1LOTA

Crystal structure of the complex of actin with vitamin d-binding protein
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
457
structure length
436
Chain Sequence
LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin D-binding protein
publication title Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
pubmed doi rcsb
molecule tags Transport protein, structural protein
total genus 161
structure length 436
sequence length 457
ec nomenclature
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00273 Serum_albumin Serum albumin family
A PF09164 VitD-bind_III Vitamin D binding protein, domain III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1lotA02
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1lotA03
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1lotA01
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1lotA04
1.10.246.10 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1lotA05
4N0UD 4EMXA 5IIXA 2XSIA 3JQZA 2BXLA 5DBYA 4K2CA 2VUEA 3LU6A 4JK4A 3A73A 3JRYA 4OT2A 5GHKA 1UORA 3B9LA 4HGMB 2BXGA 1E7HA 1LOTA 4E99A 4LUHA 1N5UA 4LA0A 3TDLA 1E7IA 4BKEA 1E7AA 4G03A 4IW2A 1HK3A 2BX8A 2VDBA 4L9QA 1E78A 4ZBQA 3B9MA 2BXMA 2BXQA 1O9XA 4J2VA 4G04A 4S1YA 1GNIA 1J7EA 2I2ZA 1KXPD 5IFOA 5ID7A 2BXNA 1HA2A 3LU8A 1BM0A 2XW1A 5HOZA 4L9KA 2YDFA 4F5TA 2BXAA 1KW2A 4IW1A 3SQJA 3V08A 2BXDA 5DQFA 1TF0A 1J78A 4Z69A 2XW0A 2VUFA 2BXHA 1HK2A 5ID9A 2XVQA 2XVWA 5IJ5A 2BXIA 2BXPA 2BXKA 1MA9A 2XVVA 5FUOA 3V03A 4HGKA 1AO6A 1E7EA 2BXFA 4PO0A 2BXCA 5IJEA 5IJFA 4LB9A 2BXOA 1E7GA 1E7CA 1HK1A 4N0FD 2BXBA 4L8UA 4K71A 3UIVA 1HK5A 4LUFA 1BKEA 4LB2A 4F5SA 2XVUA 5IIHA 1E7BA 1HK4A 3CX9A 3V09A 2BXEA 1BJ5A 2I30A 3LU7A 1H9ZA 4OR0A 1GNJA 4F5UA 4F5VA 1E7FA 4ZBRA 5IIUA
chains in the Genus database with same CATH superfamily
2EFHA 4N0UD 2DG5A 4EMXA 3M99C 2XSIA 3JQZA 2BXLA 3GQUA 4N3ZA 5DBYA 5IIXA 4K2CA 2LXSA 2Z8IA 2VUEA 3FWCC 3LU6A 4JK4A 3A73A 3JRYA 4OTTA 4OT2A 5GHKA 5B5TA 1UORA 2ROHA 3B9LA 3KIKA 4HGMB 2BXGA 1E7HA 4WA6B 3BPJA 1LOTA 4E99A 1FOUA 4LUHA 3VQIA 1N5UA 2XMOA 4LA0A 3G9KD 4Z9OA 3TDLA 5GINA 3SIVB 1E7IA 1LNSA 4BKEA 1E7AA 4G03A 4IW2A 3H37A 2GUTA 1HK3A 3WHQA 2BX8A 2JUHA 2VDBA 1E78A 4L9QA 4ZBQA 4TQ0A 3B9MA 1VZSA 2BXMA 2BXQA 1O9XA 4J2VA 1NT2B 1KDXA 4G04A 3WHSA 4S1YA 1GNIA 1J7EA 2I2ZA 4G01A 1KXPD 5IFOA 1JNBA 5ID7A 2BXNA 1HA2A 3LU8A 1BM0A 3H3AA 2EFCA 4FJCB 4ZUXV 2XW1A 2LOQA 1H5WA 2V36A 4L9KA 5HOZA 2YDFA 4F5TA 2BXAA 5GIPA 1KW2A 3KJLA 4IW1A 2DBXA 3FNMA 3SQJA 3V08A 4D7XA 2BXDA 3NVKA 4GDLB 3MHSB 2AJEA 5DQFA 1TF0A 1J78A 3SIUB 2KWFA 3WHRA 4W4UB 4Z69A 2LXTA 2XW0A 2VUFA 2BXHA 1HK2A 5ID9A 2XVQA 2XVWA 3GA9L 2QM6A 5IJ5A 2DBWA 2BXIA 2BXPA 2BXKA 2DBUA 4BY9C 1MA9A 3NMUA 3MHHB 2XVVA 4ZC6A 5FUOA 4GDKB 3V03A 2QHBA 2CKXA 4HGKA 1MIWA 4ZCGA 4ZBKA 1AO6A 1MUHA 1E7EA 4TQ1A 1IJGA 2BXFA 1MIVA 1SB0A 3GQXA 4PO0A 2BXCA 2LQHA 2NNWA 5IJEA 5IJFA 4LB9A 2BXOA 2Z8JA 1TXUA 4DM0A 1E7GA 2DYOA 3NVMA 5GIOA 4I9OA 3PLAA 2LQIA 3ECPA 1E7CA 1HK1A 4N0FD 2BXBA 5BPKA 2AGHB 2EFEA 2KBZA 4L8UA 4K71A 4OTUA 2DYMA 4GDXA 3UIVA 1HK5A 3W1SA 4C31B 4LUFA 2E0YA 4MBEC 3NVIA 4FK5B 1BKEA 4LB2A 4NAWB 4F5SA 2NQOA 4DHXB 2E0XA 2XVUA 2OZBB 4GG2A 5IIHA 1E7BA 2OT3A 1HK4A 3A75A 3CX9A 1MIYA 3V09A 4M70B 2BXEA 1BJ5A 2I30A 2Z8KA 3LU7A 1MUSA 1H9ZA 3FWBC 3ICXA 4FIPB 1GNJA 4OR0A 1VFIA 4F5UA 1MM8A 2K0NA 4F5VA 1E7FA 4ZBRA 2QMCA 2EFDA 5D7GA 5IIUA
chains in the Genus database with same CATH topology
2EFHA 4N0UD 2DG5A 4EMXA 3M99C 2XSIA 3JQZA 2BXLA 3GQUA 4N3ZA 5DBYA 5IIXA 4K2CA 2Z8IA 2VUEA 3FWCC 3LU6A 4JK4A 3A73A 3JRYA 4OTTA 4OT2A 5GHKA 5B5TA 1UORA 2ROHA 3B9LA 3KIKA 4HGMB 2BXGA 1E7HA 4WA6B 1LOTA 4E99A 1FOUA 4LUHA 3VQIA 1N5UA 2XMOA 4LA0A 3G9KD 4Z9OA 3TDLA 5GINA 3SIVB 1E7IA 1LNSA 4BKEA 1E7AA 4G03A 4IW2A 3H37A 3WHQA 1HK3A 2BX8A 2JUHA 2VDBA 1E78A 4L9QA 4ZBQA 4TQ0A 3B9MA 1VZSA 2BXMA 2BXQA 1O9XA 4J2VA 1NT2B 4G04A 3WHSA 4S1YA 1GNIA 1J7EA 2I2ZA 4G01A 1KXPD 5IFOA 1JNBA 5ID7A 2BXNA 1HA2A 3LU8A 1BM0A 3H3AA 2EFCA 4FJCB 4ZUXV 2XW1A 2LOQA 1H5WA 2V36A 4L9KA 5HOZA 2YDFA 4F5TA 2BXAA 5GIPA 1KW2A 3KJLA 4IW1A 2DBXA 3FNMA 3SQJA 3V08A 3NVKA 2BXDA 4GDLB 3MHSB 2AJEA 5DQFA 1TF0A 1J78A 3SIUB 3WHRA 4W4UB 4Z69A 2XW0A 2VUFA 2BXHA 1HK2A 5ID9A 2XVQA 2XVWA 3GA9L 2QM6A 5IJ5A 2DBWA 2BXIA 2BXPA 2BXKA 2DBUA 4BY9C 1MA9A 3NMUA 3MHHB 2XVVA 4ZC6A 5FUOA 4GDKB 3V03A 2QHBA 2CKXA 4HGKA 1MIWA 4ZCGA 4ZBKA 1AO6A 1E7EA 4TQ1A 1IJGA 2BXFA 1MIVA 3GQXA 4PO0A 2BXCA 2NNWA 5IJEA 5IJFA 4LB9A 2BXOA 2Z8JA 1TXUA 1E7GA 2DYOA 3NVMA 5GIOA 3PLAA 1E7CA 1HK1A 4N0FD 2BXBA 5BPKA 2EFEA 4L8UA 2KBZA 4K71A 4OTUA 2DYMA 4GDXA 3UIVA 1HK5A 3W1SA 4C31B 4LUFA 2E0YA 4MBEC 3NVIA 4FK5B 1BKEA 4LB2A 4NAWB 4F5SA 2NQOA 4DHXB 2E0XA 2XVUA 2OZBB 4GG2A 5IIHA 1E7BA 2OT3A 1HK4A 3A75A 3CX9A 1MIYA 3V09A 4M70B 2BXEA 1BJ5A 2I30A 2Z8KA 3LU7A 1H9ZA 3FWBC 3ICXA 4FIPB 1GNJA 4OR0A 1VFIA 4F5UA 4F5VA 1E7FA 4ZBRA 2QMCA 2EFDA 5D7GA 5IIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0U D;  4EMX A;  5IIX A;  2XSI A;  3JQZ A;  2BXL A;  5DBY A;  4K2C A;  2VUE A;  3LU6 A;  4JK4 A;  3A73 A;  3JRY A;  4OT2 A;  5GHK A;  1UOR A;  3B9L A;  4HGM B;  2BXG A;  1E7H A;  1LOT A;  4E99 A;  4LUH A;  1N5U A;  4LA0 A;  3TDL A;  1E7I A;  4BKE A;  1E7A A;  4G03 A;  4IW2 A;  1HK3 A;  2BX8 A;  2VDB A;  4L9Q A;  1E78 A;  4ZBQ A;  3B9M A;  2BXM A;  2BXQ A;  1O9X A;  4J2V A;  4G04 A;  4S1Y A;  1GNI A;  1J7E A;  2I2Z A;  1KXP D;  5IFO A;  5ID7 A;  2BXN A;  1HA2 A;  3LU8 A;  1BM0 A;  2XW1 A;  5HOZ A;  4L9K A;  2YDF A;  4F5T A;  2BXA A;  1KW2 A;  4IW1 A;  3SQJ A;  3V08 A;  2BXD A;  5DQF A;  1TF0 A;  1J78 A;  4Z69 A;  2XW0 A;  2VUF A;  2BXH A;  1HK2 A;  5ID9 A;  2XVQ A;  2XVW A;  5IJ5 A;  2BXI A;  2BXP A;  2BXK A;  1MA9 A;  2XVV A;  5FUO A;  3V03 A;  4HGK A;  1AO6 A;  1E7E A;  2BXF A;  4PO0 A;  2BXC A;  5IJE A;  5IJF A;  4LB9 A;  2BXO A;  1E7G A;  1E7C A;  1HK1 A;  4N0F D;  2BXB A;  4L8U A;  4K71 A;  3UIV A;  1HK5 A;  4LUF A;  1BKE A;  4LB2 A;  4F5S A;  2XVU A;  5IIH A;  1E7B A;  1HK4 A;  3CX9 A;  3V09 A;  2BXE A;  1BJ5 A;  2I30 A;  3LU7 A;  1H9Z A;  4OR0 A;  1GNJ A;  4F5U A;  4F5V A;  1E7F A;  4ZBR A;  5IIU A; 
#chains in the Genus database with same CATH topology
 2EFH A;  4N0U D;  2DG5 A;  4EMX A;  3M99 C;  2XSI A;  3JQZ A;  2BXL A;  3GQU A;  4N3Z A;  5DBY A;  5IIX A;  4K2C A;  2LXS A;  2Z8I A;  2VUE A;  3FWC C;  3LU6 A;  4JK4 A;  3A73 A;  3JRY A;  4OTT A;  4OT2 A;  5GHK A;  5B5T A;  1UOR A;  2ROH A;  3B9L A;  3KIK A;  4HGM B;  2BXG A;  1E7H A;  4WA6 B;  3BPJ A;  1LOT A;  4E99 A;  1FOU A;  4LUH A;  3VQI A;  1N5U A;  2XMO A;  4LA0 A;  3G9K D;  4Z9O A;  3TDL A;  5GIN A;  3SIV B;  1E7I A;  1LNS A;  4BKE A;  1E7A A;  4G03 A;  4IW2 A;  3H37 A;  2GUT A;  1HK3 A;  3WHQ A;  2BX8 A;  2JUH A;  2VDB A;  1E78 A;  4L9Q A;  4ZBQ A;  4TQ0 A;  3B9M A;  1VZS A;  2BXM A;  2BXQ A;  1O9X A;  4J2V A;  1NT2 B;  1KDX A;  4G04 A;  3WHS A;  4S1Y A;  1GNI A;  1J7E A;  2I2Z A;  4G01 A;  1KXP D;  5IFO A;  1JNB A;  5ID7 A;  2BXN A;  1HA2 A;  3LU8 A;  1BM0 A;  3H3A A;  2EFC A;  4FJC B;  4ZUX V;  2XW1 A;  2LOQ A;  1H5W A;  2V36 A;  4L9K A;  5HOZ A;  2YDF A;  4F5T A;  2BXA A;  5GIP A;  1KW2 A;  3KJL A;  4IW1 A;  2DBX A;  3FNM A;  3SQJ A;  3V08 A;  4D7X A;  2BXD A;  3NVK A;  4GDL B;  3MHS B;  2AJE A;  5DQF A;  1TF0 A;  1J78 A;  3SIU B;  2KWF A;  3WHR A;  4W4U B;  4Z69 A;  2LXT A;  2XW0 A;  2VUF A;  2BXH A;  1HK2 A;  5ID9 A;  2XVQ A;  2XVW A;  3GA9 L;  2QM6 A;  5IJ5 A;  2DBW A;  2BXI A;  2BXP A;  2BXK A;  2DBU A;  4BY9 C;  1MA9 A;  3NMU A;  3MHH B;  2XVV A;  4ZC6 A;  5FUO A;  4GDK B;  3V03 A;  2QHB A;  2CKX A;  4HGK A;  1MIW A;  4ZCG A;  4ZBK A;  1AO6 A;  1MUH A;  1E7E A;  4TQ1 A;  1IJG A;  2BXF A;  1MIV A;  1SB0 A;  3GQX A;  4PO0 A;  2BXC A;  2LQH A;  2NNW A;  5IJE A;  5IJF A;  4LB9 A;  2BXO A;  2Z8J A;  1TXU A;  4DM0 A;  1E7G A;  2DYO A;  3NVM A;  5GIO A;  4I9O A;  3PLA A;  2LQI A;  3ECP A;  1E7C A;  1HK1 A;  4N0F D;  2BXB A;  5BPK A;  2AGH B;  2EFE A;  2KBZ A;  4L8U A;  4K71 A;  4OTU A;  2DYM A;  4GDX A;  3UIV A;  1HK5 A;  3W1S A;  4C31 B;  4LUF A;  2E0Y A;  4MBE C;  3NVI A;  4FK5 B;  1BKE A;  4LB2 A;  4NAW B;  4F5S A;  2NQO A;  4DHX B;  2E0X A;  2XVU A;  2OZB B;  4GG2 A;  5IIH A;  1E7B A;  2OT3 A;  1HK4 A;  3A75 A;  3CX9 A;  1MIY A;  3V09 A;  4M70 B;  2BXE A;  1BJ5 A;  2I30 A;  2Z8K A;  3LU7 A;  1MUS A;  1H9Z A;  3FWB C;  3ICX A;  4FIP B;  1GNJ A;  4OR0 A;  1VFI A;  4F5U A;  1MM8 A;  2K0N A;  4F5V A;  1E7F A;  4ZBR A;  2QMC A;  2EFD A;  5D7G A;  5IIU A; 
#chains in the Genus database with same CATH homology
 2EFH A;  4N0U D;  2DG5 A;  4EMX A;  3M99 C;  2XSI A;  3JQZ A;  2BXL A;  3GQU A;  4N3Z A;  5DBY A;  5IIX A;  4K2C A;  2Z8I A;  2VUE A;  3FWC C;  3LU6 A;  4JK4 A;  3A73 A;  3JRY A;  4OTT A;  4OT2 A;  5GHK A;  5B5T A;  1UOR A;  2ROH A;  3B9L A;  3KIK A;  4HGM B;  2BXG A;  1E7H A;  4WA6 B;  1LOT A;  4E99 A;  1FOU A;  4LUH A;  3VQI A;  1N5U A;  2XMO A;  4LA0 A;  3G9K D;  4Z9O A;  3TDL A;  5GIN A;  3SIV B;  1E7I A;  1LNS A;  4BKE A;  1E7A A;  4G03 A;  4IW2 A;  3H37 A;  3WHQ A;  1HK3 A;  2BX8 A;  2JUH A;  2VDB A;  1E78 A;  4L9Q A;  4ZBQ A;  4TQ0 A;  3B9M A;  1VZS A;  2BXM A;  2BXQ A;  1O9X A;  4J2V A;  1NT2 B;  4G04 A;  3WHS A;  4S1Y A;  1GNI A;  1J7E A;  2I2Z A;  4G01 A;  1KXP D;  5IFO A;  1JNB A;  5ID7 A;  2BXN A;  1HA2 A;  3LU8 A;  1BM0 A;  3H3A A;  2EFC A;  4FJC B;  4ZUX V;  2XW1 A;  2LOQ A;  1H5W A;  2V36 A;  4L9K A;  5HOZ A;  2YDF A;  4F5T A;  2BXA A;  5GIP A;  1KW2 A;  3KJL A;  4IW1 A;  2DBX A;  3FNM A;  3SQJ A;  3V08 A;  3NVK A;  2BXD A;  4GDL B;  3MHS B;  2AJE A;  5DQF A;  1TF0 A;  1J78 A;  3SIU B;  3WHR A;  4W4U B;  4Z69 A;  2XW0 A;  2VUF A;  2BXH A;  1HK2 A;  5ID9 A;  2XVQ A;  2XVW A;  3GA9 L;  2QM6 A;  5IJ5 A;  2DBW A;  2BXI A;  2BXP A;  2BXK A;  2DBU A;  4BY9 C;  1MA9 A;  3NMU A;  3MHH B;  2XVV A;  4ZC6 A;  5FUO A;  4GDK B;  3V03 A;  2QHB A;  2CKX A;  4HGK A;  1MIW A;  4ZCG A;  4ZBK A;  1AO6 A;  1E7E A;  4TQ1 A;  1IJG A;  2BXF A;  1MIV A;  3GQX A;  4PO0 A;  2BXC A;  2NNW A;  5IJE A;  5IJF A;  4LB9 A;  2BXO A;  2Z8J A;  1TXU A;  1E7G A;  2DYO A;  3NVM A;  5GIO A;  3PLA A;  1E7C A;  1HK1 A;  4N0F D;  2BXB A;  5BPK A;  2EFE A;  4L8U A;  2KBZ A;  4K71 A;  4OTU A;  2DYM A;  4GDX A;  3UIV A;  1HK5 A;  3W1S A;  4C31 B;  4LUF A;  2E0Y A;  4MBE C;  3NVI A;  4FK5 B;  1BKE A;  4LB2 A;  4NAW B;  4F5S A;  2NQO A;  4DHX B;  2E0X A;  2XVU A;  2OZB B;  4GG2 A;  5IIH A;  1E7B A;  2OT3 A;  1HK4 A;  3A75 A;  3CX9 A;  1MIY A;  3V09 A;  4M70 B;  2BXE A;  1BJ5 A;  2I30 A;  2Z8K A;  3LU7 A;  1H9Z A;  3FWB C;  3ICX A;  4FIP B;  1GNJ A;  4OR0 A;  1VFI A;  4F5U A;  4F5V A;  1E7F A;  4ZBR A;  2QMC A;  2EFD A;  5D7G A;  5IIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...