1LOJA

Crystal structure of a methanobacterial sm-like archaeal protein (smap1) bound to uridine-5'-monophosphate (ump)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Rna binding protein, transcription
molecule keywords small nuclear ribonucleoprotein homolog (Sm-like)
total genus 13
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1lojA00
2EWNA 4MMKA 5GMKh 2YHTA 1HK9A 4J6WA 4X9CA 2DTOA 2EJFA 4C8QC 1WNLA 5GMKl 5LJ5g 4HT9A 5LJ5d 4M7AC 3JB9H 3JB9I 3JCMJ 2DVEA 3FJPA 5LJ5f 2DXUA 4M78C 3JCMV 4M77B 2K57A 4DQ2A 2FB7A 4X9DA 1X01A 4J6YA 4J6XA 4WF2A 1LNXA 3V8LA 4A54A 3JCMP 2DXTA 5GAN6 4C92A 4PJOG 3JCMc 5GAMd 2ZGWA 4M75C 3QUIA 4XU3A 3SWNA 5GAN2 1LOJA 4M78D 4EMKC 1Y96A 3QHSA 1JBMA 4EMHA 3FIFA 2VXEA 5GAOl 5I21A 3EFSA 4M7DC 4M7DF 1KQ1A 1TH7A 1WQWA 4PJOF 3SB2A 4M77E 3RESA 4HT8A 4M75F 4NL2A 4EMGA 5LJ5h 3INZA 5LJ3f 3V7CA 1JRIA 4M77G 1KQ2A 3JB9F 3QSUA 5LJ3g 5LJ3j 4XTUA 4M7DG 3BDUA 1H641 5DY9A 4XQ3A 3JCMf 4EMKA 5GMKm 2E41A 5GANg 3L1AA 2DJZA 4M75D 3V7RA 3HFNA 3JCMh 4A53A 2DZCA 4C8QB 1M5Q1 3M4GA 4PNOA 4C92G 4C8QA 4M7AG 4V2SA 1LJOA 5GANe 1I5LA 4N0AA 2E64A 2DZ9A 2Y90A 4M77D 3RIRA 2CGHA 3RKXA 4XTZA 4C8QD 5LJ5j 5GANf 1MGQA 3BFMA 4C92C 2EAYA 1D3BB 4M7AB 5CAIA 2RD1A 4M78E 3VU3C 5GMKi 3RUXA 4M75A 5GANj 1I81A 4JLIA 4M77A 5LJ3h 4Y91A 4M78B 3RERA 1BIAA 4M7DB 4N0AC 4M7AE 5GANh 4M7DA 3HFOA 3V7SA 3JCMg 4C92B 3JB9D 3BW1A 2E10A 4QVDA 4JRIA 4OP0A 4F7UA 3HSBA 4XTWA 4F7UB 2EJGA 4NL3A 5GAMe 5GMKj 3PGGA 3RKYA 5LJ3e 4M75E 2JN0A 1U1SA 1WPYA 4C8QG 3JCMe 4M7AA 2E65A 4M7DD 1U1TA 4M77C 2VXFA 4M75B 4C8QE 1I4K1 5GAMg 5GAOm 4F7UE 4QVCA 5GAN8 4M78A 5GAOn 2RB6A 1I8FA 3BY7A 3V8KA 1B34A 2FYKA 4PJOC 3V8JA 4M77F 4XTXA 5LJ3d 2HNIA 4JUVA 4RCCA 1D3BA 4C92D 4PJOD 5GAOr 5GAMf 3JCMb 2DTIA 4M75G 2DTHA 4JRKA 3FB9A 1N9SA 3SWNC 2DKGA 4HA8A 3GIBA 3EFRA 3QO3A 5GMKe 5GAMj 4J5YA 5GAN4 2RM4A 3JB9J 3JCMW 1M8VA 2E1HA 2EJ9A 4M7AD 2DEQA 4XU2A 4NOYA 4F7UG 5GAN7 4PJOA 1YCYA 2RA2A 4XU1A 2VC8A 3L2ZA 4M78F 4RCBA 3JCMX 4MMLA 5GAN5 4EMKB 4PJOB 1HXDA 1WQ7A 2QTXA 3RKWA 5GAOq 4XTVA 4C92F 4C92E 4XTYA 5GAMh 1B34B 1BIBA 1N9RA 4C8QF 5GAN3 4M7AF 3JCMd 2I2LA 3SWNB 4F7UF 5LJ5e 3AHUA 4M7DE 5GANd 2YLBA 4M78G 1Y96B 2YLCA 4XU0A 5GAOp 4PJOE 3JCMQ 3JB9G
chains in the Genus database with same CATH superfamily
3EGDB 1M1KR 2XDDA 5LJ5d 1VQ8A 2COWA 2FB7A 2DVJA 4JZ4A 3OS0A 3JCMP 3OYNA 3PVQA 2PU9B 1GBRA 5GAN2 3OSSC 1VQ5T 2KT1A 4M7DF 2F1LA 3RBBB 3RMQA 3VS6A 5L23A 3G6EQ 2YSQA 5I2SA 3E19A 1M3BA 2EQMA 2HAXA 4OGEA 1VQOQ 1VQKT 3A1PA 1UGSB 4IIOA 2ATCB 3PNWC 1VQ9T 2F5TX 1QVFA 2JMAA 2AZVA 4M75A 2L8DA 5GANj 3RDVA 2ZPBB 3X24B 4J9GA 4OMMA 3FJ5A 2R57A 3X20B 2W10A 4KUDK 4ELYC 2RK2A 1WHGA 1JO8A 5FRNA 1U1SA 1WPYA 2VWFA 2PVOB 3DKMA 3H41A 2KGTA 4M77C 1JQQA 1OPLA 1TS9A 1T3LA 5J3BA 2HL3A 3PFSA 1UHFA 3CCLA 2K3XA 3MJXA 1G3TA 2DFUA 1CSKA 1M2VB 1KHCA 2CZ6B 4B6MA 1MMDA 2M1HA 2HQHA 4LUEA 2RNAA 4B9XA 2PVDB 2EW3A 1ZSZC 2M51A 2VC8A 5HCKA 1KC8U 4KT0E 4PL6A 4BI4A 3LH5A 5FLXE 1RI0A 1FXXA 4LDUA 4MMKA 5KYYB 4GBQA 3ZBDA 2A0FB 3WVEB 1M90U 5D6WA 2HKQB 2XI9A 2JT4A 3CCRQ 1XNIA 2WSEE 4M78D 2C0IA 3QHSA 3META 1WDXA 1YJWA 2JM9A 4B9WA 4OMOA 3PIOA 4RTZA 4HT8A 1B7TA 2GBQA 4NL2A 3G6ET 4MZPA 1Q86R 2CP0A 3CPFA 2L3SA 1I5OB 2BIVA 4RTXA 5AT1B 2NUTA 5KCOA 3I5SA 3QJ6A 1UECA 4C5GA 5IHKA 2Y90A 2EYWA 1E6GA 3GOXA 3P8HA 3L2QA 5GMKi 3QIIA 1M2OA 4DBQA 2JW4A 4N0AC 5KYUA 3UATA 4F7UA 1D0ZA 1D1CA 5C0MA 4HXJA 2ENMA 4Q5WA 1IRXA 4C8QG 2E65A 2KNBB 2VXFA 4KBMB 4QVCA 2C0TA 3BY7A 1X27A 4TVRA 2HNIA 4C92D 3PMTA 1T0JA 2LNVA 4FW2A 2JXBA 2D1XA 3CCUT 4Z88A 2V1QA 3JCMW 1Y07A 2DL4A 2ED1A 2OTLA 2DEQA 2V8JA 2O31A 3LH0A 1YFNA 3E9GA 2CUDA 1BI0A 5D7UA 2QA4A 4M7DE 2LJ3A 4E7HA 1VYTA 4OMPA 2QQAA 4ZTFA 2DERA 2MF2A 1QVFP 2A3LA 2K5FA 3JB9H 3A5ZB 1YJNT 3I56A 3V8LA 4WF2A 4PJOG 2KRSA 2QQSA 1VQ9Q 1Y96A 1TUCA 1K73R 2E5QA 2H3EB 5I21A 1K73U 2RF0A 2E6ZA 1FX7A 2O88A 2ESWA 2O9SA 3G4ST 5LJ5h 1VQ6Q 5EC7A 4NS5A 2P0KA 1UJ0A 4EMKA 2G3RA 5GANg 3CCVT 1X69A 2DJZA 2DL5A 2EQKA 1TU0B 3CCST 3X25B 5A0DA 2P84A 4E7LA 4N0AA 3PE0A 1K8AC 2V8IA 2PUOB 3OYLA 5LL6S 4GLMA 3VUBA 2DNUA 1Y71A 3RR6A 5GANf 2YDLA 2RQRA 2Z0WA 3J81E 2E70A 3OMGA 4E6RA 2DJQA 4JJDA 3I55A 1RACB 3KXTA 1HSQA 3HHTB 3P8BB 4M7DB 1GBQA 1X75C 4QVDA 4F16A 2EGEA 2EJGA 4J7FA 2KRNA 2CS7A 3G1JA 2QTVA 1KG1A 3CCSA 1UDLA 1AZEA 3L2UA 3CCRT 1C1AA 2A36A 1WFWA 2AIRB 5LJ3d 1NLOC 4KUIA 3OS2A 5A0GA 4JRKA 2JS0A 2LP5A 2GCXA 2HBWA 1K9AA 4JJCA 4F04B 3QWYA 5AYFA 4NOYA 4BDZA 1QP2A 5GAN7 2V26A 1YCYA 3OBWA 3M0RA 4D6WA 1HXDA 3RKWA 2QTXA 3CCMQ 1JXMA 3C0CA 2IG0A 4C92F 1SPKA 4D8DA 4XTYA 1N9RA 1BBZA 2JUFA 5LJ5e 3UF4A 4JS4A 1ABQA 3HTRA 2XIDA 1VQ5A 1SKUB 2ABLA 2F2VA 3H0IA 2J05A 4HT9A 4M7AC 4R55A 2QEXT 1PSFA 2ZPGB 3HPWA 1D1AA 5KYUB 2EBPA 3QUIA 2YXYA 1LOJA 3OBYA 5DM7R 3EG0A 4JRQA 4LE9A 2OX7A 3E1SA 1K8AR 4RMOA 1YI2A 3RESA 2M16A 3DB3A 1PD1A 4E47A 1VQ9A 2VVKA 1YJNA 1VQNA 1NYFA 5DY9A 1I07A 2CT3A 3PT9A 4M75D 3V7RA 3GBQA 2LCCA 1W6XA 3J80E 3HL8A 1NYGA 4V2SA 5GANe 2DXBA 2PZ1A 2DZ9A 5I2MA 2ZPIB 1ZHIA 3N5BB 2DAQA 4M4ZA 5IHNA 3RUXA 3JSCA 1M27C 1RAHB 3QDFA 4HCZA 1BI2A 2ECZA 4J9HA 3R6NA 1Q81C 4WCIA 3V7SA 3JCMg 4OP0A 5KYYA 1KD1R 2ROLA 1YWOA 2LQ8A 2YRVA 4ORZA 2OTJQ 1MHNA 4M7DD 2SEMA 3QKJA 1UE9A 2LRQA 3OYJA 4EPCA 2HSEB 1KC8C 3QG1A 2DRMA 2YUNA 2GQIA 4ZGJB 2DM1A 3CC2Q 4J5YA 4BI8B 3I5RA 3LYIA 3F70A 2RO0A 3VUZA 1EZZB 5CIUA 4XTVA 2FPDA 5ECAA 2PUKB 4PJOE 2XICA 3CCQT 2KXDA 2BZYA 5LJ5g 5GMKl 3SFMA 4E7SA 3OYEA 2C0OA 8ATCB 3EFOB 2MWPA 3JCMJ 2D9TA 3CCSQ 1X01A 4J6YA 5GAN6 1CKAA 1ZUYA 4LUDA 4EMKC 4FYVB 4RTUA 4FIBA 1MMAA 3CMAQ 3H9NA 2LJ1A 3INZA 4M77G 2CZ0B 3QDRB 2LDMA 2DO3A 3JRZA 1SF9A 5LJ3j 2E12A 5IN1A 5I11A 1XTDA 2QXFA 2FVUA 3CCET 2QQ9A 3L1AA 3GP8A 2LX7A 1M5Q1 2YRCA 4JZ3A 4C92G 4OGCA 1LJOA 4FYYB 2X51A 2A7YA 2RHZA 2I0NA 3CC4T 1MGQA 1AOJA 4PJLA 2ZCFB 1WXTA 1BIAA 4BY6C 1YIJT 2HMAA 1KD1C 3EG2A 2DBKA 1H3ZA 1WZOA 2OTLQ 1R8OB 3GF5A 5L8RE 1M30A 4F7UB 1W2BP 1SHGA 1B3QA 3JCMe 1U1TA 2K5IA 4FYWB 3FDRA 1PM3A 1O75A 4HVWA 3O5ZA 2MPXC 1UG1A 2DL3A 1H8KA 4IURA 2X35A 2R5AA 2KMTA 1X6BA 3EHRA 3VS2A 2K7AA 4DEYA 2G6FX 2Y4XA 2D8HA 4LDVA 1OX9A 5GAN5 3EG3A 5GJVB 1UJYA 1ZA1B 2NWMA 4DA4A 3CC2A 3PIPA 3G71Q 1Q86U 5HK0A 4IUQA 4Z02A 4OB0B 4M78G 1Y96B 3JB9D 3OW2P 4OMQA 2MAMA 4X9CA 2LX9A 3VRYA 1YBYA 1TG0A 3OB9A 1PCXA 3JCMV 3E9FA 2Y4YA 4JRPA 5IT9E 2FG0A 3OYGA 3CQTA 4AFZC 1WQWA 1ZSZA 3CCJA 2EGAA 4M75F 1W2BA 5KYXB 1AWOA 1JRIA 1GFDA 4BUGA 3HRUA 4M7DG 1QWFA 4XQ3A 4II1A 3PTAA 2FO0A 3JCMh 4R56A 1VQLT 2RQTA 5KYWB 3H8ZA 4IUPA 5FWCA 5IAYA 2L5QA 3EG1A 1RUWA 2QDYB 3PMIA 2CGHA 3RKXA 1R0BG 3OYCA 1YJWT 2P4RA 2EIFA 2AT1B 4M77A 3CBMA 3RERA 3THKA 2CH4A 4BB7A 2RPNA 4M7DA 3EG9B 4JRIA 2DPPB 4NL3A 1SSFA 2E3IA 1WXBA 1AZGB 3TSZA 1VQLA 2QA4T 2RI5A 4ZTJA 4KGZB 2XHCA 1K1ZA 3M57A 2D6FA 4UC4A 1PG5B 5GAOm 2CP3A 2GNCA 4M77F 4XTXA 3LWHA 2GQVA 2FPEA 3JCMb 2VUBA 2RN8A 1AWXA 5GAN4 2EJ9A 2QQRA 3URGA 2QEXA 3OYMA 2DL7A 4CC4B 2GFUA 3DLLA 4J9EA 1KC8R 1OYXA 4XU0A 5CO7A 2YT6A 5GAOp 3JCMQ 1IGQA 1WGSA 2ZAEA 3EH2A 4C8QC 2JTMA 1WNLA 1LVKA 4FT2A 1D09B 3MEAA 2CZ1B 4CC7A 4YTLA 2K57A 3CCLQ 2RK1A 1K76A 2PTKA 1CKBA 2ZPFB 2R58A 1QKWA 2BE7D 1YJ9A 2D0QB 2M02A 3SWNA 1Z9QA 5CKFA 1WIEA 3EGDA 3FIFA 1KQ1A 1KD1U 4PLLA 1G3SA 2DK3A 3JB9F 2FL7A 3QSUA 4J7IA 1MNDA 1QP3A 3BDUA 2FRYA 5D6YA 1GXIE 3M0TA 1K0XA 1S72A 5KYWA 1Y57A 1WJRA 3C12A 1SRMA 2CREA 2DRKA 1F1BB 1DJ7B 2MK5A 4ZNXA 3OQ5A 4E7ZA 7AT1B 3DB4A 1M9SA 3WVDB 2B86A 1IXDA 5KYXA 4C92C 5CAIA 4KGVB 3X26B 1G5VA 4M78B 3CXCS 3MHXA 5GANh 2HQEA 1MNEA 5CK9A 4ELZC 2J6OA 3RKYA 4CI0C 1QQJA 2YWWA 5EG2A 4CC3A 1UHCA 2AKKA 1NLPC 1ZQ1A 2O4XA 1S1NA 3C94A 2K2VA 4QQDA 2DF6A 3WXMB 2F5KA 2KDSA 2X9HA 3MP8A 3CCQA 1VQNQ 3M55A 3QBYA 2BTTA 4RG2A 3M4YA 1RLPC 2EKHA 4PJOA 1Q82R 1V76A 3LX7A 3O8VA 2KE9A 1KSWA 3ASKA 5FU6C 3CPWA 1U5SA 1YI2T 1LPLA 3FC3A 3JCMd 2DEUA 4A4FA 1UEBA 2OI3A 1UUEA 2ZPHB 2VGNA 3TEEA 1VQNT 1Q81U 2FZCB 3CCEQ 3MO8A 3KBGA 3JB9I 4M78C 4M77B 2FZKB 1I0CA 4O6JA 4PLIA 2OJ2A 2OTJA 1VQOT 5CKBA 3CCJQ 1K9MC 1XJWB 1AWWA 1OZ2A 4HVVA 5KH6A 3OYDA 5CKHA 3TSWA 4KH1B 1B07A 4PJOF 4FL6A 4AG1C 3EH1A 1BU1A 2LTOA 3L2RA 3OYHA 1H641 3JCMf 5IXFA 4BE2A 1N5ZA 3OS1A 1J3TA 1UGVA 3NTHA 1I5LA 1NE8A 4X1VA 1VQPT 4AFUC 2K3YA 2CP7A 2LNHB 4Y28E 4OB3B 2NUZA 3QZ9B 2EAYA 3OS5A 5CQXA 2RD1A 4JS5A 1WI7A 4BY6B 1PC0A 4JLIA 5LJ3h 3QPHA 1OV3A 2AHJB 3HFOA 2K5LA 3QWXX 1NPPA 1UB4A 3REBB 3HSBA 2GF7A 4CC2A 4FW1A 3G71A 1RAAB 1G8XA 4RG8A 4LNPA 3A8OB 5HKCA 3I55T 4JUVA 2JM8A 2M0OA 4M75G 4JLGA 1GCQC 1I1JA 4DOVA 3EFRA 2JS2A 1VQ6T 1RAEB 4VUBA 4OVAA 1QKXA 2KK4A 1VIFA 2K79A 2EFIA 2A28A 4D8KA 2K4YA 2QA4Q 2VB6A 3NFCA 4R0KA 1YITT 4ATOA 2YHTA 2DTOA 3E2UA 2B8AA 2LCLA 4HCKA 1NJIR 1PHTA 2BKDN 4RTYA 1YIJQ 1KQSA 2GFAA 1VQKA 1Q81R 2KSSA 3CC7T 5GAMd 1OULA 2X3XD 1K8AU 3M56A 5J39A 1NG2A 3A8GB 3EGXA 4LDXA 2CKKA 2CT4A 1U3OA 4PKCC 2EKOA 1M1KC 2OAUA 1OQKA 2KYBA 5IXBA 1YITA 4IKFA 2KYMA 4C0GA 1BCOA 4PNOA 2P0QA 1JJ2S 1ZSZB 1TWBA 1HD3A 3M5AA 2KR3A 4N4GA 2NUPA 3RIRA 3U23A 4OMNA 2DIGA 4ZGEB 1GFCA 4X34A 1NJIU 3VS0A 3I55Q 3NHNA 4M7AE 3OYAA 3CMEA 2J7IA 3EGXB 3CD6A 2LQKA 2XDPA 3NTKA 2XDBA 2JN0A 5KCHA 3CC2T 3EFOA 3CCQQ 1D0XA 3VYGA 4J9BA 1I4K1 1Q7YU 2LZ6B 2X4XA 1M8MA 1WHMA 3D7SB 3UPUA 1OU8A 2DYIA 4RCCA 1W4SA 4C5IA 1RI9A 2RHUA 1RAFB 1QWEA 2L3PA 3A8MB 4DOWA 1VYVA 3MKDA 1M8VA 2L0AA 1YIJA 1SSHA 2VYTA 4XU2A 1VQPQ 1UTIA 2QDLA 3QXEB 3G71T 1BI3A 1GL5A 3UT1A 2MI6A 5IH2A 4C8QF 3MPUB 1RLQC 2RHXA 3CCJT 3G6EA 1Y0MA 3ZL7C 4BD3A 3CCLT 1D1BA 1P92A 1AVZC 2AZSA 3H0FA 3VS3A 1ACMB 1PD0A 1QVGS 1S72Q 4A54A 3LGLA 1WA7A 5IHIA 1Q7YR 2CSQA 4JDSA 1YCSB 1K9MR 2MYSA 5GAOl 4M7DC 2JZ2A 3MP1A 3HKSA 1RAGB 3M58A 4OB2B 1ZBJA 1YI2Q 5FU7B 4RKUE 4PJNA 1D0YA 3SD4A 2QK0A 3L42A 5LJ3g 1JJ2P 2JJ9A 4KGXB 1M4ZA 2E41A 3CMEQ 1H92A 1KQSS 1VA7A 2QEXQ 1AWJA 1M3CA 3CCMA 2AKLA 1SG5A 1PWTA 1ZUUA 5FWBA 3VYHB 2VKNA 4FU6A 2CUBA 4C8QD 4QVZA 2RJFA 4E7IA 1NEBA 3BFMA 3ULRB 2M0YA 2GTJA 3CCRA 1VQMT 3SEMA 3VU3C 3CMAT 2H8HA 3MP6A 9ATCB 3EG9A 4C92B 2C06A 1KFZA 1FMKA 1NM7A 1FMVA 4XTWA 1H3HA 2V1RA 4OF1A 4M75E 1K9MU 4ANJA 2WSFE 3OYBA 1TOVA 4C8QE 1G2BA 1M90C 4DEXA 1I8FA 1QLYA 2EGCA 4BACA 2LQWA 1VYUA 5GAOr 2HZYA 2QASA 3CD6T 3QO3A 5CKDA 2CZ7B 2PQWA 4M7AD 2DXCA 1YJ9T 4F7UG 4RUGA 4QW2A 2RA2A 3CBPA 1RL2A 4QQ6A 2CP6A 3JCMX 4RCBA 2F2WA 4PJOB 2J6KA 3VRZA 1JU5C 3G4SA 3CPWP 3SWNB 4OMLA 1QVGP 4P5NA 5GMKh 3CD6Q 1W2BS 1HK9A 2CYZB 3CCVA 5KE3A 2DIQA 1EX4A 5LJ5f 2DXUA 3T9NA 2A37A 4A4GA 4J6XA 2DXTA 2L2PA 2IVWA 2EQIA 2FZGB 3OY9A 4XU3A 4J83A 1OOTA 3I35A 1TH7A 1KJWA 4E2FB 3QJYA 1OEBA 1Y7XA 2A08A 5FROA 2JVVA 5FRMA 2XKOC 1VOMA 2KT8A 2RMOA 1OX8A 1VQ8Q 2EPDA 1JB0E 3OSVA 4FCYA 2LCSA 1WHLA 2D8JA 3TU4K 1OI1A 4C8QA 3OW2S 2MWOA 2XMFA 1M2VA 4ZN1A 1SEMA 2X4YA 4C0FA 3NMZC 2CDTA 2HSPA 4C5EA 2WSCE 4LXCA 3OYIA 3FRNA 1WXUA 2DYBA 2ZZDA 1WLPB 2E6NA 5HK3A 1VQ6A 3A8LB 3RNJA 4M75B 1YHQQ 5J26A 2DL8A 2KBTA 4Z8AA 2DD4A 3V8KA 3CMAA 1B34A 1TUGB 2HD0A 4KH0B 3VS7A 2OAWA 2J6FA 1E7OA 2LJ0A 4AMCA 3TREA 2RQWA 5GMKe 1OZ3A 3EAEA 4IUUA 1QVGA 5CVIA 2LMJA 2NYSA 1VQKQ 3UA6A 2RH2A 4QKUA 4RTTA 4C92E 2HCKA 2HDAA 3AHUA 2ROTA 2EQUA 2EYZA 2DMOA 4IUTA 3JB9G 2DD5A 2EWNA 1ZUKA 4J6WA 1WHKA 3KUFA 2L3QA 2K6DA 1VIEA 2PVGB 3P8DA 1ABOA 1W1FA 4JJBA 4C92A 3JCMc 4PJJA 1M3AA 3GNGA 2XD0A 2KQWA 3SB2A 2P0PA 4IIMA 5GJWB 4C5HA 1MMGA 2NUTB 2FHDA 5CKEA 2HEQA 1QCFA 4A53A 5CR2A 2LT4A 1BI1A 4J9IA 2KXCA 3M54A 2DBMA 2RHYA 4O5VA 5HY6A 4HVUA 1IGUA 3NTIA 2COYA 5DLOA 2EYYA 4IUVA 4XTZA 1ZA2B 1AT1B 2F2XA 4M78E 3VKIA 2YUPA 1I81A 3VS1A 2K9GA 4RTWA 3AT1B 2BE9B 2NLUA 3PGGA 5LJ3e 3FLGA 1K4US 3OW2A 1GRIA 1QCNA 1YJNQ 4N4IA 1VQMQ 2GGRA 4F14A 3RMSA 1BYMA 4M78A 5FU7C 2BUDA 2JMCA 4C0DB 4ESRA 4PJOD 1PRMC 5GAMf 2DTHA 2KAFA 3BDLA 3OYKA 3FB9A 1YN8A 1YHQA 1YITQ 3GIBA 1PSEA 1PRLC 1WHJA 1VQ7Q 3CC7A 1IZ6A 4XU1A 4Y92A 4EMKB 1Q7YC 4EDUA 2K2MA 1RADB 2MIOA 1W70A 4M7AF 1UFFA 4FSSA 2YLBA 1ZLMA 1OPKA 3TVTA 2D0NA 2SRCA 4JPBW 3L2WA 3M0UA 1WHHA 1AHJB 2BZ8A 3REAB 5D6XA 2DVEA 1TSFA 2QQBA 4DQ2A 2QGGA 2QYZA 1LNXA 1ZSGA 3LGFA 1XQHA 4FYXB 2ED0A 3TQ7P 4M75C 2VV5A 4EMHA 2JNGA 3CCMT 1G3WA 4M77E 1NJIC 1KIKA 1WYXA 4XK8E 3G7ZA 4HCCA 2E4HA 5LJ3f 1N8RC 3LWIA 4J9DA 4XTUA 1YP5A 2YUQA 1U06A 1IB8A 1LCKA 2DZCA 2EVRA 3M4GA 3GNFB 4BE0A 1ARKA 3GPLA 1K73C 2E5KA 1JJ2A 2K3BA 4GY5A 4M77D 6AT1B 2FPFA 3HP9A 4BE1A 2L3RA 1IREB 3EHQA 2QGFB 4A63B 1QVPA 2CP5A 4DBRA 1PKTA 2DX1A 1Q82C 1X43A 2KVQG 2PNIA 4A4EA 4K11A 3MEVA 1E6HA 1Q95G 3CCVQ 1SHFA 2FEIA 1QCOA 4F17A 1G83A 1N9SA 2DKGA 3UWNA 2X3WD 3DLMA 4PFOA 3JB9J 1R0CB 2DETA 2AK5A 1ZBXA 2P4TA 3FEOA 4FSXA 1WJSA 3CXCP 2XU8A 2X4WA 1X6GA 5GAMh 3C95A 2RI2A 5KE2A 2RJCA 1VQ7A 3S3OA 4LDWA 4L5GA 2W0ZA 4E7KA 3QYGB 2QI2A 2V8KA 4AFQC 2O4XB 2XK0A 1T0HA 3LW5E 1Z9ZA 2YRDA 1AEYA 2KY9A 2ZGWA 3OYFA 1VQ4A 4J8OA 4RTVA 4PFPA 2HKNA 3EFSA 1SRLA 2NUPB 4J9FA 1IO6A 1K0SA 4ZN3A 3S3NA 3V7CA 2HBPA 1VQ8T 2HL5C 4MZTA 1VQLQ 3CPWS 4WTOB 3M0PA 5GMKm 3MEUA 2EQJA 1MV3A 2CH4W 4LN2A 2LVMA 2M9UA 1OU9A 4M7AG 3ZEHA 2JTFA 4L59A 3NPFA 4FM4B 4FT4A 1NPRA 4XAXB 4A4HA 1VQ4T 1EFNA 1V1CA 3CCEA 4Y91A 4C0DC 1VUBA 2H3JA 3UDCA 2VGMA 5CQYA 3BW1A 4AFSC 1YWPA 3M0SA 5FW9A 5GAMe 2R5MA 1VQ5Q 3SDZA 1X6OA 3OA6A 1GCQA 1BCMA 1X2QA 4PJMA 5C6SA 2RQUA 5GAOn 1RABB 4JJNK 1D3BA 2LQNA 4DBHA 2DTIA 1YJ9Q 1QMCA 1MV0B 3SWNC 4HA8A 4MDWA 1JXOA 2RM4A 2DILA 2X4JA 2KI7A 3M9QA 2QG9B 1O9SA 5GAOq 1VQ4Q 3CEYA 2OTJT 2O9VA 1B34B 1BIBA 3Q1JA 1M1GA 1TTHB 3ER0A 3VV0A 3ZFJA 2JTEA 1JEGA 2WACA 4LDYA 3QZ5B 2EJFA 3OMCA 2MOXA 2E3HA 1RAIB 5FU6B 3FJPA 4EIKA 1T3SA 1FMWA 1FWZA 3X28B 1Q82U 4HKEA 3A8HB 3JAME 1QVFS 1KK7A 2OTLT 1KHIA 3A98A 3QYHB 3CC4Q 4QT7A 1VQ7T 1NEGA 3J7AF 2VXEA 3PVLA 2O2OA 3VS4A 2O01E 1VQPA 2IIMA 2VASA 4AT1B 1A0NB 5A2QE 4EMGA 4BI3A 1KQ2A 1WJQA 1N8RR 3R6OA 1N8RU 2RQVA 3I56Q 3HFNA 3LLRA 4QQGA 4C8QB 2F69A 4CRIA 2QAZA 5DLQE 1M90R 5LJ5j 4LD9K 1TUDA 1QW1A 1M1KU 2RI3A 3ME9A 1R77A 5M9OA 3VS5A 8AT1B 3S3MA 1YNZA 2ZPEB 2DLPA 4LD6A 4OMFB 1BB9A 1NZ9A 1ZX6A 1MMNA 4KULA 3UA7A 5GMKj 4E7JA 2YUOA 1S72T 2DE0X 2XG8D 5GAMg 3MCAB 1VQMA 4F7UE 5GAN8 2FYKA 4L6V5 3SHWA 2RHIA 1FYNA 1PKSA 3I9QA 3C4SA 4PK4A 2JOYA 4J9CA 1VQOA 1IHWA 5CCAA 1G3YA 3L2ZA 3CXCA 5GAN3 2L89A 2I2LA 4F7UF 3MEWA 1C6VX 2MCNA 1N6AA 5GANd 2RJDA 1UGPB 4ME7A 2YLCA 1TXQA 4BDYA 1UGQB 3CCUA 5A0LA 3M59A 1X2KA 4C0ZA 4GLKA 4X9DA 1PNJA 3NGPA 1HYOA 4KRTA 4DBFA 3M53A 3M0QA 1JBMA 1BK2A 3BE3A 3CBOA 4MZMA 4HCBA 3VJPA 1GCPA 2CSIA 2BZXA 3CC4A 3I56T 3HRSA 2J06A 2EYQA 3G4SQ 1UGRB 1NBEB 3IQLA 3TCJA 2COZA 4OB1B 2KRMA 3CMET 1IHVA 2E64A 1AD5A 3KFVA 1D3BB 4M7AB 1YHQT 1C0MA 2LC4A 4PFZA 2KROA 3L2VA 2E10A 3CC7Q 1EIFA 4A4KA 1M1FA 3H6ZA 3HRTA 1U8RA 1Q86C 2KEAA 4N4HA 4M7AA 2GTOA 3EGUA 1KQSP 2EYXA 2RB6A 4Z89A 4PJOC 3V8JA 2CP2A 2IPOB 3CCUQ 2FRWA 2HQXA 1MUZA 3GLXA 1HJDA 1YJWQ 4ZGDB 1V29B 5KYNA 2DA9A 2MMPA 4AG2C 5GAMj 1XOVA 4MDXA 2E1HA 3S6WA 1BKBA 5I22A 3JV3A 4M78F 4MMLA 1WQ7A 3OYYA 1WX6A 2RJEA 2LT1A 3H0HA 1N27A
chains in the Genus database with same CATH topology
3NFCA 1YITT 4ATOA 2YHTA 2DTOA 3L2WA 5LJ5g 5GMKl 2XDDA 1AHJB 2B8AA 2LCLA 3SFMA 5LJ5d 3OYEA 5D6XA 2MWPA 3JCMJ 2DVEA 2D9TA 1VQ8A 2QQBA 2FB7A 2BKDN 1X01A 4J6YA 4DQ2A 3OS0A 1LNXA 3JCMP 1KQSA 2GFAA 5GAN6 3OYNA 3LGFA 1VQKA 2KSSA 3CC7T 1XQHA 5GAMd 2PU9B 1K8AU 3M56A 4M75C 5J39A 3A8GB 5GAN2 2VV5A 3OSSC 4EMKC 4LDXA 4EMHA 2JNGA 1VQ5T 2CKKA 3CCMT 4M7DF 4FIBA 4PKCC 1G3WA 4M77E 2EKOA 1NJIC 3RMQA 4XK8E 3G7ZA 3INZA 5LJ3f 4HCCA 4M77G 2CZ0B 3QDRB 1N8RC 1M1KC 2OAUA 3LWIA 2LDMA 2DO3A 3JRZA 5LJ3j 4XTUA 1YITA 2E12A 5IN1A 1XTDA 2QXFA 2FVUA 3CCET 4IKFA 2QQ9A 3L1AA 4C0GA 5I2SA 3GP8A 2DZCA 1M5Q1 3M4GA 3GNFB 4PNOA 4BE0A 3E19A 3GPLA 4C92G 2EQMA 1K73C 4OGCA 2P0QA 1JJ2A 1LJOA 1JJ2S 2HAXA 4OGEA 2A7YA 1VQKT 3M5AA 1UGSB 4GY5A 4N4GA 2RHZA 4M77D 3RIRA 3HP9A 3PNWC 2DIGA 4ZGEB 3CC4T 1MGQA 1VQ9T 4BE1A 2L3RA 1IREB 2F5TX 2ZCFB 1QVFA 4X34A 4M75A 5GANj 2L8DA 1NJIU 2ZPBB 1BIAA 3X24B 4BY6C 1YIJT 1KD1C 1QVPA 4M7AE 1H3ZA 3OYAA 2R57A 3CMEA 1R8OB 3GF5A 3X20B 3CD6A 2LQKA 4KUDK 5L8RE 4ELYC 2XDPA 2RK2A 3NTKA 4F7UB 2XDBA 5FRNA 2JN0A 1U1SA 5KCHA 3CC2T 1WPYA 2PVOB 3DKMA 3JCMe 1U1TA 4M77C 1Q82C 2K5IA 3VYGA 1I4K1 1Q7YU 2X4XA 2KVQG 3FDRA 5J3BA 3PFSA 4A4EA 1O75A 3CCLA 2K3XA 3UPUA 1G3TA 3MEVA 4RCCA 1W4SA 4C5IA 2RHUA 4IURA 2X35A 2R5AA 2CZ6B 1KHCA 3A8MB 4DOWA 2M1HA 1N9SA 2DKGA 3UWNA 2KMTA 3DLMA 3JB9J 1M8VA 1YIJA 2VYTA 1ZBXA 4XU2A 2Y4XA 2P4TA 4LDVA 4B9XA 3FEOA 2PVDB 1BI3A 2VC8A 3QXEB 4FSXA 5GAN5 3G71T 1WJSA 1KC8U 4KT0E 3UT1A 2MI6A 2X4WA 2XU8A 4PL6A 5GAMh 4DA4A 4C8QF 3C95A 2RI2A 3CC2A 3PIPA 1Q86U 5KE2A 2RHXA 3CCJT 4BI4A 2RJCA 5HK0A 4IUQA 3G6EA 1VQ7A 4Z02A 4OB0B 5FLXE 4M78G 1Y96B 1RI0A 3S3OA 1FXXA 4LDWA 3JB9D 4LDUA 4BD3A 4L5GA 4MMKA 2MAMA 4E7KA 3CCLT 3ZBDA 4X9CA 1P92A 2LX9A 3QYGB 2QI2A 1YBYA 2V8KA 3WVEB 2O4XB 3OB9A 2XK0A 1M90U 3JCMV 1QVGS 5D6WA 4A54A 3LW5E 3LGLA 3E9FA 2XI9A 2KY9A 2Y4YA 1XNIA 2ZGWA 3OYFA 4JRPA 1VQ4A 5IT9E 2WSEE 4J8OA 4M78D 4JDSA 3QHSA 3META 3OYGA 5GAOl 1YJWA 4M7DC 2JZ2A 3EFSA 3MP1A 3HKSA 1WQWA 4B9WA 3M58A 3PIOA 4HT8A 4OB2B 3CCJA 4M75F 4NL2A 3G6ET 4MZPA 5FU7B 1W2BA 4RKUE 4ZN3A 3V7CA 1JRIA 3S3NA 3SD4A 2HBPA 4BUGA 1VQ8T 3HRUA 3L42A 4MZTA 3CPFA 3CPWS 5LJ3g 4M7DG 2BIVA 5GMKm 4XQ3A 1M4ZA 2E41A 5KCOA 4II1A 3MEUA 2EQJA 3PTAA 3JCMh 4R56A 3QJ6A 1KQSS 1VQLT 4C5GA 2LVMA 2M9UA 3CCMA 4M7AG 3H8ZA 3ZEHA 2JTFA 4IUPA 4L59A 4FM4B 4FT4A 5IAYA 1NPRA 4XAXB 2L5QA 2Y90A 4A4HA 1VQ4T 3VYHB 3PMIA 2QDYB 4FU6A 2CGHA 3RKXA 4QVZA 4C8QD 2RJFA 4E7IA 3GOXA 3BFMA 3CCRA 3OYCA 1VQMT 1YJWT 3P8HA 2EIFA 3L2QA 3VU3C 3QIIA 5GMKi 3CMAT 4M77A 3CCEA 4Y91A 3MP6A 3CBMA 4C0DC 1VUBA 3RERA 4N0AC 2H3JA 4BB7A 4M7DA 3UDCA 2VGMA 5CQYA 4C92B 2C06A 3BW1A 4JRIA 4F7UA 4XTWA 2DPPB 4NL3A 5GAMe 1SSFA 2R5MA 5C0MA 4OF1A 4M75E 3SDZA 1X6OA 4Q5WA 3OA6A 1K9MU 4C8QG 1VQLA 2QA4T 2WSFE 2E65A 2RI5A 4ZTJA 3OYBA 2VXFA 4KBMB 2XHCA 4C8QE 3M57A 5C6SA 2D6FA 4UC4A 5GAOm 1M90C 4QVCA 5GAOn 3BY7A 1I8FA 4M77F 4XTXA 4TVRA 3LWHA 2HNIA 4JJNK 2GQVA 4BACA 1D3BA 4C92D 3PMTA 5GAOr 2LNVA 3JCMb 2DTIA 2VUBA 3CCUT 3SWNC 4HA8A 3CD6T 3QO3A 4MDWA 5GAN4 2RM4A 5CKDA 2CZ7B 2PQWA 1Y07A 2EJ9A 2QQRA 3JCMW 2DXCA 4M7AD 2X4JA 2DEQA 2V8JA 3URGA 4F7UG 3M9QA 1YJ9T 2OTLA 3LH0A 4QW2A 2RA2A 3CBPA 1RL2A 4QQ6A 3JCMX 3OYMA 4RCBA 2QEXA 4PJOB 1O9SA 5GAOq 2GFUA 3DLLA 3E9GA 3CEYA 2OTJT 1BIBA 1B34B 1BI0A 3Q1JA 1M1GA 3G4SA 3ER0A 3SWNB 3VV0A 3ZFJA 2QA4A 4M7DE 4E7HA 1OYXA 4XU0A 5CO7A 5GAOp 3JCMQ 4P5NA 2WACA 2QQAA 4ZTFA 5GMKh 1WGSA 1W2BS 2MF2A 1HK9A 4LDYA 2EJFA 2JTMA 1WNLA 2A3LA 3QZ5B 2CYZB 3MEAA 2K5FA 3OMCA 2DIQA 4FT2A 3A5ZB 5KE3A 3CCVA 3JB9H 2CZ1B 5FU6B 3FJPA 5LJ5f 2DXUA 4YTLA 3T9NA 2K57A 1YJNT 3I56A 3V8LA 4A4GA 4J6XA 4WF2A 1FWZA 2RK1A 3X28B 1Q82U 2DXTA 4HKEA 3A8HB 2ZPFB 3JAME 2R58A 4PJOG 1QVFS 2QQSA 2IVWA 2D0QB 1KHIA 3OY9A 1YJ9A 2OTLT 4XU3A 3QYHB 4J83A 5CKFA 3SWNA 1VQ7T 1Y96A 2E5QA 3J7AF 3FIFA 2VXEA 5I21A 1K73U 1KQ1A 1FX7A 1TH7A 2E6ZA 2O01E 1VQPA 1KD1U 3QJYA 3G4ST 4PLLA 1G3SA 1Y7XA 5A2QE 5FROA 4EMGA 2JVVA 5LJ5h 2DK3A 5FRMA 4BI3A 2XKOC 1KQ2A 4NS5A 2P0KA 3JB9F 2FL7A 1WJQA 4J7IA 3QSUA 3R6OA 1QP3A 3BDUA 5D6YA 1GXIE 4EMKA 1N8RU 2G3RA 5GANg 3CCVT 2DJZA 2EQKA 3HFNA 3LLRA 4QQGA 1S72A 3OSVA 1JB0E 4C8QB 3TU4K 3CCST 1OI1A 1WJRA 3X25B 2F69A 3C12A 4C8QA 4CRIA 5A0DA 3OW2S 4E7LA 1DJ7B 2MWOA 4N0AA 3OQ5A 4ZN1A 1K8AC 3DB4A 1M9SA 2V8IA 2PUOB 5DLQE 5LL6S 3OYLA 3WVDB 3VUBA 1Y71A 2X4YA 4C0FA 5LJ5j 5GANf 4C92C 4LD9K 5CAIA 1QW1A 3J81E 2RI3A 1M1KU 2E70A 3OMGA 3ME9A 4C5EA 5M9OA 3I55A 2WSCE 3X26B 3KXTA 3HHTB 3S3MA 1G5VA 4M78B 3P8BB 3OYIA 3FRNA 3CXCS 4M7DB 3MHXA 5GANh 1X75C 2HQEA 2ZPEB 4LD6A 4OMFB 4QVDA 5CK9A 1NZ9A 2ZZDA 5HK3A 2E6NA 4KULA 2EJGA 5GMKj 1VQ6A 4ELZC 3RKYA 4J7FA 4CI0C 4E7JA 5EG2A 3A8LB 2CS7A 1S72T 1KG1A 3CCSA 2XG8D 4M75B 3L2UA 3CCRT 5GAMg 3MCAB 1ZQ1A 2O4XA 5J26A 4F7UE 1VQMA 5GAN8 3C94A 3V8KA 2DD4A 2K2VA 3CMAA 4QQDA 1B34A 2FYKA 2HD0A 3WXMB 2F5KA 4L6V5 5LJ3d 2KDSA 2RHIA 4KUIA 3MP8A 3OS2A 5A0GA 3CCQA 3C4SA 4JRKA 3TREA 2JOYA 2GCXA 3M55A 5GMKe 1OZ3A 3QBYA 3EAEA 4IUUA 1VQOA 1QVGA 5CVIA 5AYFA 4RG2A 5CCAA 4NOYA 1G3YA 1QP2A 3M4YA 5GAN7 4BDZA 4PJOA 1YCYA 2RH2A 3L2ZA 3OBWA 4D6WA 3LX7A 3O8VA 1HXDA 3RKWA 2QTXA 3ASKA 5FU6C 2IG0A 4C92F 3CXCA 4C92E 4XTYA 5GAN3 1N9RA 2L89A 3CPWA 1YI2T 2JUFA 3FC3A 3JCMd 2I2LA 4A4FA 1UEBA 3MEWA 4F7UF 5LJ5e 4JS4A 3AHUA 1N6AA 5GANd 2RJDA 1UGPB 2EQUA 2YLCA 4ME7A 2XIDA 4BDYA 1VQ5A 1UGQB 4IUTA 3CCUA 3JB9G 2DD5A 2EWNA 2ZPHB 2VGNA 3TEEA 1VQNT 4J6WA 1Q81U 4M7AC 4HT9A 5A0LA 3MO8A 3KBGA 3M59A 3KUFA 3JB9I 4R55A 1VIEA 4C0ZA 4M78C 4M77B 2QEXT 1PSFA 2PVGB 4GLKA 4X9DA 2ZPGB 4O6JA 3HPWA 3P8DA 4PLIA 2OTJA 4C92A 5CKBA 1VQOT 1K9MC 3JCMc 3M53A 1OZ2A 3GNGA 3QUIA 2XD0A 1LOJA 3OBYA 5DM7R 4JRQA 5KH6A 1JBMA 3OYDA 3E1SA 5CKHA 3CBOA 2KQWA 4PJOF 3SB2A 4MZMA 4RMOA 1YI2A 2P0PA 4FL6A 3RESA 2M16A 4HCBA 3VJPA 2LTOA 3DB3A 4C5HA 4E47A 3L2RA 1VQ9A 3CC4A 1YJNA 3I56T 3HRSA 3OYHA 2EYQA 2FHDA 1VQNA 1H641 5DY9A 3JCMf 1UGRB 5CKEA 3PT9A 4M75D 3V7RA 4BE2A 3TCJA 4A53A 4OB1B 5CR2A 2LCCA 3OS1A 2LT4A 1BI1A 3CMET 3J80E 3HL8A 3M54A 3NTHA 4V2SA 1I5LA 5GANe 1NE8A 2DXBA 4O5VA 2RHYA 1VQPT 2E64A 2DZ9A 5I2MA 2K3YA 5HY6A 2ZPIB 3NTIA 4Y28E 5DLOA 4OB3B 4IUVA 4XTZA 1ZHIA 3N5BB 3QZ9B 1D3BB 2DAQA 2EAYA 3OS5A 5CQXA 4M7AB 2RD1A 4JS5A 4M78E 2LC4A 1YHQT 3RUXA 3VKIA 4BY6B 3JSCA 1I81A 4JLIA 5LJ3h 3QPHA 4HCZA 2AHJB 1BI2A 3HFOA 1Q81C 2K5LA 3L2VA 3V7SA 1NPPA 1UB4A 3JCMg 2E10A 4OP0A 3HSBA 1EIFA 4A4KA 1M1FA 2LQ8A 2NLUA 2YRVA 3H6ZA 3FLGA 3HRTA 2GF7A 3PGGA 5LJ3e 1U8RA 1MHNA 3OW2A 1Q86C 4M7AA 4N4HA 4N4IA 4M7DD 3G71A 3OYJA 3QKJA 2LRQA 4RG8A 4EPCA 3RMSA 1BYMA 3A8OB 1KC8C 4M78A 2RB6A 5FU7C 5HKCA 3I55T 2BUDA 4PJOC 3V8JA 3QG1A 4JUVA 2HQXA 4C0DB 4ZGJB 4PJOD 2M0OA 5GAMf 3GLXA 4JLGA 2DTHA 2KAFA 3BDLA 4M75G 1V29B 3FB9A 4ZGDB 3OYKA 4C8QC 2MMPA 1YHQA 4DOVA 3GIBA 1PSEA 3EFRA 5GAMj 1XOVA 4J5YA 4BI8B 1VQ6T 4MDXA 2E1HA 3LYIA 3CC7A 4VUBA 1IZ6A 3S6WA 1BKBA 3F70A 4OVAA 2RO0A 3VUZA 4XU1A 2KK4A 4M78F 4MMLA 4EMKB 1WQ7A 1Q7YC 4EDUA 1VIFA 5CIUA 2EFIA 4XTVA 4M7AF 3OYYA 2PUKB 2YLBA 2K4YA 2RJEA 2LT1A 2XICA 3CCQT 4PJOE 1N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  4MMK A;  5GMK h;  2YHT A;  1HK9 A;  4J6W A;  4X9C A;  2DTO A;  2EJF A;  4C8Q C;  1WNL A;  5GMK l;  5LJ5 g;  4HT9 A;  5LJ5 d;  4M7A C;  3JB9 H;  3JB9 I;  3JCM J;  2DVE A;  3FJP A;  5LJ5 f;  2DXU A;  4M78 C;  3JCM V;  4M77 B;  2K57 A;  4DQ2 A;  2FB7 A;  4X9D A;  1X01 A;  4J6Y A;  4J6X A;  4WF2 A;  1LNX A;  3V8L A;  4A54 A;  3JCM P;  2DXT A;  5GAN 6;  4C92 A;  4PJO G;  3JCM c;  5GAM d;  2ZGW A;  4M75 C;  3QUI A;  4XU3 A;  3SWN A;  5GAN 2;  1LOJ A;  4M78 D;  4EMK C;  1Y96 A;  3QHS A;  1JBM A;  4EMH A;  3FIF A;  2VXE A;  5GAO l;  5I21 A;  3EFS A;  4M7D C;  4M7D F;  1KQ1 A;  1TH7 A;  1WQW A;  4PJO F;  3SB2 A;  4M77 E;  3RES A;  4HT8 A;  4M75 F;  4NL2 A;  4EMG A;  5LJ5 h;  3INZ A;  5LJ3 f;  3V7C A;  1JRI A;  4M77 G;  1KQ2 A;  3JB9 F;  3QSU A;  5LJ3 g;  5LJ3 j;  4XTU A;  4M7D G;  3BDU A;  1H64 1;  5DY9 A;  4XQ3 A;  3JCM f;  4EMK A;  5GMK m;  2E41 A;  5GAN g;  3L1A A;  2DJZ A;  4M75 D;  3V7R A;  3HFN A;  3JCM h;  4A53 A;  2DZC A;  4C8Q B;  1M5Q 1;  3M4G A;  4PNO A;  4C92 G;  4C8Q A;  4M7A G;  4V2S A;  1LJO A;  5GAN e;  1I5L A;  4N0A A;  2E64 A;  2DZ9 A;  2Y90 A;  4M77 D;  3RIR A;  2CGH A;  3RKX A;  4XTZ A;  4C8Q D;  5LJ5 j;  5GAN f;  1MGQ A;  3BFM A;  4C92 C;  2EAY A;  1D3B B;  4M7A B;  5CAI A;  2RD1 A;  4M78 E;  3VU3 C;  5GMK i;  3RUX A;  4M75 A;  5GAN j;  1I81 A;  4JLI A;  4M77 A;  5LJ3 h;  4Y91 A;  4M78 B;  3RER A;  1BIA A;  4M7D B;  4N0A C;  4M7A E;  5GAN h;  4M7D A;  3HFO A;  3V7S A;  3JCM g;  4C92 B;  3JB9 D;  3BW1 A;  2E10 A;  4QVD A;  4JRI A;  4OP0 A;  4F7U A;  3HSB A;  4XTW A;  4F7U B;  2EJG A;  4NL3 A;  5GAM e;  5GMK j;  3PGG A;  3RKY A;  5LJ3 e;  4M75 E;  2JN0 A;  1U1S A;  1WPY A;  4C8Q G;  3JCM e;  4M7A A;  2E65 A;  4M7D D;  1U1T A;  4M77 C;  2VXF A;  4M75 B;  4C8Q E;  1I4K 1;  5GAM g;  5GAO m;  4F7U E;  4QVC A;  5GAN 8;  4M78 A;  5GAO n;  2RB6 A;  1I8F A;  3BY7 A;  3V8K A;  1B34 A;  2FYK A;  4PJO C;  3V8J A;  4M77 F;  4XTX A;  5LJ3 d;  2HNI A;  4JUV A;  4RCC A;  1D3B A;  4C92 D;  4PJO D;  5GAO r;  5GAM f;  3JCM b;  2DTI A;  4M75 G;  2DTH A;  4JRK A;  3FB9 A;  1N9S A;  3SWN C;  2DKG A;  4HA8 A;  3GIB A;  3EFR A;  3QO3 A;  5GMK e;  5GAM j;  4J5Y A;  5GAN 4;  2RM4 A;  3JB9 J;  3JCM W;  1M8V A;  2E1H A;  2EJ9 A;  4M7A D;  2DEQ A;  4XU2 A;  4NOY A;  4F7U G;  5GAN 7;  4PJO A;  1YCY A;  2RA2 A;  4XU1 A;  2VC8 A;  3L2Z A;  4M78 F;  4RCB A;  3JCM X;  4MML A;  5GAN 5;  4EMK B;  4PJO B;  1HXD A;  1WQ7 A;  2QTX A;  3RKW A;  5GAO q;  4XTV A;  4C92 F;  4C92 E;  4XTY A;  5GAM h;  1B34 B;  1BIB A;  1N9R A;  4C8Q F;  5GAN 3;  4M7A F;  3JCM d;  2I2L A;  3SWN B;  4F7U F;  5LJ5 e;  3AHU A;  4M7D E;  5GAN d;  2YLB A;  4M78 G;  1Y96 B;  2YLC A;  4XU0 A;  5GAO p;  4PJO E;  3JCM Q;  3JB9 G; 
#chains in the Genus database with same CATH topology
 3EGD B;  1M1K R;  2XDD A;  5LJ5 d;  1VQ8 A;  2COW A;  2FB7 A;  2DVJ A;  4JZ4 A;  3OS0 A;  3JCM P;  3OYN A;  3PVQ A;  2PU9 B;  1GBR A;  5GAN 2;  3OSS C;  1VQ5 T;  2KT1 A;  4M7D F;  2F1L A;  3RBB B;  3RMQ A;  3VS6 A;  5L23 A;  3G6E Q;  2YSQ A;  5I2S A;  3E19 A;  1M3B A;  2EQM A;  2HAX A;  4OGE A;  1VQO Q;  1VQK T;  3A1P A;  1UGS B;  4IIO A;  2ATC B;  3PNW C;  1VQ9 T;  2F5T X;  1QVF A;  2JMA A;  2AZV A;  4M75 A;  2L8D A;  5GAN j;  3RDV A;  2ZPB B;  3X24 B;  4J9G A;  4OMM A;  3FJ5 A;  2R57 A;  3X20 B;  2W10 A;  4KUD K;  4ELY C;  2RK2 A;  1WHG A;  1JO8 A;  5FRN A;  1U1S A;  1WPY A;  2VWF A;  2PVO B;  3DKM A;  3H41 A;  2KGT A;  4M77 C;  1JQQ A;  1OPL A;  1TS9 A;  1T3L A;  5J3B A;  2HL3 A;  3PFS A;  1UHF A;  3CCL A;  2K3X A;  3MJX A;  1G3T A;  2DFU A;  1CSK A;  1M2V B;  1KHC A;  2CZ6 B;  4B6M A;  1MMD A;  2M1H A;  2HQH A;  4LUE A;  2RNA A;  4B9X A;  2PVD B;  2EW3 A;  1ZSZ C;  2M51 A;  2VC8 A;  5HCK A;  1KC8 U;  4KT0 E;  4PL6 A;  4BI4 A;  3LH5 A;  5FLX E;  1RI0 A;  1FXX A;  4LDU A;  4MMK A;  5KYY B;  4GBQ A;  3ZBD A;  2A0F B;  3WVE B;  1M90 U;  5D6W A;  2HKQ B;  2XI9 A;  2JT4 A;  3CCR Q;  1XNI A;  2WSE E;  4M78 D;  2C0I A;  3QHS A;  3MET A;  1WDX A;  1YJW A;  2JM9 A;  4B9W A;  4OMO A;  3PIO A;  4RTZ A;  4HT8 A;  1B7T A;  2GBQ A;  4NL2 A;  3G6E T;  4MZP A;  1Q86 R;  2CP0 A;  3CPF A;  2L3S A;  1I5O B;  2BIV A;  4RTX A;  5AT1 B;  2NUT A;  5KCO A;  3I5S A;  3QJ6 A;  1UEC A;  4C5G A;  5IHK A;  2Y90 A;  2EYW A;  1E6G A;  3GOX A;  3P8H A;  3L2Q A;  5GMK i;  3QII A;  1M2O A;  4DBQ A;  2JW4 A;  4N0A C;  5KYU A;  3UAT A;  4F7U A;  1D0Z A;  1D1C A;  5C0M A;  4HXJ A;  2ENM A;  4Q5W A;  1IRX A;  4C8Q G;  2E65 A;  2KNB B;  2VXF A;  4KBM B;  4QVC A;  2C0T A;  3BY7 A;  1X27 A;  4TVR A;  2HNI A;  4C92 D;  3PMT A;  1T0J A;  2LNV A;  4FW2 A;  2JXB A;  2D1X A;  3CCU T;  4Z88 A;  2V1Q A;  3JCM W;  1Y07 A;  2DL4 A;  2ED1 A;  2OTL A;  2DEQ A;  2V8J A;  2O31 A;  3LH0 A;  1YFN A;  3E9G A;  2CUD A;  1BI0 A;  5D7U A;  2QA4 A;  4M7D E;  2LJ3 A;  4E7H A;  1VYT A;  4OMP A;  2QQA A;  4ZTF A;  2DER A;  2MF2 A;  1QVF P;  2A3L A;  2K5F A;  3JB9 H;  3A5Z B;  1YJN T;  3I56 A;  3V8L A;  4WF2 A;  4PJO G;  2KRS A;  2QQS A;  1VQ9 Q;  1Y96 A;  1TUC A;  1K73 R;  2E5Q A;  2H3E B;  5I21 A;  1K73 U;  2RF0 A;  2E6Z A;  1FX7 A;  2O88 A;  2ESW A;  2O9S A;  3G4S T;  5LJ5 h;  1VQ6 Q;  5EC7 A;  4NS5 A;  2P0K A;  1UJ0 A;  4EMK A;  2G3R A;  5GAN g;  3CCV T;  1X69 A;  2DJZ A;  2DL5 A;  2EQK A;  1TU0 B;  3CCS T;  3X25 B;  5A0D A;  2P84 A;  4E7L A;  4N0A A;  3PE0 A;  1K8A C;  2V8I A;  2PUO B;  3OYL A;  5LL6 S;  4GLM A;  3VUB A;  2DNU A;  1Y71 A;  3RR6 A;  5GAN f;  2YDL A;  2RQR A;  2Z0W A;  3J81 E;  2E70 A;  3OMG A;  4E6R A;  2DJQ A;  4JJD A;  3I55 A;  1RAC B;  3KXT A;  1HSQ A;  3HHT B;  3P8B B;  4M7D B;  1GBQ A;  1X75 C;  4QVD A;  4F16 A;  2EGE A;  2EJG A;  4J7F A;  2KRN A;  2CS7 A;  3G1J A;  2QTV A;  1KG1 A;  3CCS A;  1UDL A;  1AZE A;  3L2U A;  3CCR T;  1C1A A;  2A36 A;  1WFW A;  2AIR B;  5LJ3 d;  1NLO C;  4KUI A;  3OS2 A;  5A0G A;  4JRK A;  2JS0 A;  2LP5 A;  2GCX A;  2HBW A;  1K9A A;  4JJC A;  4F04 B;  3QWY A;  5AYF A;  4NOY A;  4BDZ A;  1QP2 A;  5GAN 7;  2V26 A;  1YCY A;  3OBW A;  3M0R A;  4D6W A;  1HXD A;  3RKW A;  2QTX A;  3CCM Q;  1JXM A;  3C0C A;  2IG0 A;  4C92 F;  1SPK A;  4D8D A;  4XTY A;  1N9R A;  1BBZ A;  2JUF A;  5LJ5 e;  3UF4 A;  4JS4 A;  1ABQ A;  3HTR A;  2XID A;  1VQ5 A;  1SKU B;  2ABL A;  2F2V A;  3H0I A;  2J05 A;  4HT9 A;  4M7A C;  4R55 A;  2QEX T;  1PSF A;  2ZPG B;  3HPW A;  1D1A A;  5KYU B;  2EBP A;  3QUI A;  2YXY A;  1LOJ A;  3OBY A;  5DM7 R;  3EG0 A;  4JRQ A;  4LE9 A;  2OX7 A;  3E1S A;  1K8A R;  4RMO A;  1YI2 A;  3RES A;  2M16 A;  3DB3 A;  1PD1 A;  4E47 A;  1VQ9 A;  2VVK A;  1YJN A;  1VQN A;  1NYF A;  5DY9 A;  1I07 A;  2CT3 A;  3PT9 A;  4M75 D;  3V7R A;  3GBQ A;  2LCC A;  1W6X A;  3J80 E;  3HL8 A;  1NYG A;  4V2S A;  5GAN e;  2DXB A;  2PZ1 A;  2DZ9 A;  5I2M A;  2ZPI B;  1ZHI A;  3N5B B;  2DAQ A;  4M4Z A;  5IHN A;  3RUX A;  3JSC A;  1M27 C;  1RAH B;  3QDF A;  4HCZ A;  1BI2 A;  2ECZ A;  4J9H A;  3R6N A;  1Q81 C;  4WCI A;  3V7S A;  3JCM g;  4OP0 A;  5KYY A;  1KD1 R;  2ROL A;  1YWO A;  2LQ8 A;  2YRV A;  4ORZ A;  2OTJ Q;  1MHN A;  4M7D D;  2SEM A;  3QKJ A;  1UE9 A;  2LRQ A;  3OYJ A;  4EPC A;  2HSE B;  1KC8 C;  3QG1 A;  2DRM A;  2YUN A;  2GQI A;  4ZGJ B;  2DM1 A;  3CC2 Q;  4J5Y A;  4BI8 B;  3I5R A;  3LYI A;  3F70 A;  2RO0 A;  3VUZ A;  1EZZ B;  5CIU A;  4XTV A;  2FPD A;  5ECA A;  2PUK B;  4PJO E;  2XIC A;  3CCQ T;  2KXD A;  2BZY A;  5LJ5 g;  5GMK l;  3SFM A;  4E7S A;  3OYE A;  2C0O A;  8ATC B;  3EFO B;  2MWP A;  3JCM J;  2D9T A;  3CCS Q;  1X01 A;  4J6Y A;  5GAN 6;  1CKA A;  1ZUY A;  4LUD A;  4EMK C;  4FYV B;  4RTU A;  4FIB A;  1MMA A;  3CMA Q;  3H9N A;  2LJ1 A;  3INZ A;  4M77 G;  2CZ0 B;  3QDR B;  2LDM A;  2DO3 A;  3JRZ A;  1SF9 A;  5LJ3 j;  2E12 A;  5IN1 A;  5I11 A;  1XTD A;  2QXF A;  2FVU A;  3CCE T;  2QQ9 A;  3L1A A;  3GP8 A;  2LX7 A;  1M5Q 1;  2YRC A;  4JZ3 A;  4C92 G;  4OGC A;  1LJO A;  4FYY B;  2X51 A;  2A7Y A;  2RHZ A;  2I0N A;  3CC4 T;  1MGQ A;  1AOJ A;  4PJL A;  2ZCF B;  1WXT A;  1BIA A;  4BY6 C;  1YIJ T;  2HMA A;  1KD1 C;  3EG2 A;  2DBK A;  1H3Z A;  1WZO A;  2OTL Q;  1R8O B;  3GF5 A;  5L8R E;  1M30 A;  4F7U B;  1W2B P;  1SHG A;  1B3Q A;  3JCM e;  1U1T A;  2K5I A;  4FYW B;  3FDR A;  1PM3 A;  1O75 A;  4HVW A;  3O5Z A;  2MPX C;  1UG1 A;  2DL3 A;  1H8K A;  4IUR A;  2X35 A;  2R5A A;  2KMT A;  1X6B A;  3EHR A;  3VS2 A;  2K7A A;  4DEY A;  2G6F X;  2Y4X A;  2D8H A;  4LDV A;  1OX9 A;  5GAN 5;  3EG3 A;  5GJV B;  1UJY A;  1ZA1 B;  2NWM A;  4DA4 A;  3CC2 A;  3PIP A;  3G71 Q;  1Q86 U;  5HK0 A;  4IUQ A;  4Z02 A;  4OB0 B;  4M78 G;  1Y96 B;  3JB9 D;  3OW2 P;  4OMQ A;  2MAM A;  4X9C A;  2LX9 A;  3VRY A;  1YBY A;  1TG0 A;  3OB9 A;  1PCX A;  3JCM V;  3E9F A;  2Y4Y A;  4JRP A;  5IT9 E;  2FG0 A;  3OYG A;  3CQT A;  4AFZ C;  1WQW A;  1ZSZ A;  3CCJ A;  2EGA A;  4M75 F;  1W2B A;  5KYX B;  1AWO A;  1JRI A;  1GFD A;  4BUG A;  3HRU A;  4M7D G;  1QWF A;  4XQ3 A;  4II1 A;  3PTA A;  2FO0 A;  3JCM h;  4R56 A;  1VQL T;  2RQT A;  5KYW B;  3H8Z A;  4IUP A;  5FWC A;  5IAY A;  2L5Q A;  3EG1 A;  1RUW A;  2QDY B;  3PMI A;  2CGH A;  3RKX A;  1R0B G;  3OYC A;  1YJW T;  2P4R A;  2EIF A;  2AT1 B;  4M77 A;  3CBM A;  3RER A;  3THK A;  2CH4 A;  4BB7 A;  2RPN A;  4M7D A;  3EG9 B;  4JRI A;  2DPP B;  4NL3 A;  1SSF A;  2E3I A;  1WXB A;  1AZG B;  3TSZ A;  1VQL A;  2QA4 T;  2RI5 A;  4ZTJ A;  4KGZ B;  2XHC A;  1K1Z A;  3M57 A;  2D6F A;  4UC4 A;  1PG5 B;  5GAO m;  2CP3 A;  2GNC A;  4M77 F;  4XTX A;  3LWH A;  2GQV A;  2FPE A;  3JCM b;  2VUB A;  2RN8 A;  1AWX A;  5GAN 4;  2EJ9 A;  2QQR A;  3URG A;  2QEX A;  3OYM A;  2DL7 A;  4CC4 B;  2GFU A;  3DLL A;  4J9E A;  1KC8 R;  1OYX A;  4XU0 A;  5CO7 A;  2YT6 A;  5GAO p;  3JCM Q;  1IGQ A;  1WGS A;  2ZAE A;  3EH2 A;  4C8Q C;  2JTM A;  1WNL A;  1LVK A;  4FT2 A;  1D09 B;  3MEA A;  2CZ1 B;  4CC7 A;  4YTL A;  2K57 A;  3CCL Q;  2RK1 A;  1K76 A;  2PTK A;  1CKB A;  2ZPF B;  2R58 A;  1QKW A;  2BE7 D;  1YJ9 A;  2D0Q B;  2M02 A;  3SWN A;  1Z9Q A;  5CKF A;  1WIE A;  3EGD A;  3FIF A;  1KQ1 A;  1KD1 U;  4PLL A;  1G3S A;  2DK3 A;  3JB9 F;  2FL7 A;  3QSU A;  4J7I A;  1MND A;  1QP3 A;  3BDU A;  2FRY A;  5D6Y A;  1GXI E;  3M0T A;  1K0X A;  1S72 A;  5KYW A;  1Y57 A;  1WJR A;  3C12 A;  1SRM A;  2CRE A;  2DRK A;  1F1B B;  1DJ7 B;  2MK5 A;  4ZNX A;  3OQ5 A;  4E7Z A;  7AT1 B;  3DB4 A;  1M9S A;  3WVD B;  2B86 A;  1IXD A;  5KYX A;  4C92 C;  5CAI A;  4KGV B;  3X26 B;  1G5V A;  4M78 B;  3CXC S;  3MHX A;  5GAN h;  2HQE A;  1MNE A;  5CK9 A;  4ELZ C;  2J6O A;  3RKY A;  4CI0 C;  1QQJ A;  2YWW A;  5EG2 A;  4CC3 A;  1UHC A;  2AKK A;  1NLP C;  1ZQ1 A;  2O4X A;  1S1N A;  3C94 A;  2K2V A;  4QQD A;  2DF6 A;  3WXM B;  2F5K A;  2KDS A;  2X9H A;  3MP8 A;  3CCQ A;  1VQN Q;  3M55 A;  3QBY A;  2BTT A;  4RG2 A;  3M4Y A;  1RLP C;  2EKH A;  4PJO A;  1Q82 R;  1V76 A;  3LX7 A;  3O8V A;  2KE9 A;  1KSW A;  3ASK A;  5FU6 C;  3CPW A;  1U5S A;  1YI2 T;  1LPL A;  3FC3 A;  3JCM d;  2DEU A;  4A4F A;  1UEB A;  2OI3 A;  1UUE A;  2ZPH B;  2VGN A;  3TEE A;  1VQN T;  1Q81 U;  2FZC B;  3CCE Q;  3MO8 A;  3KBG A;  3JB9 I;  4M78 C;  4M77 B;  2FZK B;  1I0C A;  4O6J A;  4PLI A;  2OJ2 A;  2OTJ A;  1VQO T;  5CKB A;  3CCJ Q;  1K9M C;  1XJW B;  1AWW A;  1OZ2 A;  4HVV A;  5KH6 A;  3OYD A;  5CKH A;  3TSW A;  4KH1 B;  1B07 A;  4PJO F;  4FL6 A;  4AG1 C;  3EH1 A;  1BU1 A;  2LTO A;  3L2R A;  3OYH A;  1H64 1;  3JCM f;  5IXF A;  4BE2 A;  1N5Z A;  3OS1 A;  1J3T A;  1UGV A;  3NTH A;  1I5L A;  1NE8 A;  4X1V A;  1VQP T;  4AFU C;  2K3Y A;  2CP7 A;  2LNH B;  4Y28 E;  4OB3 B;  2NUZ A;  3QZ9 B;  2EAY A;  3OS5 A;  5CQX A;  2RD1 A;  4JS5 A;  1WI7 A;  4BY6 B;  1PC0 A;  4JLI A;  5LJ3 h;  3QPH A;  1OV3 A;  2AHJ B;  3HFO A;  2K5L A;  3QWX X;  1NPP A;  1UB4 A;  3REB B;  3HSB A;  2GF7 A;  4CC2 A;  4FW1 A;  3G71 A;  1RAA B;  1G8X A;  4RG8 A;  4LNP A;  3A8O B;  5HKC A;  3I55 T;  4JUV A;  2JM8 A;  2M0O A;  4M75 G;  4JLG A;  1GCQ C;  1I1J A;  4DOV A;  3EFR A;  2JS2 A;  1VQ6 T;  1RAE B;  4VUB A;  4OVA A;  1QKX A;  2KK4 A;  1VIF A;  2K79 A;  2EFI A;  2A28 A;  4D8K A;  2K4Y A;  2QA4 Q;  2VB6 A;  3NFC A;  4R0K A;  1YIT T;  4ATO A;  2YHT A;  2DTO A;  3E2U A;  2B8A A;  2LCL A;  4HCK A;  1NJI R;  1PHT A;  2BKD N;  4RTY A;  1YIJ Q;  1KQS A;  2GFA A;  1VQK A;  1Q81 R;  2KSS A;  3CC7 T;  5GAM d;  1OUL A;  2X3X D;  1K8A U;  3M56 A;  5J39 A;  1NG2 A;  3A8G B;  3EGX A;  4LDX A;  2CKK A;  2CT4 A;  1U3O A;  4PKC C;  2EKO A;  1M1K C;  2OAU A;  1OQK A;  2KYB A;  5IXB A;  1YIT A;  4IKF A;  2KYM A;  4C0G A;  1BCO A;  4PNO A;  2P0Q A;  1JJ2 S;  1ZSZ B;  1TWB A;  1HD3 A;  3M5A A;  2KR3 A;  4N4G A;  2NUP A;  3RIR A;  3U23 A;  4OMN A;  2DIG A;  4ZGE B;  1GFC A;  4X34 A;  1NJI U;  3VS0 A;  3I55 Q;  3NHN A;  4M7A E;  3OYA A;  3CME A;  2J7I A;  3EGX B;  3CD6 A;  2LQK A;  2XDP A;  3NTK A;  2XDB A;  2JN0 A;  5KCH A;  3CC2 T;  3EFO A;  3CCQ Q;  1D0X A;  3VYG A;  4J9B A;  1I4K 1;  1Q7Y U;  2LZ6 B;  2X4X A;  1M8M A;  1WHM A;  3D7S B;  3UPU A;  1OU8 A;  2DYI A;  4RCC A;  1W4S A;  4C5I A;  1RI9 A;  2RHU A;  1RAF B;  1QWE A;  2L3P A;  3A8M B;  4DOW A;  1VYV A;  3MKD A;  1M8V A;  2L0A A;  1YIJ A;  1SSH A;  2VYT A;  4XU2 A;  1VQP Q;  1UTI A;  2QDL A;  3QXE B;  3G71 T;  1BI3 A;  1GL5 A;  3UT1 A;  2MI6 A;  5IH2 A;  4C8Q F;  3MPU B;  1RLQ C;  2RHX A;  3CCJ T;  3G6E A;  1Y0M A;  3ZL7 C;  4BD3 A;  3CCL T;  1D1B A;  1P92 A;  1AVZ C;  2AZS A;  3H0F A;  3VS3 A;  1ACM B;  1PD0 A;  1QVG S;  1S72 Q;  4A54 A;  3LGL A;  1WA7 A;  5IHI A;  1Q7Y R;  2CSQ A;  4JDS A;  1YCS B;  1K9M R;  2MYS A;  5GAO l;  4M7D C;  2JZ2 A;  3MP1 A;  3HKS A;  1RAG B;  3M58 A;  4OB2 B;  1ZBJ A;  1YI2 Q;  5FU7 B;  4RKU E;  4PJN A;  1D0Y A;  3SD4 A;  2QK0 A;  3L42 A;  5LJ3 g;  1JJ2 P;  2JJ9 A;  4KGX B;  1M4Z A;  2E41 A;  3CME Q;  1H92 A;  1KQS S;  1VA7 A;  2QEX Q;  1AWJ A;  1M3C A;  3CCM A;  2AKL A;  1SG5 A;  1PWT A;  1ZUU A;  5FWB A;  3VYH B;  2VKN A;  4FU6 A;  2CUB A;  4C8Q D;  4QVZ A;  2RJF A;  4E7I A;  1NEB A;  3BFM A;  3ULR B;  2M0Y A;  2GTJ A;  3CCR A;  1VQM T;  3SEM A;  3VU3 C;  3CMA T;  2H8H A;  3MP6 A;  9ATC B;  3EG9 A;  4C92 B;  2C06 A;  1KFZ A;  1FMK A;  1NM7 A;  1FMV A;  4XTW A;  1H3H A;  2V1R A;  4OF1 A;  4M75 E;  1K9M U;  4ANJ A;  2WSF E;  3OYB A;  1TOV A;  4C8Q E;  1G2B A;  1M90 C;  4DEX A;  1I8F A;  1QLY A;  2EGC A;  4BAC A;  2LQW A;  1VYU A;  5GAO r;  2HZY A;  2QAS A;  3CD6 T;  3QO3 A;  5CKD A;  2CZ7 B;  2PQW A;  4M7A D;  2DXC A;  1YJ9 T;  4F7U G;  4RUG A;  4QW2 A;  2RA2 A;  3CBP A;  1RL2 A;  4QQ6 A;  2CP6 A;  3JCM X;  4RCB A;  2F2W A;  4PJO B;  2J6K A;  3VRZ A;  1JU5 C;  3G4S A;  3CPW P;  3SWN B;  4OML A;  1QVG P;  4P5N A;  5GMK h;  3CD6 Q;  1W2B S;  1HK9 A;  2CYZ B;  3CCV A;  5KE3 A;  2DIQ A;  1EX4 A;  5LJ5 f;  2DXU A;  3T9N A;  2A37 A;  4A4G A;  4J6X A;  2DXT A;  2L2P A;  2IVW A;  2EQI A;  2FZG B;  3OY9 A;  4XU3 A;  4J83 A;  1OOT A;  3I35 A;  1TH7 A;  1KJW A;  4E2F B;  3QJY A;  1OEB A;  1Y7X A;  2A08 A;  5FRO A;  2JVV A;  5FRM A;  2XKO C;  1VOM A;  2KT8 A;  2RMO A;  1OX8 A;  1VQ8 Q;  2EPD A;  1JB0 E;  3OSV A;  4FCY A;  2LCS A;  1WHL A;  2D8J A;  3TU4 K;  1OI1 A;  4C8Q A;  3OW2 S;  2MWO A;  2XMF A;  1M2V A;  4ZN1 A;  1SEM A;  2X4Y A;  4C0F A;  3NMZ C;  2CDT A;  2HSP A;  4C5E A;  2WSC E;  4LXC A;  3OYI A;  3FRN A;  1WXU A;  2DYB A;  2ZZD A;  1WLP B;  2E6N A;  5HK3 A;  1VQ6 A;  3A8L B;  3RNJ A;  4M75 B;  1YHQ Q;  5J26 A;  2DL8 A;  2KBT A;  4Z8A A;  2DD4 A;  3V8K A;  3CMA A;  1B34 A;  1TUG B;  2HD0 A;  4KH0 B;  3VS7 A;  2OAW A;  2J6F A;  1E7O A;  2LJ0 A;  4AMC A;  3TRE A;  2RQW A;  5GMK e;  1OZ3 A;  3EAE A;  4IUU A;  1QVG A;  5CVI A;  2LMJ A;  2NYS A;  1VQK Q;  3UA6 A;  2RH2 A;  4QKU A;  4RTT A;  4C92 E;  2HCK A;  2HDA A;  3AHU A;  2ROT A;  2EQU A;  2EYZ A;  2DMO A;  4IUT A;  3JB9 G;  2DD5 A;  2EWN A;  1ZUK A;  4J6W A;  1WHK A;  3KUF A;  2L3Q A;  2K6D A;  1VIE A;  2PVG B;  3P8D A;  1ABO A;  1W1F A;  4JJB A;  4C92 A;  3JCM c;  4PJJ A;  1M3A A;  3GNG A;  2XD0 A;  2KQW A;  3SB2 A;  2P0P A;  4IIM A;  5GJW B;  4C5H A;  1MMG A;  2NUT B;  2FHD A;  5CKE A;  2HEQ A;  1QCF A;  4A53 A;  5CR2 A;  2LT4 A;  1BI1 A;  4J9I A;  2KXC A;  3M54 A;  2DBM A;  2RHY A;  4O5V A;  5HY6 A;  4HVU A;  1IGU A;  3NTI A;  2COY A;  5DLO A;  2EYY A;  4IUV A;  4XTZ A;  1ZA2 B;  1AT1 B;  2F2X A;  4M78 E;  3VKI A;  2YUP A;  1I81 A;  3VS1 A;  2K9G A;  4RTW A;  3AT1 B;  2BE9 B;  2NLU A;  3PGG A;  5LJ3 e;  3FLG A;  1K4U S;  3OW2 A;  1GRI A;  1QCN A;  1YJN Q;  4N4I A;  1VQM Q;  2GGR A;  4F14 A;  3RMS A;  1BYM A;  4M78 A;  5FU7 C;  2BUD A;  2JMC A;  4C0D B;  4ESR A;  4PJO D;  1PRM C;  5GAM f;  2DTH A;  2KAF A;  3BDL A;  3OYK A;  3FB9 A;  1YN8 A;  1YHQ A;  1YIT Q;  3GIB A;  1PSE A;  1PRL C;  1WHJ A;  1VQ7 Q;  3CC7 A;  1IZ6 A;  4XU1 A;  4Y92 A;  4EMK B;  1Q7Y C;  4EDU A;  2K2M A;  1RAD B;  2MIO A;  1W70 A;  4M7A F;  1UFF A;  4FSS A;  2YLB A;  1ZLM A;  1OPK A;  3TVT A;  2D0N A;  2SRC A;  4JPB W;  3L2W A;  3M0U A;  1WHH A;  1AHJ B;  2BZ8 A;  3REA B;  5D6X A;  2DVE A;  1TSF A;  2QQB A;  4DQ2 A;  2QGG A;  2QYZ A;  1LNX A;  1ZSG A;  3LGF A;  1XQH A;  4FYX B;  2ED0 A;  3TQ7 P;  4M75 C;  2VV5 A;  4EMH A;  2JNG A;  3CCM T;  1G3W A;  4M77 E;  1NJI C;  1KIK A;  1WYX A;  4XK8 E;  3G7Z A;  4HCC A;  2E4H A;  5LJ3 f;  1N8R C;  3LWI A;  4J9D A;  4XTU A;  1YP5 A;  2YUQ A;  1U06 A;  1IB8 A;  1LCK A;  2DZC A;  2EVR A;  3M4G A;  3GNF B;  4BE0 A;  1ARK A;  3GPL A;  1K73 C;  2E5K A;  1JJ2 A;  2K3B A;  4GY5 A;  4M77 D;  6AT1 B;  2FPF A;  3HP9 A;  4BE1 A;  2L3R A;  1IRE B;  3EHQ A;  2QGF B;  4A63 B;  1QVP A;  2CP5 A;  4DBR A;  1PKT A;  2DX1 A;  1Q82 C;  1X43 A;  2KVQ G;  2PNI A;  4A4E A;  4K11 A;  3MEV A;  1E6H A;  1Q95 G;  3CCV Q;  1SHF A;  2FEI A;  1QCO A;  4F17 A;  1G83 A;  1N9S A;  2DKG A;  3UWN A;  2X3W D;  3DLM A;  4PFO A;  3JB9 J;  1R0C B;  2DET A;  2AK5 A;  1ZBX A;  2P4T A;  3FEO A;  4FSX A;  1WJS A;  3CXC P;  2XU8 A;  2X4W A;  1X6G A;  5GAM h;  3C95 A;  2RI2 A;  5KE2 A;  2RJC A;  1VQ7 A;  3S3O A;  4LDW A;  4L5G A;  2W0Z A;  4E7K A;  3QYG B;  2QI2 A;  2V8K A;  4AFQ C;  2O4X B;  2XK0 A;  1T0H A;  3LW5 E;  1Z9Z A;  2YRD A;  1AEY A;  2KY9 A;  2ZGW A;  3OYF A;  1VQ4 A;  4J8O A;  4RTV A;  4PFP A;  2HKN A;  3EFS A;  1SRL A;  2NUP B;  4J9F A;  1IO6 A;  1K0S A;  4ZN3 A;  3S3N A;  3V7C A;  2HBP A;  1VQ8 T;  2HL5 C;  4MZT A;  1VQL Q;  3CPW S;  4WTO B;  3M0P A;  5GMK m;  3MEU A;  2EQJ A;  1MV3 A;  2CH4 W;  4LN2 A;  2LVM A;  2M9U A;  1OU9 A;  4M7A G;  3ZEH A;  2JTF A;  4L59 A;  3NPF A;  4FM4 B;  4FT4 A;  1NPR A;  4XAX B;  4A4H A;  1VQ4 T;  1EFN A;  1V1C A;  3CCE A;  4Y91 A;  4C0D C;  1VUB A;  2H3J A;  3UDC A;  2VGM A;  5CQY A;  3BW1 A;  4AFS C;  1YWP A;  3M0S A;  5FW9 A;  5GAM e;  2R5M A;  1VQ5 Q;  3SDZ A;  1X6O A;  3OA6 A;  1GCQ A;  1BCM A;  1X2Q A;  4PJM A;  5C6S A;  2RQU A;  5GAO n;  1RAB B;  4JJN K;  1D3B A;  2LQN A;  4DBH A;  2DTI A;  1YJ9 Q;  1QMC A;  1MV0 B;  3SWN C;  4HA8 A;  4MDW A;  1JXO A;  2RM4 A;  2DIL A;  2X4J A;  2KI7 A;  3M9Q A;  2QG9 B;  1O9S A;  5GAO q;  1VQ4 Q;  3CEY A;  2OTJ T;  2O9V A;  1B34 B;  1BIB A;  3Q1J A;  1M1G A;  1TTH B;  3ER0 A;  3VV0 A;  3ZFJ A;  2JTE A;  1JEG A;  2WAC A;  4LDY A;  3QZ5 B;  2EJF A;  3OMC A;  2MOX A;  2E3H A;  1RAI B;  5FU6 B;  3FJP A;  4EIK A;  1T3S A;  1FMW A;  1FWZ A;  3X28 B;  1Q82 U;  4HKE A;  3A8H B;  3JAM E;  1QVF S;  1KK7 A;  2OTL T;  1KHI A;  3A98 A;  3QYH B;  3CC4 Q;  4QT7 A;  1VQ7 T;  1NEG A;  3J7A F;  2VXE A;  3PVL A;  2O2O A;  3VS4 A;  2O01 E;  1VQP A;  2IIM A;  2VAS A;  4AT1 B;  1A0N B;  5A2Q E;  4EMG A;  4BI3 A;  1KQ2 A;  1WJQ A;  1N8R R;  3R6O A;  1N8R U;  2RQV A;  3I56 Q;  3HFN A;  3LLR A;  4QQG A;  4C8Q B;  2F69 A;  4CRI A;  2QAZ A;  5DLQ E;  1M90 R;  5LJ5 j;  4LD9 K;  1TUD A;  1QW1 A;  1M1K U;  2RI3 A;  3ME9 A;  1R77 A;  5M9O A;  3VS5 A;  8AT1 B;  3S3M A;  1YNZ A;  2ZPE B;  2DLP A;  4LD6 A;  4OMF B;  1BB9 A;  1NZ9 A;  1ZX6 A;  1MMN A;  4KUL A;  3UA7 A;  5GMK j;  4E7J A;  2YUO A;  1S72 T;  2DE0 X;  2XG8 D;  5GAM g;  3MCA B;  1VQM A;  4F7U E;  5GAN 8;  2FYK A;  4L6V 5;  3SHW A;  2RHI A;  1FYN A;  1PKS A;  3I9Q A;  3C4S A;  4PK4 A;  2JOY A;  4J9C A;  1VQO A;  1IHW A;  5CCA A;  1G3Y A;  3L2Z A;  3CXC A;  5GAN 3;  2L89 A;  2I2L A;  4F7U F;  3MEW A;  1C6V X;  2MCN A;  1N6A A;  5GAN d;  2RJD A;  1UGP B;  4ME7 A;  2YLC A;  1TXQ A;  4BDY A;  1UGQ B;  3CCU A;  5A0L A;  3M59 A;  1X2K A;  4C0Z A;  4GLK A;  4X9D A;  1PNJ A;  3NGP A;  1HYO A;  4KRT A;  4DBF A;  3M53 A;  3M0Q A;  1JBM A;  1BK2 A;  3BE3 A;  3CBO A;  4MZM A;  4HCB A;  3VJP A;  1GCP A;  2CSI A;  2BZX A;  3CC4 A;  3I56 T;  3HRS A;  2J06 A;  2EYQ A;  3G4S Q;  1UGR B;  1NBE B;  3IQL A;  3TCJ A;  2COZ A;  4OB1 B;  2KRM A;  3CME T;  1IHV A;  2E64 A;  1AD5 A;  3KFV A;  1D3B B;  4M7A B;  1YHQ T;  1C0M A;  2LC4 A;  4PFZ A;  2KRO A;  3L2V A;  2E10 A;  3CC7 Q;  1EIF A;  4A4K A;  1M1F A;  3H6Z A;  3HRT A;  1U8R A;  1Q86 C;  2KEA A;  4N4H A;  4M7A A;  2GTO A;  3EGU A;  1KQS P;  2EYX A;  2RB6 A;  4Z89 A;  4PJO C;  3V8J A;  2CP2 A;  2IPO B;  3CCU Q;  2FRW A;  2HQX A;  1MUZ A;  3GLX A;  1HJD A;  1YJW Q;  4ZGD B;  1V29 B;  5KYN A;  2DA9 A;  2MMP A;  4AG2 C;  5GAM j;  1XOV A;  4MDX A;  2E1H A;  3S6W A;  1BKB A;  5I22 A;  3JV3 A;  4M78 F;  4MML A;  1WQ7 A;  3OYY A;  1WX6 A;  2RJE A;  2LT1 A;  3H0H A;  1N27 A; 
#chains in the Genus database with same CATH homology
 3NFC A;  1YIT T;  4ATO A;  2YHT A;  2DTO A;  3L2W A;  5LJ5 g;  5GMK l;  2XDD A;  1AHJ B;  2B8A A;  2LCL A;  3SFM A;  5LJ5 d;  3OYE A;  5D6X A;  2MWP A;  3JCM J;  2DVE A;  2D9T A;  1VQ8 A;  2QQB A;  2FB7 A;  2BKD N;  1X01 A;  4J6Y A;  4DQ2 A;  3OS0 A;  1LNX A;  3JCM P;  1KQS A;  2GFA A;  5GAN 6;  3OYN A;  3LGF A;  1VQK A;  2KSS A;  3CC7 T;  1XQH A;  5GAM d;  2PU9 B;  1K8A U;  3M56 A;  4M75 C;  5J39 A;  3A8G B;  5GAN 2;  2VV5 A;  3OSS C;  4EMK C;  4LDX A;  4EMH A;  2JNG A;  1VQ5 T;  2CKK A;  3CCM T;  4M7D F;  4FIB A;  4PKC C;  1G3W A;  4M77 E;  2EKO A;  1NJI C;  3RMQ A;  4XK8 E;  3G7Z A;  3INZ A;  5LJ3 f;  4HCC A;  4M77 G;  2CZ0 B;  3QDR B;  1N8R C;  1M1K C;  2OAU A;  3LWI A;  2LDM A;  2DO3 A;  3JRZ A;  5LJ3 j;  4XTU A;  1YIT A;  2E12 A;  5IN1 A;  1XTD A;  2QXF A;  2FVU A;  3CCE T;  4IKF A;  2QQ9 A;  3L1A A;  4C0G A;  5I2S A;  3GP8 A;  2DZC A;  1M5Q 1;  3M4G A;  3GNF B;  4PNO A;  4BE0 A;  3E19 A;  3GPL A;  4C92 G;  2EQM A;  1K73 C;  4OGC A;  2P0Q A;  1JJ2 A;  1LJO A;  1JJ2 S;  2HAX A;  4OGE A;  2A7Y A;  1VQK T;  3M5A A;  1UGS B;  4GY5 A;  4N4G A;  2RHZ A;  4M77 D;  3RIR A;  3HP9 A;  3PNW C;  2DIG A;  4ZGE B;  3CC4 T;  1MGQ A;  1VQ9 T;  4BE1 A;  2L3R A;  1IRE B;  2F5T X;  2ZCF B;  1QVF A;  4X34 A;  4M75 A;  5GAN j;  2L8D A;  1NJI U;  2ZPB B;  1BIA A;  3X24 B;  4BY6 C;  1YIJ T;  1KD1 C;  1QVP A;  4M7A E;  1H3Z A;  3OYA A;  2R57 A;  3CME A;  1R8O B;  3GF5 A;  3X20 B;  3CD6 A;  2LQK A;  4KUD K;  5L8R E;  4ELY C;  2XDP A;  2RK2 A;  3NTK A;  4F7U B;  2XDB A;  5FRN A;  2JN0 A;  1U1S A;  5KCH A;  3CC2 T;  1WPY A;  2PVO B;  3DKM A;  3JCM e;  1U1T A;  4M77 C;  1Q82 C;  2K5I A;  3VYG A;  1I4K 1;  1Q7Y U;  2X4X A;  2KVQ G;  3FDR A;  5J3B A;  3PFS A;  4A4E A;  1O75 A;  3CCL A;  2K3X A;  3UPU A;  1G3T A;  3MEV A;  4RCC A;  1W4S A;  4C5I A;  2RHU A;  4IUR A;  2X35 A;  2R5A A;  2CZ6 B;  1KHC A;  3A8M B;  4DOW A;  2M1H A;  1N9S A;  2DKG A;  3UWN A;  2KMT A;  3DLM A;  3JB9 J;  1M8V A;  1YIJ A;  2VYT A;  1ZBX A;  4XU2 A;  2Y4X A;  2P4T A;  4LDV A;  4B9X A;  3FEO A;  2PVD B;  1BI3 A;  2VC8 A;  3QXE B;  4FSX A;  5GAN 5;  3G71 T;  1WJS A;  1KC8 U;  4KT0 E;  3UT1 A;  2MI6 A;  2X4W A;  2XU8 A;  4PL6 A;  5GAM h;  4DA4 A;  4C8Q F;  3C95 A;  2RI2 A;  3CC2 A;  3PIP A;  1Q86 U;  5KE2 A;  2RHX A;  3CCJ T;  4BI4 A;  2RJC A;  5HK0 A;  4IUQ A;  3G6E A;  1VQ7 A;  4Z02 A;  4OB0 B;  5FLX E;  4M78 G;  1Y96 B;  1RI0 A;  3S3O A;  1FXX A;  4LDW A;  3JB9 D;  4LDU A;  4BD3 A;  4L5G A;  4MMK A;  2MAM A;  4E7K A;  3CCL T;  3ZBD A;  4X9C A;  1P92 A;  2LX9 A;  3QYG B;  2QI2 A;  1YBY A;  2V8K A;  3WVE B;  2O4X B;  3OB9 A;  2XK0 A;  1M90 U;  3JCM V;  1QVG S;  5D6W A;  4A54 A;  3LW5 E;  3LGL A;  3E9F A;  2XI9 A;  2KY9 A;  2Y4Y A;  1XNI A;  2ZGW A;  3OYF A;  4JRP A;  1VQ4 A;  5IT9 E;  2WSE E;  4J8O A;  4M78 D;  4JDS A;  3QHS A;  3MET A;  3OYG A;  5GAO l;  1YJW A;  4M7D C;  2JZ2 A;  3EFS A;  3MP1 A;  3HKS A;  1WQW A;  4B9W A;  3M58 A;  3PIO A;  4HT8 A;  4OB2 B;  3CCJ A;  4M75 F;  4NL2 A;  3G6E T;  4MZP A;  5FU7 B;  1W2B A;  4RKU E;  4ZN3 A;  3V7C A;  1JRI A;  3S3N A;  3SD4 A;  2HBP A;  4BUG A;  1VQ8 T;  3HRU A;  3L42 A;  4MZT A;  3CPF A;  3CPW S;  5LJ3 g;  4M7D G;  2BIV A;  5GMK m;  4XQ3 A;  1M4Z A;  2E41 A;  5KCO A;  4II1 A;  3MEU A;  2EQJ A;  3PTA A;  3JCM h;  4R56 A;  3QJ6 A;  1KQS S;  1VQL T;  4C5G A;  2LVM A;  2M9U A;  3CCM A;  4M7A G;  3H8Z A;  3ZEH A;  2JTF A;  4IUP A;  4L59 A;  4FM4 B;  4FT4 A;  5IAY A;  1NPR A;  4XAX B;  2L5Q A;  2Y90 A;  4A4H A;  1VQ4 T;  3VYH B;  3PMI A;  2QDY B;  4FU6 A;  2CGH A;  3RKX A;  4QVZ A;  4C8Q D;  2RJF A;  4E7I A;  3GOX A;  3BFM A;  3CCR A;  3OYC A;  1VQM T;  1YJW T;  3P8H A;  2EIF A;  3L2Q A;  3VU3 C;  3QII A;  5GMK i;  3CMA T;  4M77 A;  3CCE A;  4Y91 A;  3MP6 A;  3CBM A;  4C0D C;  1VUB A;  3RER A;  4N0A C;  2H3J A;  4BB7 A;  4M7D A;  3UDC A;  2VGM A;  5CQY A;  4C92 B;  2C06 A;  3BW1 A;  4JRI A;  4F7U A;  4XTW A;  2DPP B;  4NL3 A;  5GAM e;  1SSF A;  2R5M A;  5C0M A;  4OF1 A;  4M75 E;  3SDZ A;  1X6O A;  4Q5W A;  3OA6 A;  1K9M U;  4C8Q G;  1VQL A;  2QA4 T;  2WSF E;  2E65 A;  2RI5 A;  4ZTJ A;  3OYB A;  2VXF A;  4KBM B;  2XHC A;  4C8Q E;  3M57 A;  5C6S A;  2D6F A;  4UC4 A;  5GAO m;  1M90 C;  4QVC A;  5GAO n;  3BY7 A;  1I8F A;  4M77 F;  4XTX A;  4TVR A;  3LWH A;  2HNI A;  4JJN K;  2GQV A;  4BAC A;  1D3B A;  4C92 D;  3PMT A;  5GAO r;  2LNV A;  3JCM b;  2DTI A;  2VUB A;  3CCU T;  3SWN C;  4HA8 A;  3CD6 T;  3QO3 A;  4MDW A;  5GAN 4;  2RM4 A;  5CKD A;  2CZ7 B;  2PQW A;  1Y07 A;  2EJ9 A;  2QQR A;  3JCM W;  2DXC A;  4M7A D;  2X4J A;  2DEQ A;  2V8J A;  3URG A;  4F7U G;  3M9Q A;  1YJ9 T;  2OTL A;  3LH0 A;  4QW2 A;  2RA2 A;  3CBP A;  1RL2 A;  4QQ6 A;  3JCM X;  3OYM A;  4RCB A;  2QEX A;  4PJO B;  1O9S A;  5GAO q;  2GFU A;  3DLL A;  3E9G A;  3CEY A;  2OTJ T;  1BIB A;  1B34 B;  1BI0 A;  3Q1J A;  1M1G A;  3G4S A;  3ER0 A;  3SWN B;  3VV0 A;  3ZFJ A;  2QA4 A;  4M7D E;  4E7H A;  1OYX A;  4XU0 A;  5CO7 A;  5GAO p;  3JCM Q;  4P5N A;  2WAC A;  2QQA A;  4ZTF A;  5GMK h;  1WGS A;  1W2B S;  2MF2 A;  1HK9 A;  4LDY A;  2EJF A;  2JTM A;  1WNL A;  2A3L A;  3QZ5 B;  2CYZ B;  3MEA A;  2K5F A;  3OMC A;  2DIQ A;  4FT2 A;  3A5Z B;  5KE3 A;  3CCV A;  3JB9 H;  2CZ1 B;  5FU6 B;  3FJP A;  5LJ5 f;  2DXU A;  4YTL A;  3T9N A;  2K57 A;  1YJN T;  3I56 A;  3V8L A;  4A4G A;  4J6X A;  4WF2 A;  1FWZ A;  2RK1 A;  3X28 B;  1Q82 U;  2DXT A;  4HKE A;  3A8H B;  2ZPF B;  3JAM E;  2R58 A;  4PJO G;  1QVF S;  2QQS A;  2IVW A;  2D0Q B;  1KHI A;  3OY9 A;  1YJ9 A;  2OTL T;  4XU3 A;  3QYH B;  4J83 A;  5CKF A;  3SWN A;  1VQ7 T;  1Y96 A;  2E5Q A;  3J7A F;  3FIF A;  2VXE A;  5I21 A;  1K73 U;  1KQ1 A;  1FX7 A;  1TH7 A;  2E6Z A;  2O01 E;  1VQP A;  1KD1 U;  3QJY A;  3G4S T;  4PLL A;  1G3S A;  1Y7X A;  5A2Q E;  5FRO A;  4EMG A;  2JVV A;  5LJ5 h;  2DK3 A;  5FRM A;  4BI3 A;  2XKO C;  1KQ2 A;  4NS5 A;  2P0K A;  3JB9 F;  2FL7 A;  1WJQ A;  4J7I A;  3QSU A;  3R6O A;  1QP3 A;  3BDU A;  5D6Y A;  1GXI E;  4EMK A;  1N8R U;  2G3R A;  5GAN g;  3CCV T;  2DJZ A;  2EQK A;  3HFN A;  3LLR A;  4QQG A;  1S72 A;  3OSV A;  1JB0 E;  4C8Q B;  3TU4 K;  3CCS T;  1OI1 A;  1WJR A;  3X25 B;  2F69 A;  3C12 A;  4C8Q A;  4CRI A;  5A0D A;  3OW2 S;  4E7L A;  1DJ7 B;  2MWO A;  4N0A A;  3OQ5 A;  4ZN1 A;  1K8A C;  3DB4 A;  1M9S A;  2V8I A;  2PUO B;  5DLQ E;  5LL6 S;  3OYL A;  3WVD B;  3VUB A;  1Y71 A;  2X4Y A;  4C0F A;  5LJ5 j;  5GAN f;  4C92 C;  4LD9 K;  5CAI A;  1QW1 A;  3J81 E;  2RI3 A;  1M1K U;  2E70 A;  3OMG A;  3ME9 A;  4C5E A;  5M9O A;  3I55 A;  2WSC E;  3X26 B;  3KXT A;  3HHT B;  3S3M A;  1G5V A;  4M78 B;  3P8B B;  3OYI A;  3FRN A;  3CXC S;  4M7D B;  3MHX A;  5GAN h;  1X75 C;  2HQE A;  2ZPE B;  4LD6 A;  4OMF B;  4QVD A;  5CK9 A;  1NZ9 A;  2ZZD A;  5HK3 A;  2E6N A;  4KUL A;  2EJG A;  5GMK j;  1VQ6 A;  4ELZ C;  3RKY A;  4J7F A;  4CI0 C;  4E7J A;  5EG2 A;  3A8L B;  2CS7 A;  1S72 T;  1KG1 A;  3CCS A;  2XG8 D;  4M75 B;  3L2U A;  3CCR T;  5GAM g;  3MCA B;  1ZQ1 A;  2O4X A;  5J26 A;  4F7U E;  1VQM A;  5GAN 8;  3C94 A;  3V8K A;  2DD4 A;  2K2V A;  3CMA A;  4QQD A;  1B34 A;  2FYK A;  2HD0 A;  3WXM B;  2F5K A;  4L6V 5;  5LJ3 d;  2KDS A;  2RHI A;  4KUI A;  3MP8 A;  3OS2 A;  5A0G A;  3CCQ A;  3C4S A;  4JRK A;  3TRE A;  2JOY A;  2GCX A;  3M55 A;  5GMK e;  1OZ3 A;  3QBY A;  3EAE A;  4IUU A;  1VQO A;  1QVG A;  5CVI A;  5AYF A;  4RG2 A;  5CCA A;  4NOY A;  1G3Y A;  1QP2 A;  3M4Y A;  5GAN 7;  4BDZ A;  4PJO A;  1YCY A;  2RH2 A;  3L2Z A;  3OBW A;  4D6W A;  3LX7 A;  3O8V A;  1HXD A;  3RKW A;  2QTX A;  3ASK A;  5FU6 C;  2IG0 A;  4C92 F;  3CXC A;  4C92 E;  4XTY A;  5GAN 3;  1N9R A;  2L89 A;  3CPW A;  1YI2 T;  2JUF A;  3FC3 A;  3JCM d;  2I2L A;  4A4F A;  1UEB A;  3MEW A;  4F7U F;  5LJ5 e;  4JS4 A;  3AHU A;  1N6A A;  5GAN d;  2RJD A;  1UGP B;  2EQU A;  2YLC A;  4ME7 A;  2XID A;  4BDY A;  1VQ5 A;  1UGQ B;  4IUT A;  3CCU A;  3JB9 G;  2DD5 A;  2EWN A;  2ZPH B;  2VGN A;  3TEE A;  1VQN T;  4J6W A;  1Q81 U;  4M7A C;  4HT9 A;  5A0L A;  3MO8 A;  3KBG A;  3M59 A;  3KUF A;  3JB9 I;  4R55 A;  1VIE A;  4C0Z A;  4M78 C;  4M77 B;  2QEX T;  1PSF A;  2PVG B;  4GLK A;  4X9D A;  2ZPG B;  4O6J A;  3HPW A;  3P8D A;  4PLI A;  2OTJ A;  4C92 A;  5CKB A;  1VQO T;  1K9M C;  3JCM c;  3M53 A;  1OZ2 A;  3GNG A;  3QUI A;  2XD0 A;  1LOJ A;  3OBY A;  5DM7 R;  4JRQ A;  5KH6 A;  1JBM A;  3OYD A;  3E1S A;  5CKH A;  3CBO A;  2KQW A;  4PJO F;  3SB2 A;  4MZM A;  4RMO A;  1YI2 A;  2P0P A;  4FL6 A;  3RES A;  2M16 A;  4HCB A;  3VJP A;  2LTO A;  3DB3 A;  4C5H A;  4E47 A;  3L2R A;  1VQ9 A;  3CC4 A;  1YJN A;  3I56 T;  3HRS A;  3OYH A;  2EYQ A;  2FHD A;  1VQN A;  1H64 1;  5DY9 A;  3JCM f;  1UGR B;  5CKE A;  3PT9 A;  4M75 D;  3V7R A;  4BE2 A;  3TCJ A;  4A53 A;  4OB1 B;  5CR2 A;  2LCC A;  3OS1 A;  2LT4 A;  1BI1 A;  3CME T;  3J80 E;  3HL8 A;  3M54 A;  3NTH A;  4V2S A;  1I5L A;  5GAN e;  1NE8 A;  2DXB A;  4O5V A;  2RHY A;  1VQP T;  2E64 A;  2DZ9 A;  5I2M A;  2K3Y A;  5HY6 A;  2ZPI B;  3NTI A;  4Y28 E;  5DLO A;  4OB3 B;  4IUV A;  4XTZ A;  1ZHI A;  3N5B B;  3QZ9 B;  1D3B B;  2DAQ A;  2EAY A;  3OS5 A;  5CQX A;  4M7A B;  2RD1 A;  4JS5 A;  4M78 E;  2LC4 A;  1YHQ T;  3RUX A;  3VKI A;  4BY6 B;  3JSC A;  1I81 A;  4JLI A;  5LJ3 h;  3QPH A;  4HCZ A;  2AHJ B;  1BI2 A;  3HFO A;  1Q81 C;  2K5L A;  3L2V A;  3V7S A;  1NPP A;  1UB4 A;  3JCM g;  2E10 A;  4OP0 A;  3HSB A;  1EIF A;  4A4K A;  1M1F A;  2LQ8 A;  2NLU A;  2YRV A;  3H6Z A;  3FLG A;  3HRT A;  2GF7 A;  3PGG A;  5LJ3 e;  1U8R A;  1MHN A;  3OW2 A;  1Q86 C;  4M7A A;  4N4H A;  4N4I A;  4M7D D;  3G71 A;  3OYJ A;  3QKJ A;  2LRQ A;  4RG8 A;  4EPC A;  3RMS A;  1BYM A;  3A8O B;  1KC8 C;  4M78 A;  2RB6 A;  5FU7 C;  5HKC A;  3I55 T;  2BUD A;  4PJO C;  3V8J A;  3QG1 A;  4JUV A;  2HQX A;  4C0D B;  4ZGJ B;  4PJO D;  2M0O A;  5GAM f;  3GLX A;  4JLG A;  2DTH A;  2KAF A;  3BDL A;  4M75 G;  1V29 B;  3FB9 A;  4ZGD B;  3OYK A;  4C8Q C;  2MMP A;  1YHQ A;  4DOV A;  3GIB A;  1PSE A;  3EFR A;  5GAM j;  1XOV A;  4J5Y A;  4BI8 B;  1VQ6 T;  4MDX A;  2E1H A;  3LYI A;  3CC7 A;  4VUB A;  1IZ6 A;  3S6W A;  1BKB A;  3F70 A;  4OVA A;  2RO0 A;  3VUZ A;  4XU1 A;  2KK4 A;  4M78 F;  4MML A;  4EMK B;  1WQ7 A;  1Q7Y C;  4EDU A;  1VIF A;  5CIU A;  2EFI A;  4XTV A;  4M7A F;  3OYY A;  2PUK B;  2YLB A;  2K4Y A;  2RJE A;  2LT1 A;  2XIC A;  3CCQ T;  4PJO E;  1N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...