1LOJA

Crystal structure of a methanobacterial sm-like archaeal protein (smap1) bound to uridine-5'-monophosphate (ump)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
b'VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
molecule tags Rna binding protein, transcription
source organism Methanothermobacter thermautotrophicus str. delta h
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
total genus 13
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lojA00
2RD1A 5LJ3j 4M7AA 5GAN6 4RCCA 4HT8A 3GIBA 3INZA 4M78C 2RM4A 3VU3C 1U1SA 4OP0A 4NL2A 4Y91A 3BY7A 2VXFA 1U1TA 5GMKh 3HFOA 2EJGA 1Y96B 3SWNC 3RKYA 4HA8A 5LJ5j 5GAOp 3JCMP 4M7DB 3L1AA 1N9SA 4M7DG 4M78G 4F7UB 3JCMh 4J6WA 1B34A 3EFRA 3SWNA 3V7RA 4C92D 3V7SA 3JCMW 4M75C 4N0AC 4NOYA 4J6YA 1MGQA 4C92F 5LJ5g 3HFNA 2I2LA 1M8VA 4XU1A 5GAOm 1HXDA 3SWNB 2DXTA 2EAYA 4XTZA 1LOJA 4C8QB 5GANe 4JRKA 3JB9J 4C92C 5GAMg 1N9RA 5GAMj 5LJ3g 3JCMb 2RA2A 5GMKl 1WNLA 3BFMA 4EMKA 3RESA 2DTOA 4M7DA 1BIBA 4PJOB 3JCMg 3QHSA 3BDUA 3JB9H 2YLBA 2E41A 5GANg 4PJOG 4M78D 1I8FA 4M78A 4EMGA 4EMHA 4MMLA 5GAN8 3V8LA 1WPYA 5GANf 1D3BA 4C92B 3JCMJ 1TH7A 5GMKe 5LJ5d 5GAN5 4C8QE 1KQ1A 4M78F 3RIRA 1I5LA 4JLIA 4M77D 5GAOl 5GAN2 3SB2A 3AHUA 4M7AG 2HNIA 3QUIA 4M77E 1JBMA 2VC8A 4JRIA 4M77F 4M75A 4C8QG 5GAN3 3JB9F 3RKXA 4M75B 4X9DA 5DY9A 4A53A 5LJ5h 4M7AF 4M7DE 2ZGWA 4C8QF 4QVDA 4N0AA 3V8JA 4XU2A 1X01A 3JB9D 4F7UE 4PJOA 4M7AC 1D3BB 4C92A 4A54A 4M77B 1LNXA 1Y96A 1M5Q1 5LJ5e 3FJPA 2DTIA 5I21A 5LJ3e 2EJFA 5GAMd 5GANh 4MMKA 4XTYA 4PJOF 2K57A 5LJ3d 5GAN4 1KQ2A 3V8KA 3JCMe 1I4K1 4XU0A 1I81A 3L2ZA 4C8QC 3JCMQ 4M7DC 4V2SA 2DZ9A 2DKGA 4J5YA 5CAIA 2DTHA 4M77C 3QSUA 3RKWA 4C8QD 4PJOD 3JCMc 4M75G 2RB6A 4C8QA 2EWNA 4C92E 1WQ7A 3FB9A 5LJ5f 5GAOr 2DVEA 3BW1A 3QO3A 4M78E 3JCMd 1HK9A 3JB9G 4X9CA 2JN0A 4M77G 5GAOq 5GAMh 5GANd 4M7AD 2EJ9A 5LJ3h 2E65A 2E1HA 4EMKB 3JB9I 2YLCA 1YCYA 4HT9A 1H641 4NL3A 2CGHA 4F7UA 5GMKi 4PJOE 2E64A 4M7AB 4M78B 3PGGA 4F7UG 5GAMe 2DEQA 3HSBA 4XTWA 4PJOC 2DJZA 3RUXA 5GANj 2DZCA 3JCMf 4XTXA 4F7UF 3JCMX 4M7DD 4QVCA 4M75D 4M7AE 4XTVA 2FB7A 4JUVA 4XQ3A 4M7DF 4M75F 4M77A 3RERA 4J6XA 4PNOA 1BIAA 3M4GA 4WF2A 5GMKm 3V7CA 1JRIA 3FIFA 4DQ2A 3EFSA 4XTUA 5GAMf 2VXEA 5LJ3f 2QTXA 5GAN7 5GAOn 1B34B 4C92G 1WQWA 3JCMV 2Y90A 2DXUA 5GMKj 2E10A 4M75E 2FYKA 4EMKC 4XU3A 4RCBA 2YHTA 1LJOA
chains in the Genus database with same CATH superfamily
4M7AA 2VWFA 1M27C 3CCLQ 1ACMB 2KI7A 3EGDB 3VRZA 2Y4XA 3G6ET 1SHGA 2AZSA 4HCZA 2MMPA 7AT1B 1QVGA 5LJ5g 1MGQA 1MNEA 2D8JA 3QYHB 1H3HA 4XU1A 2DAQA 3OYLA 1ZSZB 2J6KA 3JB9J 2CDTA 5I2MA 1N9RA 1VQKA 4EMKA 4L5GA 5J26A 5KYWA 1ZUYA 3RNJA 3LW5E 4PFZA 4PJNA 5I11A 1G3SA 1VQ8T 5LJ5d 3CPWP 4M77E 4DBQA 1C6VX 3RKXA 1GFDA 1YIJA 1OV3A 4N4HA 3KUFA 2VV5A 4M7AC 4C92A 2D0QB 1Y96A 3CD6A 1Q81U 2O88A 3I5RA 1VQKT 4XTYA 2QA4A 2V1QA 2ZPHB 3CPWS 1TS9A 1M1FA 1D09B 5FW9A 2ROLA 3CCSQ 3OBWA 1YP5A 5IH2A 2LQ8A 2BUDA 1YCYA 4NL3A 4PJOE 2K3XA 4F7UG 1T3SA 5CKDA 4XTWA 3M54A 3DB4A 5HCKA 2KRMA 2RQRA 4A4HA 1V1CA 4M75D 1SSHA 2AKLA 2HDAA 4J6XA 1R0CB 1K73C 3H8ZA 1QP3A 1OOTA 1ZHIA 4C0DB 3M0PA 2LDMA 3EFOA 3NTIA 2EVRA 3OW2S 2QTXA 5KE3A 3JV3A 2EQMA 4XU3A 2LMJA 1VQ9A 2I0NA 2LQNA 1N8RU 1VQ5T 1K73U 4NL2A 1WDXA 3R6NA 3SWNC 4FT2A 2HZYA 1VQPA 3V7RA 3MCAB 3GPLA 1RL2A 2F69A 4JS4A 2LTOA 4FT4A 2GFAA 1HSQA 4C0ZA 3T9NA 2E5QA 1VQ5Q 3CXCP 1JB0E 3PIPA 1YHQQ 1VQLA 1PD1A 2RNAA 3CCSA 4M7AG 5D6XA 4M77F 3REAB 4B6MA 3E9FA 2EYZA 4J83A 4JRPA 3JB9D 4J8OA 2XU8A 1LNXA 1SEMA 4C0FA 3MP8A 3G1JA 2PQWA 2KK4A 3JCMQ 5FRMA 2RJCA 1G83A 1OULA 2J06A 1IZ6A 2ENMA 2GGRA 1WXBA 2KNBB 4VUBA 3CCET 2VGNA 3SEMA 3CQTA 2LQWA 4A4EA 4P5NA 1WXUA 2R58A 2DL7A 1KQSS 5L8RE 4IURA 3GF5A 2EYWA 2BIVA 1OZ2A 2EQJA 4FU6A 1NYFA 5LJ3f 2KEAA 5GAOn 1M90R 3FEOA 2EIFA 2FHDA 1OI1A 4J9IA 4OMOA 2GFUA 4HVWA 3VRYA 3CCJA 4KRTA 2FVUA 3ER0A 2LJ3A 3FRNA 4HCKA 1B34A 3EFRA 1YJ9A 1VQ4A 2JMCA 1NLOC 2EAYA 2VKNA 4C8QB 4OVAA 5GANe 4AFSC 1VQ8Q 3CCMQ 3L2UA 4C5IA 2X35A 1AZGB 1PC0A 2O2OA 4CC2A 3CC2A 3UPUA 2JM9A 2HQXA 2C0OA 1RI9A 2JVVA 4JRQA 1V29B 3R6OA 1YJWT 1AT1B 3QUIA 4JRIA 3NPFA 4N4IA 4QVZA 1I5OB 1HYOA 1OU9A 3V8JA 1M8MA 2IIMA 1YWPA 4A54A 1H92A 1Q7YC 1M1KC 2IG0A 3AT1B 3TVTA 2HBPA 4J7IA 2AK5A 2RHXA 3CCQT 1BCMA 1AVZC 3J80E 3FB9A 5GAOr 3SD4A 3CC7Q 4X9CA 1TU0B 1OZ3A 2YLCA 3L2VA 3QIIA 2X4XA 4PLLA 3M0SA 2RO0A 4FYWB 4QVCA 3OYYA 3NHNA 2HQHA 4M77A 4PJLA 2DL5A 1XNIA 4PNOA 4KUIA 5GMKm 1VQLT 3CMAA 2G6FX 1NEGA 3CCQQ 4RCBA 2AT1B 3PMIA 3H0IA 3NMZC 4D8KA 1OPKA 4OP0A 2GTJA 1UGPB 4Y91A 4N4GA 1H3ZA 5IAYA 3OYAA 1AWXA 2QQAA 1BK2A 5EG2A 1VA7A 1VQ6Q 1Q86R 4LDYA 1KJWA 2LCSA 4ZGDB 1QKXA 2PUOB 2M9UA 5CKEA 2CREA 4EMGA 3LWHA 4FW2A 3EFOB 2FEIA 4MMLA 1IHVA 4PFOA 3VUBA 1UHCA 1S72A 3I9QA 4A63B 2NWMA 1D1AA 1OEBA 4X9DA 5DY9A 5D7UA 3KXTA 3O5ZA 2JTMA 2M16A 3E1SA 2NLUA 3J81E 4OMMA 5GAMd 1X2KA 1Q82C 2G3RA 1JXOA 1XQHA 5CAIA 3OYKA 4M77C 3WVEB 3RKWA 5GJWB 4PJOD 2V8JA 2X4YA 2KROA 2XKOC 4QW2A 1KD1C 1E7OA 2DVEA 3BW1A 1QVGS 5CQYA 2R5MA 5GANd 3CCRQ 4RUGA 4BDYA 2ATCB 2L3PA 1TUGB 3THKA 5CKHA 4E7ZA 1X43A 2RHIA 5CK9A 2K3BA 2QK0A 3CCMT 3H9NA 2LT4A 1FWZA 3M0QA 2KT1A 2GQIA 3G6EA 4BI4A 4BY6B 2QDYB 3CCLA 4LDUA 1KC8U 2YRDA 2K7AA 2VXEA 2HEQA 4HVUA 2ED1A 3HTRA 3JCMV 5CVIA 1UGQB 2E10A 1X69A 1WYXA 1CKBA 1ZUKA 3VU3C 4RKUE 1NE8A 1GFCA 3EGUA 3TCJA 1KQSP 1N5ZA 3QKJA 4IUPA 5LJ5j 1VQNT 1JO8A 1WHJA 1M2VA 1EFNA 2QEXT 1TSFA 3JCMW 3CC4Q 1JXMA 2K5FA 4J6YA 3ASKA 1H8KA 4JRKA 1FMWA 2X4JA 2X3XD 3L2RA 2EQUA 2RA2A 3I56A 3BFMA 3CC7A 5CKBA 1BIBA 4KT0E 3BDUA 2YWWA 3OS5A 4F17A 4DEXA 2RI2A 3E19A 2DO3A 1UJ0A 3A5ZB 4AFUC 3CXCS 3RIRA 1YHQT 1RADB 2GNCA 3AHUA 2QYZA 1PRMC 2ZPEB 3CC4T 3QYGB 3CCUQ 3H0HA 2MWOA 4N0AA 3VS4A 1IRXA 2FPFA 4PJOA 3MEAA 1RAGB 5FU7C 3PVQA 2L89A 1SRMA 4XU0A 1K9MU 1M1KR 1FMKA 5C0MA 1GBRA 1X2QA 4IIMA 3VS3A 2LCLA 2HSEB 2PVDB 2KXCA 2ZPBB 4C0DC 3CMET 1WQ7A 2F2VA 1HK9A 3JB9G 5HK3A 2ESWA 4ZGEB 2LCCA 3DB3A 2E1HA 2CP6A 3HRSA 1H641 2JMAA 5KCOA 3CPFA 4LUDA 2EQKA 2H8HA 3UF4A 3CCVA 3EG9A 4OMNA 3RUXA 2DF6A 2DZCA 5GANj 4EPCA 3EGDA 2X9HA 4Q5WA 1JEGA 1KQSA 1RAFB 3OS2A 1BIAA 3GOXA 2PTKA 2E6NA 1UFFA 2MK5A 1SSFA 1KC8R 3OW2P 4C92G 2EGCA 1KIKA 3X24B 1TG0A 1KK7A 1QCNA 5HY6A 3A8OB 1RAIB 1IGQA 2RD1A 2K6DA 2NUTB 2ED0A 4A4GA 4IUTA 2EJGA 1QW1A 3WVDB 2RHZA 1N9SA 4HXJA 1WHGA 3CXCA 4Z8AA 1BKBA 3VJPA 4BDZA 4M75C 4NOYA 5DLOA 1MHNA 4OGEA 4UC4A 1Y57A 1NZ9A 3SWNB 2VVKA 1KC8C 2FRWA 2J6FA 5FROA 4C92C 2JJ9A 2OX7A 2QDLA 3G6EQ 1IB8A 4PJOB 1ABQA 1MNDA 3MP6A 1WHLA 1KQ1A 2KAFA 2QI2A 2VYTA 4C8QE 3OYMA 1I0CA 4BE1A 3EG0A 3LGLA 3OMCA 2XD0A 4A53A 5LJ5h 1BB9A 1NPPA 2P84A 2HD0A 2KSSA 3ULRB 2DD4A 2XK0A 3UWNA 1VUBA 2ZAEA 1QWEA 4CC3A 4LD6A 1YN8A 2Z0WA 1I4K1 1WJQA 1YIJQ 1EZZB 3EH2A 1K73R 1SPKA 3ZFJA 4V2SA 1VIEA 3QDFA 3CCVQ 4K11A 1Y7XA 3HL8A 2RHUA 3MEUA 1U5SA 1JJ2A 4M78E 1D0XA 2JN0A 4M77G 4LDXA 1UECA 2C0IA 2DETA 5A2QE 3P8BB 2BZ8A 2LJ1A 2L0AA 2CSQA 1KFZA 1PKTA 4GY5A 2DNUA 5IHKA 3VS1A 2A08A 2COYA 2QA4T 3D7SB 2RK2A 4BUGA 3I55T 3OQ5A 2AHJB 1IGUA 2YT6A 1AWWA 3EH1A 3MP1A 1Q95G 2DL3A 4F14A 3PE0A 4AFQC 2ECZA 2QGGA 3MO8A 3TSWA 1PNJA 4EMKC 3TU4K 1N8RC 5LJ3j 2COWA 1FXXA 4PK4A 3RDVA 2VXFA 1U1TA 3CPWA 2QXFA 1NM7A 1K9AA 1D1CA 3G71A 1RAHB 2YRCA 3JCMh 2X51A 4J6WA 2CS7A 2LQKA 3OYJA 4N0AC 1JJ2S 1X6GA 2NUPA 1ZX6A 2K4YA 4E7IA 1HXDA 5KYUA 2HKNA 4B9WA 1RLQC 2OAUA 2JNGA 4KBMB 5GMKl 1EX4A 1RUWA 1YITQ 2YLBA 4LXCA 2DL8A 1ZSGA 1K0SA 4RTYA 2E3HA 2E5KA 2DILA 2XIDA 4BY6C 2GCXA 1I5LA 1RABB 1PSEA 1AZEA 2FZGB 5IXBA 2EW3A 4BE0A 4E7SA 2DXBA 4GLKA 2XG8D 1G3WA 4OB2B 3QZ5B 3LWIA 2RQVA 2EKOA 4OB3B 4ORZA 2DEUA 1PM3A 2L8DA 2FZCB 2YUOA 2PVGB 1JU5C 2RPNA 4R0KA 4M7DC 1PHTA 3EAEA 2E3IA 3QSUA 1UGSB 1YJNQ 4PL6A 3CCJQ 4F16A 2XHCA 1YJ9T 4ZTFA 5KH6A 5FRNA 1VQ4T 2CKKA 2CP2A 2L3RA 2C0TA 4E7HA 5GMKi 1VQMQ 5IN1A 2QA4Q 3PGGA 2DM1A 5KYYB 4PJOC 1JJ2P 2HCKA 4XTXA 4EDUA 1FMVA 3CCQA 4M7DF 3ZBDA 4CC4B 4WF2A 2B8AA 1JRIA 2PUKB 3X20B 4Z88A 2L3SA 2CYZB 2HL5C 3VS6A 2RMOA 2E4HA 2QQRA 2SEMA 1UTIA 2XI9A 1R0BG 5CQXA 4DA4A 3CD6Q 1IXDA 1C0MA 1X27A 1XJWB 2RN8A 3BY7A 3PMTA 2JXBA 4M7DB 4LN2A 3UATA 1VYTA 3L1AA 4J9DA 5DM7R 3S6WA 4IUUA 4M78G 3QBYA 2K3YA 3A1PA 2DPPB 3KFVA 4R55A 5AYFA 2LNHB 2P4TA 5GAMj 1Y07A 1AEYA 1UGVA 3RESA 2DTOA 1WJSA 2ZZDA 3QHSA 4M78D 3I35A 3PIOA 1VQOT 2ZPIB 1WPYA 5KE2A 4C92B 2EKHA 1SG5A 4XAXB 2LX7A 3LH5A 2FRYA 1YIJT 2DBMA 4M75B 2MWPA 1M2VB 1KHIA 2GF7A 2IPOB 3OW2A 4BACA 3CCEQ 4RMOA 3OYCA 3CCRA 5IXFA 2AZVA 1O9SA 2DK3A 2DZ9A 2CP3A 2KRNA 2L2PA 2WACA 1V76A 3FC3A 2OTJT 2OTJA 1QP2A 1AHJB 2A3LA 5EC7A 1YNZA 3JB9I 2YRVA 1OU8A 1NJIR 1VQ6A 4ELYC 3X25B 1W2BP 5HK0A 2FPDA 4QT7A 1VQ5A 4MDXA 1M9SA 4YTLA 2HL3A 3P8HA 3VUZA 5IHIA 1YWOA 2CP0A 4WCIA 3RERA 4C5EA 2F2XA 1WX6A 2RQTA 2QG9B 5AT1B 5CIUA 5I2SA 3X26B 4F04B 4Y28E 2DXUA 2HAXA 4PJMA 4HT9A 1LPLA 3VS7A 4FSXA 1KSWA 1RI0A 2MYSA 4M78C 1SRLA 4DBHA 1OX8A 3EHQA 4DBFA 2DMOA 2K9GA 3NGPA 4ZGJB 5CO7A 3RKYA 3Q1JA 4C92D 3REBB 2O01E 2DRMA 2M0OA 1S1NA 1BI1A 4CI0C 5GAMg 3CBOA 1NYGA 3QZ9B 1WNLA 3EGXA 2M02A 4M7DA 1G3TA 1M2OA 3JCMg 1Q81R 3C0CA 3ZEHA 3H6ZA 3ME9A 4PJOG 3CC2T 1VQPT 1ABOA 4L6V5 1YCSB 1K9MC 1D3BA 3H41A 1BI3A 2W10A 1Q7YR 1YFNA 5LL6S 2BZYA 3L42A 1YITT 3H0FA 4A4FA 2HMAA 1UGRB 3FJPA 1VIFA 5I21A 2KDSA 2VUBA 1GBQA 3PTAA 1D0ZA 4MMKA 3DKMA 3CCJT 3QJYA 5IT9E 1YJNA 3LH0A 1NBEB 2A7YA 3L2QA 4J9FA 4J9GA 2QEXA 2P0PA 2DLPA 1MUZA 4E7JA 3CBMA 4PLIA 3QWYA 2KBTA 4M4ZA 1MV3A 2E64A 2CP7A 2DJZA 1JQQA 2NUPB 4F7UF 3WXMB 4QQDA 3O8VA 2K5LA 5FLXE 2MF2A 2IVWA 1G3YA 2A0FB 2JZ2A 4DQ2A 1OX9A 5KYXB 2GQVA 2OTLA 1T0JA 5GAN7 5FWCA 1KD1R 1DJ7B 2FYKA 4J7FA 5CR2A 2LP5A 5M9OA 1M1GA 3EHRA 1PKSA 3INZA 4KGXB 1ZA1B 2A37A 2BE9B 4QKUA 4RTWA 3LLRA 1VQ8A 2LJ0A 1WGSA 2ZPFB 4MZTA 5KYUB 2JTEA 1KG1A 4C92F 3HFNA 3RBBB 1YI2T 2KVQG 1SKUB 2XDDA 3MEVA 4MZMA 1GCQC 2LT1A 2J6OA 1EIFA 2MI6A 2ABLA 1WFWA 1D1BA 1T0HA 1M3CA 1IO6A 2O4XA 1NPRA 2CSIA 3QPHA 1A0NB 2DE0X 1IREB 5GAN3 1CKAA 5HKCA 4PJJA 4M7AF 4AG1C 1VQKQ 4OMLA 1AD5A 4XU2A 2E70A 2LRQA 3HRUA 1LCKA 3CCRT 3VS0A 4PJOF 2EPDA 5LJ3d 1YI2Q 1F1BB 2WSFE 1XTDA 2JT4A 3L2ZA 2HQEA 3M53A 3S3MA 2JUFA 4GBQA 1Y71A 5A0LA 2JM8A 5A0DA 2KRSA 4RTTA 1WHKA 1MMDA 5GAMh 5LJ3h 3LGFA 3N5BB 3M5AA 2B86A 4OGCA 4OB0B 4R56A 2RJEA 3PFSA 2QQBA 4JJDA 3VKIA 1U3OA 9ATCB 4JPBW 2XICA 1IHWA 1NJIC 1UE9A 1W2BS 4JUVA 3OS1A 1BI2A 4IKFA 3TEEA 3E9GA 1WZOA 3FIFA 2DRKA 2M51A 2QTVA 4CRIA 1Q7YU 2QQ9A 3CEYA 5C6SA 1C1AA 2V8KA 2GBQA 4M75E 1GXIE 3A8GB 2O4XB 1NJIU 1RACB 1LJOA 2LVMA 2YDLA 4RCCA 1U8RA 3DLLA 1X6OA 3OYFA 4J9BA 2CT3A 5GAOp 2LX9A 3SWNA 3QDRB 3OBYA 4D8DA 4E2FB 4OMFB 2DXTA 1RLPC 1W4SA 3HHTB 2CZ7B 3M57A 4DEYA 3EG1A 3QG1A 2PNIA 2XDBA 1WHHA 5GANg 2L3QA 1RAEB 3C12A 2CP5A 2EGEA 3C4SA 5GANf 1BYMA 5GAN5 4ZTJA 4M77D 3M4YA 3VS2A 1I1JA 1UEBA 2GTOA 5KYXA 3UA7A 1X01A 1WXTA 1TXQA 3UT1A 2EJFA 2VB6A 5GAN4 2K57A 2ROTA 2K79A 4BD3A 2ZPGB 3JCMe 2MIOA 2DX1A 1R77A 3VS5A 4Z02A 3META 2DKGA 1Q81C 3UA6A 3JCMc 5FU7B 2J7IA 1QVFP 3NTHA 2KMTA 2QGFB 3TREA 2HKQB 3CMEA 1YJWA 5CCAA 2D0NA 2YUQA 2DEQA 4OB1B 3A98A 3JCMf 2H3EB 4M7AE 4XTVA 1KHCA 1YBYA 1YHQA 3EG3A 4Z89A 4KH0B 1MMNA 4C5HA 2MPXC 3CCUT 3PT9A 1B34B 3OA6A 2XMFA 5FU6C 4IIOA 1K4US 1WHMA 4KGZB 1PD0A 2DL4A 2KYBA 1VOMA 1CSKA 3HFOA 3JCMP 1ZLMA 4GLMA 1NG2A 4LUEA 1D0YA 4TVRA 4ZNXA 4JS5A 3GNFB 2YXYA 2O9SA 4J9CA 3V7SA 1M8VA 5I22A 3JCMb 1UHFA 3GLXA 1E6GA 3JB9H 2E41A 1I8FA 4ZN3A 4C5GA 1VQMA 4AT1B 2DERA 4QQGA 3M55A 1TH7A 1VQMT 4M78F 2ZCFB 2RI3A 5GAOl 1M3AA 2CUDA 2HNIA 4C8QG 1AWOA 1WLPB 1I07A 2F5KA 2X3WD 4F7UE 3CCMA 2RF0A 1D3BB 3SDZA 2E12A 1QKWA 4RTXA 5D6WA 4X34A 1B7TA 3BE3A 1KQ2A 3V8KA 1I81A 2EGAA 3M9QA 4J5YA 2DTHA 3MEWA 4C8QD 2DIQA 2D9TA 3A8MB 1YJ9Q 2X4WA 1P92A 2RK1A 1W70A 4A4KA 5GAOq 2E65A 3CMEQ 3HPWA 3QXEB 4F7UA 3FJ5A 2FPEA 1RAAB 2VASA 4BI8B 2COZA 4FYYB 4ATOA 2WSEE 2EYQA 3KBGA 1QVFA 3JCMX 1K8AU 1M30A 3VV0A 2NUTA 3J7AF 2R5AA 4XQ3A 1VQOA 4XTUA 5GAMf 1QCOA 3GP8A 4FW1A 4PKCC 1PG5B 3OS0A 1K8AC 3OY9A 3CD6T 1K0XA 2RH2A 4ANJA 3HKSA 1VQPQ 2QQSA 2QAZA 4E7KA 2RM4A 3G4SQ 1Y96B 3NFCA 2C06A 2O31A 4F7UB 2JS0A 2KYMA 5IHNA 4O5VA 1BI0A 3M56A 3C95A 3IQLA 1VQ7T 5GAOm 2RQWA 1GCQA 4XTZA 3I56T 1KD1U 1B07A 5CKFA 3MJXA 5DLQE 1QVGP 2A36A 3MKDA 3OSVA 3CCLT 3V8LA 3JCMJ 3I5SA 4Y92A 3OSSC 4JLIA 2CZ6B 4MZPA 5FWBA 3QWXX 1BCOA 2PZ1A 2XDPA 4M75A 4C8QF 1ZSZC 5LJ3e 4FYXB 3TQ7P 3BDLA 3RMQA 2MCNA 1YJWQ 2DBKA 1MMAA 2D1XA 3OYNA 4KUDK 2NYSA 4DBRA 1WI7A 8AT1B 3CC2Q 2PVOB 1N27A 2EJ9A 2KT8A 1O75A 1UB4A 3RR6A 4M7AB 3LX7A 3SHWA 1VQ9T 2OTLQ 3MHXA 1Y0MA 2RJDA 4KGVB 1FYNA 2FB7A 2M1HA 2EQIA 4EIKA 3SFMA 3EFSA 3OYGA 1WQWA 3S3OA 1GRIA 2Y90A 5GMKj 1Q86U 1VQ7A 2JS2A 3M59A 2OAWA 2V1RA 3FDRA 2YUPA 5ECAA 3TSZA 4RTZA 2CH4W 1HD3A 1Z9ZA 1M3BA 3RMSA 2H3JA 4JJBA 1N8RR 2LC4A 2BTTA 4HA8A 3OYHA 4JLGA 5FU6B 3LYIA 3S3NA 4HCCA 3OYEA 4RTVA 1LVKA 1SF9A 2FZKB 2I2LA 5KYWB 1ZUUA 2Y4YA 2EFIA 1LOJA 2P4RA 1QMCA 1ZBJA 4FL6A 4E6RA 4LNPA 3G4ST 4DOVA 1VYUA 2A28A 2J05A 3OYDA 1VQNA 3PVLA 2QASA 2RQUA 5GAN8 3OYIA 5GMKe 3I55A 2MOXA 2EYXA 3JB9F 3G71Q 3M0RA 2E6ZA 4M7DE 2EBPA 4ESRA 2HBWA 4DOWA 1QWFA 4RG2A 5GANh 1NEBA 2JOYA 3M58A 2JTFA 4C8QC 2D6FA 1R8OB 1WA7A 4M75G 1PSFA 2RB6A 1Q82U 3CC4A 5LJ5f 1X6BA 3QO3A 2P0KA 1S72T 3GNGA 3OB9A 4RTUA 1WJRA 5GAMe 3I56Q 4JZ4A 1TUCA 2LNVA 4KULA 1TWBA 1J3TA 3HP9A 4AFZC 1AOJA 4X1VA 1QCFA 4ME7A 2DJQA 4QQ6A 2DA9A 4C0GA 4L59A 4M75F 1PCXA 2BZXA 3ZL7C 2OJ2A 2L5QA 4LDWA 5D6YA 3CCUA 3EG2A 2RI5A 1BU1A 4OMQA 4ZN1A 3E2UA 1G5VA 4WTOB 1GCPA 3QJ6A 3JSCA 1M90C 1U1SA 2WSCE 1XOVA 5GMKh 1K9MR 3EGXB 4JDSA 2CT4A 3U23A 1PRLC 4M7DG 1QVPA 2DFUA 3M0UA 3PNWC 3JRZA 3I55Q 2KXDA 2W0ZA 1U06A 4PFPA 1AWJA 3OYBA 1G8XA 1OYXA 1M90U 2KR3A 4ELZC 3EG9B 1QVFS 2EYYA 1OPLA 5LJ3g 2KY9A 1K8AR 2AKKA 2CZ1B 1K76A 1W1FA 2KQWA 4JJCA 4M78A 4NS5A 3G4SA 3A8HB 1T3LA 1ZQ1A 3UDCA 3L2WA 2YSQA 1MV0B 2BKDN 5GAN2 3SB2A 2DYBA 2K5IA 4BE2A 1VQ4Q 3MPUB 2ZGWA 4J9EA 1UJYA 2FO0A 5J39A 4J9HA 1M5Q1 2BE7D 2OI3A 5KCHA 4LDVA 2AIRB 1X75C 4BI3A 4JZ3A 4B9XA 3DLMA 2P0QA 1UDLA 1Z9QA 4C8QA 2EWNA 4C92E 1YI2A 3JCMd 1W2BA 3F70A 4HCBA 4OF1A 4AG2C 4EMKB 2OTJQ 1ZA2B 1VYVA 2DIGA 3CBPA 1ZSZA 4AMCA 3G7ZA 2V8IA 3HRTA 2FG0A 5J3BA 4JJNK 8ATCB 2F1LA 4D6WA 3OMGA 1QLYA 2QEXQ 1TTHB 1Q82R 2PU9B 4FM4B 3CMAQ 1VQNQ 2KE9A 1VQ7Q 1NLPC 2R57A 3C94A 5KYNA 2OTLT 2O9VA 2DYIA 1MMGA 3X28B 1UUEA 6AT1B 1BBZA 5GAN6 4HT8A 3GIBA 2F2WA 3URGA 1M1KU 5A0GA 2K2VA 2RJFA 3P8DA 3CCST 2FL7A 4FYVB 4LD9K 1W6XA 3GBQA 4O6JA 2SRCA 5KYYA 4FCYA 1VQLQ 2CZ0B 4FSSA 4II1A 1Q86C 1FX7A 3M0TA 2VGMA 2HSPA 3CC7T 3G71T 1G2BA 4EMHA 5L23A 1QQJA 3A8LB 2F5TX 2JW4A 2RHYA 2D8HA 1WIEA 1JBMA 2VC8A 3CCEA 1YITA 4IUQA 3VYGA 3JAME 4QVDA 2DXCA 3CMAT 4CC7A 4BB7A 3CCVT 1ZBXA 2K2MA 1E6HA 2DVJA 4M77B 4E47A 5LJ5e 4FIBA 2DTIA 1K1ZA 2NUZA 1TOVA 1S72Q 4XK8E 1UG1A 5GJVB 1YJNT 3NTKA 2KGTA 1VQ9Q 2V26A 4KH1B 1VQOQ 1PWTA 2YUNA 1SHFA 3VYHB 4M7AD 1GL5A 4RG8A 4OMPA 2M0YA 2CGHA 4M78B 3HSBA 1VQ6T 2CH4A 4M7DD 2CUBA 2DD5A 1N6AA 4IUVA 3M4GA 3FLGA 1HJDA 3V7CA 1ARKA 1TUDA 4HKEA 1B3QA 4HVVA 4LE9A 2LZ6B 4MDWA 1M4ZA 4E7LA 2MAMA 2YHTA 1OQKA
chains in the Genus database with same CATH topology
4M7AA 3HKSA 2QQSA 4FSXA 1RI0A 4E7KA 4M78C 2RM4A 3VU3C 4RKUE 1NE8A 3TCJA 4ZGJB 1Y96B 2Y4XA 3QKJA 4IUPA 5CO7A 3RKYA 3NFCA 5LJ5j 3G6ET 2C06A 1VQNT 3OYKA 4F7UB 3Q1JA 2QEXT 4HCZA 4O5VA 2MMPA 1BI0A 4C92D 3JCMW 1QVGA 3M56A 5LJ5g 2K5FA 1MGQA 3QYHB 4J6YA 2HAXA 3C95A 1VQ7T 2O01E 4XU1A 2DAQA 5GAOm 2M0OA 3OYLA 4XTZA 3ASKA 1BI1A 4JRKA 3JB9J 5I2MA 4CI0C 2X4JA 1N9RA 3CBOA 5GAMg 3I56T 5CKFA 3L2RA 1KD1U 2EQUA 2RA2A 1VQKA 3QZ9B 1WNLA 3I56A 3BFMA 5DLQE 4EMKA 5CKBA 3CC7A 4M7DA 1BIBA 1G3TA 4KT0E 4L5GA 3JCMg 3BDUA 3OS5A 3ZEHA 5J26A 3H6ZA 3ME9A 4PJOG 3CC2T 3OSVA 1VQPT 2RI2A 3E19A 3LW5E 2DO3A 3CCLT 3V8LA 4L6V5 3A5ZB 3JCMJ 1D3BA 1G3SA 1K9MC 3OSSC 5LJ5d 1VQ8T 3CXCS 3RIRA 1YHQT 4JLIA 2CZ6B 4MZPA 1BI3A 3AHUA 4M77E 2XDPA 4M75A 3RKXA 5LL6S 2ZPEB 3CC4T 3QYGB 3L42A 4C8QF 1YITT 2MWOA 4N0AA 1YIJA 4A4FA 4N4HA 3KUFA 4PJOA 2VV5A 4M7AC 4C92A 2D0QB 3MEAA 1UGRB 1Y96A 3FJPA 1VIFA 1Q81U 3CD6A 5FU7C 2KDSA 2VUBA 5I21A 5LJ3e 3PTAA 1VQKT 4MMKA 4XTYA 3DKMA 3BDLA 3RMQA 3CCJT 3QJYA 5IT9E 2L89A 2QA4A 4XU0A 2ZPHB 3CPWS 1K9MU 3OYNA 1M1FA 5C0MA 4KUDK 1YJNA 3LH0A 2A7YA 2LCLA 2ZPBB 2PVDB 4C0DC 2PVOB 3L2QA 3CMET 3OBWA 1WQ7A 2QEXA 1N27A 2P0PA 1HK9A 3JB9G 5HK3A 4C0GA 4ZGEB 4E7JA 3CBMA 2LCCA 2EJ9A 2LQ8A 3DB3A 2E1HA 2BUDA 4PLIA 1O75A 1YCYA 3HRSA 1H641 1UB4A 4NL3A 4PJOE 2K3XA 5KCOA 2E64A 3CPFA 4M7AB 2EQKA 4F7UG 3LX7A 5CKDA 3CCVA 4XTWA 2DJZA 3M54A 3RUXA 5GANj 2DZCA 1VQ9T 4EPCA 3DB4A 3MHXA 4F7UF 3WXMB 2RJDA 4QQDA 4Q5WA 4A4HA 4M75D 1KQSA 2FB7A 2M1HA 3O8VA 2K5LA 5FLXE 2MF2A 2IVWA 1G3YA 3OS2A 4J6XA 1BIAA 1K73C 3GOXA 3H8ZA 1QP3A 3SFMA 2JZ2A 1ZHIA 2E6NA 4DQ2A 3EFSA 4C0DB 2LDMA 3OYGA 3NTIA 1SSFA 2GQVA 2OTLA 3OW2S 2QTXA 5GAN7 5KE3A 4C92G 1WQWA 3S3OA 3X24B 2Y90A 5GMKj 1Q86U 1VQ7A 1DJ7B 2EQMA 2FYKA 3A8OB 3M59A 3FDRA 4J7FA 4XU3A 5HY6A 5CR2A 5M9OA 2RD1A 1M1GA 1VQ9A 3INZA 1N8RU 4A4GA 1VQ5T 1K73U 3RMSA 2H3JA 4NL2A 4IUTA 2LC4A 2EJGA 3SWNC 1QW1A 3LLRA 4HA8A 4JLGA 2RHZA 3WVDB 3OYHA 4FT2A 1VQ8A 1N9SA 5FU6B 1WGSA 1VQPA 3CXCA 2ZPFB 4MZTA 1BKBA 3LYIA 3V7RA 3VJPA 3MCAB 4BDZA 3GPLA 4M75C 3S3NA 1RL2A 4NOYA 5DLOA 4C92F 3OYEA 3HFNA 1MHNA 2I2LA 4OGEA 4UC4A 1YI2T 2KVQG 2Y4YA 2F69A 1NZ9A 2EFIA 3SWNB 4JS4A 1LOJA 1KC8C 2LTOA 5FROA 2XDDA 4C92C 4FL6A 2GFAA 4FT4A 3MEVA 4C0ZA 4MZMA 2LT1A 3T9NA 1EIFA 2MI6A 4PJOB 2E5QA 3G4ST 4DOVA 3OYDA 3OY9A 1VQNA 1JB0E 5GAN8 3PIPA 3OYIA 1VQLA 2O4XA 5GMKe 3MP6A 4C8QE 1KQ1A 2KAFA 2QI2A 2VYTA 3OYMA 3I55A 3CCSA 1NPRA 3QPHA 4M7AG 4BE1A 5D6XA 1IREB 3JB9F 4M77F 5GAN3 3LGLA 3OMCA 5HKCA 2XD0A 4A53A 2E6ZA 5LJ5h 1NPPA 4M7AF 4M7DE 2HD0A 4XU2A 2KSSA 3E9FA 4J83A 2E70A 4JRPA 3JB9D 4J8OA 2LRQA 3HRUA 2XU8A 4DOWA 1LNXA 2DD4A 2XK0A 3UWNA 1VUBA 4C0FA 3CCRT 4RG2A 5GANh 3MP8A 4LD6A 4PJOF 5LJ3d 2JOYA 2PQWA 2KK4A 1I4K1 2WSFE 1WJQA 1XTDA 2JTFA 3L2ZA 3M58A 4C8QC 3JCMQ 2D6FA 5FRMA 3ZFJA 4V2SA 2RJCA 1VIEA 1R8OB 4M75G 1IZ6A 1PSFA 2HQEA 2RB6A 3M53A 1Y7XA 3HL8A 3S3MA 2JUFA 1Y71A 2RHUA 3MEUA 5A0LA 5LJ5f 1Q82U 1JJ2A 3CC4A 3QO3A 4M78E 5A0DA 2P0KA 4VUBA 1S72T 2JN0A 4M77G 3GNGA 4LDXA 3CCET 3OB9A 5GAMh 2VGNA 5LJ3h 5A2QE 3P8BB 3LGFA 3N5BB 3M5AA 4OGCA 4OB0B 4A4EA 4R56A 4P5NA 2RJEA 1WJRA 3PFSA 2QQBA 5GAMe 3VKIA 2LNVA 4GY5A 4KULA 2R58A 1KQSS 5L8RE 2XICA 3HP9A 4IURA 1NJIC 4ME7A 2QA4T 1W2BS 4JUVA 4QQ6A 2RK2A 4BUGA 4L59A 3GF5A 3OQ5A 4M75F 2AHJB 1BI2A 2BIVA 3OS1A 3I55T 1OZ2A 4IKFA 3TEEA 3E9GA 3FIFA 2EQJA 4CRIA 1Q7YU 2L5QA 4FU6A 4LDWA 2QQ9A 5LJ3f 3MP1A 5GAOn 3CEYA 5D6YA 3CCUA 3FEOA 3MO8A 2RI5A 5C6SA 2V8KA 4M75E 4EMKC 1GXIE 3A8GB 2O4XB 2EIFA 4ZN1A 3TU4K 1NJIU 1N8RC 2FHDA 2LVMA 1LJOA 1G5VA 5LJ3j 4RCCA 1U8RA 1OI1A 3QJ6A 1FXXA 3DLLA 1X6OA 3JSCA 3OYFA 1M90C 2GFUA 1U1SA 2WSCE 1XOVA 5GMKh 2VXFA 1U1TA 3CPWA 2QXFA 5GAOp 3CCJA 4JDSA 3G71A 2FVUA 2LX9A 3ER0A 4M7DG 1QVPA 3FRNA 3JCMh 3PNWC 3JRZA 4J6WA 1B34A 3EFRA 2CS7A 3SWNA 2LQKA 3QDRB 1YJ9A 3OBYA 3OYJA 4N0AC 1VQ4A 1JJ2S 3OYBA 1OYXA 1M90U 4ELZC 2K4YA 4E7IA 1HXDA 4OMFB 2DXTA 2EAYA 4B9WA 4OVAA 4C8QB 5GANe 1QVFS 2OAUA 2JNGA 4HCCA 1W4SA 3HHTB 4KBMB 3L2UA 2CZ7B 5LJ3g 2KY9A 5GMKl 4C5IA 3M57A 2CZ1B 3CD6T 2X35A 3QG1A 3CC2A 2XDBA 2KQWA 2YLBA 5GANg 3UPUA 4M78A 4NS5A 3G4SA 3A8HB 2HQXA 3C12A 2XIDA 3C4SA 1ZQ1A 4BY6C 5GANf 1BYMA 3UDCA 2JVVA 5GAN5 2GCXA 3L2WA 4JRQA 1V29B 1I5LA 4ZTJA 4M77D 1PSEA 2BKDN 3M4YA 3R6OA 3SB2A 1UEBA 5GAN2 1YJWT 3QUIA 2K5IA 4JRIA 4N4IA 4BE2A 4QVZA 4BE0A 2DXBA 4GLKA 2XG8D 2ZGWA 3V8JA 1X01A 1G3WA 4OB2B 3QZ5B 3LWIA 2EKOA 4A54A 5J39A 1Q7YC 1M1KC 1M5Q1 4OB3B 2IG0A 3UT1A 5KCHA 2EJFA 4LDVA 2L8DA 5GAN4 2K57A 4BD3A 2ZPGB 3JCMe 2PVGB 4M7DC 1X75C 3EAEA 4BI3A 4B9XA 2HBPA 4Z02A 3META 4J7IA 2DKGA 3QSUA 1Q81C 3DLMA 2RHXA 2P0QA 3JCMc 3CCQT 5FU7B 4C8QA 1UGSB 2EWNA 3J80E 3NTHA 4C92E 3FB9A 2KMTA 5GAOr 3SD4A 1YI2A 4PL6A 3TREA 3JCMd 3CMEA 1W2BA 1YJWA 4X9CA 2XHCA 1YJ9T 3F70A 4ZTFA 4OF1A 1OZ3A 5KH6A 1VQ4T 4HCBA 5FRNA 5CCAA 2CKKA 2L3RA 4EMKB 2YLCA 3L2VA 4E7HA 3QIIA 5GMKi 2X4XA 5IN1A 4PLLA 2DIGA 3PGGA 2DEQA 3CBPA 4PJOC 4OB1B 3G7ZA 2V8IA 2RO0A 3JCMf 4XTXA 3HRTA 4EDUA 4QVCA 3OYYA 5J3BA 4JJNK 3CCQA 4M7AE 4XTVA 1KHCA 3ZBDA 1YBYA 3OMGA 4D6WA 4M7DF 1YHQA 4M77A 1XNIA 4PNOA 4KUIA 2PU9B 4FM4B 4WF2A 5GMKm 2B8AA 1VQLT 1JRIA 2PUKB 3X20B 4C5HA 3CCUT 3PT9A 3CMAA 2CYZB 1B34B 2R57A 3OA6A 3C94A 2OTLT 2QQRA 5FU6C 4RCBA 2XI9A 3X28B 3PMIA 5CQXA 5GAN6 4DA4A 4HT8A 3GIBA 3URGA 1M1KU 5A0GA 4OP0A 2K2VA 1UGPB 4Y91A 3BY7A 3PMTA 4N4GA 3HFOA 3JCMP 4M7DB 2RJFA 3P8DA 1H3ZA 5IAYA 3L1AA 3OYAA 5DM7R 3S6WA 4TVRA 4IUUA 3CCST 4M78G 4JS5A 3GNFB 2QQAA 5EG2A 3QBYA 3V7SA 2FL7A 4LD9K 4O6JA 2K3YA 4LDYA 1M8VA 2DPPB 4R55A 5AYFA 2P4TA 5GAMj 2CZ0B 4II1A 4ZGDB 3JCMb 1Q86C 1FX7A 1Y07A 3GLXA 2PUOB 2VGMA 3RESA 2M9UA 2DTOA 5CKEA 1WJSA 2ZZDA 3QHSA 3CC7T 3JB9H 2E41A 3G71T 4M78D 1I8FA 4EMGA 4ZN3A 4EMHA 3PIOA 4C5GA 3LWHA 1VQMA 4MMLA 3A8LB 1VQOT 2F5TX 2ZPIB 1WPYA 2RHYA 3VUBA 4QQGA 3M55A 1TH7A 4C92B 5KE2A 1VQMT 4M78F 2ZCFB 2RI3A 4XAXB 5GAOl 1S72A 2HNIA 4C8QG 1JBMA 2VC8A 3CCEA 1YIJT 4IUQA 3VYGA 1YITA 4M75B 4X9DA 5DY9A 3JAME 2MWPA 4QVDA 2DXCA 2F5KA 3KXTA 3CMAT 1KHIA 4BB7A 4F7UE 3CCMA 2GF7A 1D3BB 2JTMA 3CCVT 1ZBXA 4M77B 4E47A 3SDZA 5LJ5e 2M16A 3E1SA 4FIBA 2DTIA 2E12A 2NLUA 3OW2A 3J81E 4BACA 5GAMd 5D6WA 4X34A 1KQ2A 4XK8E 4RMOA 3OYCA 3V8KA 3CCRA 1Q82C 1I81A 1YJNT 3NTKA 1O9SA 2DK3A 2DZ9A 2G3RA 1XQHA 3M9QA 4J5YA 5CAIA 2DTHA 4M77C 3MEWA 3RKWA 3WVEB 4C8QD 2V8JA 4PJOD 2WACA 2DIQA 1KG1A 2X4YA 2XKOC 4QW2A 3FC3A 2OTJT 2D9TA 1KD1C 3A8MB 2DVEA 3BW1A 1QVGS 2OTJA 1QP2A 2X4WA 1AHJB 1P92A 2A3LA 2RK1A 5CQYA 2R5MA 3VYHB 4A4KA 5GANd 5GAOq 4BDYA 4M7AD 2E65A 4RG8A 3JB9I 2YRVA 5CKHA 3HPWA 2CGHA 3QXEB 4F7UA 2RHIA 5CK9A 4M78B 4BI8B 3CCMT 1VQ6A 4ELYC 3X25B 3HSBA 4ATOA 2WSEE 1K8AC 5HK0A 2EYQA 3KBGA 1QVFA 1VQ6T 2LT4A 3JCMX 1VQ5A 1K8AU 1FWZA 3VV0A 1M9SA 4M7DD 4MDXA 2DD5A 4YTLA 3J7AF 1N6AA 3P8HA 3VUZA 2R5AA 4XQ3A 4IUVA 3G6EA 3RERA 4BI4A 4C5EA 3M4GA 2QDYB 3FLGA 4BY6B 1VQOA 3CCLA 4LDUA 1KC8U 3V7CA 4HKEA 4XTUA 5GAMf 2VXEA 5CIUA 5I2SA 3GP8A 3X26B 4Y28E 3JCMV 4PKCC 4MDWA 2DXUA 5CVIA 1UGQB 2E10A 1M4ZA 3OS0A 4E7LA 2MAMA 2YHTA 2RH2A 4HT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD1 A;  5LJ3 j;  4M7A A;  5GAN 6;  4RCC A;  4HT8 A;  3GIB A;  3INZ A;  4M78 C;  2RM4 A;  3VU3 C;  1U1S A;  4OP0 A;  4NL2 A;  4Y91 A;  3BY7 A;  2VXF A;  1U1T A;  5GMK h;  3HFO A;  2EJG A;  1Y96 B;  3SWN C;  3RKY A;  4HA8 A;  5LJ5 j;  5GAO p;  3JCM P;  4M7D B;  3L1A A;  1N9S A;  4M7D G;  4M78 G;  4F7U B;  3JCM h;  4J6W A;  1B34 A;  3EFR A;  3SWN A;  3V7R A;  4C92 D;  3V7S A;  3JCM W;  4M75 C;  4N0A C;  4NOY A;  4J6Y A;  1MGQ A;  4C92 F;  5LJ5 g;  3HFN A;  2I2L A;  1M8V A;  4XU1 A;  5GAO m;  1HXD A;  3SWN B;  2DXT A;  2EAY A;  4XTZ A;  1LOJ A;  4C8Q B;  5GAN e;  4JRK A;  3JB9 J;  4C92 C;  5GAM g;  1N9R A;  5GAM j;  5LJ3 g;  3JCM b;  2RA2 A;  5GMK l;  1WNL A;  3BFM A;  4EMK A;  3RES A;  2DTO A;  4M7D A;  1BIB A;  4PJO B;  3JCM g;  3QHS A;  3BDU A;  3JB9 H;  2YLB A;  2E41 A;  5GAN g;  4PJO G;  4M78 D;  1I8F A;  4M78 A;  4EMG A;  4EMH A;  4MML A;  5GAN 8;  3V8L A;  1WPY A;  5GAN f;  1D3B A;  4C92 B;  3JCM J;  1TH7 A;  5GMK e;  5LJ5 d;  5GAN 5;  4C8Q E;  1KQ1 A;  4M78 F;  3RIR A;  1I5L A;  4JLI A;  4M77 D;  5GAO l;  5GAN 2;  3SB2 A;  3AHU A;  4M7A G;  2HNI A;  3QUI A;  4M77 E;  1JBM A;  2VC8 A;  4JRI A;  4M77 F;  4M75 A;  4C8Q G;  5GAN 3;  3JB9 F;  3RKX A;  4M75 B;  4X9D A;  5DY9 A;  4A53 A;  5LJ5 h;  4M7A F;  4M7D E;  2ZGW A;  4C8Q F;  4QVD A;  4N0A A;  3V8J A;  4XU2 A;  1X01 A;  3JB9 D;  4F7U E;  4PJO A;  4M7A C;  1D3B B;  4C92 A;  4A54 A;  4M77 B;  1LNX A;  1Y96 A;  1M5Q 1;  5LJ5 e;  3FJP A;  2DTI A;  5I21 A;  5LJ3 e;  2EJF A;  5GAM d;  5GAN h;  4MMK A;  4XTY A;  4PJO F;  2K57 A;  5LJ3 d;  5GAN 4;  1KQ2 A;  3V8K A;  3JCM e;  1I4K 1;  4XU0 A;  1I81 A;  3L2Z A;  4C8Q C;  3JCM Q;  4M7D C;  4V2S A;  2DZ9 A;  2DKG A;  4J5Y A;  5CAI A;  2DTH A;  4M77 C;  3QSU A;  3RKW A;  4C8Q D;  4PJO D;  3JCM c;  4M75 G;  2RB6 A;  4C8Q A;  2EWN A;  4C92 E;  1WQ7 A;  3FB9 A;  5LJ5 f;  5GAO r;  2DVE A;  3BW1 A;  3QO3 A;  4M78 E;  3JCM d;  1HK9 A;  3JB9 G;  4X9C A;  2JN0 A;  4M77 G;  5GAO q;  5GAM h;  5GAN d;  4M7A D;  2EJ9 A;  5LJ3 h;  2E65 A;  2E1H A;  4EMK B;  3JB9 I;  2YLC A;  1YCY A;  4HT9 A;  1H64 1;  4NL3 A;  2CGH A;  4F7U A;  5GMK i;  4PJO E;  2E64 A;  4M7A B;  4M78 B;  3PGG A;  4F7U G;  5GAM e;  2DEQ A;  3HSB A;  4XTW A;  4PJO C;  2DJZ A;  3RUX A;  5GAN j;  2DZC A;  3JCM f;  4XTX A;  4F7U F;  3JCM X;  4M7D D;  4QVC A;  4M75 D;  4M7A E;  4XTV A;  2FB7 A;  4JUV A;  4XQ3 A;  4M7D F;  4M75 F;  4M77 A;  3RER A;  4J6X A;  4PNO A;  1BIA A;  3M4G A;  4WF2 A;  5GMK m;  3V7C A;  1JRI A;  3FIF A;  4DQ2 A;  3EFS A;  4XTU A;  5GAM f;  2VXE A;  5LJ3 f;  2QTX A;  5GAN 7;  5GAO n;  1B34 B;  4C92 G;  1WQW A;  3JCM V;  2Y90 A;  2DXU A;  5GMK j;  2E10 A;  4M75 E;  2FYK A;  4EMK C;  4XU3 A;  4RCB A;  2YHT A;  1LJO A; 
#chains in the Genus database with same CATH topology
 4M7A A;  2VWF A;  1M27 C;  3CCL Q;  1ACM B;  2KI7 A;  3EGD B;  3VRZ A;  2Y4X A;  3G6E T;  1SHG A;  2AZS A;  4HCZ A;  2MMP A;  7AT1 B;  1QVG A;  5LJ5 g;  1MGQ A;  1MNE A;  2D8J A;  3QYH B;  1H3H A;  4XU1 A;  2DAQ A;  3OYL A;  1ZSZ B;  2J6K A;  3JB9 J;  2CDT A;  5I2M A;  1N9R A;  1VQK A;  4EMK A;  4L5G A;  5J26 A;  5KYW A;  1ZUY A;  3RNJ A;  3LW5 E;  4PFZ A;  4PJN A;  5I11 A;  1G3S A;  1VQ8 T;  5LJ5 d;  3CPW P;  4M77 E;  4DBQ A;  1C6V X;  3RKX A;  1GFD A;  1YIJ A;  1OV3 A;  4N4H A;  3KUF A;  2VV5 A;  4M7A C;  4C92 A;  2D0Q B;  1Y96 A;  3CD6 A;  1Q81 U;  2O88 A;  3I5R A;  1VQK T;  4XTY A;  2QA4 A;  2V1Q A;  2ZPH B;  3CPW S;  1TS9 A;  1M1F A;  1D09 B;  5FW9 A;  2ROL A;  3CCS Q;  3OBW A;  1YP5 A;  5IH2 A;  2LQ8 A;  2BUD A;  1YCY A;  4NL3 A;  4PJO E;  2K3X A;  4F7U G;  1T3S A;  5CKD A;  4XTW A;  3M54 A;  3DB4 A;  5HCK A;  2KRM A;  2RQR A;  4A4H A;  1V1C A;  4M75 D;  1SSH A;  2AKL A;  2HDA A;  4J6X A;  1R0C B;  1K73 C;  3H8Z A;  1QP3 A;  1OOT A;  1ZHI A;  4C0D B;  3M0P A;  2LDM A;  3EFO A;  3NTI A;  2EVR A;  3OW2 S;  2QTX A;  5KE3 A;  3JV3 A;  2EQM A;  4XU3 A;  2LMJ A;  1VQ9 A;  2I0N A;  2LQN A;  1N8R U;  1VQ5 T;  1K73 U;  4NL2 A;  1WDX A;  3R6N A;  3SWN C;  4FT2 A;  2HZY A;  1VQP A;  3V7R A;  3MCA B;  3GPL A;  1RL2 A;  2F69 A;  4JS4 A;  2LTO A;  4FT4 A;  2GFA A;  1HSQ A;  4C0Z A;  3T9N A;  2E5Q A;  1VQ5 Q;  3CXC P;  1JB0 E;  3PIP A;  1YHQ Q;  1VQL A;  1PD1 A;  2RNA A;  3CCS A;  4M7A G;  5D6X A;  4M77 F;  3REA B;  4B6M A;  3E9F A;  2EYZ A;  4J83 A;  4JRP A;  3JB9 D;  4J8O A;  2XU8 A;  1LNX A;  1SEM A;  4C0F A;  3MP8 A;  3G1J A;  2PQW A;  2KK4 A;  3JCM Q;  5FRM A;  2RJC A;  1G83 A;  1OUL A;  2J06 A;  1IZ6 A;  2ENM A;  2GGR A;  1WXB A;  2KNB B;  4VUB A;  3CCE T;  2VGN A;  3SEM A;  3CQT A;  2LQW A;  4A4E A;  4P5N A;  1WXU A;  2R58 A;  2DL7 A;  1KQS S;  5L8R E;  4IUR A;  3GF5 A;  2EYW A;  2BIV A;  1OZ2 A;  2EQJ A;  4FU6 A;  1NYF A;  5LJ3 f;  2KEA A;  5GAO n;  1M90 R;  3FEO A;  2EIF A;  2FHD A;  1OI1 A;  4J9I A;  4OMO A;  2GFU A;  4HVW A;  3VRY A;  3CCJ A;  4KRT A;  2FVU A;  3ER0 A;  2LJ3 A;  3FRN A;  4HCK A;  1B34 A;  3EFR A;  1YJ9 A;  1VQ4 A;  2JMC A;  1NLO C;  2EAY A;  2VKN A;  4C8Q B;  4OVA A;  5GAN e;  4AFS C;  1VQ8 Q;  3CCM Q;  3L2U A;  4C5I A;  2X35 A;  1AZG B;  1PC0 A;  2O2O A;  4CC2 A;  3CC2 A;  3UPU A;  2JM9 A;  2HQX A;  2C0O A;  1RI9 A;  2JVV A;  4JRQ A;  1V29 B;  3R6O A;  1YJW T;  1AT1 B;  3QUI A;  4JRI A;  3NPF A;  4N4I A;  4QVZ A;  1I5O B;  1HYO A;  1OU9 A;  3V8J A;  1M8M A;  2IIM A;  1YWP A;  4A54 A;  1H92 A;  1Q7Y C;  1M1K C;  2IG0 A;  3AT1 B;  3TVT A;  2HBP A;  4J7I A;  2AK5 A;  2RHX A;  3CCQ T;  1BCM A;  1AVZ C;  3J80 E;  3FB9 A;  5GAO r;  3SD4 A;  3CC7 Q;  4X9C A;  1TU0 B;  1OZ3 A;  2YLC A;  3L2V A;  3QII A;  2X4X A;  4PLL A;  3M0S A;  2RO0 A;  4FYW B;  4QVC A;  3OYY A;  3NHN A;  2HQH A;  4M77 A;  4PJL A;  2DL5 A;  1XNI A;  4PNO A;  4KUI A;  5GMK m;  1VQL T;  3CMA A;  2G6F X;  1NEG A;  3CCQ Q;  4RCB A;  2AT1 B;  3PMI A;  3H0I A;  3NMZ C;  4D8K A;  1OPK A;  4OP0 A;  2GTJ A;  1UGP B;  4Y91 A;  4N4G A;  1H3Z A;  5IAY A;  3OYA A;  1AWX A;  2QQA A;  1BK2 A;  5EG2 A;  1VA7 A;  1VQ6 Q;  1Q86 R;  4LDY A;  1KJW A;  2LCS A;  4ZGD B;  1QKX A;  2PUO B;  2M9U A;  5CKE A;  2CRE A;  4EMG A;  3LWH A;  4FW2 A;  3EFO B;  2FEI A;  4MML A;  1IHV A;  4PFO A;  3VUB A;  1UHC A;  1S72 A;  3I9Q A;  4A63 B;  2NWM A;  1D1A A;  1OEB A;  4X9D A;  5DY9 A;  5D7U A;  3KXT A;  3O5Z A;  2JTM A;  2M16 A;  3E1S A;  2NLU A;  3J81 E;  4OMM A;  5GAM d;  1X2K A;  1Q82 C;  2G3R A;  1JXO A;  1XQH A;  5CAI A;  3OYK A;  4M77 C;  3WVE B;  3RKW A;  5GJW B;  4PJO D;  2V8J A;  2X4Y A;  2KRO A;  2XKO C;  4QW2 A;  1KD1 C;  1E7O A;  2DVE A;  3BW1 A;  1QVG S;  5CQY A;  2R5M A;  5GAN d;  3CCR Q;  4RUG A;  4BDY A;  2ATC B;  2L3P A;  1TUG B;  3THK A;  5CKH A;  4E7Z A;  1X43 A;  2RHI A;  5CK9 A;  2K3B A;  2QK0 A;  3CCM T;  3H9N A;  2LT4 A;  1FWZ A;  3M0Q A;  2KT1 A;  2GQI A;  3G6E A;  4BI4 A;  4BY6 B;  2QDY B;  3CCL A;  4LDU A;  1KC8 U;  2YRD A;  2K7A A;  2VXE A;  2HEQ A;  4HVU A;  2ED1 A;  3HTR A;  3JCM V;  5CVI A;  1UGQ B;  2E10 A;  1X69 A;  1WYX A;  1CKB A;  1ZUK A;  3VU3 C;  4RKU E;  1NE8 A;  1GFC A;  3EGU A;  3TCJ A;  1KQS P;  1N5Z A;  3QKJ A;  4IUP A;  5LJ5 j;  1VQN T;  1JO8 A;  1WHJ A;  1M2V A;  1EFN A;  2QEX T;  1TSF A;  3JCM W;  3CC4 Q;  1JXM A;  2K5F A;  4J6Y A;  3ASK A;  1H8K A;  4JRK A;  1FMW A;  2X4J A;  2X3X D;  3L2R A;  2EQU A;  2RA2 A;  3I56 A;  3BFM A;  3CC7 A;  5CKB A;  1BIB A;  4KT0 E;  3BDU A;  2YWW A;  3OS5 A;  4F17 A;  4DEX A;  2RI2 A;  3E19 A;  2DO3 A;  1UJ0 A;  3A5Z B;  4AFU C;  3CXC S;  3RIR A;  1YHQ T;  1RAD B;  2GNC A;  3AHU A;  2QYZ A;  1PRM C;  2ZPE B;  3CC4 T;  3QYG B;  3CCU Q;  3H0H A;  2MWO A;  4N0A A;  3VS4 A;  1IRX A;  2FPF A;  4PJO A;  3MEA A;  1RAG B;  5FU7 C;  3PVQ A;  2L89 A;  1SRM A;  4XU0 A;  1K9M U;  1M1K R;  1FMK A;  5C0M A;  1GBR A;  1X2Q A;  4IIM A;  3VS3 A;  2LCL A;  2HSE B;  2PVD B;  2KXC A;  2ZPB B;  4C0D C;  3CME T;  1WQ7 A;  2F2V A;  1HK9 A;  3JB9 G;  5HK3 A;  2ESW A;  4ZGE B;  2LCC A;  3DB3 A;  2E1H A;  2CP6 A;  3HRS A;  1H64 1;  2JMA A;  5KCO A;  3CPF A;  4LUD A;  2EQK A;  2H8H A;  3UF4 A;  3CCV A;  3EG9 A;  4OMN A;  3RUX A;  2DF6 A;  2DZC A;  5GAN j;  4EPC A;  3EGD A;  2X9H A;  4Q5W A;  1JEG A;  1KQS A;  1RAF B;  3OS2 A;  1BIA A;  3GOX A;  2PTK A;  2E6N A;  1UFF A;  2MK5 A;  1SSF A;  1KC8 R;  3OW2 P;  4C92 G;  2EGC A;  1KIK A;  3X24 B;  1TG0 A;  1KK7 A;  1QCN A;  5HY6 A;  3A8O B;  1RAI B;  1IGQ A;  2RD1 A;  2K6D A;  2NUT B;  2ED0 A;  4A4G A;  4IUT A;  2EJG A;  1QW1 A;  3WVD B;  2RHZ A;  1N9S A;  4HXJ A;  1WHG A;  3CXC A;  4Z8A A;  1BKB A;  3VJP A;  4BDZ A;  4M75 C;  4NOY A;  5DLO A;  1MHN A;  4OGE A;  4UC4 A;  1Y57 A;  1NZ9 A;  3SWN B;  2VVK A;  1KC8 C;  2FRW A;  2J6F A;  5FRO A;  4C92 C;  2JJ9 A;  2OX7 A;  2QDL A;  3G6E Q;  1IB8 A;  4PJO B;  1ABQ A;  1MND A;  3MP6 A;  1WHL A;  1KQ1 A;  2KAF A;  2QI2 A;  2VYT A;  4C8Q E;  3OYM A;  1I0C A;  4BE1 A;  3EG0 A;  3LGL A;  3OMC A;  2XD0 A;  4A53 A;  5LJ5 h;  1BB9 A;  1NPP A;  2P84 A;  2HD0 A;  2KSS A;  3ULR B;  2DD4 A;  2XK0 A;  3UWN A;  1VUB A;  2ZAE A;  1QWE A;  4CC3 A;  4LD6 A;  1YN8 A;  2Z0W A;  1I4K 1;  1WJQ A;  1YIJ Q;  1EZZ B;  3EH2 A;  1K73 R;  1SPK A;  3ZFJ A;  4V2S A;  1VIE A;  3QDF A;  3CCV Q;  4K11 A;  1Y7X A;  3HL8 A;  2RHU A;  3MEU A;  1U5S A;  1JJ2 A;  4M78 E;  1D0X A;  2JN0 A;  4M77 G;  4LDX A;  1UEC A;  2C0I A;  2DET A;  5A2Q E;  3P8B B;  2BZ8 A;  2LJ1 A;  2L0A A;  2CSQ A;  1KFZ A;  1PKT A;  4GY5 A;  2DNU A;  5IHK A;  3VS1 A;  2A08 A;  2COY A;  2QA4 T;  3D7S B;  2RK2 A;  4BUG A;  3I55 T;  3OQ5 A;  2AHJ B;  1IGU A;  2YT6 A;  1AWW A;  3EH1 A;  3MP1 A;  1Q95 G;  2DL3 A;  4F14 A;  3PE0 A;  4AFQ C;  2ECZ A;  2QGG A;  3MO8 A;  3TSW A;  1PNJ A;  4EMK C;  3TU4 K;  1N8R C;  5LJ3 j;  2COW A;  1FXX A;  4PK4 A;  3RDV A;  2VXF A;  1U1T A;  3CPW A;  2QXF A;  1NM7 A;  1K9A A;  1D1C A;  3G71 A;  1RAH B;  2YRC A;  3JCM h;  2X51 A;  4J6W A;  2CS7 A;  2LQK A;  3OYJ A;  4N0A C;  1JJ2 S;  1X6G A;  2NUP A;  1ZX6 A;  2K4Y A;  4E7I A;  1HXD A;  5KYU A;  2HKN A;  4B9W A;  1RLQ C;  2OAU A;  2JNG A;  4KBM B;  5GMK l;  1EX4 A;  1RUW A;  1YIT Q;  2YLB A;  4LXC A;  2DL8 A;  1ZSG A;  1K0S A;  4RTY A;  2E3H A;  2E5K A;  2DIL A;  2XID A;  4BY6 C;  2GCX A;  1I5L A;  1RAB B;  1PSE A;  1AZE A;  2FZG B;  5IXB A;  2EW3 A;  4BE0 A;  4E7S A;  2DXB A;  4GLK A;  2XG8 D;  1G3W A;  4OB2 B;  3QZ5 B;  3LWI A;  2RQV A;  2EKO A;  4OB3 B;  4ORZ A;  2DEU A;  1PM3 A;  2L8D A;  2FZC B;  2YUO A;  2PVG B;  1JU5 C;  2RPN A;  4R0K A;  4M7D C;  1PHT A;  3EAE A;  2E3I A;  3QSU A;  1UGS B;  1YJN Q;  4PL6 A;  3CCJ Q;  4F16 A;  2XHC A;  1YJ9 T;  4ZTF A;  5KH6 A;  5FRN A;  1VQ4 T;  2CKK A;  2CP2 A;  2L3R A;  2C0T A;  4E7H A;  5GMK i;  1VQM Q;  5IN1 A;  2QA4 Q;  3PGG A;  2DM1 A;  5KYY B;  4PJO C;  1JJ2 P;  2HCK A;  4XTX A;  4EDU A;  1FMV A;  3CCQ A;  4M7D F;  3ZBD A;  4CC4 B;  4WF2 A;  2B8A A;  1JRI A;  2PUK B;  3X20 B;  4Z88 A;  2L3S A;  2CYZ B;  2HL5 C;  3VS6 A;  2RMO A;  2E4H A;  2QQR A;  2SEM A;  1UTI A;  2XI9 A;  1R0B G;  5CQX A;  4DA4 A;  3CD6 Q;  1IXD A;  1C0M A;  1X27 A;  1XJW B;  2RN8 A;  3BY7 A;  3PMT A;  2JXB A;  4M7D B;  4LN2 A;  3UAT A;  1VYT A;  3L1A A;  4J9D A;  5DM7 R;  3S6W A;  4IUU A;  4M78 G;  3QBY A;  2K3Y A;  3A1P A;  2DPP B;  3KFV A;  4R55 A;  5AYF A;  2LNH B;  2P4T A;  5GAM j;  1Y07 A;  1AEY A;  1UGV A;  3RES A;  2DTO A;  1WJS A;  2ZZD A;  3QHS A;  4M78 D;  3I35 A;  3PIO A;  1VQO T;  2ZPI B;  1WPY A;  5KE2 A;  4C92 B;  2EKH A;  1SG5 A;  4XAX B;  2LX7 A;  3LH5 A;  2FRY A;  1YIJ T;  2DBM A;  4M75 B;  2MWP A;  1M2V B;  1KHI A;  2GF7 A;  2IPO B;  3OW2 A;  4BAC A;  3CCE Q;  4RMO A;  3OYC A;  3CCR A;  5IXF A;  2AZV A;  1O9S A;  2DK3 A;  2DZ9 A;  2CP3 A;  2KRN A;  2L2P A;  2WAC A;  1V76 A;  3FC3 A;  2OTJ T;  2OTJ A;  1QP2 A;  1AHJ B;  2A3L A;  5EC7 A;  1YNZ A;  3JB9 I;  2YRV A;  1OU8 A;  1NJI R;  1VQ6 A;  4ELY C;  3X25 B;  1W2B P;  5HK0 A;  2FPD A;  4QT7 A;  1VQ5 A;  4MDX A;  1M9S A;  4YTL A;  2HL3 A;  3P8H A;  3VUZ A;  5IHI A;  1YWO A;  2CP0 A;  4WCI A;  3RER A;  4C5E A;  2F2X A;  1WX6 A;  2RQT A;  2QG9 B;  5AT1 B;  5CIU A;  5I2S A;  3X26 B;  4F04 B;  4Y28 E;  2DXU A;  2HAX A;  4PJM A;  4HT9 A;  1LPL A;  3VS7 A;  4FSX A;  1KSW A;  1RI0 A;  2MYS A;  4M78 C;  1SRL A;  4DBH A;  1OX8 A;  3EHQ A;  4DBF A;  2DMO A;  2K9G A;  3NGP A;  4ZGJ B;  5CO7 A;  3RKY A;  3Q1J A;  4C92 D;  3REB B;  2O01 E;  2DRM A;  2M0O A;  1S1N A;  1BI1 A;  4CI0 C;  5GAM g;  3CBO A;  1NYG A;  3QZ9 B;  1WNL A;  3EGX A;  2M02 A;  4M7D A;  1G3T A;  1M2O A;  3JCM g;  1Q81 R;  3C0C A;  3ZEH A;  3H6Z A;  3ME9 A;  4PJO G;  3CC2 T;  1VQP T;  1ABO A;  4L6V 5;  1YCS B;  1K9M C;  1D3B A;  3H41 A;  1BI3 A;  2W10 A;  1Q7Y R;  1YFN A;  5LL6 S;  2BZY A;  3L42 A;  1YIT T;  3H0F A;  4A4F A;  2HMA A;  1UGR B;  3FJP A;  1VIF A;  5I21 A;  2KDS A;  2VUB A;  1GBQ A;  3PTA A;  1D0Z A;  4MMK A;  3DKM A;  3CCJ T;  3QJY A;  5IT9 E;  1YJN A;  3LH0 A;  1NBE B;  2A7Y A;  3L2Q A;  4J9F A;  4J9G A;  2QEX A;  2P0P A;  2DLP A;  1MUZ A;  4E7J A;  3CBM A;  4PLI A;  3QWY A;  2KBT A;  4M4Z A;  1MV3 A;  2E64 A;  2CP7 A;  2DJZ A;  1JQQ A;  2NUP B;  4F7U F;  3WXM B;  4QQD A;  3O8V A;  2K5L A;  5FLX E;  2MF2 A;  2IVW A;  1G3Y A;  2A0F B;  2JZ2 A;  4DQ2 A;  1OX9 A;  5KYX B;  2GQV A;  2OTL A;  1T0J A;  5GAN 7;  5FWC A;  1KD1 R;  1DJ7 B;  2FYK A;  4J7F A;  5CR2 A;  2LP5 A;  5M9O A;  1M1G A;  3EHR A;  1PKS A;  3INZ A;  4KGX B;  1ZA1 B;  2A37 A;  2BE9 B;  4QKU A;  4RTW A;  3LLR A;  1VQ8 A;  2LJ0 A;  1WGS A;  2ZPF B;  4MZT A;  5KYU B;  2JTE A;  1KG1 A;  4C92 F;  3HFN A;  3RBB B;  1YI2 T;  2KVQ G;  1SKU B;  2XDD A;  3MEV A;  4MZM A;  1GCQ C;  2LT1 A;  2J6O A;  1EIF A;  2MI6 A;  2ABL A;  1WFW A;  1D1B A;  1T0H A;  1M3C A;  1IO6 A;  2O4X A;  1NPR A;  2CSI A;  3QPH A;  1A0N B;  2DE0 X;  1IRE B;  5GAN 3;  1CKA A;  5HKC A;  4PJJ A;  4M7A F;  4AG1 C;  1VQK Q;  4OML A;  1AD5 A;  4XU2 A;  2E70 A;  2LRQ A;  3HRU A;  1LCK A;  3CCR T;  3VS0 A;  4PJO F;  2EPD A;  5LJ3 d;  1YI2 Q;  1F1B B;  2WSF E;  1XTD A;  2JT4 A;  3L2Z A;  2HQE A;  3M53 A;  3S3M A;  2JUF A;  4GBQ A;  1Y71 A;  5A0L A;  2JM8 A;  5A0D A;  2KRS A;  4RTT A;  1WHK A;  1MMD A;  5GAM h;  5LJ3 h;  3LGF A;  3N5B B;  3M5A A;  2B86 A;  4OGC A;  4OB0 B;  4R56 A;  2RJE A;  3PFS A;  2QQB A;  4JJD A;  3VKI A;  1U3O A;  9ATC B;  4JPB W;  2XIC A;  1IHW A;  1NJI C;  1UE9 A;  1W2B S;  4JUV A;  3OS1 A;  1BI2 A;  4IKF A;  3TEE A;  3E9G A;  1WZO A;  3FIF A;  2DRK A;  2M51 A;  2QTV A;  4CRI A;  1Q7Y U;  2QQ9 A;  3CEY A;  5C6S A;  1C1A A;  2V8K A;  2GBQ A;  4M75 E;  1GXI E;  3A8G B;  2O4X B;  1NJI U;  1RAC B;  1LJO A;  2LVM A;  2YDL A;  4RCC A;  1U8R A;  3DLL A;  1X6O A;  3OYF A;  4J9B A;  2CT3 A;  5GAO p;  2LX9 A;  3SWN A;  3QDR B;  3OBY A;  4D8D A;  4E2F B;  4OMF B;  2DXT A;  1RLP C;  1W4S A;  3HHT B;  2CZ7 B;  3M57 A;  4DEY A;  3EG1 A;  3QG1 A;  2PNI A;  2XDB A;  1WHH A;  5GAN g;  2L3Q A;  1RAE B;  3C12 A;  2CP5 A;  2EGE A;  3C4S A;  5GAN f;  1BYM A;  5GAN 5;  4ZTJ A;  4M77 D;  3M4Y A;  3VS2 A;  1I1J A;  1UEB A;  2GTO A;  5KYX A;  3UA7 A;  1X01 A;  1WXT A;  1TXQ A;  3UT1 A;  2EJF A;  2VB6 A;  5GAN 4;  2K57 A;  2ROT A;  2K79 A;  4BD3 A;  2ZPG B;  3JCM e;  2MIO A;  2DX1 A;  1R77 A;  3VS5 A;  4Z02 A;  3MET A;  2DKG A;  1Q81 C;  3UA6 A;  3JCM c;  5FU7 B;  2J7I A;  1QVF P;  3NTH A;  2KMT A;  2QGF B;  3TRE A;  2HKQ B;  3CME A;  1YJW A;  5CCA A;  2D0N A;  2YUQ A;  2DEQ A;  4OB1 B;  3A98 A;  3JCM f;  2H3E B;  4M7A E;  4XTV A;  1KHC A;  1YBY A;  1YHQ A;  3EG3 A;  4Z89 A;  4KH0 B;  1MMN A;  4C5H A;  2MPX C;  3CCU T;  3PT9 A;  1B34 B;  3OA6 A;  2XMF A;  5FU6 C;  4IIO A;  1K4U S;  1WHM A;  4KGZ B;  1PD0 A;  2DL4 A;  2KYB A;  1VOM A;  1CSK A;  3HFO A;  3JCM P;  1ZLM A;  4GLM A;  1NG2 A;  4LUE A;  1D0Y A;  4TVR A;  4ZNX A;  4JS5 A;  3GNF B;  2YXY A;  2O9S A;  4J9C A;  3V7S A;  1M8V A;  5I22 A;  3JCM b;  1UHF A;  3GLX A;  1E6G A;  3JB9 H;  2E41 A;  1I8F A;  4ZN3 A;  4C5G A;  1VQM A;  4AT1 B;  2DER A;  4QQG A;  3M55 A;  1TH7 A;  1VQM T;  4M78 F;  2ZCF B;  2RI3 A;  5GAO l;  1M3A A;  2CUD A;  2HNI A;  4C8Q G;  1AWO A;  1WLP B;  1I07 A;  2F5K A;  2X3W D;  4F7U E;  3CCM A;  2RF0 A;  1D3B B;  3SDZ A;  2E12 A;  1QKW A;  4RTX A;  5D6W A;  4X34 A;  1B7T A;  3BE3 A;  1KQ2 A;  3V8K A;  1I81 A;  2EGA A;  3M9Q A;  4J5Y A;  2DTH A;  3MEW A;  4C8Q D;  2DIQ A;  2D9T A;  3A8M B;  1YJ9 Q;  2X4W A;  1P92 A;  2RK1 A;  1W70 A;  4A4K A;  5GAO q;  2E65 A;  3CME Q;  3HPW A;  3QXE B;  4F7U A;  3FJ5 A;  2FPE A;  1RAA B;  2VAS A;  4BI8 B;  2COZ A;  4FYY B;  4ATO A;  2WSE E;  2EYQ A;  3KBG A;  1QVF A;  3JCM X;  1K8A U;  1M30 A;  3VV0 A;  2NUT A;  3J7A F;  2R5A A;  4XQ3 A;  1VQO A;  4XTU A;  5GAM f;  1QCO A;  3GP8 A;  4FW1 A;  4PKC C;  1PG5 B;  3OS0 A;  1K8A C;  3OY9 A;  3CD6 T;  1K0X A;  2RH2 A;  4ANJ A;  3HKS A;  1VQP Q;  2QQS A;  2QAZ A;  4E7K A;  2RM4 A;  3G4S Q;  1Y96 B;  3NFC A;  2C06 A;  2O31 A;  4F7U B;  2JS0 A;  2KYM A;  5IHN A;  4O5V A;  1BI0 A;  3M56 A;  3C95 A;  3IQL A;  1VQ7 T;  5GAO m;  2RQW A;  1GCQ A;  4XTZ A;  3I56 T;  1KD1 U;  1B07 A;  5CKF A;  3MJX A;  5DLQ E;  1QVG P;  2A36 A;  3MKD A;  3OSV A;  3CCL T;  3V8L A;  3JCM J;  3I5S A;  4Y92 A;  3OSS C;  4JLI A;  2CZ6 B;  4MZP A;  5FWB A;  3QWX X;  1BCO A;  2PZ1 A;  2XDP A;  4M75 A;  4C8Q F;  1ZSZ C;  5LJ3 e;  4FYX B;  3TQ7 P;  3BDL A;  3RMQ A;  2MCN A;  1YJW Q;  2DBK A;  1MMA A;  2D1X A;  3OYN A;  4KUD K;  2NYS A;  4DBR A;  1WI7 A;  8AT1 B;  3CC2 Q;  2PVO B;  1N27 A;  2EJ9 A;  2KT8 A;  1O75 A;  1UB4 A;  3RR6 A;  4M7A B;  3LX7 A;  3SHW A;  1VQ9 T;  2OTL Q;  3MHX A;  1Y0M A;  2RJD A;  4KGV B;  1FYN A;  2FB7 A;  2M1H A;  2EQI A;  4EIK A;  3SFM A;  3EFS A;  3OYG A;  1WQW A;  3S3O A;  1GRI A;  2Y90 A;  5GMK j;  1Q86 U;  1VQ7 A;  2JS2 A;  3M59 A;  2OAW A;  2V1R A;  3FDR A;  2YUP A;  5ECA A;  3TSZ A;  4RTZ A;  2CH4 W;  1HD3 A;  1Z9Z A;  1M3B A;  3RMS A;  2H3J A;  4JJB A;  1N8R R;  2LC4 A;  2BTT A;  4HA8 A;  3OYH A;  4JLG A;  5FU6 B;  3LYI A;  3S3N A;  4HCC A;  3OYE A;  4RTV A;  1LVK A;  1SF9 A;  2FZK B;  2I2L A;  5KYW B;  1ZUU A;  2Y4Y A;  2EFI A;  1LOJ A;  2P4R A;  1QMC A;  1ZBJ A;  4FL6 A;  4E6R A;  4LNP A;  3G4S T;  4DOV A;  1VYU A;  2A28 A;  2J05 A;  3OYD A;  1VQN A;  3PVL A;  2QAS A;  2RQU A;  5GAN 8;  3OYI A;  5GMK e;  3I55 A;  2MOX A;  2EYX A;  3JB9 F;  3G71 Q;  3M0R A;  2E6Z A;  4M7D E;  2EBP A;  4ESR A;  2HBW A;  4DOW A;  1QWF A;  4RG2 A;  5GAN h;  1NEB A;  2JOY A;  3M58 A;  2JTF A;  4C8Q C;  2D6F A;  1R8O B;  1WA7 A;  4M75 G;  1PSF A;  2RB6 A;  1Q82 U;  3CC4 A;  5LJ5 f;  1X6B A;  3QO3 A;  2P0K A;  1S72 T;  3GNG A;  3OB9 A;  4RTU A;  1WJR A;  5GAM e;  3I56 Q;  4JZ4 A;  1TUC A;  2LNV A;  4KUL A;  1TWB A;  1J3T A;  3HP9 A;  4AFZ C;  1AOJ A;  4X1V A;  1QCF A;  4ME7 A;  2DJQ A;  4QQ6 A;  2DA9 A;  4C0G A;  4L59 A;  4M75 F;  1PCX A;  2BZX A;  3ZL7 C;  2OJ2 A;  2L5Q A;  4LDW A;  5D6Y A;  3CCU A;  3EG2 A;  2RI5 A;  1BU1 A;  4OMQ A;  4ZN1 A;  3E2U A;  1G5V A;  4WTO B;  1GCP A;  3QJ6 A;  3JSC A;  1M90 C;  1U1S A;  2WSC E;  1XOV A;  5GMK h;  1K9M R;  3EGX B;  4JDS A;  2CT4 A;  3U23 A;  1PRL C;  4M7D G;  1QVP A;  2DFU A;  3M0U A;  3PNW C;  3JRZ A;  3I55 Q;  2KXD A;  2W0Z A;  1U06 A;  4PFP A;  1AWJ A;  3OYB A;  1G8X A;  1OYX A;  1M90 U;  2KR3 A;  4ELZ C;  3EG9 B;  1QVF S;  2EYY A;  1OPL A;  5LJ3 g;  2KY9 A;  1K8A R;  2AKK A;  2CZ1 B;  1K76 A;  1W1F A;  2KQW A;  4JJC A;  4M78 A;  4NS5 A;  3G4S A;  3A8H B;  1T3L A;  1ZQ1 A;  3UDC A;  3L2W A;  2YSQ A;  1MV0 B;  2BKD N;  5GAN 2;  3SB2 A;  2DYB A;  2K5I A;  4BE2 A;  1VQ4 Q;  3MPU B;  2ZGW A;  4J9E A;  1UJY A;  2FO0 A;  5J39 A;  4J9H A;  1M5Q 1;  2BE7 D;  2OI3 A;  5KCH A;  4LDV A;  2AIR B;  1X75 C;  4BI3 A;  4JZ3 A;  4B9X A;  3DLM A;  2P0Q A;  1UDL A;  1Z9Q A;  4C8Q A;  2EWN A;  4C92 E;  1YI2 A;  3JCM d;  1W2B A;  3F70 A;  4HCB A;  4OF1 A;  4AG2 C;  4EMK B;  2OTJ Q;  1ZA2 B;  1VYV A;  2DIG A;  3CBP A;  1ZSZ A;  4AMC A;  3G7Z A;  2V8I A;  3HRT A;  2FG0 A;  5J3B A;  4JJN K;  8ATC B;  2F1L A;  4D6W A;  3OMG A;  1QLY A;  2QEX Q;  1TTH B;  1Q82 R;  2PU9 B;  4FM4 B;  3CMA Q;  1VQN Q;  2KE9 A;  1VQ7 Q;  1NLP C;  2R57 A;  3C94 A;  5KYN A;  2OTL T;  2O9V A;  2DYI A;  1MMG A;  3X28 B;  1UUE A;  6AT1 B;  1BBZ A;  5GAN 6;  4HT8 A;  3GIB A;  2F2W A;  3URG A;  1M1K U;  5A0G A;  2K2V A;  2RJF A;  3P8D A;  3CCS T;  2FL7 A;  4FYV B;  4LD9 K;  1W6X A;  3GBQ A;  4O6J A;  2SRC A;  5KYY A;  4FCY A;  1VQL Q;  2CZ0 B;  4FSS A;  4II1 A;  1Q86 C;  1FX7 A;  3M0T A;  2VGM A;  2HSP A;  3CC7 T;  3G71 T;  1G2B A;  4EMH A;  5L23 A;  1QQJ A;  3A8L B;  2F5T X;  2JW4 A;  2RHY A;  2D8H A;  1WIE A;  1JBM A;  2VC8 A;  3CCE A;  1YIT A;  4IUQ A;  3VYG A;  3JAM E;  4QVD A;  2DXC A;  3CMA T;  4CC7 A;  4BB7 A;  3CCV T;  1ZBX A;  2K2M A;  1E6H A;  2DVJ A;  4M77 B;  4E47 A;  5LJ5 e;  4FIB A;  2DTI A;  1K1Z A;  2NUZ A;  1TOV A;  1S72 Q;  4XK8 E;  1UG1 A;  5GJV B;  1YJN T;  3NTK A;  2KGT A;  1VQ9 Q;  2V26 A;  4KH1 B;  1VQO Q;  1PWT A;  2YUN A;  1SHF A;  3VYH B;  4M7A D;  1GL5 A;  4RG8 A;  4OMP A;  2M0Y A;  2CGH A;  4M78 B;  3HSB A;  1VQ6 T;  2CH4 A;  4M7D D;  2CUB A;  2DD5 A;  1N6A A;  4IUV A;  3M4G A;  3FLG A;  1HJD A;  3V7C A;  1ARK A;  1TUD A;  4HKE A;  1B3Q A;  4HVV A;  4LE9 A;  2LZ6 B;  4MDW A;  1M4Z A;  4E7L A;  2MAM A;  2YHT A;  1OQK A; 
#chains in the Genus database with same CATH homology
 4M7A A;  3HKS A;  2QQS A;  4FSX A;  1RI0 A;  4E7K A;  4M78 C;  2RM4 A;  3VU3 C;  4RKU E;  1NE8 A;  3TCJ A;  4ZGJ B;  1Y96 B;  2Y4X A;  3QKJ A;  4IUP A;  5CO7 A;  3RKY A;  3NFC A;  5LJ5 j;  3G6E T;  2C06 A;  1VQN T;  3OYK A;  4F7U B;  3Q1J A;  2QEX T;  4HCZ A;  4O5V A;  2MMP A;  1BI0 A;  4C92 D;  3JCM W;  1QVG A;  3M56 A;  5LJ5 g;  2K5F A;  1MGQ A;  3QYH B;  4J6Y A;  2HAX A;  3C95 A;  1VQ7 T;  2O01 E;  4XU1 A;  2DAQ A;  5GAO m;  2M0O A;  3OYL A;  4XTZ A;  3ASK A;  1BI1 A;  4JRK A;  3JB9 J;  5I2M A;  4CI0 C;  2X4J A;  1N9R A;  3CBO A;  5GAM g;  3I56 T;  5CKF A;  3L2R A;  1KD1 U;  2EQU A;  2RA2 A;  1VQK A;  3QZ9 B;  1WNL A;  3I56 A;  3BFM A;  5DLQ E;  4EMK A;  5CKB A;  3CC7 A;  4M7D A;  1BIB A;  1G3T A;  4KT0 E;  4L5G A;  3JCM g;  3BDU A;  3OS5 A;  3ZEH A;  5J26 A;  3H6Z A;  3ME9 A;  4PJO G;  3CC2 T;  3OSV A;  1VQP T;  2RI2 A;  3E19 A;  3LW5 E;  2DO3 A;  3CCL T;  3V8L A;  4L6V 5;  3A5Z B;  3JCM J;  1D3B A;  1G3S A;  1K9M C;  3OSS C;  5LJ5 d;  1VQ8 T;  3CXC S;  3RIR A;  1YHQ T;  4JLI A;  2CZ6 B;  4MZP A;  1BI3 A;  3AHU A;  4M77 E;  2XDP A;  4M75 A;  3RKX A;  5LL6 S;  2ZPE B;  3CC4 T;  3QYG B;  3L42 A;  4C8Q F;  1YIT T;  2MWO A;  4N0A A;  1YIJ A;  4A4F A;  4N4H A;  3KUF A;  4PJO A;  2VV5 A;  4M7A C;  4C92 A;  2D0Q B;  3MEA A;  1UGR B;  1Y96 A;  3FJP A;  1VIF A;  1Q81 U;  3CD6 A;  5FU7 C;  2KDS A;  2VUB A;  5I21 A;  5LJ3 e;  3PTA A;  1VQK T;  4MMK A;  4XTY A;  3DKM A;  3BDL A;  3RMQ A;  3CCJ T;  3QJY A;  5IT9 E;  2L89 A;  2QA4 A;  4XU0 A;  2ZPH B;  3CPW S;  1K9M U;  3OYN A;  1M1F A;  5C0M A;  4KUD K;  1YJN A;  3LH0 A;  2A7Y A;  2LCL A;  2ZPB B;  2PVD B;  4C0D C;  2PVO B;  3L2Q A;  3CME T;  3OBW A;  1WQ7 A;  2QEX A;  1N27 A;  2P0P A;  1HK9 A;  3JB9 G;  5HK3 A;  4C0G A;  4ZGE B;  4E7J A;  3CBM A;  2LCC A;  2EJ9 A;  2LQ8 A;  3DB3 A;  2E1H A;  2BUD A;  4PLI A;  1O75 A;  1YCY A;  3HRS A;  1H64 1;  1UB4 A;  4NL3 A;  4PJO E;  2K3X A;  5KCO A;  2E64 A;  3CPF A;  4M7A B;  2EQK A;  4F7U G;  3LX7 A;  5CKD A;  3CCV A;  4XTW A;  2DJZ A;  3M54 A;  3RUX A;  5GAN j;  2DZC A;  1VQ9 T;  4EPC A;  3DB4 A;  3MHX A;  4F7U F;  3WXM B;  2RJD A;  4QQD A;  4Q5W A;  4A4H A;  4M75 D;  1KQS A;  2FB7 A;  2M1H A;  3O8V A;  2K5L A;  5FLX E;  2MF2 A;  2IVW A;  1G3Y A;  3OS2 A;  4J6X A;  1BIA A;  1K73 C;  3GOX A;  3H8Z A;  1QP3 A;  3SFM A;  2JZ2 A;  1ZHI A;  2E6N A;  4DQ2 A;  3EFS A;  4C0D B;  2LDM A;  3OYG A;  3NTI A;  1SSF A;  2GQV A;  2OTL A;  3OW2 S;  2QTX A;  5GAN 7;  5KE3 A;  4C92 G;  1WQW A;  3S3O A;  3X24 B;  2Y90 A;  5GMK j;  1Q86 U;  1VQ7 A;  1DJ7 B;  2EQM A;  2FYK A;  3A8O B;  3M59 A;  3FDR A;  4J7F A;  4XU3 A;  5HY6 A;  5CR2 A;  5M9O A;  2RD1 A;  1M1G A;  1VQ9 A;  3INZ A;  1N8R U;  4A4G A;  1VQ5 T;  1K73 U;  3RMS A;  2H3J A;  4NL2 A;  4IUT A;  2LC4 A;  2EJG A;  3SWN C;  1QW1 A;  3LLR A;  4HA8 A;  4JLG A;  2RHZ A;  3WVD B;  3OYH A;  4FT2 A;  1VQ8 A;  1N9S A;  5FU6 B;  1WGS A;  1VQP A;  3CXC A;  2ZPF B;  4MZT A;  1BKB A;  3LYI A;  3V7R A;  3VJP A;  3MCA B;  4BDZ A;  3GPL A;  4M75 C;  3S3N A;  1RL2 A;  4NOY A;  5DLO A;  4C92 F;  3OYE A;  3HFN A;  1MHN A;  2I2L A;  4OGE A;  4UC4 A;  1YI2 T;  2KVQ G;  2Y4Y A;  2F69 A;  1NZ9 A;  2EFI A;  3SWN B;  4JS4 A;  1LOJ A;  1KC8 C;  2LTO A;  5FRO A;  2XDD A;  4C92 C;  4FL6 A;  2GFA A;  4FT4 A;  3MEV A;  4C0Z A;  4MZM A;  2LT1 A;  3T9N A;  1EIF A;  2MI6 A;  4PJO B;  2E5Q A;  3G4S T;  4DOV A;  3OYD A;  3OY9 A;  1VQN A;  1JB0 E;  5GAN 8;  3PIP A;  3OYI A;  1VQL A;  2O4X A;  5GMK e;  3MP6 A;  4C8Q E;  1KQ1 A;  2KAF A;  2QI2 A;  2VYT A;  3OYM A;  3I55 A;  3CCS A;  1NPR A;  3QPH A;  4M7A G;  4BE1 A;  5D6X A;  1IRE B;  3JB9 F;  4M77 F;  5GAN 3;  3LGL A;  3OMC A;  5HKC A;  2XD0 A;  4A53 A;  2E6Z A;  5LJ5 h;  1NPP A;  4M7A F;  4M7D E;  2HD0 A;  4XU2 A;  2KSS A;  3E9F A;  4J83 A;  2E70 A;  4JRP A;  3JB9 D;  4J8O A;  2LRQ A;  3HRU A;  2XU8 A;  4DOW A;  1LNX A;  2DD4 A;  2XK0 A;  3UWN A;  1VUB A;  4C0F A;  3CCR T;  4RG2 A;  5GAN h;  3MP8 A;  4LD6 A;  4PJO F;  5LJ3 d;  2JOY A;  2PQW A;  2KK4 A;  1I4K 1;  2WSF E;  1WJQ A;  1XTD A;  2JTF A;  3L2Z A;  3M58 A;  4C8Q C;  3JCM Q;  2D6F A;  5FRM A;  3ZFJ A;  4V2S A;  2RJC A;  1VIE A;  1R8O B;  4M75 G;  1IZ6 A;  1PSF A;  2HQE A;  2RB6 A;  3M53 A;  1Y7X A;  3HL8 A;  3S3M A;  2JUF A;  1Y71 A;  2RHU A;  3MEU A;  5A0L A;  5LJ5 f;  1Q82 U;  1JJ2 A;  3CC4 A;  3QO3 A;  4M78 E;  5A0D A;  2P0K A;  4VUB A;  1S72 T;  2JN0 A;  4M77 G;  3GNG A;  4LDX A;  3CCE T;  3OB9 A;  5GAM h;  2VGN A;  5LJ3 h;  5A2Q E;  3P8B B;  3LGF A;  3N5B B;  3M5A A;  4OGC A;  4OB0 B;  4A4E A;  4R56 A;  4P5N A;  2RJE A;  1WJR A;  3PFS A;  2QQB A;  5GAM e;  3VKI A;  2LNV A;  4GY5 A;  4KUL A;  2R58 A;  1KQS S;  5L8R E;  2XIC A;  3HP9 A;  4IUR A;  1NJI C;  4ME7 A;  2QA4 T;  1W2B S;  4JUV A;  4QQ6 A;  2RK2 A;  4BUG A;  4L59 A;  3GF5 A;  3OQ5 A;  4M75 F;  2AHJ B;  1BI2 A;  2BIV A;  3OS1 A;  3I55 T;  1OZ2 A;  4IKF A;  3TEE A;  3E9G A;  3FIF A;  2EQJ A;  4CRI A;  1Q7Y U;  2L5Q A;  4FU6 A;  4LDW A;  2QQ9 A;  5LJ3 f;  3MP1 A;  5GAO n;  3CEY A;  5D6Y A;  3CCU A;  3FEO A;  3MO8 A;  2RI5 A;  5C6S A;  2V8K A;  4M75 E;  4EMK C;  1GXI E;  3A8G B;  2O4X B;  2EIF A;  4ZN1 A;  3TU4 K;  1NJI U;  1N8R C;  2FHD A;  2LVM A;  1LJO A;  1G5V A;  5LJ3 j;  4RCC A;  1U8R A;  1OI1 A;  3QJ6 A;  1FXX A;  3DLL A;  1X6O A;  3JSC A;  3OYF A;  1M90 C;  2GFU A;  1U1S A;  2WSC E;  1XOV A;  5GMK h;  2VXF A;  1U1T A;  3CPW A;  2QXF A;  5GAO p;  3CCJ A;  4JDS A;  3G71 A;  2FVU A;  2LX9 A;  3ER0 A;  4M7D G;  1QVP A;  3FRN A;  3JCM h;  3PNW C;  3JRZ A;  4J6W A;  1B34 A;  3EFR A;  2CS7 A;  3SWN A;  2LQK A;  3QDR B;  1YJ9 A;  3OBY A;  3OYJ A;  4N0A C;  1VQ4 A;  1JJ2 S;  3OYB A;  1OYX A;  1M90 U;  4ELZ C;  2K4Y A;  4E7I A;  1HXD A;  4OMF B;  2DXT A;  2EAY A;  4B9W A;  4OVA A;  4C8Q B;  5GAN e;  1QVF S;  2OAU A;  2JNG A;  4HCC A;  1W4S A;  3HHT B;  4KBM B;  3L2U A;  2CZ7 B;  5LJ3 g;  2KY9 A;  5GMK l;  4C5I A;  3M57 A;  2CZ1 B;  3CD6 T;  2X35 A;  3QG1 A;  3CC2 A;  2XDB A;  2KQW A;  2YLB A;  5GAN g;  3UPU A;  4M78 A;  4NS5 A;  3G4S A;  3A8H B;  2HQX A;  3C12 A;  2XID A;  3C4S A;  1ZQ1 A;  4BY6 C;  5GAN f;  1BYM A;  3UDC A;  2JVV A;  5GAN 5;  2GCX A;  3L2W A;  4JRQ A;  1V29 B;  1I5L A;  4ZTJ A;  4M77 D;  1PSE A;  2BKD N;  3M4Y A;  3R6O A;  3SB2 A;  1UEB A;  5GAN 2;  1YJW T;  3QUI A;  2K5I A;  4JRI A;  4N4I A;  4BE2 A;  4QVZ A;  4BE0 A;  2DXB A;  4GLK A;  2XG8 D;  2ZGW A;  3V8J A;  1X01 A;  1G3W A;  4OB2 B;  3QZ5 B;  3LWI A;  2EKO A;  4A54 A;  5J39 A;  1Q7Y C;  1M1K C;  1M5Q 1;  4OB3 B;  2IG0 A;  3UT1 A;  5KCH A;  2EJF A;  4LDV A;  2L8D A;  5GAN 4;  2K57 A;  4BD3 A;  2ZPG B;  3JCM e;  2PVG B;  4M7D C;  1X75 C;  3EAE A;  4BI3 A;  4B9X A;  2HBP A;  4Z02 A;  3MET A;  4J7I A;  2DKG A;  3QSU A;  1Q81 C;  3DLM A;  2RHX A;  2P0Q A;  3JCM c;  3CCQ T;  5FU7 B;  4C8Q A;  1UGS B;  2EWN A;  3J80 E;  3NTH A;  4C92 E;  3FB9 A;  2KMT A;  5GAO r;  3SD4 A;  1YI2 A;  4PL6 A;  3TRE A;  3JCM d;  3CME A;  1W2B A;  1YJW A;  4X9C A;  2XHC A;  1YJ9 T;  3F70 A;  4ZTF A;  4OF1 A;  1OZ3 A;  5KH6 A;  1VQ4 T;  4HCB A;  5FRN A;  5CCA A;  2CKK A;  2L3R A;  4EMK B;  2YLC A;  3L2V A;  4E7H A;  3QII A;  5GMK i;  2X4X A;  5IN1 A;  4PLL A;  2DIG A;  3PGG A;  2DEQ A;  3CBP A;  4PJO C;  4OB1 B;  3G7Z A;  2V8I A;  2RO0 A;  3JCM f;  4XTX A;  3HRT A;  4EDU A;  4QVC A;  3OYY A;  5J3B A;  4JJN K;  3CCQ A;  4M7A E;  4XTV A;  1KHC A;  3ZBD A;  1YBY A;  3OMG A;  4D6W A;  4M7D F;  1YHQ A;  4M77 A;  1XNI A;  4PNO A;  4KUI A;  2PU9 B;  4FM4 B;  4WF2 A;  5GMK m;  2B8A A;  1VQL T;  1JRI A;  2PUK B;  3X20 B;  4C5H A;  3CCU T;  3PT9 A;  3CMA A;  2CYZ B;  1B34 B;  2R57 A;  3OA6 A;  3C94 A;  2OTL T;  2QQR A;  5FU6 C;  4RCB A;  2XI9 A;  3X28 B;  3PMI A;  5CQX A;  5GAN 6;  4DA4 A;  4HT8 A;  3GIB A;  3URG A;  1M1K U;  5A0G A;  4OP0 A;  2K2V A;  1UGP B;  4Y91 A;  3BY7 A;  3PMT A;  4N4G A;  3HFO A;  3JCM P;  4M7D B;  2RJF A;  3P8D A;  1H3Z A;  5IAY A;  3L1A A;  3OYA A;  5DM7 R;  3S6W A;  4TVR A;  4IUU A;  3CCS T;  4M78 G;  4JS5 A;  3GNF B;  2QQA A;  5EG2 A;  3QBY A;  3V7S A;  2FL7 A;  4LD9 K;  4O6J A;  2K3Y A;  4LDY A;  1M8V A;  2DPP B;  4R55 A;  5AYF A;  2P4T A;  5GAM j;  2CZ0 B;  4II1 A;  4ZGD B;  3JCM b;  1Q86 C;  1FX7 A;  1Y07 A;  3GLX A;  2PUO B;  2VGM A;  3RES A;  2M9U A;  2DTO A;  5CKE A;  1WJS A;  2ZZD A;  3QHS A;  3CC7 T;  3JB9 H;  2E41 A;  3G71 T;  4M78 D;  1I8F A;  4EMG A;  4ZN3 A;  4EMH A;  3PIO A;  4C5G A;  3LWH A;  1VQM A;  4MML A;  3A8L B;  1VQO T;  2F5T X;  2ZPI B;  1WPY A;  2RHY A;  3VUB A;  4QQG A;  3M55 A;  1TH7 A;  4C92 B;  5KE2 A;  1VQM T;  4M78 F;  2ZCF B;  2RI3 A;  4XAX B;  5GAO l;  1S72 A;  2HNI A;  4C8Q G;  1JBM A;  2VC8 A;  3CCE A;  1YIJ T;  4IUQ A;  3VYG A;  1YIT A;  4M75 B;  4X9D A;  5DY9 A;  3JAM E;  2MWP A;  4QVD A;  2DXC A;  2F5K A;  3KXT A;  3CMA T;  1KHI A;  4BB7 A;  4F7U E;  3CCM A;  2GF7 A;  1D3B B;  2JTM A;  3CCV T;  1ZBX A;  4M77 B;  4E47 A;  3SDZ A;  5LJ5 e;  2M16 A;  3E1S A;  4FIB A;  2DTI A;  2E12 A;  2NLU A;  3OW2 A;  3J81 E;  4BAC A;  5GAM d;  5D6W A;  4X34 A;  1KQ2 A;  4XK8 E;  4RMO A;  3OYC A;  3V8K A;  3CCR A;  1Q82 C;  1I81 A;  1YJN T;  3NTK A;  1O9S A;  2DK3 A;  2DZ9 A;  2G3R A;  1XQH A;  3M9Q A;  4J5Y A;  5CAI A;  2DTH A;  4M77 C;  3MEW A;  3RKW A;  3WVE B;  4C8Q D;  2V8J A;  4PJO D;  2WAC A;  2DIQ A;  1KG1 A;  2X4Y A;  2XKO C;  4QW2 A;  3FC3 A;  2OTJ T;  2D9T A;  1KD1 C;  3A8M B;  2DVE A;  3BW1 A;  1QVG S;  2OTJ A;  1QP2 A;  2X4W A;  1AHJ B;  1P92 A;  2A3L A;  2RK1 A;  5CQY A;  2R5M A;  3VYH B;  4A4K A;  5GAN d;  5GAO q;  4BDY A;  4M7A D;  2E65 A;  4RG8 A;  3JB9 I;  2YRV A;  5CKH A;  3HPW A;  2CGH A;  3QXE B;  4F7U A;  2RHI A;  5CK9 A;  4M78 B;  4BI8 B;  3CCM T;  1VQ6 A;  4ELY C;  3X25 B;  3HSB A;  4ATO A;  2WSE E;  1K8A C;  5HK0 A;  2EYQ A;  3KBG A;  1QVF A;  1VQ6 T;  2LT4 A;  3JCM X;  1VQ5 A;  1K8A U;  1FWZ A;  3VV0 A;  1M9S A;  4M7D D;  4MDX A;  2DD5 A;  4YTL A;  3J7A F;  1N6A A;  3P8H A;  3VUZ A;  2R5A A;  4XQ3 A;  4IUV A;  3G6E A;  3RER A;  4BI4 A;  4C5E A;  3M4G A;  2QDY B;  3FLG A;  4BY6 B;  1VQO A;  3CCL A;  4LDU A;  1KC8 U;  3V7C A;  4HKE A;  4XTU A;  5GAM f;  2VXE A;  5CIU A;  5I2S A;  3GP8 A;  3X26 B;  4Y28 E;  3JCM V;  4PKC C;  4MDW A;  2DXU A;  5CVI A;  1UGQ B;  2E10 A;  1M4Z A;  3OS0 A;  4E7L A;  2MAM A;  2YHT A;  2RH2 A;  4HT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...