1LOJA

Crystal structure of a methanobacterial sm-like archaeal protein (smap1) bound to uridine-5'-monophosphate (ump)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
b'VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Rna binding protein, transcription
total genus 13
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lojA00
2DVEA 4PJOD 4F7UG 5GANh 4M78F 2FB7A 5GAOm 5GANj 3GIBA 1B34B 1HXDA 1LOJA 4J6XA 4M7AB 4C8QA 5GAN2 1LJOA 4M7AC 2QTXA 4C8QF 4M77D 3V8JA 1WPYA 1X01A 4J5YA 4M78B 4M75A 1N9SA 1Y96A 4M78C 5LJ5j 4XTUA 4NL3A 3FIFA 4F7UF 5GAOl 5LJ3f 3INZA 2DXUA 2EAYA 2EJ9A 5LJ3g 2E65A 2DTOA 4XTVA 5LJ3e 4M7DE 1WNLA 2VXFA 5GAN3 3RKXA 3JB9H 5GAN6 5GAN4 4F7UB 4XU3A 3PGGA 4C92D 3JCMX 5GMKi 4JLIA 3SWNB 3HSBA 3M4GA 3SWNC 2DTIA 1B34A 4MMKA 3RKWA 1I8FA 3JCMh 4M7AA 3SB2A 4N0AC 4HT9A 3JB9J 2EWNA 2HNIA 4M7DG 4M77E 4M78A 3JCMW 3HFNA 3JCMb 4J6WA 4XTYA 3BDUA 3EFSA 4J6YA 5LJ3d 3JCMQ 2E64A 4EMHA 4M7AD 5GAN8 2YLCA 2FYKA 4F7UA 4M7DF 4X9DA 5GAOq 5LJ5h 5GAMg 2EJGA 1BIBA 4M78D 4A54A 5GAMe 1YCYA 4A53A 5GMKh 5GMKj 1JRIA 1H641 2RB6A 3SWNA 4C92E 4M77G 4XU1A 5I21A 4V2SA 4C8QD 4M7DB 4N0AA 2RD1A 4M7DC 1LNXA 3BFMA 3JCMP 3JCMc 4M75D 4XU2A 5GMKm 1JBMA 3HFOA 3JCMJ 3BW1A 3V7SA 3JB9G 4M77F 4HA8A 1D3BB 4XTZA 4PJOE 1N9RA 2Y90A 4PJOC 1TH7A 3EFRA 1M8VA 1KQ1A 2E41A 3L2ZA 1WQ7A 4M77B 4MMLA 4M77C 5GMKl 4EMGA 4EMKB 5GAMd 3JB9F 4EMKC 4WF2A 5GANf 5GAN7 4JRKA 3V8LA 5GANg 3JB9I 2JN0A 5GANe 4Y91A 4QVDA 2DZCA 1WQWA 5LJ3h 5LJ3j 4M7DA 5GAOr 4C8QE 4PJOG 4QVCA 5GAMf 2VXEA 3L1AA 3JCMV 5LJ5g 4M75E 2K57A 5LJ5e 3RESA 4C92C 3QO3A 4XTXA 3QSUA 1D3BA 1I5LA 5DY9A 3QUIA 4PJOF 4M7DD 4JRIA 2CGHA 4M77A 2DXTA 4C8QG 4EMKA 2DTHA 2YHTA 3V7RA 4PJOB 1KQ2A 4NL2A 5GANd 3V8KA 4DQ2A 4M75G 4OP0A 3JCMf 1M5Q1 4C92G 5GAN5 1I4K1 1BIAA 4X9CA 4RCBA 3JCMg 3VU3C 3JCMe 2E10A 5GAOp 2YLBA 3BY7A 3V7CA 2I2LA 4M7AE 1MGQA 3RKYA 5CAIA 5GAMh 5LJ5d 5GAMj 4JUVA 4M78E 4C92A 3RERA 2RA2A 4M75F 4C92F 1I81A 2ZGWA 4C8QB 2RM4A 3FB9A 3FJPA 4C8QC 4HT8A 1HK9A 2DJZA 2DZ9A 3JB9D 5LJ5f 4M75B 3QHSA 4C92B 4NOYA 1Y96B 4M75C 4RCCA 4PNOA 4F7UE 1U1SA 5GMKe 4M7AG 1U1TA 4XU0A 4PJOA 2DEQA 4XQ3A 2VC8A 4XTWA 3RIRA 2E1HA 4M78G 3AHUA 3JCMd 2EJFA 5GAOn 4M7AF 3RUXA 2DKGA
chains in the Genus database with same CATH superfamily
1NEBA 1OOTA 4HCZA 3CPFA 2EGAA 2D6FA 3OW2P 1AVZC 4PFPA 5LJ3f 4OB3B 4Q5WA 5KCOA 3QZ9B 3VRYA 4F7UB 3OSSC 4RUGA 3JCMX 5GMKi 1UDLA 5KYXA 2KRSA 3EGDB 1OZ2A 1BKBA 2QXFA 1YJWQ 4OB0B 2NLUA 3M5AA 1GFCA 1QWFA 4J8OA 1O75A 1G3TA 2ZPFB 3ZFJA 2EJGA 4LNPA 4D6WA 1BYMA 4XU1A 4N4HA 1AWWA 2C06A 3FJ5A 4E6RA 5GMKm 2IG0A 4E2FB 3G1JA 1UECA 1G3WA 2KE9A 3MP8A 4KH1B 1IHWA 1CSKA 1IZ6A 2H8HA 2XDBA 2EYXA 1NEGA 1VQ8Q 4RG2A 3JB9F 1M9SA 2COZA 3FLGA 4E7SA 4QVDA 3ER0A 3THKA 4PFZA 1Q81C 2AIRB 3PVLA 3VS5A 2K79A 2HBPA 4E7JA 3N5BB 2M16A 4J9IA 5LJ5g 1VQNQ 2M0OA 5A0LA 2RMOA 4J7FA 2JMCA 1R0BG 2DETA 1KK7A 3M53A 4X9CA 1R8OB 5D6YA 1FMWA 1UGPB 1VQ9Q 4QVZA 8ATCB 5A0GA 1IGUA 2M1HA 3FB9A 4HVVA 2DJZA 3QHSA 2LT4A 3OW2S 5I11A 5IXFA 1ZUUA 3S3MA 2J7IA 2EJFA 5FRNA 3WVDB 3L2QA 5IXBA 1IREB 3EG1A 3CD6T 1Q81R 5GANj 3HP9A 1QKXA 3CCMA 3CCJQ 2GFUA 2V26A 2X4YA 4PJNA 1LVKA 2JUFA 2LQWA 3OMGA 3LH5A 2EAYA 2DTOA 2D8HA 3CCMT 2EPDA 3VS3A 4C92D 5IHKA 4HKEA 2XI9A 3HSBA 3I5SA 1KD1C 1JXMA 1FXXA 2NUZA 3QIIA 1Y7XA 2HNIA 2O9SA 4M77E 3BE3A 2VWFA 4Z89A 3CC4A 1BI1A 3UA7A 1VQ5Q 3JRZA 3CCSQ 3HTRA 2JVVA 3A5ZB 3CC4T 4LE9A 2XK0A 5AT1B 4XU2A 2B86A 2FPDA 1QMCA 1RLPC 3PMTA 4UC4A 1VQKQ 1UG1A 1I0CA 3VS0A 2EFIA 3EFRA 4M77B 3CQTA 3I5RA 4M77C 2CYZB 3CMEQ 1Q81U 2FHDA 1VQ8T 4E7IA 1MMGA 2RH2A 5GAOr 2DAQA 2RQVA 4IKFA 5IHNA 5CKHA 5FWCA 1RLQC 1W2BS 2R5MA 3ZEHA 4LDWA 1KD1R 2LX7A 4ZTJA 4J9CA 4R0KA 1X2KA 4JRIA 2A3LA 2CGHA 3H0FA 2JJ9A 3KFVA 3A1PA 1WLPB 3E9GA 1KSWA 2CUBA 4NL2A 1VQ9A 2QK0A 3VUBA 1YJNA 2WSEE 3JCMe 4Z8AA 4M7AE 1M3CA 1R77A 2COYA 1MGQA 2F1LA 3OYHA 2JMAA 1VQ9T 1OEBA 2X9HA 2QEXA 2YRCA 1BCMA 3FC3A 1TUCA 5LJ5f 3ASKA 2A7YA 1GCQC 3M0SA 2QEXT 2X35A 2YUNA 4HCCA 1KHCA 2BKDN 1GBRA 4BE0A 1OU9A 3ULRB 2FB7A 2KMTA 4M7AB 4C8QA 4M7AC 3RMQA 1X01A 3HRSA 2P4TA 4LD6A 1QCFA 4A4FA 1PD1A 3I55Q 2EQJA 3P8HA 3GOXA 3DB3A 3M4GA 1KD1U 4A4EA 1VQ5A 1Y0MA 4ZGJB 4M7DG 3KXTA 4WTOB 1ABQA 3C94A 5GAN8 1VQ5T 3UATA 2OTJQ 2LVMA 1WFWA 1RAHB 3EH2A 5GAMg 2J06A 2KBTA 1H641 2RJDA 3CCEQ 2ENMA 1R0CB 1OPKA 3VS4A 2PUKB 1PCXA 1JBMA 3QG1A 3MP1A 1M4ZA 1MMNA 2QASA 1WJQA 4EPCA 1M8VA 2KVQG 2PVGB 1D1BA 2XICA 3M55A 4KULA 2HEQA 4QVCA 2F2XA 1VQ4Q 2LMJA 5LJ5e 3I56Q 1YHQQ 2A08A 2YHTA 1VQ6A 3V7RA 4OMMA 3V8KA 1RUWA 1TS9A 3OY9A 5GAOp 2H3EB 2MCNA 1NBEB 1V1CA 1M90C 1VQ6T 4M78E 4A4GA 2EYWA 2R5AA 3CCUA 1TOVA 2HL3A 2SEMA 1WGSA 2E1HA 1VQ7A 1PSFA 5HY6A 3J80E 3EGXB 1B34B 3CCVQ 4CRIA 2ZCFB 4M77D 4M78B 2ZPGB 4M78C 4FSXA 7AT1B 3QWYA 2MF2A 2RN8A 2JS0A 3OYAA 4F17A 3H0HA 3RKWA 4DOWA 4HT9A 1QVPA 2FPFA 1YCSB 5CKDA 1KG1A 1HSQA 4J6WA 2OX7A 3L2VA 1NPPA 2QA4Q 2I0NA 3CCQQ 4ATOA 2PVOB 1NJIC 5GMKh 1YCYA 2CP0A 1G3SA 2D8JA 3OYKA 2HMAA 2ZPBB 3CMAQ 1X6OA 3EG2A 4J9HA 1SSFA 3P8BB 3PTAA 3SD4A 2KRMA 4OVAA 3QZ5B 1AWOA 1NLOC 3OBWA 5GANf 3V8LA 1VQ4A 1LCKA 1G2BA 2RI5A 4ELYC 4PJOG 1ZSZA 3EG9B 5GAMf 1B7TA 1RL2A 3QSUA 1VQ4T 3CXCP 9ATCB 3X25B 1VQPQ 2C0OA 1X6BA 2GQIA 1YHQT 2EVRA 2KAFA 5GAN5 2RJCA 3MP6A 2HZYA 3TCJA 1PC0A 2CDTA 2RA2A 3ZBDA 2JT4A 1VIEA 2M51A 2AZVA 1M1KC 2CT4A 2IIMA 2WSCE 3RNJA 1Y96B 2YUOA 2YWWA 4ORZA 1XTDA 3LGLA 3EFOB 2DX1A 2XU8A 3EG0A 5GAOn 1UB4A 1NG2A 1YITQ 4QQDA 3C0CA 1P92A 1Z9QA 4F7UG 4AG2C 5DM7R 3GLXA 3CBOA 3CCVT 2W10A 1W4SA 4NL3A 2L89A 4XTUA 1W2BA 5GAOl 3INZA 2DXUA 1GBQA 5LJ3g 2QG9B 2DL7A 3HL8A 1WNLA 3PIPA 3UF4A 4O6JA 1RAAB 2QQRA 4RTVA 4J7IA 1XJWB 2MIOA 3SB2A 2K7AA 4RTYA 2QQAA 2LCSA 2O01E 5CQYA 4II1A 3M54A 1BI0A 1M1KR 1YIJA 2NYSA 2FYKA 2H3JA 4M7DF 2E4HA 2RJEA 1DJ7B 2BE7D 2EIFA 5GAMe 3CCQT 3SWNA 1PD0A 4VUBA 1A0NB 3QXEB 5FU7B 3CC2A 5FU7C 1OULA 5DLOA 3BFMA 4BDYA 5CO7A 3HFOA 2MI6A 4DBQA 1PWTA 4D8DA 3CC2T 3CXCS 2OI3A 1KFZA 1C1AA 1UEBA 3CCLQ 3JV3A 5KYYB 2DZCA 2MWPA 4M7DA 3PT9A 3JCMV 1E7OA 2PZ1A 2MMPA 2K4YA 1Q7YC 3ZL7C 1VYTA 2DXTA 3WXMB 3OA6A 2DYBA 2L8DA 4PL6A 3NPFA 2AKLA 3SHWA 4FYYB 3TREA 2RHUA 2O31A 2LQ8A 1PRMC 2JTFA 2XHCA 5CIUA 3SFMA 1BI2A 2XKOC 3REAB 1NYFA 4C92B 1U1SA 4MZTA 2ATCB 2CZ7B 2HDAA 1RAGB 1GL5A 1UGSB 1AWXA 3JCMd 2LRQA 3MPUB 2ESWA 2O4XB 3G7ZA 5GAOm 2DYIA 2WACA 1WDXA 4J6XA 1WI7A 3KBGA 1WPYA 3VUZA 2GTJA 3FIFA 4P5NA 2RQTA 2EQUA 1JJ2P 1Q7YR 1UE9A 4AMCA 4E47A 5HCKA 1IGQA 1EIFA 3I9QA 1EX4A 2DL8A 2GCXA 1I8FA 1AZGB 3OS2A 1VUBA 1RADB 1RI0A 2HKQB 2KXCA 3JCMW 1M8MA 3CPWS 3MJXA 5M9OA 4ZGDB 2FO0A 2L0AA 5GMKj 3VS2A 2X3WD 1MNEA 1JRIA 1UGQB 4F14A 3CCMQ 4M77G 1KQSP 1ZQ1A 2L3QA 4N0AA 5KYNA 4JLGA 4FSSA 4PJLA 3V7SA 4GLKA 2P0KA 3CCLA 1D0ZA 2HCKA 3P8DA 4XK8E 1AEYA 1KQ1A 5GJVB 3NTKA 2KQWA 2YDLA 4LDYA 1QVGP 1UFFA 2BZXA 1SG5A 1QLYA 3CCLT 3LH0A 3G4SQ 1X27A 3CC4Q 1G3YA 1PM3A 3L1AA 2A37A 2FRWA 3G71A 4JDSA 1D3BA 1EFNA 2OTLA 1Q7YU 1F1BB 4PJOF 3X28B 3M56A 4CI0C 3G71T 2DE0X 2OTLT 4OB2B 2PUOB 3VU3C 2QQ9A 4BE1A 2MOXA 2E10A 5FROA 5LJ5d 4C92A 1BI3A 5DLQE 1HJDA 2FVUA 2JS2A 4M7AG 2O4XA 4PJOA 1AOJA 2D1XA 1JJ2S 2NUTB 1W70A 2DNUA 2P0QA 2JXBA 2HSEB 1YJNQ 4TVRA 5AYFA 4F7UF 4AG1C 3OQ5A 3PIOA 2E65A 5LJ3e 1AZEA 3JB9H 3RKXA 3OYIA 2QEXQ 4FIBA 4KUIA 2RK1A 1SRMA 5I2MA 2PU9B 1KQSS 3OYNA 3E9FA 2XMFA 2K2MA 3EFSA 4PJJA 4F7UA 3GBQA 3MEWA 1VQOQ 1K8AU 2SRCA 2K6DA 1QVGS 2DL3A 3VV0A 3EGDA 2F2WA 4B9XA 2CSIA 1ZX6A 4Z02A 3D7SB 3BW1A 2MPXC 1V29B 1XNIA 2WSFE 3G4SA 4EMGA 1WHLA 1W6XA 4Y91A 1O9SA 3HRTA 3LX7A 4IIMA 5CKEA 5L8RE 3QYHB 3G4ST 2ZPEB 1MNDA 1BB9A 5L23A 4KGVB 4PLIA 4JJBA 3QUIA 3S6WA 4A4KA 5I22A 2KEAA 1H3ZA 1RAIB 1KJWA 3OS5A 1OX9A 1KQ2A 1VQLA 2VVKA 1VYUA 1PSEA 1MMDA 4OMPA 1VQMA 1VQLT 2KY9A 2EKHA 3LYIA 3PFSA 3JB9D 3OMCA 3DLLA 2NUTA 1VQMT 2HQXA 4XQ3A 4XTWA 3RIRA 1OV3A 1Z9ZA 4M78G 3PE0A 1WJRA 1K73R 1IB8A 1WXUA 2P84A 1VQ6Q 2XIDA 2K2VA 4KRTA 4C8QF 3QYGB 2LJ0A 1N9SA 4C5EA 1YJNT 2YT6A 3U23A 3CEYA 3REBB 4JJDA 1TWBA 1QVFP 1B07A 3PGGA 3CCUQ 3GF5A 3C4SA 3JCMh 5D6XA 3EAEA 2K3YA 3HPWA 1U06A 1Y71A 5FW9A 1M3BA 4OMOA 2QTVA 3JB9J 2FRYA 4BI3A 1VQ7Q 2V1RA 2YUPA 4C5HA 1VQOA 2EW3A 1PNJA 2V8IA 2M0YA 2X4XA 2DMOA 3RDVA 4F16A 2RB6A 1VQOT 4A4HA 2O88A 4Z88A 3SEMA 2EYYA 3META 2KT1A 2CT3A 3L2UA 4M77F 1Q86R 3O5ZA 2VV5A 1JQQA 4AFQC 1K73U 1VYVA 5GAMd 4EMKB 4EMKC 4JRKA 5GANg 1AHJB 1OQKA 2LCLA 3I35A 1WQWA 3O8VA 3DLMA 2CUDA 3NHNA 1QP2A 1WHHA 2B8AA 3M4YA 1OU8A 2DEUA 1I5LA 2K3BA 4JS4A 2FZGB 4M77A 1E6GA 4J83A 4LDVA 2EKOA 1WHKA 4EIKA 3CPWA 5ECAA 4FYVB 3BY7A 1ZA1B 3OYBA 1Y07A 3RERA 4FU6A 1AT1B 4R56A 2P0PA 2EQKA 5KYUB 1WYXA 3Q1JA 5KYWB 2DZ9A 4MDXA 5CR2A 2E6ZA 1TG0A 4RCCA 1GFDA 4RMOA 2X3XD 4M7AF 1JXOA 1QVFS 4KH0B 1Q86U 1FMVA 4OMFB 2J05A 3V8JA 1GCQA 1BU1A 2F5TX 1SF9A 4HCBA 2BZ8A 2BE9B 2A0FB 3DB4A 2JW4A 4J9GA 4F04B 2F2VA 3LLRA 3CCUT 4M7AA 3L42A 1XOVA 1YN8A 3JCMb 2KROA 2DL5A 1D0YA 1WHMA 1M2VB 4XTYA 1VQ7T 4J6YA 3JCMQ 2CKKA 2L3RA 1AWJA 3M0PA 3X20B 4A54A 5C6SA 4CC4B 4JJCA 2V1QA 2Y4XA 1YWPA 1RACB 2CP2A 1WQ7A 4J9FA 5FWBA 5KE2A 1WJSA 3CBPA 3TSWA 2JN0A 3QDFA 5GJWB 2A28A 4M75E 3OW2A 1W1FA 3RESA 4DBFA 1YIJQ 1ZSGA 4GBQA 4RTWA 1YI2A 3TQ7P 3MCAB 2EYQA 3EG3A 4JS5A 1YBYA 2JM8A 3CC2Q 3OYCA 1SHGA 3H6ZA 4M4ZA 3FRNA 1M5Q1 4C92G 1I4K1 1IO6A 4RCBA 4C0FA 1T0JA 5IH2A 1I1JA 8AT1B 3VS7A 3FJPA 3M0TA 1HK9A 3GPLA 4M75B 2ABLA 4M75C 4MZPA 2K5LA 4XAXB 1K9AA 3AHUA 2DO3A 2RQWA 4ZGEB 4N4GA 2HKNA 4M78F 2J6FA 2JTEA 3QWXX 4LXCA 2E3HA 2NUPB 4AFSC 1UGVA 5HK3A 2KRNA 3X24B 2DM1A 3M9QA 3UT1A 4EDUA 4QQGA 4HXJA 1YJ9A 2VB6A 2EQMA 4C0ZA 4XU3A 2CS7A 4LDUA 4JLIA 1GCPA 2R58A 3EGXA 1B34A 1SEMA 3G6EA 3J7AF 4DBRA 5FU6B 2DF6A 2RF0A 3UPUA 5FU6C 3H0IA 1YJ9T 2D0NA 4M78A 4PJMA 3G6ET 5LJ3d 1ZBXA 6AT1B 4LDXA 4EMHA 1M3AA 1NLPC 4FT4A 4IURA 5GAOq 4FW1A 3OS1A 1QCOA 1FX7A 4DA4A 2LTOA 3A8OB 2RD1A 2Y4YA 2O2OA 3R6OA 1QW1A 4XTZA 3CBMA 4QQ6A 1MUZA 1TH7A 1X2QA 2JM9A 2EGEA 2LQKA 4WF2A 1U5SA 2DRMA 3JB9I 3HRUA 5GANe 2DILA 2W0ZA 1ZHIA 3WVEB 1WIEA 1YIJT 5CKFA 3CC7A 1D1AA 4IUTA 2DIQA 3NGPA 2EQIA 2LNVA 4DQ2A 1X69A 3CC7T 2YLBA 1B3QA 3V7CA 3EG9A 3OBYA 5GAMh 2MK5A 1I81A 2RM4A 3QPHA 2HBWA 2DERA 1U1TA 2VC8A 1WHJA 3A8MB 3OYDA 1NYGA 5FRMA 1QKWA 2ED1A 2DJQA 3G71Q 4E7LA 2LT1A 2NUPA 1T0HA 4FL6A 2OTLQ 4N4IA 2QDYB 1TU0B 5KYXB 2F5KA 2MWOA 3TSZA 5CQXA 2JZ2A 2DXCA 1Y96A 5LJ5j 3HKSA 3NMZC 2CZ6B 3JAME 3EFOA 2DPPB 3R6NA 1SHFA 2J6KA 4DEYA 1H3HA 4MMKA 1YFNA 4PLLA 1S72A 3E19A 2HSPA 3GNGA 2GFAA 2DD5A 2GTOA 1NPRA 2LNHB 1S72T 4QT7A 2YXYA 4OMLA 4D8KA 2KDSA 4GLMA 4M75D 3JCMJ 3S3OA 3FEOA 3A8GB 3PNWC 2DBKA 4PJOC 1K0XA 2FG0A 4JJNK 1RABB 1K4US 2CZ1B 5CK9A 2ZZDA 4B6MA 2VGNA 3HHTB 2AZSA 2PVDB 1UUEA 2VUBA 2GGRA 1VA7A 1RAEB 2RO0A 2HQEA 1H92A 1K8AC 1PRLC 4M7DD 2F69A 2J6OA 5KCHA 5KYYA 1N27A 3OYGA 3T9NA 5J3BA 1JU5C 5IAYA 2I2LA 1BBZA 3URGA 5CAIA 3MEUA 4CC7A 5CVIA 2RQUA 3UWNA 4C92F 2AT1B 4JZ3A 1MV3A 2BUDA 2LQNA 1NZ9A 1MHNA 4B9WA 2VYTA 4PNOA 2QDLA 1WXBA 2VASA 1FYNA 4PK4A 4BDZA 2RHXA 1PKSA 2LDMA 1ZLMA 1GRIA 1ZA2B 1G5VA 5A2QE 2E3IA 2C0IA 5GAN2 5HK0A 1VQLQ 4K11A 4BB7A 1K8AR 4C0GA 1VQMQ 1HYOA 1YP5A 1ZUYA 1SSHA 4RG8A 1RI9A 4IUVA 4RTTA 4YTLA 2DTIA 5CKBA 2K5IA 2EGCA 1N8RC 2RI2A 4FYWB 1KC8U 3SDZA 3HFNA 3UDCA 3EH1A 4FT2A 1ZUKA 4X9DA 1UHFA 2CP6A 2ZPHB 2KYMA 4BUGA 1PHTA 4QW2A 3JCMP 2LZ6B 1QCNA 1WZOA 1OPLA 2MAMA 3AT1B 3FDRA 2XD0A 1FWZA 4MMLA 2YRDA 3IQLA 2NWMA 1W2BP 1K76A 4J9DA 2KSSA 3L2WA 5LJ3h 5FLXE 4C8QE 5LL6S 3S3NA 4R55A 1Q95G 4C0DB 2QGGA 2VGMA 4IUPA 4C0DC 3CD6A 2GF7A 1N8RR 3OYLA 2QQBA 2ZPIB 3GNFB 2AK5A 5IN1A 4OP0A 2E12A 3JCMf 5GAN4 3NTIA 1BIAA 2O9VA 1T3LA 1AD5A 2HD0A 2PNIA 4RTUA 1K73C 5GAMj 5A0DA 4KUDK 3GP8A 2ZGWA 4C8QB 1D0XA 4C8QC 1LPLA 2KK4A 1BCOA 3PMIA 3OB9A 1YJWA 3QBYA 1H8KA 4ME7A 1GXIE 1TSFA 1ABOA 1YJWT 4PJOD 1VOMA 3GIBA 3VYGA 1LOJA 1D1CA 2CP7A 2HQHA 1EZZB 1X6GA 3F70A 2X51A 1UJ0A 2Z0WA 1X43A 2M9UA 4KGZB 3OYYA 2DRKA 1Y57A 2BIVA 2LX9A 2KR3A 1K1ZA 4FYXB 2AKKA 4HVUA 1N8RU 1VQ8A 1T3SA 2HL5C 3CXCA 3VS1A 1K9MC 2L3PA 2CH4A 5IHIA 3H9NA 4WCIA 2FEIA 1Q86C 3BDUA 1MMAA 3EHRA 1VQNA 2RI3A 4A53A 2OJ2A 2RJFA 3VYHB 4V2SA 1JB0E 1VQNT 1QQJA 2DBMA 5J26A 3LWHA 4JRPA 3H8ZA 2G3RA 1M30A 4HA8A 2L2PA 3C95A 3L2RA 4JZ4A 3L2ZA 5EC7A 3M0UA 5KH6A 2E5KA 1G83A 2D0QB 2IVWA 2YUQA 4Y92A 1N5ZA 3QJ6A 2K57A 2LP5A 2BZYA 4LUDA 2HAXA 2EBPA 2E6NA 3A98A 1K9MR 4A63B 2V8JA 5IT9E 1QWEA 3QKJA 5GANd 4M75G 1CKAA 2CSQA 3CCJA 4Y28E 3J81E 2GBQA 4OMQA 2JOYA 4J9EA 3CCJT 1WHGA 1OZ3A 4PKCC 2K3XA 3MEAA 1IHVA 1C6VX 4DEXA 1U8RA 2LJ3A 4E7ZA 3NFCA 4JRQA 1WX6A 2CP5A 3LW5E 2QI2A 4QKUA 2DKGA 1U3OA 3CCSA 1N6AA 1YI2Q 2X4JA 2OAUA 4HVWA 1SPKA 2QTXA 4CC3A 2MYSA 3CCST 1IRXA 2R57A 2DL4A 1YNZA 1G8XA 3LWIA 4XTVA 4ZTFA 5GAN3 5GAN6 1VQKA 2KXDA 5C0MA 2L5QA 1K9MU 2BTTA 2ECZA 4RTZA 3CMEA 1VQKT 2CP3A 2EWNA 1M1GA 3M57A 3VRZA 3CMET 2E64A 5LJ5h 2DIGA 5KE3A 2PQWA 1UTIA 3OYEA 3A8HB 4C8QD 2ED0A 1LNXA 1ZSZB 1J3TA 1ZSZC 3MKDA 2GQVA 4BI8B 1D09B 1YJ9Q 2Y90A 4E7KA 1YWOA 4J9BA 3OYJA 2CH4W 3G6EQ 5J39A 2RHYA 2COWA 3OYFA 2QGFB 5LJ3j 2VXEA 4O5VA 3E2UA 4XTXA 1JJ2A 2FPEA 4EMKA 3DKMA 2PTKA 3TVTA 1OI1A 4LD9K 3M0RA 1NE8A 3I55A 3LGFA 2XDDA 4ZN1A 2DK3A 2RNAA 1HD3A 4E7HA 3I55T 4NOYA 5GMKe 4XU0A 3TEEA 4BE2A 2GNCA 1KQSA 2RK2A 4FW2A 1KHIA 1M90R 1OYXA 3RR6A 3CC7Q 2DVEA 1YI2T 3M58A 2OTJA 3VKIA 4X34A 5KYUA 1LJOA 4X1VA 2FZKB 5KYWA 3C12A 3CCEA 2KT8A 2OAWA 2V8KA 4J5YA 5D6WA 2OTJT 4BD3A 1QVGA 2C0TA 2EJ9A 3E1SA 4M7DE 3CCET 2VXFA 4CC2A 3SWNB 1JEGA 1K0SA 3SWNC 3RBBB 2JTMA 2LC4A 1SRLA 1WA7A 2L3SA 4OB1B 1PKTA 1VIFA 1MV0B 3VS6A 3EGUA 4M7AD 2YLCA 3M0QA 3I56A 4BACA 4AFZC 1BIBA 2JNGA 1YHQA 2M02A 5I21A 2K5FA 3EHQA 4M7DB 4M7DC 3CCRQ 3JCMc 3I56T 3JB9G 4ZN3A 1M2VA 1N9RA 4C5GA 1UJYA 2VKNA 4ESRA 1NJIR 1M90U 2EYZA 1SKUB 4AFUC 4AT1B 1S72Q 2RQRA 3VJPA 5I2SA 4OF1A 1I07A 3OS0A 3QO3A 2D9TA 1ARKA 2ROLA 2YRVA 1Q82C 4JPBW 4NS5A 2DA9A 2FL7A 4L59A 3CCVA 2FZCB 3A8LB 2DTHA 2KI7A 4IIOA 1BK2A 2KYBA 4DOVA 2XDPA 1TXQA 3QDRB 1S1NA 3RKYA 1XQHA 4JUVA 4MDWA 3RMSA 4M75F 2A36A 1KIKA 2ZAEA 3NTHA 3UA6A 2QQSA 4IUQA 4HCKA 4IUUA 1OX8A 2DEQA 4C5IA 3MO8A 2AHJB 4OGCA 2E70A 3RUXA 2QYZA 2QA4A 3ME9A 3KUFA 5GANh 3CCQA 2ROTA 1HXDA 1PG5B 1NJIU 1V76A 4M75A 4OMNA 2QA4T 5D7UA 2E5QA 1Q82R 3CMAA 4FM4B 2DD4A 2IPOB 3PVQA 2CZ0B 4LUEA 4FCYA 1C0MA 4GY5A 1UHCA 5HKCA 4KBMB 1X75C 3CPWP 3CMAT 1CKBA 4N0AC 3MEVA 3MHXA 1I5OB 3X26B 2XG8D 2KGTA 2QAZA 1WXTA 2P4RA 1ACMB 3BDLA 4M78D 3CCRA 1VQPA 4C92E 2DVJA 3TU4K 4ANJA 3OYMA 3CCRT 1VQPT 4L6V5 4BI4A 1D3BB 3JSCA 4PJOE 4RTXA 4BY6B 1TUDA 4BY6C 2E41A 5GMKl 1RAFB 1KC8C 2RHZA 1QP3A 5GAN7 2RHIA 1E6HA 2G6FX 2CREA 2LCCA 1M1KU 3M59A 5EG2A 3OSVA 4KT0E 4C92C 1Q82U 5DY9A 2RPNA 1YITA 1IXDA 1TUGB 4C8QG 1QVFA 3QJYA 4PJOB 1M2OA 4KGXB 3JCMg 1YITT 1UGRB 2YSQA 2LJ1A 1M27C 2DFUA 3H41A 4DBHA 2DLPA 2X4WA 4MZMA 1M1FA 4HT8A 2K9GA 4L5GA 4ZNXA 4F7UE 4OGEA 2KNBB 4ELZC 4RKUE 1JO8A 1FMKA 5CCAA 4PFOA 2DXBA 1NM7A 1TTHB 1KC8R 3CD6Q 4LN2A 1ZBJA
chains in the Genus database with same CATH topology
4HCZA 4QQDA 1YJWT 1Q86U 4PJOD 1P92A 4F7UG 3GIBA 3CPFA 4OMFB 3VYGA 5DM7R 1LOJA 3GLXA 3CBOA 3CCVT 2D6FA 3V8JA 3F70A 1W4SA 4NL3A 2L89A 4XTUA 1W2BA 2F5TX 2M9UA 5GAOl 5LJ3f 3INZA 2DXUA 5LJ3g 3OYYA 4HCBA 3HL8A 4OB3B 1WNLA 4Q5WA 5KCOA 3QZ9B 3PIPA 4F7UB 3DB4A 4O6JA 2BIVA 2LX9A 3OSSC 3JCMX 2QQRA 5GMKi 4J7IA 3LLRA 3CCUT 1N8RU 1VQ8A 3CXCA 3L42A 1OZ2A 1XOVA 3SB2A 1K9MC 4M7AA 1BKBA 2QXFA 2QQAA 4OB0B 2NLUA 2O01E 3JCMb 5CQYA 4II1A 3M5AA 4XTYA 1Q86C 3BDUA 1VQ7T 4J6YA 4J8OA 3JCMQ 1O75A 1G3TA 2CKKA 1BI0A 3M54A 1VQNA 1YIJA 2L3RA 2RI3A 2ZPFB 2FYKA 2H3JA 4M7DF 3ZFJA 2EJGA 2RJEA 3X20B 1DJ7B 2EIFA 4A54A 4A53A 5GAMe 5C6SA 3SWNA 2RJFA 4D6WA 4VUBA 3VYHB 4XU1A 3CCQT 4V2SA 1JB0E 1BYMA 3QXEB 4N4HA 5FU7B 2C06A 1VQNT 3CC2A 5J26A 5FU7C 5DLOA 3LWHA 3BFMA 4JRPA 4BDYA 3H8ZA 5CO7A 3HFOA 2IG0A 5GMKm 2MI6A 2G3RA 4HA8A 1G3WA 2Y4XA 3MP8A 3CC2T 3CXCS 3C95A 1IZ6A 3L2RA 2XDBA 3L2ZA 1WQ7A 5KE2A 4RG2A 1UEBA 5KH6A 3JB9F 1M9SA 1WJSA 3CBPA 3FLGA 2JN0A 3ER0A 2D0QB 2IVWA 2DZCA 4QVDA 1Q81C 2MWPA 4M7DA 4E7JA 2HBPA 3PT9A 3N5BB 2M16A 3JCMV 3QJ6A 5LJ5g 4M75E 3OW2A 2K57A 2M0OA 3RESA 5A0LA 2MMPA 1YI2A 2HAXA 4J7FA 2E6NA 2K4YA 1Q7YC 3MCAB 2EYQA 4JS5A 2DXTA 3WXMB 3OA6A 1YBYA 2V8JA 2L8DA 5IT9E 3OYCA 4PL6A 3QKJA 5GANd 3H6ZA 4M75G 3M53A 3FRNA 1M5Q1 4C92G 3CCJA 1I4K1 4Y28E 4X9CA 4RCBA 3TREA 4C0FA 3J81E 1R8OB 2RHUA 5D6YA 1UGPB 2LQ8A 2JOYA 4QVZA 2JTFA 2XHCA 5CIUA 5A0GA 3CCJT 2M1HA 3SFMA 3FB9A 3FJPA 1BI2A 1HK9A 2DJZA 1OZ3A 3GPLA 2XKOC 4M75B 3QHSA 4PKCC 4C92B 2K3XA 2LT4A 3MEAA 4M75C 2K5LA 1U1SA 4MZPA 3OW2S 4MZTA 4XAXB 1U8RA 2CZ7B 3NFCA 3S3MA 3AHUA 1UGSB 2DO3A 4ZGEB 2EJFA 3JCMd 4N4GA 2LRQA 4JRQA 5FRNA 3WVDB 3L2QA 3LW5E 2QI2A 3CCSA 2DKGA 2O4XB 1N6AA 2X4JA 1IREB 3CD6T 3G7ZA 3HP9A 2OAUA 2WACA 4M78F 5GAOm 5GANj 4J6XA 2QTXA 5HK3A 3X24B 3KBGA 3CCMA 1WPYA 3CCST 2GFUA 3M9QA 2R57A 3UT1A 3VUZA 2X4YA 3FIFA 4P5NA 2JUFA 2EQUA 3OMGA 3LWIA 2EAYA 4EDUA 4XTVA 2DTOA 4ZTFA 4QQGA 5GAN3 3CCMT 5GAN6 1YJ9A 1VQKA 4C0ZA 2EQMA 4XU3A 4C92D 4E47A 5C0MA 2CS7A 4HKEA 4LDUA 2XI9A 4JLIA 2L5QA 3HSBA 1EIFA 1K9MU 2R58A 2GCXA 1B34A 3G6EA 3CMEA 1I8FA 1KD1C 5FU6B 3J7AF 3UPUA 1FXXA 3QIIA 5FU6C 1VUBA 3OS2A 1YJ9T 1VQKT 1RI0A 1Y7XA 2EWNA 2HNIA 4M77E 4M78A 1M1GA 3M57A 3JCMW 3CC4A 3CPWS 1BI1A 3G6ET 3JRZA 3CMET 5LJ3d 1ZBXA 4LDXA 2E64A 4EMHA 2JVVA 5M9OA 4FT4A 4IURA 3A5ZB 4ZGDB 5GAOq 5LJ5h 3OS1A 2DIGA 5GMKj 3CC4T 1FX7A 1UGQB 1JRIA 5KE3A 2PQWA 4DA4A 4M77G 3OYEA 1ZQ1A 3A8HB 2LTOA 4C8QD 2XK0A 3A8OB 4N0AA 2RD1A 1LNXA 2Y4YA 3R6OA 2GQVA 4XU2A 4JLGA 3V7SA 4GLKA 1QW1A 3PMTA 4UC4A 4XTZA 3CBMA 4QQ6A 2P0KA 4BI8B 3CPWA 2Y90A 4E7KA 3CCLA 3P8DA 2EFIA 1TH7A 3EFRA 4XK8E 1KQ1A 4M77B 3NTKA 3OYJA 4M77C 2CYZB 2KQWA 2LQKA 4LDYA 5J39A 4WF2A 1Q81U 2RHYA 2FHDA 3JB9I 3HRUA 5GANe 3OYFA 3CCLT 1VQ8T 3LH0A 4E7IA 5LJ3j 5GAOr 2RH2A 2DAQA 4IKFA 2VXEA 1G3YA 4O5VA 5CKHA 1ZHIA 3L1AA 3WVEB 3G71A 4XTXA 1W2BS 2R5MA 4JDSA 3ZEHA 1D3BA 4LDWA 2OTLA 1Q7YU 4ZTJA 1YIJT 5CKFA 4PJOF 1JJ2A 3X28B 4JRIA 3CC7A 2A3LA 2CGHA 3M56A 4CI0C 4IUTA 2DIQA 4EMKA 3DKMA 3E9GA 3G71T 2LNVA 4NL2A 1VQ9A 2OTLT 4OB2B 4DQ2A 3VUBA 1YJNA 2WSEE 1OI1A 2PUOB 3VU3C 2QQ9A 4BE1A 3JCMe 2E10A 3CC7T 2YLBA 4LD9K 3V7CA 4M7AE 1NE8A 1MGQA 3OBYA 5FROA 5GAMh 5LJ5d 3I55A 4C92A 3OYHA 1BI3A 1VQ9T 3LGFA 5DLQE 2XDDA 1I81A 2QEXA 4ZN1A 2FVUA 2DK3A 2RM4A 3FC3A 3QPHA 5LJ5f 3ASKA 2A7YA 4E7HA 3I55T 4NOYA 4M7AG 5GMKe 1U1TA 2O4XA 4XU0A 3TEEA 4PJOA 2VC8A 3A8MB 3OYDA 2QEXT 5FRMA 4BE2A 2X35A 1KQSA 2RK2A 1JJ2S 4HCCA 4E7LA 2LT1A 1KHIA 4FL6A 1OYXA 2BKDN 2QDYB 1KHCA 4N4IA 2P0QA 4BE0A 2DVEA 1YI2T 3M58A 2OTJA 2FB7A 3VKIA 2KMTA 2F5KA 4X34A 4M7AB 4C8QA 1LJOA 2MWOA 4M7AC 3CCEA 3C12A 3RMQA 1X01A 2V8KA 4J5YA 5CQXA 2JZ2A 2DXCA 1Y96A 3HRSA 4TVRA 5D6WA 5AYFA 5LJ5j 3HKSA 4F7UF 2OTJT 4BD3A 2P4TA 4LD6A 1QVGA 2CZ6B 4A4FA 2EJ9A 3OQ5A 3E1SA 3JAME 3PIOA 2E65A 5LJ3e 4M7DE 3CCET 2DPPB 2VXFA 3RKXA 3JB9H 3OYIA 2EQJA 4FIBA 3P8HA 4KUIA 3GOXA 3SWNB 3DB3A 2RK1A 3M4GA 5I2MA 3SWNC 2PU9B 1KD1U 4MMKA 1KQSS 4A4EA 3OYNA 2JTMA 2LC4A 3E9FA 1VQ5A 4ZGJB 4PLLA 4M7DG 1S72A 3KXTA 3E19A 4OB1B 3GNGA 3EFSA 2GFAA 1VIFA 2DD5A 3C94A 4M7AD 5GAN8 1NPRA 1VQ5T 2YLCA 2LVMA 4F7UA 3I56A 1S72T 4BACA 5GAMg 3MEWA 1BIBA 2JNGA 1YHQA 1H641 2RJDA 5I21A 2K5FA 1K8AU 1QVGS 4M7DB 3VV0A 2KDSA 4M7DC 4B9XA 2PUKB 3JCMc 4M75D 4Z02A 3I56T 1JBMA 3JCMJ 3QG1A 3S3OA 3BW1A 3MP1A 1M4ZA 3FEOA 3JB9G 3A8GB 4ZN3A 3PNWC 1V29B 1N9RA 4PJOC 1WJQA 4C5GA 1XNIA 2WSFE 4JJNK 4EPCA 1M8VA 2CZ1B 1M90U 2KVQG 2PVGB 3G4SA 4EMGA 5CK9A 2XICA 2ZZDA 2VGNA 3HHTB 3M55A 4Y91A 4KULA 1O9SA 2PVDB 3VJPA 5I2SA 4QVCA 3HRTA 3LX7A 5CKEA 5L8RE 2VUBA 3QYHB 3G4ST 2ZPEB 4OF1A 3OS0A 2RO0A 5LJ5e 2HQEA 3QO3A 2D9TA 1K8AC 4PLIA 2YRVA 1Q82C 3QUIA 4M7DD 2F69A 4NS5A 3S6WA 2FL7A 4A4KA 1H3ZA 4L59A 3CCVA 3A8LB 5KCHA 2DTHA 2YHTA 3OS5A 1N27A 3V7RA 1VQ6A 1KQ2A 3V8KA 1VQLA 4HT9A 3OYGA 4DOVA 2XDPA 3T9NA 3OY9A 5GAOp 1PSEA 5J3BA 5IAYA 2I2LA 3QDRB 3RKYA 3URGA 1XQHA 3MEUA 5CAIA 5CVIA 1M90C 1VQ6T 4JUVA 4M78E 4A4GA 4MDWA 1VQMA 3RMSA 4M75F 1VQLT 2R5AA 3UWNA 4C92F 2KY9A 3NTHA 2QQSA 3CCUA 3LYIA 3PFSA 4IUQA 3JB9D 3OMCA 2BUDA 1NZ9A 1MHNA 4IUUA 3DLLA 4B9WA 2VYTA 4PNOA 1VQMT 2HQXA 2DEQA 4XQ3A 4XTWA 3RIRA 1WGSA 2E1HA 4C5IA 4M78G 1VQ7A 3MO8A 1PSFA 1WJRA 2AHJB 5HY6A 4BDZA 4OGCA 2E70A 2RHXA 3RUXA 2LDMA 2QA4A 3ME9A 3KUFA 1G5VA 5GANh 5A2QE 3CCQA 3J80E 1B34B 1HXDA 4CRIA 5GAN2 2ZCFB 2XIDA 2K2VA 1NJIU 4C8QF 4M77D 5HK0A 3QYGB 4M75A 4M78B 2QA4T 1N9SA 2ZPGB 4M78C 4FSXA 4C5EA 4BB7A 1YJNT 2E5QA 3CMAA 4FM4B 2DD4A 4C0GA 3CEYA 2CZ0B 2MF2A 4GY5A 4RG8A 3PGGA 5HKCA 4KBMB 1X75C 3OYAA 4IUVA 3CMAT 4YTLA 2DTIA 5CKBA 3GF5A 3C4SA 3RKWA 3JCMh 5D6XA 3EAEA 2K3YA 2K5IA 1QVPA 3HPWA 1Y71A 4N0AC 4DOWA 2RI2A 3MEVA 5CKDA 3JB9J 1N8RC 1KC8U 3MHXA 4BI3A 1KG1A 3SDZA 3HFNA 3X26B 4J6WA 3UDCA 4C5HA 3L2VA 2XG8D 1NPPA 1VQOA 2V8IA 4FT2A 4ATOA 2PVOB 3BDLA 4X9DA 1NJIC 2X4XA 4M78D 5GMKh 3CCRA 1YCYA 1VQPA 2ZPHB 2RB6A 4C92E 1VQOT 1G3SA 4BUGA 4A4HA 3OYKA 4QW2A 3META 3TU4K 3JCMP 2ZPBB 3OYMA 1X6OA 3CCRT 3L2UA 1SSFA 1VQPT 3P8BB 4L6V5 4M77F 4BI4A 1D3BB 3PTAA 3JSCA 4PJOE 3SD4A 2MAMA 2VV5A 4OVAA 3FDRA 4BY6B 2XD0A 3QZ5B 1FWZA 4BY6C 2E41A 4MMLA 1K73U 5GMKl 5GAMd 4EMKB 1KC8C 2RHZA 1QP3A 3OBWA 4EMKC 5GANf 4JRKA 3V8LA 5GANg 5GAN7 2KSSA 1VQ4A 1AHJB 2LCLA 2RHIA 2RI5A 3L2WA 1WQWA 3O8VA 5LJ3h 4ELYC 5FLXE 2LCCA 3DLMA 4PJOG 4C8QE 3M59A 1M1KU 5GAMf 5LL6S 5EG2A 1QP2A 2B8AA 1RL2A 3S3NA 3M4YA 3OSVA 4KT0E 4C92C 4R55A 1VQ4T 1Q82U 3QSUA 4C0DB 1I5LA 2VGMA 5DY9A 4IUPA 4C0DC 3CD6A 3X25B 2GF7A 4JS4A 1YITA 3OYLA 2QQBA 2ZPIB 4M77A 4C8QG 1YHQT 1QVFA 4J83A 3GNFB 4LDVA 3QJYA 2EKOA 4PJOB 2KAFA 4OP0A 2E12A 5IN1A 3JCMf 5GAN5 3NTIA 2RJCA 1BIAA 3JCMg 3MP6A 5GAN4 1YITT 1UGRB 3BY7A 2HD0A 3TCJA 1K73C 5GAMj 1Y07A 3OYBA 3RERA 4FU6A 2RA2A 3ZBDA 5A0DA 4R56A 2P0PA 2EQKA 4KUDK 3GP8A 2ZGWA 4C8QB 2X4WA 1VIEA 4MZMA 4C8QC 1M1FA 3Q1JA 4HT8A 2DZ9A 4L5GA 1M1KC 4MDXA 2WSCE 2KK4A 3PMIA 1Y96B 4OGEA 2E6ZA 3OB9A 4RCCA 4F7UE 5CR2A 1YJWA 3QBYA 4ELZC 4RKUE 1XTDA 3LGLA 4ME7A 5CCAA 4RMOA 1GXIE 2XU8A 2DXBA 5GAOn 4M7AF 1UB4A 1QVFS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVE A;  4PJO D;  4F7U G;  5GAN h;  4M78 F;  2FB7 A;  5GAO m;  5GAN j;  3GIB A;  1B34 B;  1HXD A;  1LOJ A;  4J6X A;  4M7A B;  4C8Q A;  5GAN 2;  1LJO A;  4M7A C;  2QTX A;  4C8Q F;  4M77 D;  3V8J A;  1WPY A;  1X01 A;  4J5Y A;  4M78 B;  4M75 A;  1N9S A;  1Y96 A;  4M78 C;  5LJ5 j;  4XTU A;  4NL3 A;  3FIF A;  4F7U F;  5GAO l;  5LJ3 f;  3INZ A;  2DXU A;  2EAY A;  2EJ9 A;  5LJ3 g;  2E65 A;  2DTO A;  4XTV A;  5LJ3 e;  4M7D E;  1WNL A;  2VXF A;  5GAN 3;  3RKX A;  3JB9 H;  5GAN 6;  5GAN 4;  4F7U B;  4XU3 A;  3PGG A;  4C92 D;  3JCM X;  5GMK i;  4JLI A;  3SWN B;  3HSB A;  3M4G A;  3SWN C;  2DTI A;  1B34 A;  4MMK A;  3RKW A;  1I8F A;  3JCM h;  4M7A A;  3SB2 A;  4N0A C;  4HT9 A;  3JB9 J;  2EWN A;  2HNI A;  4M7D G;  4M77 E;  4M78 A;  3JCM W;  3HFN A;  3JCM b;  4J6W A;  4XTY A;  3BDU A;  3EFS A;  4J6Y A;  5LJ3 d;  3JCM Q;  2E64 A;  4EMH A;  4M7A D;  5GAN 8;  2YLC A;  2FYK A;  4F7U A;  4M7D F;  4X9D A;  5GAO q;  5LJ5 h;  5GAM g;  2EJG A;  1BIB A;  4M78 D;  4A54 A;  5GAM e;  1YCY A;  4A53 A;  5GMK h;  5GMK j;  1JRI A;  1H64 1;  2RB6 A;  3SWN A;  4C92 E;  4M77 G;  4XU1 A;  5I21 A;  4V2S A;  4C8Q D;  4M7D B;  4N0A A;  2RD1 A;  4M7D C;  1LNX A;  3BFM A;  3JCM P;  3JCM c;  4M75 D;  4XU2 A;  5GMK m;  1JBM A;  3HFO A;  3JCM J;  3BW1 A;  3V7S A;  3JB9 G;  4M77 F;  4HA8 A;  1D3B B;  4XTZ A;  4PJO E;  1N9R A;  2Y90 A;  4PJO C;  1TH7 A;  3EFR A;  1M8V A;  1KQ1 A;  2E41 A;  3L2Z A;  1WQ7 A;  4M77 B;  4MML A;  4M77 C;  5GMK l;  4EMG A;  4EMK B;  5GAM d;  3JB9 F;  4EMK C;  4WF2 A;  5GAN f;  5GAN 7;  4JRK A;  3V8L A;  5GAN g;  3JB9 I;  2JN0 A;  5GAN e;  4Y91 A;  4QVD A;  2DZC A;  1WQW A;  5LJ3 h;  5LJ3 j;  4M7D A;  5GAO r;  4C8Q E;  4PJO G;  4QVC A;  5GAM f;  2VXE A;  3L1A A;  3JCM V;  5LJ5 g;  4M75 E;  2K57 A;  5LJ5 e;  3RES A;  4C92 C;  3QO3 A;  4XTX A;  3QSU A;  1D3B A;  1I5L A;  5DY9 A;  3QUI A;  4PJO F;  4M7D D;  4JRI A;  2CGH A;  4M77 A;  2DXT A;  4C8Q G;  4EMK A;  2DTH A;  2YHT A;  3V7R A;  4PJO B;  1KQ2 A;  4NL2 A;  5GAN d;  3V8K A;  4DQ2 A;  4M75 G;  4OP0 A;  3JCM f;  1M5Q 1;  4C92 G;  5GAN 5;  1I4K 1;  1BIA A;  4X9C A;  4RCB A;  3JCM g;  3VU3 C;  3JCM e;  2E10 A;  5GAO p;  2YLB A;  3BY7 A;  3V7C A;  2I2L A;  4M7A E;  1MGQ A;  3RKY A;  5CAI A;  5GAM h;  5LJ5 d;  5GAM j;  4JUV A;  4M78 E;  4C92 A;  3RER A;  2RA2 A;  4M75 F;  4C92 F;  1I81 A;  2ZGW A;  4C8Q B;  2RM4 A;  3FB9 A;  3FJP A;  4C8Q C;  4HT8 A;  1HK9 A;  2DJZ A;  2DZ9 A;  3JB9 D;  5LJ5 f;  4M75 B;  3QHS A;  4C92 B;  4NOY A;  1Y96 B;  4M75 C;  4RCC A;  4PNO A;  4F7U E;  1U1S A;  5GMK e;  4M7A G;  1U1T A;  4XU0 A;  4PJO A;  2DEQ A;  4XQ3 A;  2VC8 A;  4XTW A;  3RIR A;  2E1H A;  4M78 G;  3AHU A;  3JCM d;  2EJF A;  5GAO n;  4M7A F;  3RUX A;  2DKG A; 
#chains in the Genus database with same CATH topology
 1NEB A;  1OOT A;  4HCZ A;  3CPF A;  2EGA A;  2D6F A;  3OW2 P;  1AVZ C;  4PFP A;  5LJ3 f;  4OB3 B;  4Q5W A;  5KCO A;  3QZ9 B;  3VRY A;  4F7U B;  3OSS C;  4RUG A;  3JCM X;  5GMK i;  1UDL A;  5KYX A;  2KRS A;  3EGD B;  1OZ2 A;  1BKB A;  2QXF A;  1YJW Q;  4OB0 B;  2NLU A;  3M5A A;  1GFC A;  1QWF A;  4J8O A;  1O75 A;  1G3T A;  2ZPF B;  3ZFJ A;  2EJG A;  4LNP A;  4D6W A;  1BYM A;  4XU1 A;  4N4H A;  1AWW A;  2C06 A;  3FJ5 A;  4E6R A;  5GMK m;  2IG0 A;  4E2F B;  3G1J A;  1UEC A;  1G3W A;  2KE9 A;  3MP8 A;  4KH1 B;  1IHW A;  1CSK A;  1IZ6 A;  2H8H A;  2XDB A;  2EYX A;  1NEG A;  1VQ8 Q;  4RG2 A;  3JB9 F;  1M9S A;  2COZ A;  3FLG A;  4E7S A;  4QVD A;  3ER0 A;  3THK A;  4PFZ A;  1Q81 C;  2AIR B;  3PVL A;  3VS5 A;  2K79 A;  2HBP A;  4E7J A;  3N5B B;  2M16 A;  4J9I A;  5LJ5 g;  1VQN Q;  2M0O A;  5A0L A;  2RMO A;  4J7F A;  2JMC A;  1R0B G;  2DET A;  1KK7 A;  3M53 A;  4X9C A;  1R8O B;  5D6Y A;  1FMW A;  1UGP B;  1VQ9 Q;  4QVZ A;  8ATC B;  5A0G A;  1IGU A;  2M1H A;  3FB9 A;  4HVV A;  2DJZ A;  3QHS A;  2LT4 A;  3OW2 S;  5I11 A;  5IXF A;  1ZUU A;  3S3M A;  2J7I A;  2EJF A;  5FRN A;  3WVD B;  3L2Q A;  5IXB A;  1IRE B;  3EG1 A;  3CD6 T;  1Q81 R;  5GAN j;  3HP9 A;  1QKX A;  3CCM A;  3CCJ Q;  2GFU A;  2V26 A;  2X4Y A;  4PJN A;  1LVK A;  2JUF A;  2LQW A;  3OMG A;  3LH5 A;  2EAY A;  2DTO A;  2D8H A;  3CCM T;  2EPD A;  3VS3 A;  4C92 D;  5IHK A;  4HKE A;  2XI9 A;  3HSB A;  3I5S A;  1KD1 C;  1JXM A;  1FXX A;  2NUZ A;  3QII A;  1Y7X A;  2HNI A;  2O9S A;  4M77 E;  3BE3 A;  2VWF A;  4Z89 A;  3CC4 A;  1BI1 A;  3UA7 A;  1VQ5 Q;  3JRZ A;  3CCS Q;  3HTR A;  2JVV A;  3A5Z B;  3CC4 T;  4LE9 A;  2XK0 A;  5AT1 B;  4XU2 A;  2B86 A;  2FPD A;  1QMC A;  1RLP C;  3PMT A;  4UC4 A;  1VQK Q;  1UG1 A;  1I0C A;  3VS0 A;  2EFI A;  3EFR A;  4M77 B;  3CQT A;  3I5R A;  4M77 C;  2CYZ B;  3CME Q;  1Q81 U;  2FHD A;  1VQ8 T;  4E7I A;  1MMG A;  2RH2 A;  5GAO r;  2DAQ A;  2RQV A;  4IKF A;  5IHN A;  5CKH A;  5FWC A;  1RLQ C;  1W2B S;  2R5M A;  3ZEH A;  4LDW A;  1KD1 R;  2LX7 A;  4ZTJ A;  4J9C A;  4R0K A;  1X2K A;  4JRI A;  2A3L A;  2CGH A;  3H0F A;  2JJ9 A;  3KFV A;  3A1P A;  1WLP B;  3E9G A;  1KSW A;  2CUB A;  4NL2 A;  1VQ9 A;  2QK0 A;  3VUB A;  1YJN A;  2WSE E;  3JCM e;  4Z8A A;  4M7A E;  1M3C A;  1R77 A;  2COY A;  1MGQ A;  2F1L A;  3OYH A;  2JMA A;  1VQ9 T;  1OEB A;  2X9H A;  2QEX A;  2YRC A;  1BCM A;  3FC3 A;  1TUC A;  5LJ5 f;  3ASK A;  2A7Y A;  1GCQ C;  3M0S A;  2QEX T;  2X35 A;  2YUN A;  4HCC A;  1KHC A;  2BKD N;  1GBR A;  4BE0 A;  1OU9 A;  3ULR B;  2FB7 A;  2KMT A;  4M7A B;  4C8Q A;  4M7A C;  3RMQ A;  1X01 A;  3HRS A;  2P4T A;  4LD6 A;  1QCF A;  4A4F A;  1PD1 A;  3I55 Q;  2EQJ A;  3P8H A;  3GOX A;  3DB3 A;  3M4G A;  1KD1 U;  4A4E A;  1VQ5 A;  1Y0M A;  4ZGJ B;  4M7D G;  3KXT A;  4WTO B;  1ABQ A;  3C94 A;  5GAN 8;  1VQ5 T;  3UAT A;  2OTJ Q;  2LVM A;  1WFW A;  1RAH B;  3EH2 A;  5GAM g;  2J06 A;  2KBT A;  1H64 1;  2RJD A;  3CCE Q;  2ENM A;  1R0C B;  1OPK A;  3VS4 A;  2PUK B;  1PCX A;  1JBM A;  3QG1 A;  3MP1 A;  1M4Z A;  1MMN A;  2QAS A;  1WJQ A;  4EPC A;  1M8V A;  2KVQ G;  2PVG B;  1D1B A;  2XIC A;  3M55 A;  4KUL A;  2HEQ A;  4QVC A;  2F2X A;  1VQ4 Q;  2LMJ A;  5LJ5 e;  3I56 Q;  1YHQ Q;  2A08 A;  2YHT A;  1VQ6 A;  3V7R A;  4OMM A;  3V8K A;  1RUW A;  1TS9 A;  3OY9 A;  5GAO p;  2H3E B;  2MCN A;  1NBE B;  1V1C A;  1M90 C;  1VQ6 T;  4M78 E;  4A4G A;  2EYW A;  2R5A A;  3CCU A;  1TOV A;  2HL3 A;  2SEM A;  1WGS A;  2E1H A;  1VQ7 A;  1PSF A;  5HY6 A;  3J80 E;  3EGX B;  1B34 B;  3CCV Q;  4CRI A;  2ZCF B;  4M77 D;  4M78 B;  2ZPG B;  4M78 C;  4FSX A;  7AT1 B;  3QWY A;  2MF2 A;  2RN8 A;  2JS0 A;  3OYA A;  4F17 A;  3H0H A;  3RKW A;  4DOW A;  4HT9 A;  1QVP A;  2FPF A;  1YCS B;  5CKD A;  1KG1 A;  1HSQ A;  4J6W A;  2OX7 A;  3L2V A;  1NPP A;  2QA4 Q;  2I0N A;  3CCQ Q;  4ATO A;  2PVO B;  1NJI C;  5GMK h;  1YCY A;  2CP0 A;  1G3S A;  2D8J A;  3OYK A;  2HMA A;  2ZPB B;  3CMA Q;  1X6O A;  3EG2 A;  4J9H A;  1SSF A;  3P8B B;  3PTA A;  3SD4 A;  2KRM A;  4OVA A;  3QZ5 B;  1AWO A;  1NLO C;  3OBW A;  5GAN f;  3V8L A;  1VQ4 A;  1LCK A;  1G2B A;  2RI5 A;  4ELY C;  4PJO G;  1ZSZ A;  3EG9 B;  5GAM f;  1B7T A;  1RL2 A;  3QSU A;  1VQ4 T;  3CXC P;  9ATC B;  3X25 B;  1VQP Q;  2C0O A;  1X6B A;  2GQI A;  1YHQ T;  2EVR A;  2KAF A;  5GAN 5;  2RJC A;  3MP6 A;  2HZY A;  3TCJ A;  1PC0 A;  2CDT A;  2RA2 A;  3ZBD A;  2JT4 A;  1VIE A;  2M51 A;  2AZV A;  1M1K C;  2CT4 A;  2IIM A;  2WSC E;  3RNJ A;  1Y96 B;  2YUO A;  2YWW A;  4ORZ A;  1XTD A;  3LGL A;  3EFO B;  2DX1 A;  2XU8 A;  3EG0 A;  5GAO n;  1UB4 A;  1NG2 A;  1YIT Q;  4QQD A;  3C0C A;  1P92 A;  1Z9Q A;  4F7U G;  4AG2 C;  5DM7 R;  3GLX A;  3CBO A;  3CCV T;  2W10 A;  1W4S A;  4NL3 A;  2L89 A;  4XTU A;  1W2B A;  5GAO l;  3INZ A;  2DXU A;  1GBQ A;  5LJ3 g;  2QG9 B;  2DL7 A;  3HL8 A;  1WNL A;  3PIP A;  3UF4 A;  4O6J A;  1RAA B;  2QQR A;  4RTV A;  4J7I A;  1XJW B;  2MIO A;  3SB2 A;  2K7A A;  4RTY A;  2QQA A;  2LCS A;  2O01 E;  5CQY A;  4II1 A;  3M54 A;  1BI0 A;  1M1K R;  1YIJ A;  2NYS A;  2FYK A;  2H3J A;  4M7D F;  2E4H A;  2RJE A;  1DJ7 B;  2BE7 D;  2EIF A;  5GAM e;  3CCQ T;  3SWN A;  1PD0 A;  4VUB A;  1A0N B;  3QXE B;  5FU7 B;  3CC2 A;  5FU7 C;  1OUL A;  5DLO A;  3BFM A;  4BDY A;  5CO7 A;  3HFO A;  2MI6 A;  4DBQ A;  1PWT A;  4D8D A;  3CC2 T;  3CXC S;  2OI3 A;  1KFZ A;  1C1A A;  1UEB A;  3CCL Q;  3JV3 A;  5KYY B;  2DZC A;  2MWP A;  4M7D A;  3PT9 A;  3JCM V;  1E7O A;  2PZ1 A;  2MMP A;  2K4Y A;  1Q7Y C;  3ZL7 C;  1VYT A;  2DXT A;  3WXM B;  3OA6 A;  2DYB A;  2L8D A;  4PL6 A;  3NPF A;  2AKL A;  3SHW A;  4FYY B;  3TRE A;  2RHU A;  2O31 A;  2LQ8 A;  1PRM C;  2JTF A;  2XHC A;  5CIU A;  3SFM A;  1BI2 A;  2XKO C;  3REA B;  1NYF A;  4C92 B;  1U1S A;  4MZT A;  2ATC B;  2CZ7 B;  2HDA A;  1RAG B;  1GL5 A;  1UGS B;  1AWX A;  3JCM d;  2LRQ A;  3MPU B;  2ESW A;  2O4X B;  3G7Z A;  5GAO m;  2DYI A;  2WAC A;  1WDX A;  4J6X A;  1WI7 A;  3KBG A;  1WPY A;  3VUZ A;  2GTJ A;  3FIF A;  4P5N A;  2RQT A;  2EQU A;  1JJ2 P;  1Q7Y R;  1UE9 A;  4AMC A;  4E47 A;  5HCK A;  1IGQ A;  1EIF A;  3I9Q A;  1EX4 A;  2DL8 A;  2GCX A;  1I8F A;  1AZG B;  3OS2 A;  1VUB A;  1RAD B;  1RI0 A;  2HKQ B;  2KXC A;  3JCM W;  1M8M A;  3CPW S;  3MJX A;  5M9O A;  4ZGD B;  2FO0 A;  2L0A A;  5GMK j;  3VS2 A;  2X3W D;  1MNE A;  1JRI A;  1UGQ B;  4F14 A;  3CCM Q;  4M77 G;  1KQS P;  1ZQ1 A;  2L3Q A;  4N0A A;  5KYN A;  4JLG A;  4FSS A;  4PJL A;  3V7S A;  4GLK A;  2P0K A;  3CCL A;  1D0Z A;  2HCK A;  3P8D A;  4XK8 E;  1AEY A;  1KQ1 A;  5GJV B;  3NTK A;  2KQW A;  2YDL A;  4LDY A;  1QVG P;  1UFF A;  2BZX A;  1SG5 A;  1QLY A;  3CCL T;  3LH0 A;  3G4S Q;  1X27 A;  3CC4 Q;  1G3Y A;  1PM3 A;  3L1A A;  2A37 A;  2FRW A;  3G71 A;  4JDS A;  1D3B A;  1EFN A;  2OTL A;  1Q7Y U;  1F1B B;  4PJO F;  3X28 B;  3M56 A;  4CI0 C;  3G71 T;  2DE0 X;  2OTL T;  4OB2 B;  2PUO B;  3VU3 C;  2QQ9 A;  4BE1 A;  2MOX A;  2E10 A;  5FRO A;  5LJ5 d;  4C92 A;  1BI3 A;  5DLQ E;  1HJD A;  2FVU A;  2JS2 A;  4M7A G;  2O4X A;  4PJO A;  1AOJ A;  2D1X A;  1JJ2 S;  2NUT B;  1W70 A;  2DNU A;  2P0Q A;  2JXB A;  2HSE B;  1YJN Q;  4TVR A;  5AYF A;  4F7U F;  4AG1 C;  3OQ5 A;  3PIO A;  2E65 A;  5LJ3 e;  1AZE A;  3JB9 H;  3RKX A;  3OYI A;  2QEX Q;  4FIB A;  4KUI A;  2RK1 A;  1SRM A;  5I2M A;  2PU9 B;  1KQS S;  3OYN A;  3E9F A;  2XMF A;  2K2M A;  3EFS A;  4PJJ A;  4F7U A;  3GBQ A;  3MEW A;  1VQO Q;  1K8A U;  2SRC A;  2K6D A;  1QVG S;  2DL3 A;  3VV0 A;  3EGD A;  2F2W A;  4B9X A;  2CSI A;  1ZX6 A;  4Z02 A;  3D7S B;  3BW1 A;  2MPX C;  1V29 B;  1XNI A;  2WSF E;  3G4S A;  4EMG A;  1WHL A;  1W6X A;  4Y91 A;  1O9S A;  3HRT A;  3LX7 A;  4IIM A;  5CKE A;  5L8R E;  3QYH B;  3G4S T;  2ZPE B;  1MND A;  1BB9 A;  5L23 A;  4KGV B;  4PLI A;  4JJB A;  3QUI A;  3S6W A;  4A4K A;  5I22 A;  2KEA A;  1H3Z A;  1RAI B;  1KJW A;  3OS5 A;  1OX9 A;  1KQ2 A;  1VQL A;  2VVK A;  1VYU A;  1PSE A;  1MMD A;  4OMP A;  1VQM A;  1VQL T;  2KY9 A;  2EKH A;  3LYI A;  3PFS A;  3JB9 D;  3OMC A;  3DLL A;  2NUT A;  1VQM T;  2HQX A;  4XQ3 A;  4XTW A;  3RIR A;  1OV3 A;  1Z9Z A;  4M78 G;  3PE0 A;  1WJR A;  1K73 R;  1IB8 A;  1WXU A;  2P84 A;  1VQ6 Q;  2XID A;  2K2V A;  4KRT A;  4C8Q F;  3QYG B;  2LJ0 A;  1N9S A;  4C5E A;  1YJN T;  2YT6 A;  3U23 A;  3CEY A;  3REB B;  4JJD A;  1TWB A;  1QVF P;  1B07 A;  3PGG A;  3CCU Q;  3GF5 A;  3C4S A;  3JCM h;  5D6X A;  3EAE A;  2K3Y A;  3HPW A;  1U06 A;  1Y71 A;  5FW9 A;  1M3B A;  4OMO A;  2QTV A;  3JB9 J;  2FRY A;  4BI3 A;  1VQ7 Q;  2V1R A;  2YUP A;  4C5H A;  1VQO A;  2EW3 A;  1PNJ A;  2V8I A;  2M0Y A;  2X4X A;  2DMO A;  3RDV A;  4F16 A;  2RB6 A;  1VQO T;  4A4H A;  2O88 A;  4Z88 A;  3SEM A;  2EYY A;  3MET A;  2KT1 A;  2CT3 A;  3L2U A;  4M77 F;  1Q86 R;  3O5Z A;  2VV5 A;  1JQQ A;  4AFQ C;  1K73 U;  1VYV A;  5GAM d;  4EMK B;  4EMK C;  4JRK A;  5GAN g;  1AHJ B;  1OQK A;  2LCL A;  3I35 A;  1WQW A;  3O8V A;  3DLM A;  2CUD A;  3NHN A;  1QP2 A;  1WHH A;  2B8A A;  3M4Y A;  1OU8 A;  2DEU A;  1I5L A;  2K3B A;  4JS4 A;  2FZG B;  4M77 A;  1E6G A;  4J83 A;  4LDV A;  2EKO A;  1WHK A;  4EIK A;  3CPW A;  5ECA A;  4FYV B;  3BY7 A;  1ZA1 B;  3OYB A;  1Y07 A;  3RER A;  4FU6 A;  1AT1 B;  4R56 A;  2P0P A;  2EQK A;  5KYU B;  1WYX A;  3Q1J A;  5KYW B;  2DZ9 A;  4MDX A;  5CR2 A;  2E6Z A;  1TG0 A;  4RCC A;  1GFD A;  4RMO A;  2X3X D;  4M7A F;  1JXO A;  1QVF S;  4KH0 B;  1Q86 U;  1FMV A;  4OMF B;  2J05 A;  3V8J A;  1GCQ A;  1BU1 A;  2F5T X;  1SF9 A;  4HCB A;  2BZ8 A;  2BE9 B;  2A0F B;  3DB4 A;  2JW4 A;  4J9G A;  4F04 B;  2F2V A;  3LLR A;  3CCU T;  4M7A A;  3L42 A;  1XOV A;  1YN8 A;  3JCM b;  2KRO A;  2DL5 A;  1D0Y A;  1WHM A;  1M2V B;  4XTY A;  1VQ7 T;  4J6Y A;  3JCM Q;  2CKK A;  2L3R A;  1AWJ A;  3M0P A;  3X20 B;  4A54 A;  5C6S A;  4CC4 B;  4JJC A;  2V1Q A;  2Y4X A;  1YWP A;  1RAC B;  2CP2 A;  1WQ7 A;  4J9F A;  5FWB A;  5KE2 A;  1WJS A;  3CBP A;  3TSW A;  2JN0 A;  3QDF A;  5GJW B;  2A28 A;  4M75 E;  3OW2 A;  1W1F A;  3RES A;  4DBF A;  1YIJ Q;  1ZSG A;  4GBQ A;  4RTW A;  1YI2 A;  3TQ7 P;  3MCA B;  2EYQ A;  3EG3 A;  4JS5 A;  1YBY A;  2JM8 A;  3CC2 Q;  3OYC A;  1SHG A;  3H6Z A;  4M4Z A;  3FRN A;  1M5Q 1;  4C92 G;  1I4K 1;  1IO6 A;  4RCB A;  4C0F A;  1T0J A;  5IH2 A;  1I1J A;  8AT1 B;  3VS7 A;  3FJP A;  3M0T A;  1HK9 A;  3GPL A;  4M75 B;  2ABL A;  4M75 C;  4MZP A;  2K5L A;  4XAX B;  1K9A A;  3AHU A;  2DO3 A;  2RQW A;  4ZGE B;  4N4G A;  2HKN A;  4M78 F;  2J6F A;  2JTE A;  3QWX X;  4LXC A;  2E3H A;  2NUP B;  4AFS C;  1UGV A;  5HK3 A;  2KRN A;  3X24 B;  2DM1 A;  3M9Q A;  3UT1 A;  4EDU A;  4QQG A;  4HXJ A;  1YJ9 A;  2VB6 A;  2EQM A;  4C0Z A;  4XU3 A;  2CS7 A;  4LDU A;  4JLI A;  1GCP A;  2R58 A;  3EGX A;  1B34 A;  1SEM A;  3G6E A;  3J7A F;  4DBR A;  5FU6 B;  2DF6 A;  2RF0 A;  3UPU A;  5FU6 C;  3H0I A;  1YJ9 T;  2D0N A;  4M78 A;  4PJM A;  3G6E T;  5LJ3 d;  1ZBX A;  6AT1 B;  4LDX A;  4EMH A;  1M3A A;  1NLP C;  4FT4 A;  4IUR A;  5GAO q;  4FW1 A;  3OS1 A;  1QCO A;  1FX7 A;  4DA4 A;  2LTO A;  3A8O B;  2RD1 A;  2Y4Y A;  2O2O A;  3R6O A;  1QW1 A;  4XTZ A;  3CBM A;  4QQ6 A;  1MUZ A;  1TH7 A;  1X2Q A;  2JM9 A;  2EGE A;  2LQK A;  4WF2 A;  1U5S A;  2DRM A;  3JB9 I;  3HRU A;  5GAN e;  2DIL A;  2W0Z A;  1ZHI A;  3WVE B;  1WIE A;  1YIJ T;  5CKF A;  3CC7 A;  1D1A A;  4IUT A;  2DIQ A;  3NGP A;  2EQI A;  2LNV A;  4DQ2 A;  1X69 A;  3CC7 T;  2YLB A;  1B3Q A;  3V7C A;  3EG9 A;  3OBY A;  5GAM h;  2MK5 A;  1I81 A;  2RM4 A;  3QPH A;  2HBW A;  2DER A;  1U1T A;  2VC8 A;  1WHJ A;  3A8M B;  3OYD A;  1NYG A;  5FRM A;  1QKW A;  2ED1 A;  2DJQ A;  3G71 Q;  4E7L A;  2LT1 A;  2NUP A;  1T0H A;  4FL6 A;  2OTL Q;  4N4I A;  2QDY B;  1TU0 B;  5KYX B;  2F5K A;  2MWO A;  3TSZ A;  5CQX A;  2JZ2 A;  2DXC A;  1Y96 A;  5LJ5 j;  3HKS A;  3NMZ C;  2CZ6 B;  3JAM E;  3EFO A;  2DPP B;  3R6N A;  1SHF A;  2J6K A;  4DEY A;  1H3H A;  4MMK A;  1YFN A;  4PLL A;  1S72 A;  3E19 A;  2HSP A;  3GNG A;  2GFA A;  2DD5 A;  2GTO A;  1NPR A;  2LNH B;  1S72 T;  4QT7 A;  2YXY A;  4OML A;  4D8K A;  2KDS A;  4GLM A;  4M75 D;  3JCM J;  3S3O A;  3FEO A;  3A8G B;  3PNW C;  2DBK A;  4PJO C;  1K0X A;  2FG0 A;  4JJN K;  1RAB B;  1K4U S;  2CZ1 B;  5CK9 A;  2ZZD A;  4B6M A;  2VGN A;  3HHT B;  2AZS A;  2PVD B;  1UUE A;  2VUB A;  2GGR A;  1VA7 A;  1RAE B;  2RO0 A;  2HQE A;  1H92 A;  1K8A C;  1PRL C;  4M7D D;  2F69 A;  2J6O A;  5KCH A;  5KYY A;  1N27 A;  3OYG A;  3T9N A;  5J3B A;  1JU5 C;  5IAY A;  2I2L A;  1BBZ A;  3URG A;  5CAI A;  3MEU A;  4CC7 A;  5CVI A;  2RQU A;  3UWN A;  4C92 F;  2AT1 B;  4JZ3 A;  1MV3 A;  2BUD A;  2LQN A;  1NZ9 A;  1MHN A;  4B9W A;  2VYT A;  4PNO A;  2QDL A;  1WXB A;  2VAS A;  1FYN A;  4PK4 A;  4BDZ A;  2RHX A;  1PKS A;  2LDM A;  1ZLM A;  1GRI A;  1ZA2 B;  1G5V A;  5A2Q E;  2E3I A;  2C0I A;  5GAN 2;  5HK0 A;  1VQL Q;  4K11 A;  4BB7 A;  1K8A R;  4C0G A;  1VQM Q;  1HYO A;  1YP5 A;  1ZUY A;  1SSH A;  4RG8 A;  1RI9 A;  4IUV A;  4RTT A;  4YTL A;  2DTI A;  5CKB A;  2K5I A;  2EGC A;  1N8R C;  2RI2 A;  4FYW B;  1KC8 U;  3SDZ A;  3HFN A;  3UDC A;  3EH1 A;  4FT2 A;  1ZUK A;  4X9D A;  1UHF A;  2CP6 A;  2ZPH B;  2KYM A;  4BUG A;  1PHT A;  4QW2 A;  3JCM P;  2LZ6 B;  1QCN A;  1WZO A;  1OPL A;  2MAM A;  3AT1 B;  3FDR A;  2XD0 A;  1FWZ A;  4MML A;  2YRD A;  3IQL A;  2NWM A;  1W2B P;  1K76 A;  4J9D A;  2KSS A;  3L2W A;  5LJ3 h;  5FLX E;  4C8Q E;  5LL6 S;  3S3N A;  4R55 A;  1Q95 G;  4C0D B;  2QGG A;  2VGM A;  4IUP A;  4C0D C;  3CD6 A;  2GF7 A;  1N8R R;  3OYL A;  2QQB A;  2ZPI B;  3GNF B;  2AK5 A;  5IN1 A;  4OP0 A;  2E12 A;  3JCM f;  5GAN 4;  3NTI A;  1BIA A;  2O9V A;  1T3L A;  1AD5 A;  2HD0 A;  2PNI A;  4RTU A;  1K73 C;  5GAM j;  5A0D A;  4KUD K;  3GP8 A;  2ZGW A;  4C8Q B;  1D0X A;  4C8Q C;  1LPL A;  2KK4 A;  1BCO A;  3PMI A;  3OB9 A;  1YJW A;  3QBY A;  1H8K A;  4ME7 A;  1GXI E;  1TSF A;  1ABO A;  1YJW T;  4PJO D;  1VOM A;  3GIB A;  3VYG A;  1LOJ A;  1D1C A;  2CP7 A;  2HQH A;  1EZZ B;  1X6G A;  3F70 A;  2X51 A;  1UJ0 A;  2Z0W A;  1X43 A;  2M9U A;  4KGZ B;  3OYY A;  2DRK A;  1Y57 A;  2BIV A;  2LX9 A;  2KR3 A;  1K1Z A;  4FYX B;  2AKK A;  4HVU A;  1N8R U;  1VQ8 A;  1T3S A;  2HL5 C;  3CXC A;  3VS1 A;  1K9M C;  2L3P A;  2CH4 A;  5IHI A;  3H9N A;  4WCI A;  2FEI A;  1Q86 C;  3BDU A;  1MMA A;  3EHR A;  1VQN A;  2RI3 A;  4A53 A;  2OJ2 A;  2RJF A;  3VYH B;  4V2S A;  1JB0 E;  1VQN T;  1QQJ A;  2DBM A;  5J26 A;  3LWH A;  4JRP A;  3H8Z A;  2G3R A;  1M30 A;  4HA8 A;  2L2P A;  3C95 A;  3L2R A;  4JZ4 A;  3L2Z A;  5EC7 A;  3M0U A;  5KH6 A;  2E5K A;  1G83 A;  2D0Q B;  2IVW A;  2YUQ A;  4Y92 A;  1N5Z A;  3QJ6 A;  2K57 A;  2LP5 A;  2BZY A;  4LUD A;  2HAX A;  2EBP A;  2E6N A;  3A98 A;  1K9M R;  4A63 B;  2V8J A;  5IT9 E;  1QWE A;  3QKJ A;  5GAN d;  4M75 G;  1CKA A;  2CSQ A;  3CCJ A;  4Y28 E;  3J81 E;  2GBQ A;  4OMQ A;  2JOY A;  4J9E A;  3CCJ T;  1WHG A;  1OZ3 A;  4PKC C;  2K3X A;  3MEA A;  1IHV A;  1C6V X;  4DEX A;  1U8R A;  2LJ3 A;  4E7Z A;  3NFC A;  4JRQ A;  1WX6 A;  2CP5 A;  3LW5 E;  2QI2 A;  4QKU A;  2DKG A;  1U3O A;  3CCS A;  1N6A A;  1YI2 Q;  2X4J A;  2OAU A;  4HVW A;  1SPK A;  2QTX A;  4CC3 A;  2MYS A;  3CCS T;  1IRX A;  2R57 A;  2DL4 A;  1YNZ A;  1G8X A;  3LWI A;  4XTV A;  4ZTF A;  5GAN 3;  5GAN 6;  1VQK A;  2KXD A;  5C0M A;  2L5Q A;  1K9M U;  2BTT A;  2ECZ A;  4RTZ A;  3CME A;  1VQK T;  2CP3 A;  2EWN A;  1M1G A;  3M57 A;  3VRZ A;  3CME T;  2E64 A;  5LJ5 h;  2DIG A;  5KE3 A;  2PQW A;  1UTI A;  3OYE A;  3A8H B;  4C8Q D;  2ED0 A;  1LNX A;  1ZSZ B;  1J3T A;  1ZSZ C;  3MKD A;  2GQV A;  4BI8 B;  1D09 B;  1YJ9 Q;  2Y90 A;  4E7K A;  1YWO A;  4J9B A;  3OYJ A;  2CH4 W;  3G6E Q;  5J39 A;  2RHY A;  2COW A;  3OYF A;  2QGF B;  5LJ3 j;  2VXE A;  4O5V A;  3E2U A;  4XTX A;  1JJ2 A;  2FPE A;  4EMK A;  3DKM A;  2PTK A;  3TVT A;  1OI1 A;  4LD9 K;  3M0R A;  1NE8 A;  3I55 A;  3LGF A;  2XDD A;  4ZN1 A;  2DK3 A;  2RNA A;  1HD3 A;  4E7H A;  3I55 T;  4NOY A;  5GMK e;  4XU0 A;  3TEE A;  4BE2 A;  2GNC A;  1KQS A;  2RK2 A;  4FW2 A;  1KHI A;  1M90 R;  1OYX A;  3RR6 A;  3CC7 Q;  2DVE A;  1YI2 T;  3M58 A;  2OTJ A;  3VKI A;  4X34 A;  5KYU A;  1LJO A;  4X1V A;  2FZK B;  5KYW A;  3C12 A;  3CCE A;  2KT8 A;  2OAW A;  2V8K A;  4J5Y A;  5D6W A;  2OTJ T;  4BD3 A;  1QVG A;  2C0T A;  2EJ9 A;  3E1S A;  4M7D E;  3CCE T;  2VXF A;  4CC2 A;  3SWN B;  1JEG A;  1K0S A;  3SWN C;  3RBB B;  2JTM A;  2LC4 A;  1SRL A;  1WA7 A;  2L3S A;  4OB1 B;  1PKT A;  1VIF A;  1MV0 B;  3VS6 A;  3EGU A;  4M7A D;  2YLC A;  3M0Q A;  3I56 A;  4BAC A;  4AFZ C;  1BIB A;  2JNG A;  1YHQ A;  2M02 A;  5I21 A;  2K5F A;  3EHQ A;  4M7D B;  4M7D C;  3CCR Q;  3JCM c;  3I56 T;  3JB9 G;  4ZN3 A;  1M2V A;  1N9R A;  4C5G A;  1UJY A;  2VKN A;  4ESR A;  1NJI R;  1M90 U;  2EYZ A;  1SKU B;  4AFU C;  4AT1 B;  1S72 Q;  2RQR A;  3VJP A;  5I2S A;  4OF1 A;  1I07 A;  3OS0 A;  3QO3 A;  2D9T A;  1ARK A;  2ROL A;  2YRV A;  1Q82 C;  4JPB W;  4NS5 A;  2DA9 A;  2FL7 A;  4L59 A;  3CCV A;  2FZC B;  3A8L B;  2DTH A;  2KI7 A;  4IIO A;  1BK2 A;  2KYB A;  4DOV A;  2XDP A;  1TXQ A;  3QDR B;  1S1N A;  3RKY A;  1XQH A;  4JUV A;  4MDW A;  3RMS A;  4M75 F;  2A36 A;  1KIK A;  2ZAE A;  3NTH A;  3UA6 A;  2QQS A;  4IUQ A;  4HCK A;  4IUU A;  1OX8 A;  2DEQ A;  4C5I A;  3MO8 A;  2AHJ B;  4OGC A;  2E70 A;  3RUX A;  2QYZ A;  2QA4 A;  3ME9 A;  3KUF A;  5GAN h;  3CCQ A;  2ROT A;  1HXD A;  1PG5 B;  1NJI U;  1V76 A;  4M75 A;  4OMN A;  2QA4 T;  5D7U A;  2E5Q A;  1Q82 R;  3CMA A;  4FM4 B;  2DD4 A;  2IPO B;  3PVQ A;  2CZ0 B;  4LUE A;  4FCY A;  1C0M A;  4GY5 A;  1UHC A;  5HKC A;  4KBM B;  1X75 C;  3CPW P;  3CMA T;  1CKB A;  4N0A C;  3MEV A;  3MHX A;  1I5O B;  3X26 B;  2XG8 D;  2KGT A;  2QAZ A;  1WXT A;  2P4R A;  1ACM B;  3BDL A;  4M78 D;  3CCR A;  1VQP A;  4C92 E;  2DVJ A;  3TU4 K;  4ANJ A;  3OYM A;  3CCR T;  1VQP T;  4L6V 5;  4BI4 A;  1D3B B;  3JSC A;  4PJO E;  4RTX A;  4BY6 B;  1TUD A;  4BY6 C;  2E41 A;  5GMK l;  1RAF B;  1KC8 C;  2RHZ A;  1QP3 A;  5GAN 7;  2RHI A;  1E6H A;  2G6F X;  2CRE A;  2LCC A;  1M1K U;  3M59 A;  5EG2 A;  3OSV A;  4KT0 E;  4C92 C;  1Q82 U;  5DY9 A;  2RPN A;  1YIT A;  1IXD A;  1TUG B;  4C8Q G;  1QVF A;  3QJY A;  4PJO B;  1M2O A;  4KGX B;  3JCM g;  1YIT T;  1UGR B;  2YSQ A;  2LJ1 A;  1M27 C;  2DFU A;  3H41 A;  4DBH A;  2DLP A;  2X4W A;  4MZM A;  1M1F A;  4HT8 A;  2K9G A;  4L5G A;  4ZNX A;  4F7U E;  4OGE A;  2KNB B;  4ELZ C;  4RKU E;  1JO8 A;  1FMK A;  5CCA A;  4PFO A;  2DXB A;  1NM7 A;  1TTH B;  1KC8 R;  3CD6 Q;  4LN2 A;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 4HCZ A;  4QQD A;  1YJW T;  1Q86 U;  4PJO D;  1P92 A;  4F7U G;  3GIB A;  3CPF A;  4OMF B;  3VYG A;  5DM7 R;  1LOJ A;  3GLX A;  3CBO A;  3CCV T;  2D6F A;  3V8J A;  3F70 A;  1W4S A;  4NL3 A;  2L89 A;  4XTU A;  1W2B A;  2F5T X;  2M9U A;  5GAO l;  5LJ3 f;  3INZ A;  2DXU A;  5LJ3 g;  3OYY A;  4HCB A;  3HL8 A;  4OB3 B;  1WNL A;  4Q5W A;  5KCO A;  3QZ9 B;  3PIP A;  4F7U B;  3DB4 A;  4O6J A;  2BIV A;  2LX9 A;  3OSS C;  3JCM X;  2QQR A;  5GMK i;  4J7I A;  3LLR A;  3CCU T;  1N8R U;  1VQ8 A;  3CXC A;  3L42 A;  1OZ2 A;  1XOV A;  3SB2 A;  1K9M C;  4M7A A;  1BKB A;  2QXF A;  2QQA A;  4OB0 B;  2NLU A;  2O01 E;  3JCM b;  5CQY A;  4II1 A;  3M5A A;  4XTY A;  1Q86 C;  3BDU A;  1VQ7 T;  4J6Y A;  4J8O A;  3JCM Q;  1O75 A;  1G3T A;  2CKK A;  1BI0 A;  3M54 A;  1VQN A;  1YIJ A;  2L3R A;  2RI3 A;  2ZPF B;  2FYK A;  2H3J A;  4M7D F;  3ZFJ A;  2EJG A;  2RJE A;  3X20 B;  1DJ7 B;  2EIF A;  4A54 A;  4A53 A;  5GAM e;  5C6S A;  3SWN A;  2RJF A;  4D6W A;  4VUB A;  3VYH B;  4XU1 A;  3CCQ T;  4V2S A;  1JB0 E;  1BYM A;  3QXE B;  4N4H A;  5FU7 B;  2C06 A;  1VQN T;  3CC2 A;  5J26 A;  5FU7 C;  5DLO A;  3LWH A;  3BFM A;  4JRP A;  4BDY A;  3H8Z A;  5CO7 A;  3HFO A;  2IG0 A;  5GMK m;  2MI6 A;  2G3R A;  4HA8 A;  1G3W A;  2Y4X A;  3MP8 A;  3CC2 T;  3CXC S;  3C95 A;  1IZ6 A;  3L2R A;  2XDB A;  3L2Z A;  1WQ7 A;  5KE2 A;  4RG2 A;  1UEB A;  5KH6 A;  3JB9 F;  1M9S A;  1WJS A;  3CBP A;  3FLG A;  2JN0 A;  3ER0 A;  2D0Q B;  2IVW A;  2DZC A;  4QVD A;  1Q81 C;  2MWP A;  4M7D A;  4E7J A;  2HBP A;  3PT9 A;  3N5B B;  2M16 A;  3JCM V;  3QJ6 A;  5LJ5 g;  4M75 E;  3OW2 A;  2K57 A;  2M0O A;  3RES A;  5A0L A;  2MMP A;  1YI2 A;  2HAX A;  4J7F A;  2E6N A;  2K4Y A;  1Q7Y C;  3MCA B;  2EYQ A;  4JS5 A;  2DXT A;  3WXM B;  3OA6 A;  1YBY A;  2V8J A;  2L8D A;  5IT9 E;  3OYC A;  4PL6 A;  3QKJ A;  5GAN d;  3H6Z A;  4M75 G;  3M53 A;  3FRN A;  1M5Q 1;  4C92 G;  3CCJ A;  1I4K 1;  4Y28 E;  4X9C A;  4RCB A;  3TRE A;  4C0F A;  3J81 E;  1R8O B;  2RHU A;  5D6Y A;  1UGP B;  2LQ8 A;  2JOY A;  4QVZ A;  2JTF A;  2XHC A;  5CIU A;  5A0G A;  3CCJ T;  2M1H A;  3SFM A;  3FB9 A;  3FJP A;  1BI2 A;  1HK9 A;  2DJZ A;  1OZ3 A;  3GPL A;  2XKO C;  4M75 B;  3QHS A;  4PKC C;  4C92 B;  2K3X A;  2LT4 A;  3MEA A;  4M75 C;  2K5L A;  1U1S A;  4MZP A;  3OW2 S;  4MZT A;  4XAX B;  1U8R A;  2CZ7 B;  3NFC A;  3S3M A;  3AHU A;  1UGS B;  2DO3 A;  4ZGE B;  2EJF A;  3JCM d;  4N4G A;  2LRQ A;  4JRQ A;  5FRN A;  3WVD B;  3L2Q A;  3LW5 E;  2QI2 A;  3CCS A;  2DKG A;  2O4X B;  1N6A A;  2X4J A;  1IRE B;  3CD6 T;  3G7Z A;  3HP9 A;  2OAU A;  2WAC A;  4M78 F;  5GAO m;  5GAN j;  4J6X A;  2QTX A;  5HK3 A;  3X24 B;  3KBG A;  3CCM A;  1WPY A;  3CCS T;  2GFU A;  3M9Q A;  2R57 A;  3UT1 A;  3VUZ A;  2X4Y A;  3FIF A;  4P5N A;  2JUF A;  2EQU A;  3OMG A;  3LWI A;  2EAY A;  4EDU A;  4XTV A;  2DTO A;  4ZTF A;  4QQG A;  5GAN 3;  3CCM T;  5GAN 6;  1YJ9 A;  1VQK A;  4C0Z A;  2EQM A;  4XU3 A;  4C92 D;  4E47 A;  5C0M A;  2CS7 A;  4HKE A;  4LDU A;  2XI9 A;  4JLI A;  2L5Q A;  3HSB A;  1EIF A;  1K9M U;  2R58 A;  2GCX A;  1B34 A;  3G6E A;  3CME A;  1I8F A;  1KD1 C;  5FU6 B;  3J7A F;  3UPU A;  1FXX A;  3QII A;  5FU6 C;  1VUB A;  3OS2 A;  1YJ9 T;  1VQK T;  1RI0 A;  1Y7X A;  2EWN A;  2HNI A;  4M77 E;  4M78 A;  1M1G A;  3M57 A;  3JCM W;  3CC4 A;  3CPW S;  1BI1 A;  3G6E T;  3JRZ A;  3CME T;  5LJ3 d;  1ZBX A;  4LDX A;  2E64 A;  4EMH A;  2JVV A;  5M9O A;  4FT4 A;  4IUR A;  3A5Z B;  4ZGD B;  5GAO q;  5LJ5 h;  3OS1 A;  2DIG A;  5GMK j;  3CC4 T;  1FX7 A;  1UGQ B;  1JRI A;  5KE3 A;  2PQW A;  4DA4 A;  4M77 G;  3OYE A;  1ZQ1 A;  3A8H B;  2LTO A;  4C8Q D;  2XK0 A;  3A8O B;  4N0A A;  2RD1 A;  1LNX A;  2Y4Y A;  3R6O A;  2GQV A;  4XU2 A;  4JLG A;  3V7S A;  4GLK A;  1QW1 A;  3PMT A;  4UC4 A;  4XTZ A;  3CBM A;  4QQ6 A;  2P0K A;  4BI8 B;  3CPW A;  2Y90 A;  4E7K A;  3CCL A;  3P8D A;  2EFI A;  1TH7 A;  3EFR A;  4XK8 E;  1KQ1 A;  4M77 B;  3NTK A;  3OYJ A;  4M77 C;  2CYZ B;  2KQW A;  2LQK A;  4LDY A;  5J39 A;  4WF2 A;  1Q81 U;  2RHY A;  2FHD A;  3JB9 I;  3HRU A;  5GAN e;  3OYF A;  3CCL T;  1VQ8 T;  3LH0 A;  4E7I A;  5LJ3 j;  5GAO r;  2RH2 A;  2DAQ A;  4IKF A;  2VXE A;  1G3Y A;  4O5V A;  5CKH A;  1ZHI A;  3L1A A;  3WVE B;  3G71 A;  4XTX A;  1W2B S;  2R5M A;  4JDS A;  3ZEH A;  1D3B A;  4LDW A;  2OTL A;  1Q7Y U;  4ZTJ A;  1YIJ T;  5CKF A;  4PJO F;  1JJ2 A;  3X28 B;  4JRI A;  3CC7 A;  2A3L A;  2CGH A;  3M56 A;  4CI0 C;  4IUT A;  2DIQ A;  4EMK A;  3DKM A;  3E9G A;  3G71 T;  2LNV A;  4NL2 A;  1VQ9 A;  2OTL T;  4OB2 B;  4DQ2 A;  3VUB A;  1YJN A;  2WSE E;  1OI1 A;  2PUO B;  3VU3 C;  2QQ9 A;  4BE1 A;  3JCM e;  2E10 A;  3CC7 T;  2YLB A;  4LD9 K;  3V7C A;  4M7A E;  1NE8 A;  1MGQ A;  3OBY A;  5FRO A;  5GAM h;  5LJ5 d;  3I55 A;  4C92 A;  3OYH A;  1BI3 A;  1VQ9 T;  3LGF A;  5DLQ E;  2XDD A;  1I81 A;  2QEX A;  4ZN1 A;  2FVU A;  2DK3 A;  2RM4 A;  3FC3 A;  3QPH A;  5LJ5 f;  3ASK A;  2A7Y A;  4E7H A;  3I55 T;  4NOY A;  4M7A G;  5GMK e;  1U1T A;  2O4X A;  4XU0 A;  3TEE A;  4PJO A;  2VC8 A;  3A8M B;  3OYD A;  2QEX T;  5FRM A;  4BE2 A;  2X35 A;  1KQS A;  2RK2 A;  1JJ2 S;  4HCC A;  4E7L A;  2LT1 A;  1KHI A;  4FL6 A;  1OYX A;  2BKD N;  2QDY B;  1KHC A;  4N4I A;  2P0Q A;  4BE0 A;  2DVE A;  1YI2 T;  3M58 A;  2OTJ A;  2FB7 A;  3VKI A;  2KMT A;  2F5K A;  4X34 A;  4M7A B;  4C8Q A;  1LJO A;  2MWO A;  4M7A C;  3CCE A;  3C12 A;  3RMQ A;  1X01 A;  2V8K A;  4J5Y A;  5CQX A;  2JZ2 A;  2DXC A;  1Y96 A;  3HRS A;  4TVR A;  5D6W A;  5AYF A;  5LJ5 j;  3HKS A;  4F7U F;  2OTJ T;  4BD3 A;  2P4T A;  4LD6 A;  1QVG A;  2CZ6 B;  4A4F A;  2EJ9 A;  3OQ5 A;  3E1S A;  3JAM E;  3PIO A;  2E65 A;  5LJ3 e;  4M7D E;  3CCE T;  2DPP B;  2VXF A;  3RKX A;  3JB9 H;  3OYI A;  2EQJ A;  4FIB A;  3P8H A;  4KUI A;  3GOX A;  3SWN B;  3DB3 A;  2RK1 A;  3M4G A;  5I2M A;  3SWN C;  2PU9 B;  1KD1 U;  4MMK A;  1KQS S;  4A4E A;  3OYN A;  2JTM A;  2LC4 A;  3E9F A;  1VQ5 A;  4ZGJ B;  4PLL A;  4M7D G;  1S72 A;  3KXT A;  3E19 A;  4OB1 B;  3GNG A;  3EFS A;  2GFA A;  1VIF A;  2DD5 A;  3C94 A;  4M7A D;  5GAN 8;  1NPR A;  1VQ5 T;  2YLC A;  2LVM A;  4F7U A;  3I56 A;  1S72 T;  4BAC A;  5GAM g;  3MEW A;  1BIB A;  2JNG A;  1YHQ A;  1H64 1;  2RJD A;  5I21 A;  2K5F A;  1K8A U;  1QVG S;  4M7D B;  3VV0 A;  2KDS A;  4M7D C;  4B9X A;  2PUK B;  3JCM c;  4M75 D;  4Z02 A;  3I56 T;  1JBM A;  3JCM J;  3QG1 A;  3S3O A;  3BW1 A;  3MP1 A;  1M4Z A;  3FEO A;  3JB9 G;  3A8G B;  4ZN3 A;  3PNW C;  1V29 B;  1N9R A;  4PJO C;  1WJQ A;  4C5G A;  1XNI A;  2WSF E;  4JJN K;  4EPC A;  1M8V A;  2CZ1 B;  1M90 U;  2KVQ G;  2PVG B;  3G4S A;  4EMG A;  5CK9 A;  2XIC A;  2ZZD A;  2VGN A;  3HHT B;  3M55 A;  4Y91 A;  4KUL A;  1O9S A;  2PVD B;  3VJP A;  5I2S A;  4QVC A;  3HRT A;  3LX7 A;  5CKE A;  5L8R E;  2VUB A;  3QYH B;  3G4S T;  2ZPE B;  4OF1 A;  3OS0 A;  2RO0 A;  5LJ5 e;  2HQE A;  3QO3 A;  2D9T A;  1K8A C;  4PLI A;  2YRV A;  1Q82 C;  3QUI A;  4M7D D;  2F69 A;  4NS5 A;  3S6W A;  2FL7 A;  4A4K A;  1H3Z A;  4L59 A;  3CCV A;  3A8L B;  5KCH A;  2DTH A;  2YHT A;  3OS5 A;  1N27 A;  3V7R A;  1VQ6 A;  1KQ2 A;  3V8K A;  1VQL A;  4HT9 A;  3OYG A;  4DOV A;  2XDP A;  3T9N A;  3OY9 A;  5GAO p;  1PSE A;  5J3B A;  5IAY A;  2I2L A;  3QDR B;  3RKY A;  3URG A;  1XQH A;  3MEU A;  5CAI A;  5CVI A;  1M90 C;  1VQ6 T;  4JUV A;  4M78 E;  4A4G A;  4MDW A;  1VQM A;  3RMS A;  4M75 F;  1VQL T;  2R5A A;  3UWN A;  4C92 F;  2KY9 A;  3NTH A;  2QQS A;  3CCU A;  3LYI A;  3PFS A;  4IUQ A;  3JB9 D;  3OMC A;  2BUD A;  1NZ9 A;  1MHN A;  4IUU A;  3DLL A;  4B9W A;  2VYT A;  4PNO A;  1VQM T;  2HQX A;  2DEQ A;  4XQ3 A;  4XTW A;  3RIR A;  1WGS A;  2E1H A;  4C5I A;  4M78 G;  1VQ7 A;  3MO8 A;  1PSF A;  1WJR A;  2AHJ B;  5HY6 A;  4BDZ A;  4OGC A;  2E70 A;  2RHX A;  3RUX A;  2LDM A;  2QA4 A;  3ME9 A;  3KUF A;  1G5V A;  5GAN h;  5A2Q E;  3CCQ A;  3J80 E;  1B34 B;  1HXD A;  4CRI A;  5GAN 2;  2ZCF B;  2XID A;  2K2V A;  1NJI U;  4C8Q F;  4M77 D;  5HK0 A;  3QYG B;  4M75 A;  4M78 B;  2QA4 T;  1N9S A;  2ZPG B;  4M78 C;  4FSX A;  4C5E A;  4BB7 A;  1YJN T;  2E5Q A;  3CMA A;  4FM4 B;  2DD4 A;  4C0G A;  3CEY A;  2CZ0 B;  2MF2 A;  4GY5 A;  4RG8 A;  3PGG A;  5HKC A;  4KBM B;  1X75 C;  3OYA A;  4IUV A;  3CMA T;  4YTL A;  2DTI A;  5CKB A;  3GF5 A;  3C4S A;  3RKW A;  3JCM h;  5D6X A;  3EAE A;  2K3Y A;  2K5I A;  1QVP A;  3HPW A;  1Y71 A;  4N0A C;  4DOW A;  2RI2 A;  3MEV A;  5CKD A;  3JB9 J;  1N8R C;  1KC8 U;  3MHX A;  4BI3 A;  1KG1 A;  3SDZ A;  3HFN A;  3X26 B;  4J6W A;  3UDC A;  4C5H A;  3L2V A;  2XG8 D;  1NPP A;  1VQO A;  2V8I A;  4FT2 A;  4ATO A;  2PVO B;  3BDL A;  4X9D A;  1NJI C;  2X4X A;  4M78 D;  5GMK h;  3CCR A;  1YCY A;  1VQP A;  2ZPH B;  2RB6 A;  4C92 E;  1VQO T;  1G3S A;  4BUG A;  4A4H A;  3OYK A;  4QW2 A;  3MET A;  3TU4 K;  3JCM P;  2ZPB B;  3OYM A;  1X6O A;  3CCR T;  3L2U A;  1SSF A;  1VQP T;  3P8B B;  4L6V 5;  4M77 F;  4BI4 A;  1D3B B;  3PTA A;  3JSC A;  4PJO E;  3SD4 A;  2MAM A;  2VV5 A;  4OVA A;  3FDR A;  4BY6 B;  2XD0 A;  3QZ5 B;  1FWZ A;  4BY6 C;  2E41 A;  4MML A;  1K73 U;  5GMK l;  5GAM d;  4EMK B;  1KC8 C;  2RHZ A;  1QP3 A;  3OBW A;  4EMK C;  5GAN f;  4JRK A;  3V8L A;  5GAN g;  5GAN 7;  2KSS A;  1VQ4 A;  1AHJ B;  2LCL A;  2RHI A;  2RI5 A;  3L2W A;  1WQW A;  3O8V A;  5LJ3 h;  4ELY C;  5FLX E;  2LCC A;  3DLM A;  4PJO G;  4C8Q E;  3M59 A;  1M1K U;  5GAM f;  5LL6 S;  5EG2 A;  1QP2 A;  2B8A A;  1RL2 A;  3S3N A;  3M4Y A;  3OSV A;  4KT0 E;  4C92 C;  4R55 A;  1VQ4 T;  1Q82 U;  3QSU A;  4C0D B;  1I5L A;  2VGM A;  5DY9 A;  4IUP A;  4C0D C;  3CD6 A;  3X25 B;  2GF7 A;  4JS4 A;  1YIT A;  3OYL A;  2QQB A;  2ZPI B;  4M77 A;  4C8Q G;  1YHQ T;  1QVF A;  4J83 A;  3GNF B;  4LDV A;  3QJY A;  2EKO A;  4PJO B;  2KAF A;  4OP0 A;  2E12 A;  5IN1 A;  3JCM f;  5GAN 5;  3NTI A;  2RJC A;  1BIA A;  3JCM g;  3MP6 A;  5GAN 4;  1YIT T;  1UGR B;  3BY7 A;  2HD0 A;  3TCJ A;  1K73 C;  5GAM j;  1Y07 A;  3OYB A;  3RER A;  4FU6 A;  2RA2 A;  3ZBD A;  5A0D A;  4R56 A;  2P0P A;  2EQK A;  4KUD K;  3GP8 A;  2ZGW A;  4C8Q B;  2X4W A;  1VIE A;  4MZM A;  4C8Q C;  1M1F A;  3Q1J A;  4HT8 A;  2DZ9 A;  4L5G A;  1M1K C;  4MDX A;  2WSC E;  2KK4 A;  3PMI A;  1Y96 B;  4OGE A;  2E6Z A;  3OB9 A;  4RCC A;  4F7U E;  5CR2 A;  1YJW A;  3QBY A;  4ELZ C;  4RKU E;  1XTD A;  3LGL A;  4ME7 A;  5CCA A;  4RMO A;  1GXI E;  2XU8 A;  2DXB A;  5GAO n;  4M7A F;  1UB4 A;  1QVF S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...