5BNOC 1AXZA 1RITA 1UMZA 1RUG1 2YGLA 1WA4A 4P9JA 1B35B 3AZYA 3LA3A 2QQPA 2YY1A 1L3JA 1IPJA 4YVSB 3RDIA 4I2OA 4OHWA 4YM1A 4Q0SA 5DUXA 5HXVA 4XZPA 4J1WA 2XJUA 3JCIA 4Y22B 5DUWA 4JQRA 5FPZA 2PELA 3MW4A 2ET1A 4PIYA 4LLOA 1YFXA 3I8TA 4XOGA 4FOVA 1NLRA 4K9SA 5CBLA 1QJZA 2ZX4A 4IEZA 3M70A 3MZHA 2R043 4ZU5A 5FQ0B 3AP4A 4DPNA 4LUKA 4QD2A 3KZ4C 3U0ZA 1RVF1 1QQP1 2ZA9A 4PDWB 4XJWA 3ZFGA 2DVDA 1KQRA 4PLMA 4D94A 3FUOA 1N1SA 1OMIA 4YW3A 2WJSA 1LU2A 5FDBA 1VAKA 2ZHKA 3IDEA 2ZS6B 4OUMA 1A78A 1Z7S1 2PHUA 4KU8A 4K1YA 5KHGA 4HANA 1K5MC 3B9CA 4CEYB 4IEOA 1LOEA 5LRRA 3KGZA 4AHYA 4FQ4A 4Q4W1 1JUIA 2WQZC 1V6KA 1QOOA 4IV3C 3R6SA 4FPOB 5I91A 1OOPC 2QFEA 4RS5C 2XKOA 1OA4A 1AX2A 1TNRA 1H4GA 4AQ2A 4Q4X2 1RUJ2 2Z5WA 3ELNA 1SLBA 3OGJA 2NYYA 1KFUL 2P2KA 3WQ7A 1EPZA 1C3HA 4HVQA 1RUJ3 2ZOEB 4HKLA 3ME2A 1WW6A 1LENA 2PAEA 4XDQA 1BEV1 1HQNA 3T1LA 4LHNA 4FPKA 4XJZA 1BBT2 1H1AA 4LBOA 5DXDA 1VAMA 2AREA 2JG9A 4RGGA 1YIPA 4FPCA 1BBT3 4ISRA 3WDYA 3WP6A 2A73B 4DFSA 5EYYA 2IZWA 4AEMA 3QCWA 1H2MA 4HPKA 3EO6A 1ND2A 4N7UA 1GV9A 1GQGA 3G6JB 2TEPA 3RYRA 5C9AB 1GKBA 4N43B 1F5FA 4B29A 1NXD1 4RGAA 1ZA4A 1RUF2 4AI1A 4YNIA 3WY6A 3WW4A 5I93A 4Y1ZA 1S1AA 4RL7A 4D7YA 1RUF3 2ARXA 4Q29A 1UX6A 4BWOA 5T3NA 5J3UA 4YZ3A 4HN1A 2MEV1 3SCFA 1PO12 2RE9A 2ZABA 1ASJ1 4ZXKA 2JG8C 2RR11 4N9HA 3PLQA 5FLJA 1PO13 4IESA 2X5IC 3KM5A 4XBLA 1PZ7A 2R32A 2IXHA 2WSUA 4GB31 2RM22 4Q0QA 2ZAHA 1Y7BA 1QNWA 4XF0A 5EZWA 2RS51 4MYEA 2UWBA 1UU5A 2WSVA 3WHUA 5AVPA 5GJ6A 2GAUA 4QPIA 4NHMA 2E9QA 1XU1A 4XETA 2XB6C 3EHKA 3VKFC 4AW7A 5J7MA 2XBO2 3MEPA 3QH7A 1DQ1A 2VVFA 2F4PA 3NV4A 4JDNA 5C33A 3LGRA 1YWKA 2XBO3 4G4FA 1MEC3 2G4IA 5GLUA 3BODA 2DVAA 3IBMA 1FNYA 3A0KA 3VL9A 5JWPA 4CDWB 4WM7C 4YGEA 3ZPYA 1OHFA 2XGXA 3WV6A 3K48A 1RUI2 2Q8OA 1LGBA 4CTEA 4JDOA 3WZ1A 3FBYA 4P9GA 3ZSLA 1RUI3 3H3UA 1BK1A 2VNRA 3OYWA 4FAGA 4FTSA 4YVWC 3VBHA 1MS4A 3GBFA 3MYXA 2P34A 1MS9A 1H2KA 2GNTA 1Z78A 5BNQA 3WHTA 1W0OA 3VBFC 3SNMA 1QXPA 5JR7B 2D6NA 3BTAA 4IV3A 5DG2A 5DZGA 2BQPA 5T5JA 4FOWA 2ZX1A 2ZBJA 1BYHA 2HEWF 4FXGB 4Q8KA 4WBBA 3AFKA 2PHXA 3AKPA 3RNSA 1ND2B 2PQQA 5CNAA 4XMAA 2OUHA 1VBA2 2C0ZA 1ZZ9A 1D4VB 1DLLA 1VBE1 1SBFA 2PTMA 2XVGA 3D0SA 4Q1PA 3TB0A 4YFZA 5T50A 1Q8QA 5KC6A 4ISQA 4K3UA 2WFF1 1ZX5A 3ZX7A 5KXBA 4XBQA 1GZWA 2AH2A 4I01A 4BH9A 5JZGC 4XIOA 1FAYA 1Q56A 3NKTA 1DFQA 4R9DA 2DCZA 5FMOS 3WW2A 3GNEA 5D8AC 1IGOA 4O9EA 1LCLA 3POWA 4XF4A 1ND3C 5JLVA 1YFWA 1NYWA 5T54A 2FHRA 2W39A 1RTVA 3RMYA 1R1ZA 1O5UA 4H55A 4EWDA 3KT4A 1O91A 1S2KA 4CDQA 3ZXKA 4S2DA 2GN7A 2NP0A 2JE9A 3H1MA 3TYJA 1WCKA 3V56A 1QU0A 2KM2A 3E5UA 2DVBA 2X8KA 2C9AA 3FLTA 5BY5A 3ZXLA 1HIXA 4YG3A 5D1IA 4QPIB 1AXKA 3APBA 2DCTA 1V6IA 1WD4A 2XUMA 4JRAA 1ZZ6A 1EYBA 4XHBA 1RHI3 2XVKA 5KHJA 2GC0A 1APNA 3QLQA 4D69A 2A6XA 1WUVA 2A5ZA 1RC6A 2DFCA 1WGPA 3E97A 4Z8BA 4J6GA 1AUYA 2HEVF 3AKSA 1EV13 1LJ7A 4AVAA 1QMJA 2NMOA 1JHNA 1FATA 4N9IA 2NLRA 1RMU2 3ZXAC 4OI4A 2BUKA 2A75A 1URXA 3PMEA 1REDA 1AJKA 1RMU3 3NSTA 3ZYIB 4COWA 4YG6A 2HWF1 5K0UA 2KXLA 2R063 3OCPA 3FHIB 2BVVA 1OKQA 3OY8A 4Z07A 1COV2 3USUB 4QPGC 1C5IA 1UD1A 2JICA 3SISA 3TN92 1DDLA 1S0GA 4XFAA 1COV3 3BU7A 3CF6E 3AB0A 5F6KA 4AFAA 2PHFA 1CAWB 3D6EA 3TN93 1XYNA 2V09A 1OFSA 2ERFA 2ZGSA 2WNEA 2IXJA 3EQEA 2P3IA 1KD7A 3CJIC 1LHUA 1G9AA 1FXZA 2EA7A 1CAUA 3SITA 3U4XA 4Q4X1 2QJVA 1B09A 1O4ZA 1W39A 3H50A 1AXYA 2DTWA 3WQ0A 2UYAA 1HXS2 4QGNA 3AMMA 3OGGA 4C1WA 4FCAA 3VBRB 3DUIA 1X8MA 2XJQA 5ABJA 1HXS3 4AGRA 3MFCA 3VBFA 1AJOA 4FBFA 1HX6A 3UKTA 1XYOA 2OZ6A 5FBZA 4D7SA 1V6NA 1FV3A 1AZDA 3E5XA 4RR3A 4WM8B 1VBC2 1XNDA 2GZWA 5B2GB 4I30A 4LO4B 5JI9A 5FRAA 3RJRA 1R082 1VBC3 1QOSA 2JJ6A 1B35C 5BYNA 1ZVFA 4COYA 2I2SA 4FXKB 1LULA 1R083 1I1EA 4Y24A 3MLKA 2ZTNA 1OA2A 2CWSA 1SLAA 3VDDA 4MX3A 2B9UA 1NCRB 3B94A 5BNNB 4NWWA 4TLFA 5T55A 2ZGPA 5AVAA 4AQSA 1KRIA 2K2SA 4Q8LA 1EPWA 2ARBA 4JC1A 1LODA 2CAUA 2I07B 3GZUC 4XFHA 4LNVA 4HFSA 4AEDA 1BQPA 2VMIA 2IXIA 1LOGA 1PO11 2HJIA 1J58A 1RUH1 2VGDA 1LOCA 3NW4A 4GWNA 4H14A 3K51A 3WG4A 2B46X 2RM21 5C4WB 1WBFA 3RS6A 5IK4A 3WG1A 4MGIE 3VBOA 2Y38A 4LBQA 4ZU7A 4KGQA 4NPRA 2D6OX 3ZVXA 1FX5A 2GMEA 5CB7A 4ATFA 1X33A 2B45X 2XBO1 4XXAA 2HWE2 2WNVA 3OY8B 3VHNA 4CEYC 1LHOA 2NN8A 5KXCA 4BCUA 1S0CA 3JBG2 2WNUC 2HWE3 4R8HA 2PA7A 2B39A 5EYXA 1OI6A 5KBFA 3RWNA 3JBG3 4YW2A 4B3NA 3BIWE 3AM2A 1RUI1 3M4FA 3M1HA 3V0AA 2PHWA 2BNOA 2RS12 3MFAA 2EXKA 4GA9A 1D4M2 3BALA 3V64A 1VBD2 3HMYA 2RS32 2RS13 3UJQA 2XH6A 1MS8A 1AX1A 4GKYA 1G9DA 1LU1A 1MS1A 1D4M3 4XHXA 3OD4A 1VBD3 2D6LX 2RS33 4QPGA 2G9FA 1KS5A 2BTVC 4ORFA 5CADA 1JW6A 3RYKA 3ZSJA 1GSLA 1NCQB 1MQTC 2TBVA 2UWAA 4XFIA 4OI2A 4HVOA 4RSUA 1OLRA 1IHMA 4YZ2A 4XFBA 1ZNPA 5H9QA 2D43A 1V9U1 1RB8G 1WCDJ 2IC1A 3HR9A 4AI2A 4MGYE 3MIBA 3C3VA 4IXLA 2N7GA 1DBNA 2VPVA 1CAXB 4Q4Y1 1LOBA 1C57A 2YGMA 1DGRN 3CEWA 4HN0A 1VBA1 1GR3A 4Z2WA 1V6JA 5C9AC 4EWEA 4N43C 3N35A 4AGGA 4JGYA 4DOUA 3VBSC 1V00A 1LGNA 4WVMA 4CDUA 1X36A 3LAGA