1LQBA

Crystal structure of a hydroxylated hif-1 alpha peptide bound to the pvhl/elongin-c/elongin-b complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongin B
publication title Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1lqbA00
3IHPC 3N30A 3ML8A 4LDTB 1J8CA 2FIFA 2MBOA 2RGFA 2DYMA 2RD0A 3QAQA 2XK5A 3M63B 2KJHB 3U30A 5JH5C 1I35A 4EFOA 4G3XB 1E7UA 1V81A 1WGHA 2GBMA 1WRDB 1SIFA 2KN5A 2LASA 3HM3A 3PV1A 3R66C 4LDTD 2BWES 2NBUA 3VUYA 4OVUA 3PPAA 4B9KA 4E3CA 4IM2A 2KDFB 2LZ6A 4MEMA 4WJQA 2N1VA 4HDOA 3KVFB 1V6EA 1V5OA 1V5TA 3ONSA 2O6VB 2JPHA 1M94A 2AEHA 1RAXA 3Q3JA 2OJRA 2UWQA 2NS5A 2J0MA 4W9IA 2IO0B 3I3TB 4DDGD 1WM3A 4B6WA 2O6VD 1SE9A 1KLVA 4ZYNA 2G4SA 1WIAA 2WYQA 4K7SA 3R3MA 1L2NA 1LXDA 4GSWA 3ZVVA 2LRUA 3IVFA 1GC7A 2BGFA 2DZJA 4IWQA 2LGXA 2V1YA 3B08A 3B1LX 4J6IA 3V6EB 4PYZA 1TGZB 1WZ0A 1E90A 3M62B 2KMCA 3ENEA 3H7PB 4M8NA 2KFKB 5L83A 2CHXA 1G6JA 3A9JA 1OQYA 3DCGA 3M95A 3ZLZA 2JWZA 4A3OA 4F1SA 3W1YA 1R4MI 1Y8RC 1TTNA 2GOWA 3S2AA 4EZJA 4LJPB 1UZXB 3L10B 3PHXB 3V6CB 2KC1A 1S1QB 5DPTA 2MCNB 2LVQA 2N9EB 5TR5A 4DBGA 2BKFA 3QARA 3V60A 3VXWA 4M8MA 4IW0A 2MP2B 4NAWB 4AJWA 1WGYA 3PSEB 5BO4B 3X23A 1WFYA 1V49A 4W9EA 2FNJB 4FULA 4F8CB 1ZKHA 2L3ZA 1U4AA 2KLGA 2WX0A 2ZPYA 4ANUA 2KX0A 2MBEA 2O6VA 2L76A 1RFAA 1P9DU 3DBLI 5C1ZA 3RYTA 3TL5A 4BBNC 2BF8B 2MWSB 4HPMB 1KM7A 2I1KA 2NCNA 4RM8A 3APCA 3DVNU 1UBIA 3AXCA 1V86A 4BOSC 4EZKA 4GXBA 3H6NA 4HDQA 2XK5B 4MGKE 4MM3A 3OLMD 2B3AA 2J0KA 2KTRA 2CU1A 3H7PA 2K39A 3A9KA 2KANA 2KFKA 4GGQA 3DVGY 3PRZA 1TBEA 2NBWB 5LLIA 2V4LA 2KFJA 4URKA 4W9JA 3PT2B 2V3SA 1XD3B 5LXIB 3NS8A 4PS8A 2AYOB 3A4RA 3CSFA 3IBEA 3PRPB 3L13A 1WF9A 4IM3A 2ASQA 2UYZB 4I6NB 3ZUNA 3DPDA 4FA6A 3SD5A 3QCAA 2MW5A 2ZJDA 2IY0B 2G45B 3EECA 1TZ1A 2C60A 2KLCA 3WA0A 4E74A 2BYVE 2DYOA 4E71A 3PS6A 3ZIMA 2K1FA 3QA8A 1VCBA 1P1AA 1CMXB 3ECIA 1WX8A 3WAPA 1WH3A 1WGDA 3L54A 1KOTA 4ZDVA 2KOXA 4W9HA 3TCAA 4KVGB 2WWZA 1EF5A 4MH0E 4GU2A 2DYBA 4RM9A 4YL8A 2QHOA 4DDID 4FADA 4HK2A 4I6PA 2BYEA 4NNJB 2XEWA 5J18A 3Q3FA 2LI5A 4BVUC 4DHJB 1XQQA 2JRIB 2D3GA 4TV3A 3L17A 2IO3B 3MHSD 5KHOA 3UQBA 3KUZA 2WX1A 4JIOU 1HE8A 3TMPB 1Z2MA 4EUTA 3VFKA 3QIJA 3JSVB 3DQVA 2K6QA 2EMTA 4DHJD 4EOYA 1EUVB 3QK0A 5AZFA 3WAOA 4M0WB 4KZCA 5J2RA 3VAWA 1UBQA 3VHTC 3H1UA 5CHWA 5G2NA 4A3PA 2JXXA 3GOEA 4NJ6A 2O2VB 3DBSA 5DPWA 1H8CA 1WXAA 4MSQB 5JZEB 2CHWA 3PGEA 3ZNZB 4AP4C 2Y5BB 3W1SC 2MLBA 1WY8A 2EKEC 4NQLB 2RR9A 4PYUA 2XBBC 3O65B 4DHZE 3NHEB 3KW5B 4BFRA 2DHZA 1YIWA 4DK5A 4K1RB 1UELA 2M1MA 2PJHA 4IG7B 4ANVA 5GMVA 4XX5A 2KTRB 2LWPA 3QWZB 2RPQA 3A9KB 3ZO5B 4HCNB 2DENB 3KYCD 4CO7A 4MDKE 3A1QA 5CHVC 1OEYA 1WZ3A 2DAFA 2GBJA 1R4NI 2HJ8A 2KX3A 3VUWA 4AUQC 3N3KB 3D32A 1WXSA 1LQBA 2HE7A 2PPHA 3ML9A 5AEKB 3JW0X 3L0WB 3VTUA 1V2YA 3BY4B 5JHAA 4PS3A 1IP9A 1NI2A 1WR6E 2KVRA 2RSUA 4KIKA 5DCNA 3JYUA 2MSED 3NY5A 3ZNID 2K8CA 4HJKA 2A4ZA 4W9KA 1UH6A 3M3JA 2ZZPB 1IPGA 3WALA 2IY1B 5AZGA 2LD9A 3CMMB 3JSVA 4GDKB 4AWJA 4WJNA 2BYFA 1E7VA 3RCZA 1WI0A 2N7DA 3KYDD 3OJ4B 4ZRIA 4K7UA 2N9XA 4FBJB 4WJPA 3T8MA 3NZUA 4IM0A 1T0YA 5LXHA 4WQOB 1Q0WB 5E6PA 2PE6B 5EDSA 4IC7B 2O2VA 1XT9B 2PE9A 3SU8X 2L05A 1Q1OA 2L0TA 3ZNGC 2KK8A 1WJ6A 3HM6X 1ISNA 3R7QA 3MJWA 4MJSA 2Z0EB 3DVGX 2A5UA 4MGYE 4NY0A 4GMVA 3SDLC 2D11A 3APDA 1KJTA 5G55A 3W1SA 1WX7A 3PLVA 1NBFC 1UD7A 1WE7A 4JQWC 2L7RA 3HHMA 4KZ0A 1WJNA 3DVNV 5AZHA 2C7MB 4II3B 2KD0A 2JUOA 4PS7A 3V61A 3VH4B 2C9WB 2IBIB 2KHWB 2NR2A 4DHZB 3VTWA 3RT3B 2G4DB 2LXAA 3A4SC 4JLCA 3WIMA 3T9LA 4HLEA 5FR6A 3WANA 4IWOA 3PZDA 4WWOA 2MA9B 3RUIB 3H7SA 1WXMA 2I1JA 3ZDTA 2DAJA 3DOWA 1K8RB 4WWNA 3TJPA 4G11A 3A33B 4GDLA 4BKSA 2L00B 1C3TA 1ZGUB 4GDKA 1RLFA 2LUEA 2YLMA 2LJ5A 5IAAC 3UIOB 2N4FA 1YJ1A 2C7NB 4GB9A 2J7QB 3UINB 4K81A 4XC2A 4EKUA 1UGMA 1SGHA 3A1QB 4GOCA 1IYFA 5CTRC 2M4NA 2MQJA 4G0NB 3H9DA 2CKHB 4TQ0A 2HTHA 1YQBA 4FHKA 4HPLB 3X0WA 2D07B 1MG8A 2LVOA 4KIKB 3DBRI 3BINA 4ICVA 4MSMB 2KC2A 1YX6B 3GZNI 1WE6A 4AJYB 1GNUA 4IWPA 3K9OB 5HKHA 1WGRA 3APFA 4W9DA 3ZDMC 3IFWB 2CHZA 2MBBB 3ZKJC 2REXA 4KV2A 2KDBA 1WYWB 2FCMA 2D2QA 4K7WA 4CHKA 2MX2A 1J19A 2AL6A 4TKNA 4BBNF 2JZZA 1X1MA 2LGDA 1PQSA 3L16A 3QJZA 1E8XA 3N32A 4HCPB 2VRRB 4A20A 4HVBA 2OOBB 1D3ZA 2NBVB 4ASWC 1L7YA 2KO3A 2Z0DB 2ZVNA 3LJ3A 1FXTB 1C1YB 5CX3A 2MBHA 4P7IA 4N9F4 4MELA 2L0FA 4NJ7A 2KWUB 2MRPA 3CF6E 1GG3A 2CR5A 1S3SG 2K8BA 2N1WA 2R2OA 4FJYA 2KJRA 4GIVA 4MJSB 4ZRKA 4AOFA 2KXJA 4RMAA 3U7DA 2DZIA 4LJOB 2MBQA 3ZRCA 4NQKE 5CHFA 4FJVB 2CS4A 5D6JB 1OTRB 5C23A 4B95A 1WGGA 3K9PB 3ZTCA 3LDZE 3U8ZA 3UGBB 3VQIA 4W9FA 2M0XA 2KQ7A 3PRMB 2DZMA 4X57B 1I42A 2LVPA 5E6NA 3AU4A 3RZFA 5D2MB 2JVCA 3PLUA 2K25A 3L08A 4LCDE 3ZTDA 2EMSA 1H4RA 2BKRB 1E8ZA 3UIPB 2IO2B 3AULA 3VTVA 4CYEA 5L95C 1V9JA 3NOBA 2KNBA 3R7RA 2GBKA 4KDLB 1WXVA 4GDLB 2DX5B 4HXDA 4W9GA 2JF5A 3EFUA 2KDEB 4JGHB 4FN2A 3WAMA 2KJ6A 1J0GA 2M8SA 4XZ4A 1WMHA 4HWIB 4DXAB 1WR1A 1P0RA 3PHWB 2JY6A 3DBHI 4BKSD 3MTNB 5J17A 2W9NA 1E8YA 3QQ8B 1V80A 2NPTA 1Q5WB 2FCQA 2BPSA 1GUAB 2C7HA 4KSLC 2JRHA 3NZSA 4DWFA 1AARA 2IYDB 4WJOA 2K8HA 3AI5A 4G50A 4NPNA 2GBNA 4II2B 2KMAA 3VH3B 1OGWA 1BT0A 3PREA 4KDIC 2BWFA 2ZVOA 5E6OA 2WDTB 3HK0A 2KDIA 5KHQA 1ZW7A 1LM8B 2AL3A 2M17A 2C5LC 2IZVB 4BKTA 3RZWC 3TIXA 2NVUI 4FHJA 3EC8A 3KUDB 4GN1A 4TUUA 3VVWB 4KSKC 3KH0A 4BKGA 2HD5B 3UF8A 2FAZA 3OAWA 4ZRJA 3RD2A 2DZKA 2GBRA 1NDDA 3QC8B 2L8JA 3KUCB 3HIZA 2FCNA 3AU5A 4BOZB 2ZCCA 3ZRFA 2IO1B 2PEAA 4WWPA 3PTFC 4ANXA 2ZEQA 5DPSA 5D94A 3RULA 1YD8U 4EZLA 1EF1A 4MGIE 3V62A 4WAAA 1WM2A 1LFDA 1P98A 4F7ZA 3TBLD 3ZNHB 1QZEA 2KTFA 1RRBA 4TQ1A 2KZRA 4W9CA 5JHBA 3C0RB 1WX9A 2KWVB 2JT4B 2ZNVC 4ICUA 2N9PC 3P2BA 4IUMB 2N7EA 2FIDA 4FJZA 4W9LA 1OEYJ 2D10A 4I6LB 2ZNVB 3JVZX 3B0AA 1E5WA 3ZW3A 3VDZA 2MP2A 2G3QB 2K6DB 2KKCA 1Z5SB 2LGYA 2JZ3B 3CSTA 4NAWA 1E8WA 2LRWA 1WJ4A 2R2QA 3ALBA 3EHVA 1YX5B 3PVLA 3SHQA 5IA7A 1P3QU 2J0JA 4EEWA 3IG3A 5DPRA 2Z59B 1JRUA 2FUHB 2YVCA 2GMIC 3DDCB 2KQSA 1VD2A 2FCSA 2KWCA 1WJUA 1EO6A 3A9JB 3QX1A 3QHTA 3OJ3A 2AWTA 1F9JA 1WMHB 4FLHA 1GC6A 4MGZE 3VUXA 1GJZA 4OVVA 5D7GA 4ANWA 2LXCA 2NPTB 2ZCBA 4JL9A 3UQAA 2ZPNA 1A5RA
chains in the Genus database with same CATH superfamily
4LDTB 2MBOA 2RGFA 2DYMA 2RD0A 3P4RB 1FCCC 5JH5C 3U30A 1C79A 1V81A 1SIFA 2KN5A 3R66C 4E3CA 4B9KA 2LZ6A 3ZXVA 2N1VA 4HDOA 2ZW1A 5HG2A 1V6EA 1V5OA 1V5TA 2O6VB 2JPHA 2WXRA 2WXNA 4Q2JA 2UWQA 1XCQL 2IO0B 3I3TB 4B6WA 1T0QC 4ZYNA 3ZVVA 2DZJA 3B1LX 4J6IA 4PYZA 2KMCA 2K22A 3ETRA 3M95A 4C56C 2KACA 3ZLZA 2JWZA 3W1YA 1BXTA 4LJPB 4XWWA 1UWXA 1UZXB 3L10B 3V6CB 1A70A 1S1QB 2HTME 2D5GA 1WGYA 5BO4B 2ACZB 1MVKA 1EWYC 4F8CB 1ZKHA 2O6VA 2LMCA 2LHEA 1C77A 1E10A 1DOXA 3BK2A 1V86A 4EZKA 2WXHA 1FXIA 1N61A 1ZE3D 2QIEB 1WSPA 2K39A 3P42A 2AQ1B 2JYTA 5LLIA 2V4LA 4URKA 2PKOA 4W9JA 1FRRA 2V3SA 5LXIB 3NS8A 3IBEA 3CSFA 3L13A 1WF9A 3J9CA 1UF0A 1ZOYB 3QCAA 1V1PA 3EECA 3WA0A 3IAM1 2IGDA 2N9KA 2BYVE 3ZIMA 3SR6A 1P1AA 3ECIA 1WH3A 4ARIA 2YEPF 3TCAA 2WWZA 4RM9A 4YL8A 3AN1A 4FADA 2N7JA 4DXFA 3DBLB 1D5XC 3Q3FA 4BVUC 3FKYA 1KLGD 1XQQA 2WQYB 4YSZB 3PO0A 3N1ZC 5IKCM 1HE8A 5BMHA 4LNFA 2K6QA 4DHJD 1N5XA 3QK0A 3WAOA 4KZCA 3VAWA 1UBQA 3H1UA 5CHWA 2Y3AA 1SIJA 3DBSA 4XGAB 4KX6B 4MSQB 3PGEA 3ZNZB 1N5WA 2V4IB 1KF6B 4NQLB 4BZAA 3MC8A 1AN8A 5C3JB 4BFRA 4DK5A 1UELA 1N63A 1RM6C 5GMVA 4WURA 1YN5A 4DQOC 3BVGA 3A9KB 2DAFA 1VLBA 2HJ8A 2KX3A 3L0WB 3VTUA 3BY4B 1E6EB 2WP9B 2RSUA 4P1BC 1KRHA 4KIKA 2KYWA 5DCNA 2MSED 4HJKA 1UH6A 2KMMA 5G5GA 3CMMB 3VRBB 1WI0A 3OJ4B 4FBJB 4WJPA 5E6PA 1J7AA 1FXAA 4USAA 3ZNGC 3HM6X 3RNCC 3R7QA 1F1HA 1ZXIA 3I5JC 4NY0A 3APDA 1KJTA 2WNMA 1QQRA 3Q2AC 5AZHA 4C4VB 3ABVB 1TIFA 2KD0A 2JUOA 3V61A 2C9WB 2IBIB 3C19A 3RT3B 2G4DB 1D5ZC 2W55A 3A4SC 4IWOA 1HZ5A 1SJED 3H7SA 1WXMA 4YSXB 2I1JA 3ZDTA 4WWNA 1ACCA 2L00B 1ZGUB 2YLMA 4AQ7A 4OW0A 1WYGA 3UINB 1JWMD 1T0SC 2BBCA 2KT7A 3IAS1 2BYTA 2QMTA 1YQBA 3X0WA 1D4BA 2W54A 1MG8A 2KC2A 1YQ3B 5HKHA 4YXDB 3TEYA 3B9JA 4KV2A 4CHKA 2D2QA 4K7WA 1J19A 2AL6A 4TKNA 2G1EA 1PQSA 2RMMA 2Z0DB 4N9F4 2BW2A 4MELA 3RPFC 3VR9B 1STEA 4NJ7A 2MRPA 5AZFA 1S3SG 4FJYA 4ZRKA 3AEBB 4C80A 3MHZA 1QILA 4RFBA 3ZTCA 1SE3A 1D5MC 4REZA 3EA6A 5D2MB 1ZPSA 3Q3MC 2VH2A 4LCDE 3ZTDA 3UI3A 2EMSA 4WQMA 1FFUA 1YN4A 3NOBA 2KNBA 1WXVA 2JF5A 3BZDB 2J4XA 3DWGC 2M8SA 3AE9B 3PHWB 4HROA 2JY6A 2KWDA 4ZHOA 2ONQA 4KSLC 3E56A 1I4QA 1HA5A 2IYDB 2K8HA 3DHHC 4KGTA 4L1BA 1BT0A 2Q5WD 1GAQB 2WDTB 1V97A 3AE1B 5EE3A 2MH7A 1SJHD 4YTMB 2NMQA 2HD5B 1NI3A 3RD2A 1NDDA 3Q8EA 2FCNA 3H8HA 1YJIA 1CZPA 3PTFC 2ZEQA 2WXGA 5D94A 4WAAA 1WM2A 4F7ZA 2KTFA 3PZ7A 1I4XA 3BWUD 2ZNVC 4ICUA 2N7EA 4FJZA 2BS3B 1PYWD 1FIQA 2Y5PA 4UDUC 3ZYYX 3EUB2 3ZW3A 1IGCA 3ALBA 2LRWA 4TMAB 3SHQA 3MFGA 5IA7A 1KLUD 1RWSA 2J0JA 4S0RA 3DWMA 2FCSA 1MG4A 1WJUA 1FCLA 2AWTA 1WMHB 2JSVX 4ANWA 1WRIA 3I63C 2BB5A 1A5RA 1SBBB 4HKZE 2XK5A 2K9XA 3M63B 2KJHB 1I35A 3HM3A 1WRDB 4LDTD 3VUYA 4MEMA 3KVFB 5EE9A 5LNK1 1RAXA 1FNUA 3FC4A 1L6VA 1HZ6A 2OJRA 2J0MA 4W9IA 4DDGD 4MH8A 2O6VD 2BS2B 2KAJA 1KLVA 2JXTA 1RYJA 4NZLB 2BT6A 4GSWA 2LRUA 1GC7A 2D3BA 2AX5A 1ZDXA 3H7PB 5L83A 1IUEA 2WXMA 1KTKA 3Q3OC 1BMLC 2LFIA 1Y8RC 1TTNA 2GOWA 1J7CA 5DPTA 2N9EB 4DBGA 2BKFA 1L6UA 2MP2B 4AJWA 4RNAA 4RH6A 3X23A 1JMLA 1V49A 4FULA 4NJCA 2KLGA 2ZPYA 2KX0A 2MBEA 1P9DU 2AQ2B 5IOIA 2MWSB 1F0ZA 1KM7A 3DVNU 3AXCA 3H6NA 1PDXA 4ZOHC 3RI7C 1CJEA 3W2DA 4YTPB 4C7YA 3H7PA 2PTLA 1TBEA 2NBWB 3WCQA 4ZRQA 5H8YE 4PS8A 3PRPB 3ZUNA 3DPDA 3SD5A 2ZJDA 1ZUD2 2QC8A 1TZ1A 2C60A 2KLCA 4E74A 1TY0A 2DYOA 4E71A 1WGKA 2X8XX 2Z8LA 4ZRPA 1FM0D 1R7SA 3AB5A 1KOTA 4ZDVA 2KOXA 4MH0E 4GU2A 1C4AA 4HK2A 1HXYD 4I6PA 2XEWA 1KH0A 1TS5A 3MHSD 2WX1A 4EUTA 1B1ZA 3JSVB 3DQVA 2JX5A 3HRDD 5G5HA 1EUVB 1Y56A 4M0WB 2FUG1 1C4PA 5J2RA 3P4PB 5AUIA 1TY2A 2CHWA 1L4DB 2RR9A 2XBBC 4US8A 4DHZE 3KW5B 3AEGB 4ACFA 4K1RB 2PJHA 2M1MA 4ANVA 4XX5A 5I4DA 4FXCA 2H89B 2RPQA 2XN9C 2LHDA 3KYCD 4MDKE 1R4NI 4AUQC 5AEKB 1WXSA 1LQBA 2HE7A 2WLBA 1PGBA 5FKAC 1WR6E 1TZOA 2VZKB 1V1PB 2K8CA 3M3JA 2ZW0A 1IPGA 5MPOA 5HI1A 3WALA 3DBRB 1TKGA 5AZGA 2LD9A 3JSVA 2WDRB 4WJNA 3RCZA 5C2TB 4KGRA 4M0WA 3IT6B 3Q8BA 2X38A 4WQOB 5EDSA 2PE6B 4IC7B 4CQNA 1GB4A 1LGRA 5H92C 2L05A 3B2GA 2L0TA 1UNSA 1YMHE 2EELA 1ISNA 3MJWA 1IGDA 4MJSA 2Z0EB 2QDFA 3DVGX 4MGYE 1QOAA 4IKGA 4JPSA 1WX7A 4KZ0A 1CK1A 3VR8B 2N0SB 4YSYB 2CJNA 1F52A 3VH4B 3VTWA 4ZHPA 1UWMA 5FR6A 2NTTA 3RUIB 1F2RI 3TJPA 4BKSA 5JXVA 3UIOB 1SEBD 1YJ1A 4WWMA 1UGMA 5CTRC 3FILB 4G0NB 2NTSA 1DGJA 4TQ0A 2KVZA 1TS3A 4KIKB 4MSMB 1ZXHA 3DBRI 3KWVA 3ZGZA 1SB3C 1WE6A 4AJYB 2INPE 3W5UB 2V3PA 2E3TA 1EU3A 2REXA 2KDBA 3RNEC 2MX2A 5D3DA 3L16A 3QJZA 1E8XA 3N32A 4WIPA 2VRRB 4HVBA 4ASWC 1L7YA 2KO3A 2ZVNA 1FXTB 1C1YB 1QOFA 2MBHA 1TKEA 3LXFA 3CF6E 2N1WA 3ZJTA 4OVZA 4RMAA 4TSSA 3U7DA 1TT5B 2MBQA 4LJOB 3ZRCA 2WXQA 4FJVB 2V3NA 1N62A 1TJEA 3MC0B 2CS4A 3NVZA 5D6JB 5C23A 4B95A 4AS1A 1WGGA 3LDZE 1D6EC 3VQIA 2KQ7A 4PT5A 5E6NA 3AU4A 5AUKA 3FILA 3AEFB 3PLUA 2OEDA 1ET6A 4XDCA 3Q14C 1H4RA 2BKRB 4M01A 1XLQA 1JWBD 1FNVA 3GE3C 4XYCA 2GBKA 1PGAA 4HXDA 2WXFA 3I9V1 1NYRA 4XZ4A 1WR1A 2W9NA 1E8YA 1V80A 2NPTA 4P16A 1Q5WB 2C7HA 3KWLA 2JRHA 1AARA 3AI5A 4NPNA 2RDHA 3VH3B 1OGWA 1K52A 1M4VA 4KDIC 2ZVOA 3AM9A 4A90A 1GB1A 1ZW7A 2GB1A 1PFDA 1LM8B 3AE5B 3GB1A 2AL3A 2M17A 1ET9A 4BKTA 2AQ3B 1E7PB 3TIXA 4FHJA 3EC8A 4GN1A 4PK1A 3BYYB 2FAZA 3TSSA 2DZKA 2IGHA 2GBRA 4OZBA 3QC8B 2WXLA 3HIZA 4BOZB 2IO1B 4NAMA 2PEAA 4ANXA 5DPSA 1EF1A 4MGIE 3DHGC 1LFDA 3AE2B 1I4HA 2V0GA 4W9CA 3LB8C 5JHBA 1E0ZA 1WX9A 1UUPA 2N9PC 3P2BA 4IUMB 4LTUA 4A55A 3NVWA 3JVZX 2JYEA 2MJEA 2KKCA 4NAWA 3PVLA 1WJ4A 2R2QA 1YX5B 1P3QU 2WDQB 4QAYA 3IG3A 3HVZA 1JRUA 3A9JB 1VD2A 3QX1A 3QHTA 4FLHA 1F9JA 4MGZE 4HRSA 4OVVA 4RCOA 4OZCA 2M19A 3UQAA 4RGNA 3N30A 2FIFA 3SFEB 1T5XD 3QAQA 4MT5A 5E6JA 2GI9A 3Q69A 4EFOA 3U52E 1E7UA 1WGHA 2GBMA 4WJQA 2LASA 4A6QA 1NYQA 4C7ZA 4OVUA 3PPAA 4IM2A 4YT0B 3ONSA 1M94A 4JWUC 1WM3A 1K53A 2L52A 2WYQA 4K7SA 1GPXA 1L2NA 3T3OA 2N9LA 4MM3B 2BGFA 2QJLA 2LGXA 2V1YA 3B08A 1TGZB 1E90A 3ENEA 3BVMA 3A9JA 1OQYA 4L2YA 5BMGA 2INCC 2WXKA 4A3OA 3AEDB 3S2AA 3TEXA 4EE2A 3PHXB 2LUMA 3AE3B 2KC1A 3P4QB 2QCZA 3V60A 3BIID 1WFYA 4W9EA 2FNJB 2WX0A 4ANUA 1FO4A 2L76A 1RFAA 1NVID 2SEBD 2JWUA 4N6EB 2BF8B 4HPMB 2NCNA 2I1KA 1UBIA 2BS4B 4BOSC 2IGGA 1SXTA 2XK5B 4MGKE 4MM3A 4US9A 3U2SC 3OLMD 3AEAB 1GOZA 2J0KA 3N1XC 2KTRA 2KANA 2KFJA 3N20C 4RGOS 4HKQA 3PT2B 2AYOB 2DBYA 1L5PA 2K3UA 5FR3A 4FA6A 2MW5A 3AMZA 1I4RA 4B0EA 1QKZA 1JWAD 3SFDB 3N9YC 3AE6B 3ZJUA 3L54A 1QOBA 1I4PA 1JW9D 2EKIA 2DYBA 1TS4A 2QHOA 2BYEA 3I57A 3R8BA 2LI5A 2D3GA 1JALA 4LNKA 1AWDA 2IO3B 5KHOA 3UQBA 3KUZA 4RGTA 3QIJA 3V3XA 2EMTA 1YQ4B 1N6ZA 3MC9A 1FMAD 3VHTC 2JXXA 2O2VB 5DPWA 5FK9C 5JZEB 4AP4C 2Y5BB 2MLBA 2BQQA 2EKEC 3O65B 4IG7B 4O1NA 2LWPA 1N60A 1J7BA 3Q8CA 3QWZB 3ZO5B 4HCNB 3A1QA 1OEYA 2GBJA 2ON8A 3VUWA 3N3KB 1EWCA 2PPHA 3CIRB 3ML9A 2KDMA 5JHAA 2KVRA 2BB6A 1SSNA 4N59A 4N58A 2A4ZA 4W9KA 5GXGB 2WGSA 1I4GA 2VZKD 1MFWA 3GZNB 1TS2A 1BUIC 1MJDA 4JE3B 2N9XA 3T8MA 3E9SA 1T0YA 5LXHA 3IT4B 2O2VA 1XT9B 3SU8X 5BYSA 1C4CA 1L0VB 1Q1OA 2KK8A 2LGSA 2MJDA 1L0YB 4GMVA 3SDLC 2D11A 1MHXA 3W1SA 2WXOA 3PLVA 4K3BA 1UD7A 1XXGA 1WE7A 4JQWC 3OWEB 1JCKB 3DVNV 2C7MB 2UU7A 4ITKA 4PS7A 4XE0A 4RF1A 3R2IA 4S17A 3O13A 2LXAA 5BYRA 3T9LA 4HLEA 1R4NB 3WANA 2L1AA 2WXJA 3GP7A 4WWOA 2MA9B 2DAJA 1LO5D 3DOWA 1FFVA 3A33B 4GDLA 2TSSA 1RLFA 1VZ8A 2LUEA 1I7HA 2R61A 4K81A 4EKUA 1SGHA 3RFZB 3NRZA 4GOCA 1IYFA 2M4NA 2MQJA 1JROA 2CKHB 2HTHA 3DBHB 4FHKA 4HPLB 3TEZA 2D07B 4DXGA 1ESFA 2FE8A 2LVOA 3BINA 4ICVA 3LYYA 1HQRD 3GZNI 1GNUA 4IWPA 1SE4A 3APFA 4W9DA 2CHZA 2MBBB 3ZKJC 1WYWB 1QT9A 3W5VB 1VRAB 2JZZA 1X1MA 3AE4B 2LGDA 4HCPB 1D3ZA 3RNBC 4P7IA 2OJWA 2L0FA 1GG3A 2CR5A 4MJSB 2R2OA 4GIVA 4YTNB 2KJRA 2MJ3A 3P63A 2DZIA 5CHFA 4L23A 1OTRB 4JX1C 3K9PB 4J3OD 3U8ZA 1VR9A 3PRMB 2D3CA 2DZMA 1I42A 2PLPA 2RDGA 3ZQ4A 3L08A 3HVDA 3R2TA 1E8ZA 3UIPB 1F77A 3VTVA 2LJIA 5EE1A 4HPPA 1V9JA 4R3DA 2MEKA 4RF0A 4W9GA 3EFUA 1IBXB 4JGHB 3WAMA 1J0GA 2WU5B 3DBHI 5J17A 2BPSA 1EU4A 2L32A 1TYGB 4WJOA 3P1MA 3EGRA 1JRPA 2KMAA 2YEPB 3PREA 1SE2A 3Q3NC 5E6OA 2BWFA 1C78A 2C5LC 2I2YA 3KUDB 4TUUA 4KSKC 4LNOA 4BKGA 2GLSA 3EFCA 3L4PA 2M0AA 3AE7B 1OFFA 3KUCB 4JWSC 3AU5A 3FAHA 2PVGC 4WWPA 3RULA 4EZLA 1YD8U 3V62A 4WAFA 1AW7A 1P98A 2INDC 1B9RA 3TBLD 1IBXA 1ENFA 4TQ1A 2KZRA 3C0RB 3C8YA 2FIDA 3MJ5A 2D10A 1R4MB 1FNWA 3B0AA 1E5WA 1VZ7A 3VDZA 2G3QB 2K6DB 1Z5SB 1HEZE 3NZ3A 1MI0A 4EEWA 3SEBA 2DLBA 2Z59B 2WXPA 2YVCA 1ZP0B 2KWCA 1EO6A 2QSDA 2WHIA 3OJ3A 3VUXA 1GJZA 2M56B 5D7GA 4B0MA 2LXCA 2D3AA 2NPTB 3IHPC 3ML8A 1J8CA 3NVYA 2Y5CA 4G3XB 1QLBB 3PV1A 2BWES 2NBUA 2KDFB 3NS1A 2AEHA 1JWUD 3Q3JA 3RNGC 5D3IB 3ZJVA 2NS5A 1L0XB 1T0RC 1SE9A 3AECB 1HTQA 2G4SA 1MHHE 1WIAA 3R3MA 1LXDA 2RDBC 3IVFA 4IWQA 1WXQA 5HFYA 3V6EB 1WZ0A 3M62B 2QILA 4M02A 4M8NA 2KFKB 2CHXA 1G6JA 3AV8A 3DCGA 3GE8C 4F1SA 2RPVA 1R4MI 4EZJA 4KKIA 1ZDVA 4KKJA 1WWTA 4GLSC 5HHDG 2DWQA 2LVQA 5TR5A 3KLSX 3QARA 5IN7A 3VXWA 4M8MA 4IW0A 1FD6A 4NAWB 2OHFA 3RNFC 3PSEB 2KQ4X 4XDDA 2L3ZA 1C9FA 1U4AA 4RGMA 1HTOA 3DBLI 1OQRA 5C1ZA 3RYTA 3TL5A 1QF6A 4BBNC 2MHJA 1YOVB 4RM8A 3APCA 3VRAB 3NUHB 4GXBA 4HDQA 2B3AA 2CU1A 1DOYA 3A9KA 2KFKA 4GGQA 3DVGY 3PRZA 3PZ8A 1EM7A 1TKYA 1XD3B 5BYQA 1AYFA 3A4RA 1PUTA 2IJ0A 4IM3A 1XLOA 2ASQA 2UYZB 4I6NB 3IXSA 1QOGA 1Q10A 4LLGM 2IY0B 2G45B 3PS6A 2LGIA 3BVZA 2K1FA 3QA8A 2W3SA 4XWTA 1VCBA 1P7EA 1CMXB 1V8CA 4C00A 1WX8A 3WAPA 1WGDA 4YWGG 5TSSA 4W9HA 1PGXA 1ROEA 4KVGB 1EF5A 4DDID 1JWSD 2J53A 1K50A 3RN9C 4NNJB 5J18A 4DHJB 2JRIB 4TV3A 3L17A 4JIOU 3TMPB 1Z2MA 3VFKA 3P4SB 2PVOD 2W82A 2QEJC 2HJ1A 1XF5L 2SAKA 4EOYA 3W9CB 4LNIA 4C4VA 4P6VF 5G2NA 4A3PA 1XEEA 3GOEA 4NJ6A 1H8CA 1VJKA 1WXAA 3NVVA 1VZ6A 3W1SC 1WY8A 4PYUA 3RNAC 3BYTB 2GRIA 1YN3A 1DYQA 2V9HA 3NHEB 3RMKC 2DHZA 1YIWA 2KTRB 3Q8AA 2DENB 4CO7A 5CHVC 1WZ3A 2W3RA 1C76A 3D32A 3JW0X 2HDEA 1V2YA 1DOIA 4LNNA 4PS3A 1IP9A 1NI2A 3JYUA 3NY5A 2B76B 3ZNID 2ZZPB 2IY1B 2XNAC 4GDKB 2I38A 4AWJA 2BYFA 1E7VA 3TUOA 2N7DA 3KYDD 4ZRIA 4K7UA 3NZUA 3AEEB 4IM0A 2CJOA 1Q0WB 2PE9A 3AH7A 1WJ6A 1T3QA 1K51A 2A5UA 5G55A 1NBFC 1E9MA 1V1OA 2L7RA 3HHMA 3GS2A 1WJNA 2KN4A 1P7FA 4MACA 4II3B 1T6BX 2KHWB 2NR2A 4DHZB 3MP9A 5T8IA 4OHJA 4OZAA 1OQQA 4JLCA 3WIMA 1YNTE 3PZDA 5IO9A 4M00A 1K8RB 4IOIE 5IP4D 4G11A 5EE0A 1C3TA 4K3CA 4GDKA 2LJ5A 5IAAC 2N4FA 1NENB 2C7NB 4GB9A 2J7QB 2JZPA 1FPYA 4XC2A 1FEHA 3A1QB 2IDYA 3URYA 3H9DA 1NEKB 4ARCA 2BTEA 3Q6BA 4BAXA 3T3NA 1YX6B 2DNFA 2WXIA 3KQ4A 3CWIA 3K9OB 1WGRA 3ZDMC 3IFWB 1RFKA 3TEWA 2FCMA 1XLPA 4BBNF 1L4ZB 3N1YC 4P1CC 4WH4A 4A20A 2OOBB 2NBVB 3LJ3A 5CX3A 4IDIA 4D2KA 2KWUB 2K8BA 4AOFA 2KXJA 1F2RC 2H88B 1FRDA 4NQKE 4HJGE 3V05A 3ZXRA 3UGBB 2VH1A 4W9FA 2M0XA 4X57B 2LVPA 4A8XC 1CQVA 3RZFA 1UGJA 2JVCA 1KFYB 2WU2B 2J52A 2K25A 4A9AA 2K0PA 2IPKD 2IO2B 3AULA 4CYEA 5L95C 3U4EG 3R7RA 4KDLB 4GDLB 2DX5B 3HUIA 2KDEB 5BMIA 1VDVA 4FN2A 2KJ6A 2PIAA 2L83A 1WMHA 3Q8FA 4HWIB 4DXAB 1SF0A 1P0RA 4BKSD 3MTNB 3QQ8B 3DHIC 2FCQA 2WS3B 1GUAB 2K5PA 3NZSA 4DWFA 4ZYSA 3NJTA 3B2FA 4G50A 3U7ZA 1YJJA 2GBNA 4II2B 2E6XA 2BVCA 2INNE 2CU3A 3HK0A 2KDIA 5KHQA 2FBWB 2IZVB 3RZWC 4H2AA 2NVUI 1XO3A 3VVWB 3KH0A 3UF8A 1MPEA 3OAWA 1XLNA 4ZRJA 4LK0M 3OG5A 2L8JA 4HEA1 2JU6X 2ZCCA 3ZRFA 2ICIA 2G9HD 3ZNHB 2PW9A 1QZEA 1RRBA 2KWVB 2JT4B 4W9LA 1OEYJ 4I6LB 2ZNVB 2LEKA 2MP2A 2MCNB 2LGYA 2JZ3B 3CSTA 1E8WA 3BK1A 3EHVA 1JQ4A 1XCTL 5DPRA 2FUHB 3DDCB 2GMIC 2KQSA 3NG0A 1GC6A 2PMVA 3AE8B 4KGSA 2ZCBA 2WDVB 2JQRB 4JL9A 2J42A 2ZPNA
chains in the Genus database with same CATH topology
3IHPC 3N30A 3ML8A 4LDTB 1J8CA 2FIFA 2MBOA 2RGFA 2DYMA 2RD0A 3QAQA 2XK5A 3M63B 2KJHB 3U30A 5JH5C 1I35A 4EFOA 4G3XB 1E7UA 1V81A 1WGHA 2GBMA 1WRDB 1SIFA 2KN5A 2LASA 3HM3A 3PV1A 3R66C 4LDTD 2BWES 2NBUA 3VUYA 4OVUA 3PPAA 4B9KA 4E3CA 4IM2A 2KDFB 2LZ6A 4MEMA 4WJQA 2N1VA 4HDOA 3KVFB 1V6EA 1V5OA 1V5TA 3ONSA 2O6VB 2JPHA 1M94A 2AEHA 1RAXA 3Q3JA 2OJRA 2UWQA 2NS5A 2J0MA 4W9IA 2IO0B 3I3TB 4DDGD 1WM3A 4B6WA 2O6VD 1SE9A 1KLVA 4ZYNA 2G4SA 1WIAA 2WYQA 4K7SA 3R3MA 1L2NA 1LXDA 4GSWA 3ZVVA 2LRUA 3IVFA 1GC7A 2BGFA 2DZJA 4IWQA 2LGXA 2V1YA 3B08A 3B1LX 4J6IA 3V6EB 4PYZA 1TGZB 1WZ0A 1E90A 3M62B 2KMCA 3ENEA 3H7PB 4M8NA 2KFKB 5L83A 2CHXA 1G6JA 3A9JA 1OQYA 3DCGA 3M95A 3ZLZA 2JWZA 4A3OA 4F1SA 3W1YA 1R4MI 1Y8RC 1TTNA 2GOWA 3S2AA 4EZJA 4LJPB 1UZXB 3L10B 3PHXB 3V6CB 2KC1A 1S1QB 5DPTA 2MCNB 2LVQA 2N9EB 5TR5A 4DBGA 2BKFA 3QARA 3V60A 3VXWA 4M8MA 4IW0A 2MP2B 4NAWB 4AJWA 1WGYA 3PSEB 5BO4B 3X23A 1WFYA 1V49A 4W9EA 2FNJB 4FULA 4F8CB 1ZKHA 2L3ZA 1U4AA 2KLGA 2WX0A 2ZPYA 4ANUA 2KX0A 2MBEA 2O6VA 2L76A 1RFAA 1P9DU 3DBLI 5C1ZA 3RYTA 3TL5A 4BBNC 2BF8B 2MWSB 4HPMB 1KM7A 2I1KA 2NCNA 4RM8A 3APCA 3DVNU 1UBIA 3AXCA 1V86A 4BOSC 4EZKA 4GXBA 3H6NA 4HDQA 2XK5B 4MGKE 4MM3A 3OLMD 2B3AA 2J0KA 2KTRA 2CU1A 3H7PA 2K39A 3A9KA 2KANA 2KFKA 4GGQA 3DVGY 3PRZA 1TBEA 2NBWB 5LLIA 2V4LA 2KFJA 4URKA 4W9JA 3PT2B 2V3SA 1XD3B 5LXIB 3NS8A 4PS8A 2AYOB 3A4RA 3CSFA 3IBEA 3PRPB 3L13A 1WF9A 4IM3A 2ASQA 2UYZB 4I6NB 3ZUNA 3DPDA 4FA6A 3SD5A 3QCAA 2MW5A 2ZJDA 2IY0B 2G45B 3EECA 1TZ1A 2C60A 2KLCA 3WA0A 4E74A 2BYVE 2DYOA 4E71A 3PS6A 3ZIMA 2K1FA 3QA8A 1VCBA 1P1AA 1CMXB 3ECIA 1WX8A 3WAPA 1WH3A 1WGDA 3L54A 1KOTA 4ZDVA 2KOXA 4W9HA 3TCAA 4KVGB 2WWZA 1EF5A 4MH0E 4GU2A 2DYBA 4RM9A 4YL8A 2QHOA 4DDID 4FADA 4HK2A 4I6PA 2BYEA 4NNJB 2XEWA 5J18A 3Q3FA 2LI5A 4BVUC 4DHJB 1XQQA 2JRIB 2D3GA 4TV3A 3L17A 2IO3B 3MHSD 5KHOA 3UQBA 3KUZA 2WX1A 4JIOU 1HE8A 3TMPB 1Z2MA 4EUTA 3VFKA 3QIJA 3JSVB 3DQVA 2K6QA 2EMTA 4DHJD 4EOYA 1EUVB 3QK0A 5AZFA 3WAOA 4M0WB 4KZCA 5J2RA 3VAWA 1UBQA 3VHTC 3H1UA 5CHWA 5G2NA 4A3PA 2JXXA 3GOEA 4NJ6A 2O2VB 3DBSA 5DPWA 1H8CA 1WXAA 4MSQB 5JZEB 2CHWA 3PGEA 3ZNZB 4AP4C 2Y5BB 3W1SC 2MLBA 1WY8A 2EKEC 4NQLB 2RR9A 4PYUA 2XBBC 3O65B 4DHZE 3NHEB 3KW5B 4BFRA 2DHZA 1YIWA 4DK5A 4K1RB 1UELA 2M1MA 2PJHA 4IG7B 4ANVA 5GMVA 4XX5A 2KTRB 2LWPA 3QWZB 2RPQA 3A9KB 3ZO5B 4HCNB 2DENB 3KYCD 4CO7A 4MDKE 3A1QA 5CHVC 1OEYA 1WZ3A 2DAFA 2GBJA 1R4NI 2HJ8A 2KX3A 3VUWA 4AUQC 3N3KB 3D32A 1WXSA 1LQBA 2HE7A 2PPHA 3ML9A 5AEKB 3JW0X 3L0WB 3VTUA 1V2YA 3BY4B 5JHAA 4PS3A 1IP9A 1NI2A 1WR6E 2KVRA 2RSUA 4KIKA 5DCNA 3JYUA 2MSED 3NY5A 3ZNID 2K8CA 4HJKA 2A4ZA 4W9KA 1UH6A 3M3JA 2ZZPB 1IPGA 3WALA 2IY1B 5AZGA 2LD9A 3CMMB 3JSVA 4GDKB 4AWJA 4WJNA 2BYFA 1E7VA 3RCZA 1WI0A 2N7DA 3KYDD 3OJ4B 4ZRIA 4K7UA 2N9XA 4FBJB 4WJPA 3T8MA 3NZUA 4IM0A 1T0YA 5LXHA 4WQOB 1Q0WB 5E6PA 2PE6B 5EDSA 4IC7B 2O2VA 1XT9B 2PE9A 3SU8X 2L05A 1Q1OA 2L0TA 3ZNGC 2KK8A 1WJ6A 3HM6X 1ISNA 3R7QA 3MJWA 4MJSA 2Z0EB 3DVGX 2A5UA 4MGYE 4NY0A 4GMVA 3SDLC 2D11A 3APDA 1KJTA 5G55A 3W1SA 1WX7A 3PLVA 1NBFC 1UD7A 1WE7A 4JQWC 2L7RA 3HHMA 4KZ0A 1WJNA 3DVNV 5AZHA 2C7MB 4II3B 2KD0A 2JUOA 4PS7A 3V61A 3VH4B 2C9WB 2IBIB 2KHWB 2NR2A 4DHZB 3VTWA 3RT3B 2G4DB 2LXAA 3A4SC 4JLCA 3WIMA 3T9LA 4HLEA 5FR6A 3WANA 4IWOA 3PZDA 4WWOA 2MA9B 3RUIB 3H7SA 1WXMA 2I1JA 3ZDTA 2DAJA 3DOWA 1K8RB 4WWNA 3TJPA 4G11A 3A33B 4GDLA 4BKSA 2L00B 1C3TA 1ZGUB 4GDKA 1RLFA 2LUEA 2YLMA 2LJ5A 5IAAC 3UIOB 2N4FA 1YJ1A 2C7NB 4GB9A 2J7QB 3UINB 4K81A 4XC2A 4EKUA 1UGMA 1SGHA 3A1QB 4GOCA 1IYFA 5CTRC 2M4NA 2MQJA 4G0NB 3H9DA 2CKHB 4TQ0A 2HTHA 1YQBA 4FHKA 4HPLB 3X0WA 2D07B 1MG8A 2LVOA 4KIKB 3DBRI 3BINA 4ICVA 4MSMB 2KC2A 1YX6B 3GZNI 1WE6A 4AJYB 1GNUA 4IWPA 3K9OB 5HKHA 1WGRA 3APFA 4W9DA 3ZDMC 3IFWB 2CHZA 2MBBB 3ZKJC 2REXA 4KV2A 2KDBA 1WYWB 2FCMA 2D2QA 4K7WA 4CHKA 2MX2A 1J19A 2AL6A 4TKNA 4BBNF 2JZZA 1X1MA 2LGDA 1PQSA 3L16A 3QJZA 1E8XA 3N32A 4HCPB 2VRRB 4A20A 4HVBA 2OOBB 1D3ZA 2NBVB 4ASWC 1L7YA 2KO3A 2Z0DB 2ZVNA 3LJ3A 1FXTB 1C1YB 5CX3A 2MBHA 4P7IA 4N9F4 4MELA 2L0FA 4NJ7A 2KWUB 2MRPA 3CF6E 1GG3A 2CR5A 1S3SG 2K8BA 2N1WA 2R2OA 4FJYA 2KJRA 4GIVA 4MJSB 4ZRKA 4AOFA 2KXJA 4RMAA 3U7DA 2DZIA 4LJOB 2MBQA 3ZRCA 4NQKE 5CHFA 4FJVB 2CS4A 5D6JB 1OTRB 5C23A 4B95A 1WGGA 3K9PB 3ZTCA 3LDZE 3U8ZA 3UGBB 3VQIA 4W9FA 2M0XA 2KQ7A 3PRMB 2DZMA 4X57B 1I42A 2LVPA 5E6NA 3AU4A 3RZFA 5D2MB 2JVCA 3PLUA 2K25A 3L08A 4LCDE 3ZTDA 2EMSA 1H4RA 2BKRB 1E8ZA 3UIPB 2IO2B 3AULA 3VTVA 4CYEA 5L95C 1V9JA 3NOBA 2KNBA 3R7RA 2GBKA 4KDLB 1WXVA 4GDLB 2DX5B 4HXDA 4W9GA 2JF5A 3EFUA 2KDEB 4JGHB 4FN2A 3WAMA 2KJ6A 1J0GA 2M8SA 4XZ4A 1WMHA 4HWIB 4DXAB 1WR1A 1P0RA 3PHWB 2JY6A 3DBHI 4BKSD 3MTNB 5J17A 2W9NA 1E8YA 3QQ8B 1V80A 2NPTA 1Q5WB 2FCQA 2BPSA 1GUAB 2C7HA 4KSLC 2JRHA 3NZSA 4DWFA 1AARA 2IYDB 4WJOA 2K8HA 3AI5A 4G50A 4NPNA 2GBNA 4II2B 2KMAA 3VH3B 1OGWA 1BT0A 3PREA 4KDIC 2BWFA 2ZVOA 5E6OA 2WDTB 3HK0A 2KDIA 5KHQA 1ZW7A 1LM8B 2AL3A 2M17A 2C5LC 2IZVB 4BKTA 3RZWC 3TIXA 2NVUI 4FHJA 3EC8A 3KUDB 4GN1A 4TUUA 3VVWB 4KSKC 3KH0A 4BKGA 2HD5B 3UF8A 2FAZA 3OAWA 4ZRJA 3RD2A 2DZKA 2GBRA 1NDDA 3QC8B 2L8JA 3KUCB 3HIZA 2FCNA 3AU5A 4BOZB 2ZCCA 3ZRFA 2IO1B 2PEAA 4WWPA 3PTFC 4ANXA 2ZEQA 5DPSA 5D94A 3RULA 1YD8U 4EZLA 1EF1A 4MGIE 3V62A 4WAAA 1WM2A 1LFDA 1P98A 4F7ZA 3TBLD 3ZNHB 1QZEA 2KTFA 1RRBA 4TQ1A 2KZRA 4W9CA 5JHBA 3C0RB 1WX9A 2KWVB 2JT4B 2ZNVC 4ICUA 2N9PC 3P2BA 4IUMB 2N7EA 2FIDA 4FJZA 4W9LA 1OEYJ 2D10A 4I6LB 2ZNVB 3JVZX 3B0AA 1E5WA 3ZW3A 3VDZA 2MP2A 2G3QB 2K6DB 2KKCA 1Z5SB 2LGYA 2JZ3B 3CSTA 4NAWA 1E8WA 2LRWA 1WJ4A 2R2QA 3ALBA 3EHVA 1YX5B 3PVLA 3SHQA 5IA7A 1P3QU 2J0JA 4EEWA 3IG3A 5DPRA 2Z59B 1JRUA 2FUHB 2YVCA 2GMIC 3DDCB 2KQSA 1VD2A 2FCSA 2KWCA 1WJUA 1EO6A 3A9JB 3QX1A 3QHTA 3OJ3A 2AWTA 1F9JA 1WMHB 4FLHA 1GC6A 4MGZE 3VUXA 1GJZA 4OVVA 5D7GA 4ANWA 2LXCA 2NPTB 2ZCBA 4JL9A 3UQAA 2ZPNA 1A5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP C;  3N30 A;  3ML8 A;  4LDT B;  1J8C A;  2FIF A;  2MBO A;  2RGF A;  2DYM A;  2RD0 A;  3QAQ A;  2XK5 A;  3M63 B;  2KJH B;  3U30 A;  5JH5 C;  1I35 A;  4EFO A;  4G3X B;  1E7U A;  1V81 A;  1WGH A;  2GBM A;  1WRD B;  1SIF A;  2KN5 A;  2LAS A;  3HM3 A;  3PV1 A;  3R66 C;  4LDT D;  2BWE S;  2NBU A;  3VUY A;  4OVU A;  3PPA A;  4B9K A;  4E3C A;  4IM2 A;  2KDF B;  2LZ6 A;  4MEM A;  4WJQ A;  2N1V A;  4HDO A;  3KVF B;  1V6E A;  1V5O A;  1V5T A;  3ONS A;  2O6V B;  2JPH A;  1M94 A;  2AEH A;  1RAX A;  3Q3J A;  2OJR A;  2UWQ A;  2NS5 A;  2J0M A;  4W9I A;  2IO0 B;  3I3T B;  4DDG D;  1WM3 A;  4B6W A;  2O6V D;  1SE9 A;  1KLV A;  4ZYN A;  2G4S A;  1WIA A;  2WYQ A;  4K7S A;  3R3M A;  1L2N A;  1LXD A;  4GSW A;  3ZVV A;  2LRU A;  3IVF A;  1GC7 A;  2BGF A;  2DZJ A;  4IWQ A;  2LGX A;  2V1Y A;  3B08 A;  3B1L X;  4J6I A;  3V6E B;  4PYZ A;  1TGZ B;  1WZ0 A;  1E90 A;  3M62 B;  2KMC A;  3ENE A;  3H7P B;  4M8N A;  2KFK B;  5L83 A;  2CHX A;  1G6J A;  3A9J A;  1OQY A;  3DCG A;  3M95 A;  3ZLZ A;  2JWZ A;  4A3O A;  4F1S A;  3W1Y A;  1R4M I;  1Y8R C;  1TTN A;  2GOW A;  3S2A A;  4EZJ A;  4LJP B;  1UZX B;  3L10 B;  3PHX B;  3V6C B;  2KC1 A;  1S1Q B;  5DPT A;  2MCN B;  2LVQ A;  2N9E B;  5TR5 A;  4DBG A;  2BKF A;  3QAR A;  3V60 A;  3VXW A;  4M8M A;  4IW0 A;  2MP2 B;  4NAW B;  4AJW A;  1WGY A;  3PSE B;  5BO4 B;  3X23 A;  1WFY A;  1V49 A;  4W9E A;  2FNJ B;  4FUL A;  4F8C B;  1ZKH A;  2L3Z A;  1U4A A;  2KLG A;  2WX0 A;  2ZPY A;  4ANU A;  2KX0 A;  2MBE A;  2O6V A;  2L76 A;  1RFA A;  1P9D U;  3DBL I;  5C1Z A;  3RYT A;  3TL5 A;  4BBN C;  2BF8 B;  2MWS B;  4HPM B;  1KM7 A;  2I1K A;  2NCN A;  4RM8 A;  3APC A;  3DVN U;  1UBI A;  3AXC A;  1V86 A;  4BOS C;  4EZK A;  4GXB A;  3H6N A;  4HDQ A;  2XK5 B;  4MGK E;  4MM3 A;  3OLM D;  2B3A A;  2J0K A;  2KTR A;  2CU1 A;  3H7P A;  2K39 A;  3A9K A;  2KAN A;  2KFK A;  4GGQ A;  3DVG Y;  3PRZ A;  1TBE A;  2NBW B;  5LLI A;  2V4L A;  2KFJ A;  4URK A;  4W9J A;  3PT2 B;  2V3S A;  1XD3 B;  5LXI B;  3NS8 A;  4PS8 A;  2AYO B;  3A4R A;  3CSF A;  3IBE A;  3PRP B;  3L13 A;  1WF9 A;  4IM3 A;  2ASQ A;  2UYZ B;  4I6N B;  3ZUN A;  3DPD A;  4FA6 A;  3SD5 A;  3QCA A;  2MW5 A;  2ZJD A;  2IY0 B;  2G45 B;  3EEC A;  1TZ1 A;  2C60 A;  2KLC A;  3WA0 A;  4E74 A;  2BYV E;  2DYO A;  4E71 A;  3PS6 A;  3ZIM A;  2K1F A;  3QA8 A;  1VCB A;  1P1A A;  1CMX B;  3ECI A;  1WX8 A;  3WAP A;  1WH3 A;  1WGD A;  3L54 A;  1KOT A;  4ZDV A;  2KOX A;  4W9H A;  3TCA A;  4KVG B;  2WWZ A;  1EF5 A;  4MH0 E;  4GU2 A;  2DYB A;  4RM9 A;  4YL8 A;  2QHO A;  4DDI D;  4FAD A;  4HK2 A;  4I6P A;  2BYE A;  4NNJ B;  2XEW A;  5J18 A;  3Q3F A;  2LI5 A;  4BVU C;  4DHJ B;  1XQQ A;  2JRI B;  2D3G A;  4TV3 A;  3L17 A;  2IO3 B;  3MHS D;  5KHO A;  3UQB A;  3KUZ A;  2WX1 A;  4JIO U;  1HE8 A;  3TMP B;  1Z2M A;  4EUT A;  3VFK A;  3QIJ A;  3JSV B;  3DQV A;  2K6Q A;  2EMT A;  4DHJ D;  4EOY A;  1EUV B;  3QK0 A;  5AZF A;  3WAO A;  4M0W B;  4KZC A;  5J2R A;  3VAW A;  1UBQ A;  3VHT C;  3H1U A;  5CHW A;  5G2N A;  4A3P A;  2JXX A;  3GOE A;  4NJ6 A;  2O2V B;  3DBS A;  5DPW A;  1H8C A;  1WXA A;  4MSQ B;  5JZE B;  2CHW A;  3PGE A;  3ZNZ B;  4AP4 C;  2Y5B B;  3W1S C;  2MLB A;  1WY8 A;  2EKE C;  4NQL B;  2RR9 A;  4PYU A;  2XBB C;  3O65 B;  4DHZ E;  3NHE B;  3KW5 B;  4BFR A;  2DHZ A;  1YIW A;  4DK5 A;  4K1R B;  1UEL A;  2M1M A;  2PJH A;  4IG7 B;  4ANV A;  5GMV A;  4XX5 A;  2KTR B;  2LWP A;  3QWZ B;  2RPQ A;  3A9K B;  3ZO5 B;  4HCN B;  2DEN B;  3KYC D;  4CO7 A;  4MDK E;  3A1Q A;  5CHV C;  1OEY A;  1WZ3 A;  2DAF A;  2GBJ A;  1R4N I;  2HJ8 A;  2KX3 A;  3VUW A;  4AUQ C;  3N3K B;  3D32 A;  1WXS A;  1LQB A;  2HE7 A;  2PPH A;  3ML9 A;  5AEK B;  3JW0 X;  3L0W B;  3VTU A;  1V2Y A;  3BY4 B;  5JHA A;  4PS3 A;  1IP9 A;  1NI2 A;  1WR6 E;  2KVR A;  2RSU A;  4KIK A;  5DCN A;  3JYU A;  2MSE D;  3NY5 A;  3ZNI D;  2K8C A;  4HJK A;  2A4Z A;  4W9K A;  1UH6 A;  3M3J A;  2ZZP B;  1IPG A;  3WAL A;  2IY1 B;  5AZG A;  2LD9 A;  3CMM B;  3JSV A;  4GDK B;  4AWJ A;  4WJN A;  2BYF A;  1E7V A;  3RCZ A;  1WI0 A;  2N7D A;  3KYD D;  3OJ4 B;  4ZRI A;  4K7U A;  2N9X A;  4FBJ B;  4WJP A;  3T8M A;  3NZU A;  4IM0 A;  1T0Y A;  5LXH A;  4WQO B;  1Q0W B;  5E6P A;  2PE6 B;  5EDS A;  4IC7 B;  2O2V A;  1XT9 B;  2PE9 A;  3SU8 X;  2L05 A;  1Q1O A;  2L0T A;  3ZNG C;  2KK8 A;  1WJ6 A;  3HM6 X;  1ISN A;  3R7Q A;  3MJW A;  4MJS A;  2Z0E B;  3DVG X;  2A5U A;  4MGY E;  4NY0 A;  4GMV A;  3SDL C;  2D11 A;  3APD A;  1KJT A;  5G55 A;  3W1S A;  1WX7 A;  3PLV A;  1NBF C;  1UD7 A;  1WE7 A;  4JQW C;  2L7R A;  3HHM A;  4KZ0 A;  1WJN A;  3DVN V;  5AZH A;  2C7M B;  4II3 B;  2KD0 A;  2JUO A;  4PS7 A;  3V61 A;  3VH4 B;  2C9W B;  2IBI B;  2KHW B;  2NR2 A;  4DHZ B;  3VTW A;  3RT3 B;  2G4D B;  2LXA A;  3A4S C;  4JLC A;  3WIM A;  3T9L A;  4HLE A;  5FR6 A;  3WAN A;  4IWO A;  3PZD A;  4WWO A;  2MA9 B;  3RUI B;  3H7S A;  1WXM A;  2I1J A;  3ZDT A;  2DAJ A;  3DOW A;  1K8R B;  4WWN A;  3TJP A;  4G11 A;  3A33 B;  4GDL A;  4BKS A;  2L00 B;  1C3T A;  1ZGU B;  4GDK A;  1RLF A;  2LUE A;  2YLM A;  2LJ5 A;  5IAA C;  3UIO B;  2N4F A;  1YJ1 A;  2C7N B;  4GB9 A;  2J7Q B;  3UIN B;  4K81 A;  4XC2 A;  4EKU A;  1UGM A;  1SGH A;  3A1Q B;  4GOC A;  1IYF A;  5CTR C;  2M4N A;  2MQJ A;  4G0N B;  3H9D A;  2CKH B;  4TQ0 A;  2HTH A;  1YQB A;  4FHK A;  4HPL B;  3X0W A;  2D07 B;  1MG8 A;  2LVO A;  4KIK B;  3DBR I;  3BIN A;  4ICV A;  4MSM B;  2KC2 A;  1YX6 B;  3GZN I;  1WE6 A;  4AJY B;  1GNU A;  4IWP A;  3K9O B;  5HKH A;  1WGR A;  3APF A;  4W9D A;  3ZDM C;  3IFW B;  2CHZ A;  2MBB B;  3ZKJ C;  2REX A;  4KV2 A;  2KDB A;  1WYW B;  2FCM A;  2D2Q A;  4K7W A;  4CHK A;  2MX2 A;  1J19 A;  2AL6 A;  4TKN A;  4BBN F;  2JZZ A;  1X1M A;  2LGD A;  1PQS A;  3L16 A;  3QJZ A;  1E8X A;  3N32 A;  4HCP B;  2VRR B;  4A20 A;  4HVB A;  2OOB B;  1D3Z A;  2NBV B;  4ASW C;  1L7Y A;  2KO3 A;  2Z0D B;  2ZVN A;  3LJ3 A;  1FXT B;  1C1Y B;  5CX3 A;  2MBH A;  4P7I A;  4N9F 4;  4MEL A;  2L0F A;  4NJ7 A;  2KWU B;  2MRP A;  3CF6 E;  1GG3 A;  2CR5 A;  1S3S G;  2K8B A;  2N1W A;  2R2O A;  4FJY A;  2KJR A;  4GIV A;  4MJS B;  4ZRK A;  4AOF A;  2KXJ A;  4RMA A;  3U7D A;  2DZI A;  4LJO B;  2MBQ A;  3ZRC A;  4NQK E;  5CHF A;  4FJV B;  2CS4 A;  5D6J B;  1OTR B;  5C23 A;  4B95 A;  1WGG A;  3K9P B;  3ZTC A;  3LDZ E;  3U8Z A;  3UGB B;  3VQI A;  4W9F A;  2M0X A;  2KQ7 A;  3PRM B;  2DZM A;  4X57 B;  1I42 A;  2LVP A;  5E6N A;  3AU4 A;  3RZF A;  5D2M B;  2JVC A;  3PLU A;  2K25 A;  3L08 A;  4LCD E;  3ZTD A;  2EMS A;  1H4R A;  2BKR B;  1E8Z A;  3UIP B;  2IO2 B;  3AUL A;  3VTV A;  4CYE A;  5L95 C;  1V9J A;  3NOB A;  2KNB A;  3R7R A;  2GBK A;  4KDL B;  1WXV A;  4GDL B;  2DX5 B;  4HXD A;  4W9G A;  2JF5 A;  3EFU A;  2KDE B;  4JGH B;  4FN2 A;  3WAM A;  2KJ6 A;  1J0G A;  2M8S A;  4XZ4 A;  1WMH A;  4HWI B;  4DXA B;  1WR1 A;  1P0R A;  3PHW B;  2JY6 A;  3DBH I;  4BKS D;  3MTN B;  5J17 A;  2W9N A;  1E8Y A;  3QQ8 B;  1V80 A;  2NPT A;  1Q5W B;  2FCQ A;  2BPS A;  1GUA B;  2C7H A;  4KSL C;  2JRH A;  3NZS A;  4DWF A;  1AAR A;  2IYD B;  4WJO A;  2K8H A;  3AI5 A;  4G50 A;  4NPN A;  2GBN A;  4II2 B;  2KMA A;  3VH3 B;  1OGW A;  1BT0 A;  3PRE A;  4KDI C;  2BWF A;  2ZVO A;  5E6O A;  2WDT B;  3HK0 A;  2KDI A;  5KHQ A;  1ZW7 A;  1LM8 B;  2AL3 A;  2M17 A;  2C5L C;  2IZV B;  4BKT A;  3RZW C;  3TIX A;  2NVU I;  4FHJ A;  3EC8 A;  3KUD B;  4GN1 A;  4TUU A;  3VVW B;  4KSK C;  3KH0 A;  4BKG A;  2HD5 B;  3UF8 A;  2FAZ A;  3OAW A;  4ZRJ A;  3RD2 A;  2DZK A;  2GBR A;  1NDD A;  3QC8 B;  2L8J A;  3KUC B;  3HIZ A;  2FCN A;  3AU5 A;  4BOZ B;  2ZCC A;  3ZRF A;  2IO1 B;  2PEA A;  4WWP A;  3PTF C;  4ANX A;  2ZEQ A;  5DPS A;  5D94 A;  3RUL A;  1YD8 U;  4EZL A;  1EF1 A;  4MGI E;  3V62 A;  4WAA A;  1WM2 A;  1LFD A;  1P98 A;  4F7Z A;  3TBL D;  3ZNH B;  1QZE A;  2KTF A;  1RRB A;  4TQ1 A;  2KZR A;  4W9C A;  5JHB A;  3C0R B;  1WX9 A;  2KWV B;  2JT4 B;  2ZNV C;  4ICU A;  2N9P C;  3P2B A;  4IUM B;  2N7E A;  2FID A;  4FJZ A;  4W9L A;  1OEY J;  2D10 A;  4I6L B;  2ZNV B;  3JVZ X;  3B0A A;  1E5W A;  3ZW3 A;  3VDZ A;  2MP2 A;  2G3Q B;  2K6D B;  2KKC A;  1Z5S B;  2LGY A;  2JZ3 B;  3CST A;  4NAW A;  1E8W A;  2LRW A;  1WJ4 A;  2R2Q A;  3ALB A;  3EHV A;  1YX5 B;  3PVL A;  3SHQ A;  5IA7 A;  1P3Q U;  2J0J A;  4EEW A;  3IG3 A;  5DPR A;  2Z59 B;  1JRU A;  2FUH B;  2YVC A;  2GMI C;  3DDC B;  2KQS A;  1VD2 A;  2FCS A;  2KWC A;  1WJU A;  1EO6 A;  3A9J B;  3QX1 A;  3QHT A;  3OJ3 A;  2AWT A;  1F9J A;  1WMH B;  4FLH A;  1GC6 A;  4MGZ E;  3VUX A;  1GJZ A;  4OVV A;  5D7G A;  4ANW A;  2LXC A;  2NPT B;  2ZCB A;  4JL9 A;  3UQA A;  2ZPN A;  1A5R A; 
#chains in the Genus database with same CATH topology
 4LDT B;  2MBO A;  2RGF A;  2DYM A;  2RD0 A;  3P4R B;  1FCC C;  5JH5 C;  3U30 A;  1C79 A;  1V81 A;  1SIF A;  2KN5 A;  3R66 C;  4E3C A;  4B9K A;  2LZ6 A;  3ZXV A;  2N1V A;  4HDO A;  2ZW1 A;  5HG2 A;  1V6E A;  1V5O A;  1V5T A;  2O6V B;  2JPH A;  2WXR A;  2WXN A;  4Q2J A;  2UWQ A;  1XCQ L;  2IO0 B;  3I3T B;  4B6W A;  1T0Q C;  4ZYN A;  3ZVV A;  2DZJ A;  3B1L X;  4J6I A;  4PYZ A;  2KMC A;  2K22 A;  3ETR A;  3M95 A;  4C56 C;  2KAC A;  3ZLZ A;  2JWZ A;  3W1Y A;  1BXT A;  4LJP B;  4XWW A;  1UWX A;  1UZX B;  3L10 B;  3V6C B;  1A70 A;  1S1Q B;  2HTM E;  2D5G A;  1WGY A;  5BO4 B;  2ACZ B;  1MVK A;  1EWY C;  4F8C B;  1ZKH A;  2O6V A;  2LMC A;  2LHE A;  1C77 A;  1E10 A;  1DOX A;  3BK2 A;  1V86 A;  4EZK A;  2WXH A;  1FXI A;  1N61 A;  1ZE3 D;  2QIE B;  1WSP A;  2K39 A;  3P42 A;  2AQ1 B;  2JYT A;  5LLI A;  2V4L A;  4URK A;  2PKO A;  4W9J A;  1FRR A;  2V3S A;  5LXI B;  3NS8 A;  3IBE A;  3CSF A;  3L13 A;  1WF9 A;  3J9C A;  1UF0 A;  1ZOY B;  3QCA A;  1V1P A;  3EEC A;  3WA0 A;  3IAM 1;  2IGD A;  2N9K A;  2BYV E;  3ZIM A;  3SR6 A;  1P1A A;  3ECI A;  1WH3 A;  4ARI A;  2YEP F;  3TCA A;  2WWZ A;  4RM9 A;  4YL8 A;  3AN1 A;  4FAD A;  2N7J A;  4DXF A;  3DBL B;  1D5X C;  3Q3F A;  4BVU C;  3FKY A;  1KLG D;  1XQQ A;  2WQY B;  4YSZ B;  3PO0 A;  3N1Z C;  5IKC M;  1HE8 A;  5BMH A;  4LNF A;  2K6Q A;  4DHJ D;  1N5X A;  3QK0 A;  3WAO A;  4KZC A;  3VAW A;  1UBQ A;  3H1U A;  5CHW A;  2Y3A A;  1SIJ A;  3DBS A;  4XGA B;  4KX6 B;  4MSQ B;  3PGE A;  3ZNZ B;  1N5W A;  2V4I B;  1KF6 B;  4NQL B;  4BZA A;  3MC8 A;  1AN8 A;  5C3J B;  4BFR A;  4DK5 A;  1UEL A;  1N63 A;  1RM6 C;  5GMV A;  4WUR A;  1YN5 A;  4DQO C;  3BVG A;  3A9K B;  2DAF A;  1VLB A;  2HJ8 A;  2KX3 A;  3L0W B;  3VTU A;  3BY4 B;  1E6E B;  2WP9 B;  2RSU A;  4P1B C;  1KRH A;  4KIK A;  2KYW A;  5DCN A;  2MSE D;  4HJK A;  1UH6 A;  2KMM A;  5G5G A;  3CMM B;  3VRB B;  1WI0 A;  3OJ4 B;  4FBJ B;  4WJP A;  5E6P A;  1J7A A;  1FXA A;  4USA A;  3ZNG C;  3HM6 X;  3RNC C;  3R7Q A;  1F1H A;  1ZXI A;  3I5J C;  4NY0 A;  3APD A;  1KJT A;  2WNM A;  1QQR A;  3Q2A C;  5AZH A;  4C4V B;  3ABV B;  1TIF A;  2KD0 A;  2JUO A;  3V61 A;  2C9W B;  2IBI B;  3C19 A;  3RT3 B;  2G4D B;  1D5Z C;  2W55 A;  3A4S C;  4IWO A;  1HZ5 A;  1SJE D;  3H7S A;  1WXM A;  4YSX B;  2I1J A;  3ZDT A;  4WWN A;  1ACC A;  2L00 B;  1ZGU B;  2YLM A;  4AQ7 A;  4OW0 A;  1WYG A;  3UIN B;  1JWM D;  1T0S C;  2BBC A;  2KT7 A;  3IAS 1;  2BYT A;  2QMT A;  1YQB A;  3X0W A;  1D4B A;  2W54 A;  1MG8 A;  2KC2 A;  1YQ3 B;  5HKH A;  4YXD B;  3TEY A;  3B9J A;  4KV2 A;  4CHK A;  2D2Q A;  4K7W A;  1J19 A;  2AL6 A;  4TKN A;  2G1E A;  1PQS A;  2RMM A;  2Z0D B;  4N9F 4;  2BW2 A;  4MEL A;  3RPF C;  3VR9 B;  1STE A;  4NJ7 A;  2MRP A;  5AZF A;  1S3S G;  4FJY A;  4ZRK A;  3AEB B;  4C80 A;  3MHZ A;  1QIL A;  4RFB A;  3ZTC A;  1SE3 A;  1D5M C;  4REZ A;  3EA6 A;  5D2M B;  1ZPS A;  3Q3M C;  2VH2 A;  4LCD E;  3ZTD A;  3UI3 A;  2EMS A;  4WQM A;  1FFU A;  1YN4 A;  3NOB A;  2KNB A;  1WXV A;  2JF5 A;  3BZD B;  2J4X A;  3DWG C;  2M8S A;  3AE9 B;  3PHW B;  4HRO A;  2JY6 A;  2KWD A;  4ZHO A;  2ONQ A;  4KSL C;  3E56 A;  1I4Q A;  1HA5 A;  2IYD B;  2K8H A;  3DHH C;  4KGT A;  4L1B A;  1BT0 A;  2Q5W D;  1GAQ B;  2WDT B;  1V97 A;  3AE1 B;  5EE3 A;  2MH7 A;  1SJH D;  4YTM B;  2NMQ A;  2HD5 B;  1NI3 A;  3RD2 A;  1NDD A;  3Q8E A;  2FCN A;  3H8H A;  1YJI A;  1CZP A;  3PTF C;  2ZEQ A;  2WXG A;  5D94 A;  4WAA A;  1WM2 A;  4F7Z A;  2KTF A;  3PZ7 A;  1I4X A;  3BWU D;  2ZNV C;  4ICU A;  2N7E A;  4FJZ A;  2BS3 B;  1PYW D;  1FIQ A;  2Y5P A;  4UDU C;  3ZYY X;  3EUB 2;  3ZW3 A;  1IGC A;  3ALB A;  2LRW A;  4TMA B;  3SHQ A;  3MFG A;  5IA7 A;  1KLU D;  1RWS A;  2J0J A;  4S0R A;  3DWM A;  2FCS A;  1MG4 A;  1WJU A;  1FCL A;  2AWT A;  1WMH B;  2JSV X;  4ANW A;  1WRI A;  3I63 C;  2BB5 A;  1A5R A;  1SBB B;  4HKZ E;  2XK5 A;  2K9X A;  3M63 B;  2KJH B;  1I35 A;  3HM3 A;  1WRD B;  4LDT D;  3VUY A;  4MEM A;  3KVF B;  5EE9 A;  5LNK 1;  1RAX A;  1FNU A;  3FC4 A;  1L6V A;  1HZ6 A;  2OJR A;  2J0M A;  4W9I A;  4DDG D;  4MH8 A;  2O6V D;  2BS2 B;  2KAJ A;  1KLV A;  2JXT A;  1RYJ A;  4NZL B;  2BT6 A;  4GSW A;  2LRU A;  1GC7 A;  2D3B A;  2AX5 A;  1ZDX A;  3H7P B;  5L83 A;  1IUE A;  2WXM A;  1KTK A;  3Q3O C;  1BML C;  2LFI A;  1Y8R C;  1TTN A;  2GOW A;  1J7C A;  5DPT A;  2N9E B;  4DBG A;  2BKF A;  1L6U A;  2MP2 B;  4AJW A;  4RNA A;  4RH6 A;  3X23 A;  1JML A;  1V49 A;  4FUL A;  4NJC A;  2KLG A;  2ZPY A;  2KX0 A;  2MBE A;  1P9D U;  2AQ2 B;  5IOI A;  2MWS B;  1F0Z A;  1KM7 A;  3DVN U;  3AXC A;  3H6N A;  1PDX A;  4ZOH C;  3RI7 C;  1CJE A;  3W2D A;  4YTP B;  4C7Y A;  3H7P A;  2PTL A;  1TBE A;  2NBW B;  3WCQ A;  4ZRQ A;  5H8Y E;  4PS8 A;  3PRP B;  3ZUN A;  3DPD A;  3SD5 A;  2ZJD A;  1ZUD 2;  2QC8 A;  1TZ1 A;  2C60 A;  2KLC A;  4E74 A;  1TY0 A;  2DYO A;  4E71 A;  1WGK A;  2X8X X;  2Z8L A;  4ZRP A;  1FM0 D;  1R7S A;  3AB5 A;  1KOT A;  4ZDV A;  2KOX A;  4MH0 E;  4GU2 A;  1C4A A;  4HK2 A;  1HXY D;  4I6P A;  2XEW A;  1KH0 A;  1TS5 A;  3MHS D;  2WX1 A;  4EUT A;  1B1Z A;  3JSV B;  3DQV A;  2JX5 A;  3HRD D;  5G5H A;  1EUV B;  1Y56 A;  4M0W B;  2FUG 1;  1C4P A;  5J2R A;  3P4P B;  5AUI A;  1TY2 A;  2CHW A;  1L4D B;  2RR9 A;  2XBB C;  4US8 A;  4DHZ E;  3KW5 B;  3AEG B;  4ACF A;  4K1R B;  2PJH A;  2M1M A;  4ANV A;  4XX5 A;  5I4D A;  4FXC A;  2H89 B;  2RPQ A;  2XN9 C;  2LHD A;  3KYC D;  4MDK E;  1R4N I;  4AUQ C;  5AEK B;  1WXS A;  1LQB A;  2HE7 A;  2WLB A;  1PGB A;  5FKA C;  1WR6 E;  1TZO A;  2VZK B;  1V1P B;  2K8C A;  3M3J A;  2ZW0 A;  1IPG A;  5MPO A;  5HI1 A;  3WAL A;  3DBR B;  1TKG A;  5AZG A;  2LD9 A;  3JSV A;  2WDR B;  4WJN A;  3RCZ A;  5C2T B;  4KGR A;  4M0W A;  3IT6 B;  3Q8B A;  2X38 A;  4WQO B;  5EDS A;  2PE6 B;  4IC7 B;  4CQN A;  1GB4 A;  1LGR A;  5H92 C;  2L05 A;  3B2G A;  2L0T A;  1UNS A;  1YMH E;  2EEL A;  1ISN A;  3MJW A;  1IGD A;  4MJS A;  2Z0E B;  2QDF A;  3DVG X;  4MGY E;  1QOA A;  4IKG A;  4JPS A;  1WX7 A;  4KZ0 A;  1CK1 A;  3VR8 B;  2N0S B;  4YSY B;  2CJN A;  1F52 A;  3VH4 B;  3VTW A;  4ZHP A;  1UWM A;  5FR6 A;  2NTT A;  3RUI B;  1F2R I;  3TJP A;  4BKS A;  5JXV A;  3UIO B;  1SEB D;  1YJ1 A;  4WWM A;  1UGM A;  5CTR C;  3FIL B;  4G0N B;  2NTS A;  1DGJ A;  4TQ0 A;  2KVZ A;  1TS3 A;  4KIK B;  4MSM B;  1ZXH A;  3DBR I;  3KWV A;  3ZGZ A;  1SB3 C;  1WE6 A;  4AJY B;  2INP E;  3W5U B;  2V3P A;  2E3T A;  1EU3 A;  2REX A;  2KDB A;  3RNE C;  2MX2 A;  5D3D A;  3L16 A;  3QJZ A;  1E8X A;  3N32 A;  4WIP A;  2VRR B;  4HVB A;  4ASW C;  1L7Y A;  2KO3 A;  2ZVN A;  1FXT B;  1C1Y B;  1QOF A;  2MBH A;  1TKE A;  3LXF A;  3CF6 E;  2N1W A;  3ZJT A;  4OVZ A;  4RMA A;  4TSS A;  3U7D A;  1TT5 B;  2MBQ A;  4LJO B;  3ZRC A;  2WXQ A;  4FJV B;  2V3N A;  1N62 A;  1TJE A;  3MC0 B;  2CS4 A;  3NVZ A;  5D6J B;  5C23 A;  4B95 A;  4AS1 A;  1WGG A;  3LDZ E;  1D6E C;  3VQI A;  2KQ7 A;  4PT5 A;  5E6N A;  3AU4 A;  5AUK A;  3FIL A;  3AEF B;  3PLU A;  2OED A;  1ET6 A;  4XDC A;  3Q14 C;  1H4R A;  2BKR B;  4M01 A;  1XLQ A;  1JWB D;  1FNV A;  3GE3 C;  4XYC A;  2GBK A;  1PGA A;  4HXD A;  2WXF A;  3I9V 1;  1NYR A;  4XZ4 A;  1WR1 A;  2W9N A;  1E8Y A;  1V80 A;  2NPT A;  4P16 A;  1Q5W B;  2C7H A;  3KWL A;  2JRH A;  1AAR A;  3AI5 A;  4NPN A;  2RDH A;  3VH3 B;  1OGW A;  1K52 A;  1M4V A;  4KDI C;  2ZVO A;  3AM9 A;  4A90 A;  1GB1 A;  1ZW7 A;  2GB1 A;  1PFD A;  1LM8 B;  3AE5 B;  3GB1 A;  2AL3 A;  2M17 A;  1ET9 A;  4BKT A;  2AQ3 B;  1E7P B;  3TIX A;  4FHJ A;  3EC8 A;  4GN1 A;  4PK1 A;  3BYY B;  2FAZ A;  3TSS A;  2DZK A;  2IGH A;  2GBR A;  4OZB A;  3QC8 B;  2WXL A;  3HIZ A;  4BOZ B;  2IO1 B;  4NAM A;  2PEA A;  4ANX A;  5DPS A;  1EF1 A;  4MGI E;  3DHG C;  1LFD A;  3AE2 B;  1I4H A;  2V0G A;  4W9C A;  3LB8 C;  5JHB A;  1E0Z A;  1WX9 A;  1UUP A;  2N9P C;  3P2B A;  4IUM B;  4LTU A;  4A55 A;  3NVW A;  3JVZ X;  2JYE A;  2MJE A;  2KKC A;  4NAW A;  3PVL A;  1WJ4 A;  2R2Q A;  1YX5 B;  1P3Q U;  2WDQ B;  4QAY A;  3IG3 A;  3HVZ A;  1JRU A;  3A9J B;  1VD2 A;  3QX1 A;  3QHT A;  4FLH A;  1F9J A;  4MGZ E;  4HRS A;  4OVV A;  4RCO A;  4OZC A;  2M19 A;  3UQA A;  4RGN A;  3N30 A;  2FIF A;  3SFE B;  1T5X D;  3QAQ A;  4MT5 A;  5E6J A;  2GI9 A;  3Q69 A;  4EFO A;  3U52 E;  1E7U A;  1WGH A;  2GBM A;  4WJQ A;  2LAS A;  4A6Q A;  1NYQ A;  4C7Z A;  4OVU A;  3PPA A;  4IM2 A;  4YT0 B;  3ONS A;  1M94 A;  4JWU C;  1WM3 A;  1K53 A;  2L52 A;  2WYQ A;  4K7S A;  1GPX A;  1L2N A;  3T3O A;  2N9L A;  4MM3 B;  2BGF A;  2QJL A;  2LGX A;  2V1Y A;  3B08 A;  1TGZ B;  1E90 A;  3ENE A;  3BVM A;  3A9J A;  1OQY A;  4L2Y A;  5BMG A;  2INC C;  2WXK A;  4A3O A;  3AED B;  3S2A A;  3TEX A;  4EE2 A;  3PHX B;  2LUM A;  3AE3 B;  2KC1 A;  3P4Q B;  2QCZ A;  3V60 A;  3BII D;  1WFY A;  4W9E A;  2FNJ B;  2WX0 A;  4ANU A;  1FO4 A;  2L76 A;  1RFA A;  1NVI D;  2SEB D;  2JWU A;  4N6E B;  2BF8 B;  4HPM B;  2NCN A;  2I1K A;  1UBI A;  2BS4 B;  4BOS C;  2IGG A;  1SXT A;  2XK5 B;  4MGK E;  4MM3 A;  4US9 A;  3U2S C;  3OLM D;  3AEA B;  1GOZ A;  2J0K A;  3N1X C;  2KTR A;  2KAN A;  2KFJ A;  3N20 C;  4RGO S;  4HKQ A;  3PT2 B;  2AYO B;  2DBY A;  1L5P A;  2K3U A;  5FR3 A;  4FA6 A;  2MW5 A;  3AMZ A;  1I4R A;  4B0E A;  1QKZ A;  1JWA D;  3SFD B;  3N9Y C;  3AE6 B;  3ZJU A;  3L54 A;  1QOB A;  1I4P A;  1JW9 D;  2EKI A;  2DYB A;  1TS4 A;  2QHO A;  2BYE A;  3I57 A;  3R8B A;  2LI5 A;  2D3G A;  1JAL A;  4LNK A;  1AWD A;  2IO3 B;  5KHO A;  3UQB A;  3KUZ A;  4RGT A;  3QIJ A;  3V3X A;  2EMT A;  1YQ4 B;  1N6Z A;  3MC9 A;  1FMA D;  3VHT C;  2JXX A;  2O2V B;  5DPW A;  5FK9 C;  5JZE B;  4AP4 C;  2Y5B B;  2MLB A;  2BQQ A;  2EKE C;  3O65 B;  4IG7 B;  4O1N A;  2LWP A;  1N60 A;  1J7B A;  3Q8C A;  3QWZ B;  3ZO5 B;  4HCN B;  3A1Q A;  1OEY A;  2GBJ A;  2ON8 A;  3VUW A;  3N3K B;  1EWC A;  2PPH A;  3CIR B;  3ML9 A;  2KDM A;  5JHA A;  2KVR A;  2BB6 A;  1SSN A;  4N59 A;  4N58 A;  2A4Z A;  4W9K A;  5GXG B;  2WGS A;  1I4G A;  2VZK D;  1MFW A;  3GZN B;  1TS2 A;  1BUI C;  1MJD A;  4JE3 B;  2N9X A;  3T8M A;  3E9S A;  1T0Y A;  5LXH A;  3IT4 B;  2O2V A;  1XT9 B;  3SU8 X;  5BYS A;  1C4C A;  1L0V B;  1Q1O A;  2KK8 A;  2LGS A;  2MJD A;  1L0Y B;  4GMV A;  3SDL C;  2D11 A;  1MHX A;  3W1S A;  2WXO A;  3PLV A;  4K3B A;  1UD7 A;  1XXG A;  1WE7 A;  4JQW C;  3OWE B;  1JCK B;  3DVN V;  2C7M B;  2UU7 A;  4ITK A;  4PS7 A;  4XE0 A;  4RF1 A;  3R2I A;  4S17 A;  3O13 A;  2LXA A;  5BYR A;  3T9L A;  4HLE A;  1R4N B;  3WAN A;  2L1A A;  2WXJ A;  3GP7 A;  4WWO A;  2MA9 B;  2DAJ A;  1LO5 D;  3DOW A;  1FFV A;  3A33 B;  4GDL A;  2TSS A;  1RLF A;  1VZ8 A;  2LUE A;  1I7H A;  2R61 A;  4K81 A;  4EKU A;  1SGH A;  3RFZ B;  3NRZ A;  4GOC A;  1IYF A;  2M4N A;  2MQJ A;  1JRO A;  2CKH B;  2HTH A;  3DBH B;  4FHK A;  4HPL B;  3TEZ A;  2D07 B;  4DXG A;  1ESF A;  2FE8 A;  2LVO A;  3BIN A;  4ICV A;  3LYY A;  1HQR D;  3GZN I;  1GNU A;  4IWP A;  1SE4 A;  3APF A;  4W9D A;  2CHZ A;  2MBB B;  3ZKJ C;  1WYW B;  1QT9 A;  3W5V B;  1VRA B;  2JZZ A;  1X1M A;  3AE4 B;  2LGD A;  4HCP B;  1D3Z A;  3RNB C;  4P7I A;  2OJW A;  2L0F A;  1GG3 A;  2CR5 A;  4MJS B;  2R2O A;  4GIV A;  4YTN B;  2KJR A;  2MJ3 A;  3P63 A;  2DZI A;  5CHF A;  4L23 A;  1OTR B;  4JX1 C;  3K9P B;  4J3O D;  3U8Z A;  1VR9 A;  3PRM B;  2D3C A;  2DZM A;  1I42 A;  2PLP A;  2RDG A;  3ZQ4 A;  3L08 A;  3HVD A;  3R2T A;  1E8Z A;  3UIP B;  1F77 A;  3VTV A;  2LJI A;  5EE1 A;  4HPP A;  1V9J A;  4R3D A;  2MEK A;  4RF0 A;  4W9G A;  3EFU A;  1IBX B;  4JGH B;  3WAM A;  1J0G A;  2WU5 B;  3DBH I;  5J17 A;  2BPS A;  1EU4 A;  2L32 A;  1TYG B;  4WJO A;  3P1M A;  3EGR A;  1JRP A;  2KMA A;  2YEP B;  3PRE A;  1SE2 A;  3Q3N C;  5E6O A;  2BWF A;  1C78 A;  2C5L C;  2I2Y A;  3KUD B;  4TUU A;  4KSK C;  4LNO A;  4BKG A;  2GLS A;  3EFC A;  3L4P A;  2M0A A;  3AE7 B;  1OFF A;  3KUC B;  4JWS C;  3AU5 A;  3FAH A;  2PVG C;  4WWP A;  3RUL A;  4EZL A;  1YD8 U;  3V62 A;  4WAF A;  1AW7 A;  1P98 A;  2IND C;  1B9R A;  3TBL D;  1IBX A;  1ENF A;  4TQ1 A;  2KZR A;  3C0R B;  3C8Y A;  2FID A;  3MJ5 A;  2D10 A;  1R4M B;  1FNW A;  3B0A A;  1E5W A;  1VZ7 A;  3VDZ A;  2G3Q B;  2K6D B;  1Z5S B;  1HEZ E;  3NZ3 A;  1MI0 A;  4EEW A;  3SEB A;  2DLB A;  2Z59 B;  2WXP A;  2YVC A;  1ZP0 B;  2KWC A;  1EO6 A;  2QSD A;  2WHI A;  3OJ3 A;  3VUX A;  1GJZ A;  2M56 B;  5D7G A;  4B0M A;  2LXC A;  2D3A A;  2NPT B;  3IHP C;  3ML8 A;  1J8C A;  3NVY A;  2Y5C A;  4G3X B;  1QLB B;  3PV1 A;  2BWE S;  2NBU A;  2KDF B;  3NS1 A;  2AEH A;  1JWU D;  3Q3J A;  3RNG C;  5D3I B;  3ZJV A;  2NS5 A;  1L0X B;  1T0R C;  1SE9 A;  3AEC B;  1HTQ A;  2G4S A;  1MHH E;  1WIA A;  3R3M A;  1LXD A;  2RDB C;  3IVF A;  4IWQ A;  1WXQ A;  5HFY A;  3V6E B;  1WZ0 A;  3M62 B;  2QIL A;  4M02 A;  4M8N A;  2KFK B;  2CHX A;  1G6J A;  3AV8 A;  3DCG A;  3GE8 C;  4F1S A;  2RPV A;  1R4M I;  4EZJ A;  4KKI A;  1ZDV A;  4KKJ A;  1WWT A;  4GLS C;  5HHD G;  2DWQ A;  2LVQ A;  5TR5 A;  3KLS X;  3QAR A;  5IN7 A;  3VXW A;  4M8M A;  4IW0 A;  1FD6 A;  4NAW B;  2OHF A;  3RNF C;  3PSE B;  2KQ4 X;  4XDD A;  2L3Z A;  1C9F A;  1U4A A;  4RGM A;  1HTO A;  3DBL I;  1OQR A;  5C1Z A;  3RYT A;  3TL5 A;  1QF6 A;  4BBN C;  2MHJ A;  1YOV B;  4RM8 A;  3APC A;  3VRA B;  3NUH B;  4GXB A;  4HDQ A;  2B3A A;  2CU1 A;  1DOY A;  3A9K A;  2KFK A;  4GGQ A;  3DVG Y;  3PRZ A;  3PZ8 A;  1EM7 A;  1TKY A;  1XD3 B;  5BYQ A;  1AYF A;  3A4R A;  1PUT A;  2IJ0 A;  4IM3 A;  1XLO A;  2ASQ A;  2UYZ B;  4I6N B;  3IXS A;  1QOG A;  1Q10 A;  4LLG M;  2IY0 B;  2G45 B;  3PS6 A;  2LGI A;  3BVZ A;  2K1F A;  3QA8 A;  2W3S A;  4XWT A;  1VCB A;  1P7E A;  1CMX B;  1V8C A;  4C00 A;  1WX8 A;  3WAP A;  1WGD A;  4YWG G;  5TSS A;  4W9H A;  1PGX A;  1ROE A;  4KVG B;  1EF5 A;  4DDI D;  1JWS D;  2J53 A;  1K50 A;  3RN9 C;  4NNJ B;  5J18 A;  4DHJ B;  2JRI B;  4TV3 A;  3L17 A;  4JIO U;  3TMP B;  1Z2M A;  3VFK A;  3P4S B;  2PVO D;  2W82 A;  2QEJ C;  2HJ1 A;  1XF5 L;  2SAK A;  4EOY A;  3W9C B;  4LNI A;  4C4V A;  4P6V F;  5G2N A;  4A3P A;  1XEE A;  3GOE A;  4NJ6 A;  1H8C A;  1VJK A;  1WXA A;  3NVV A;  1VZ6 A;  3W1S C;  1WY8 A;  4PYU A;  3RNA C;  3BYT B;  2GRI A;  1YN3 A;  1DYQ A;  2V9H A;  3NHE B;  3RMK C;  2DHZ A;  1YIW A;  2KTR B;  3Q8A A;  2DEN B;  4CO7 A;  5CHV C;  1WZ3 A;  2W3R A;  1C76 A;  3D32 A;  3JW0 X;  2HDE A;  1V2Y A;  1DOI A;  4LNN A;  4PS3 A;  1IP9 A;  1NI2 A;  3JYU A;  3NY5 A;  2B76 B;  3ZNI D;  2ZZP B;  2IY1 B;  2XNA C;  4GDK B;  2I38 A;  4AWJ A;  2BYF A;  1E7V A;  3TUO A;  2N7D A;  3KYD D;  4ZRI A;  4K7U A;  3NZU A;  3AEE B;  4IM0 A;  2CJO A;  1Q0W B;  2PE9 A;  3AH7 A;  1WJ6 A;  1T3Q A;  1K51 A;  2A5U A;  5G55 A;  1NBF C;  1E9M A;  1V1O A;  2L7R A;  3HHM A;  3GS2 A;  1WJN A;  2KN4 A;  1P7F A;  4MAC A;  4II3 B;  1T6B X;  2KHW B;  2NR2 A;  4DHZ B;  3MP9 A;  5T8I A;  4OHJ A;  4OZA A;  1OQQ A;  4JLC A;  3WIM A;  1YNT E;  3PZD A;  5IO9 A;  4M00 A;  1K8R B;  4IOI E;  5IP4 D;  4G11 A;  5EE0 A;  1C3T A;  4K3C A;  4GDK A;  2LJ5 A;  5IAA C;  2N4F A;  1NEN B;  2C7N B;  4GB9 A;  2J7Q B;  2JZP A;  1FPY A;  4XC2 A;  1FEH A;  3A1Q B;  2IDY A;  3URY A;  3H9D A;  1NEK B;  4ARC A;  2BTE A;  3Q6B A;  4BAX A;  3T3N A;  1YX6 B;  2DNF A;  2WXI A;  3KQ4 A;  3CWI A;  3K9O B;  1WGR A;  3ZDM C;  3IFW B;  1RFK A;  3TEW A;  2FCM A;  1XLP A;  4BBN F;  1L4Z B;  3N1Y C;  4P1C C;  4WH4 A;  4A20 A;  2OOB B;  2NBV B;  3LJ3 A;  5CX3 A;  4IDI A;  4D2K A;  2KWU B;  2K8B A;  4AOF A;  2KXJ A;  1F2R C;  2H88 B;  1FRD A;  4NQK E;  4HJG E;  3V05 A;  3ZXR A;  3UGB B;  2VH1 A;  4W9F A;  2M0X A;  4X57 B;  2LVP A;  4A8X C;  1CQV A;  3RZF A;  1UGJ A;  2JVC A;  1KFY B;  2WU2 B;  2J52 A;  2K25 A;  4A9A A;  2K0P A;  2IPK D;  2IO2 B;  3AUL A;  4CYE A;  5L95 C;  3U4E G;  3R7R A;  4KDL B;  4GDL B;  2DX5 B;  3HUI A;  2KDE B;  5BMI A;  1VDV A;  4FN2 A;  2KJ6 A;  2PIA A;  2L83 A;  1WMH A;  3Q8F A;  4HWI B;  4DXA B;  1SF0 A;  1P0R A;  4BKS D;  3MTN B;  3QQ8 B;  3DHI C;  2FCQ A;  2WS3 B;  1GUA B;  2K5P A;  3NZS A;  4DWF A;  4ZYS A;  3NJT A;  3B2F A;  4G50 A;  3U7Z A;  1YJJ A;  2GBN A;  4II2 B;  2E6X A;  2BVC A;  2INN E;  2CU3 A;  3HK0 A;  2KDI A;  5KHQ A;  2FBW B;  2IZV B;  3RZW C;  4H2A A;  2NVU I;  1XO3 A;  3VVW B;  3KH0 A;  3UF8 A;  1MPE A;  3OAW A;  1XLN A;  4ZRJ A;  4LK0 M;  3OG5 A;  2L8J A;  4HEA 1;  2JU6 X;  2ZCC A;  3ZRF A;  2ICI A;  2G9H D;  3ZNH B;  2PW9 A;  1QZE A;  1RRB A;  2KWV B;  2JT4 B;  4W9L A;  1OEY J;  4I6L B;  2ZNV B;  2LEK A;  2MP2 A;  2MCN B;  2LGY A;  2JZ3 B;  3CST A;  1E8W A;  3BK1 A;  3EHV A;  1JQ4 A;  1XCT L;  5DPR A;  2FUH B;  3DDC B;  2GMI C;  2KQS A;  3NG0 A;  1GC6 A;  2PMV A;  3AE8 B;  4KGS A;  2ZCB A;  2WDV B;  2JQR B;  4JL9 A;  2J42 A;  2ZPN A; 
#chains in the Genus database with same CATH homology
 3IHP C;  3N30 A;  3ML8 A;  4LDT B;  1J8C A;  2FIF A;  2MBO A;  2RGF A;  2DYM A;  2RD0 A;  3QAQ A;  2XK5 A;  3M63 B;  2KJH B;  3U30 A;  5JH5 C;  1I35 A;  4EFO A;  4G3X B;  1E7U A;  1V81 A;  1WGH A;  2GBM A;  1WRD B;  1SIF A;  2KN5 A;  2LAS A;  3HM3 A;  3PV1 A;  3R66 C;  4LDT D;  2BWE S;  2NBU A;  3VUY A;  4OVU A;  3PPA A;  4B9K A;  4E3C A;  4IM2 A;  2KDF B;  2LZ6 A;  4MEM A;  4WJQ A;  2N1V A;  4HDO A;  3KVF B;  1V6E A;  1V5O A;  1V5T A;  3ONS A;  2O6V B;  2JPH A;  1M94 A;  2AEH A;  1RAX A;  3Q3J A;  2OJR A;  2UWQ A;  2NS5 A;  2J0M A;  4W9I A;  2IO0 B;  3I3T B;  4DDG D;  1WM3 A;  4B6W A;  2O6V D;  1SE9 A;  1KLV A;  4ZYN A;  2G4S A;  1WIA A;  2WYQ A;  4K7S A;  3R3M A;  1L2N A;  1LXD A;  4GSW A;  3ZVV A;  2LRU A;  3IVF A;  1GC7 A;  2BGF A;  2DZJ A;  4IWQ A;  2LGX A;  2V1Y A;  3B08 A;  3B1L X;  4J6I A;  3V6E B;  4PYZ A;  1TGZ B;  1WZ0 A;  1E90 A;  3M62 B;  2KMC A;  3ENE A;  3H7P B;  4M8N A;  2KFK B;  5L83 A;  2CHX A;  1G6J A;  3A9J A;  1OQY A;  3DCG A;  3M95 A;  3ZLZ A;  2JWZ A;  4A3O A;  4F1S A;  3W1Y A;  1R4M I;  1Y8R C;  1TTN A;  2GOW A;  3S2A A;  4EZJ A;  4LJP B;  1UZX B;  3L10 B;  3PHX B;  3V6C B;  2KC1 A;  1S1Q B;  5DPT A;  2MCN B;  2LVQ A;  2N9E B;  5TR5 A;  4DBG A;  2BKF A;  3QAR A;  3V60 A;  3VXW A;  4M8M A;  4IW0 A;  2MP2 B;  4NAW B;  4AJW A;  1WGY A;  3PSE B;  5BO4 B;  3X23 A;  1WFY A;  1V49 A;  4W9E A;  2FNJ B;  4FUL A;  4F8C B;  1ZKH A;  2L3Z A;  1U4A A;  2KLG A;  2WX0 A;  2ZPY A;  4ANU A;  2KX0 A;  2MBE A;  2O6V A;  2L76 A;  1RFA A;  1P9D U;  3DBL I;  5C1Z A;  3RYT A;  3TL5 A;  4BBN C;  2BF8 B;  2MWS B;  4HPM B;  1KM7 A;  2I1K A;  2NCN A;  4RM8 A;  3APC A;  3DVN U;  1UBI A;  3AXC A;  1V86 A;  4BOS C;  4EZK A;  4GXB A;  3H6N A;  4HDQ A;  2XK5 B;  4MGK E;  4MM3 A;  3OLM D;  2B3A A;  2J0K A;  2KTR A;  2CU1 A;  3H7P A;  2K39 A;  3A9K A;  2KAN A;  2KFK A;  4GGQ A;  3DVG Y;  3PRZ A;  1TBE A;  2NBW B;  5LLI A;  2V4L A;  2KFJ A;  4URK A;  4W9J A;  3PT2 B;  2V3S A;  1XD3 B;  5LXI B;  3NS8 A;  4PS8 A;  2AYO B;  3A4R A;  3CSF A;  3IBE A;  3PRP B;  3L13 A;  1WF9 A;  4IM3 A;  2ASQ A;  2UYZ B;  4I6N B;  3ZUN A;  3DPD A;  4FA6 A;  3SD5 A;  3QCA A;  2MW5 A;  2ZJD A;  2IY0 B;  2G45 B;  3EEC A;  1TZ1 A;  2C60 A;  2KLC A;  3WA0 A;  4E74 A;  2BYV E;  2DYO A;  4E71 A;  3PS6 A;  3ZIM A;  2K1F A;  3QA8 A;  1VCB A;  1P1A A;  1CMX B;  3ECI A;  1WX8 A;  3WAP A;  1WH3 A;  1WGD A;  3L54 A;  1KOT A;  4ZDV A;  2KOX A;  4W9H A;  3TCA A;  4KVG B;  2WWZ A;  1EF5 A;  4MH0 E;  4GU2 A;  2DYB A;  4RM9 A;  4YL8 A;  2QHO A;  4DDI D;  4FAD A;  4HK2 A;  4I6P A;  2BYE A;  4NNJ B;  2XEW A;  5J18 A;  3Q3F A;  2LI5 A;  4BVU C;  4DHJ B;  1XQQ A;  2JRI B;  2D3G A;  4TV3 A;  3L17 A;  2IO3 B;  3MHS D;  5KHO A;  3UQB A;  3KUZ A;  2WX1 A;  4JIO U;  1HE8 A;  3TMP B;  1Z2M A;  4EUT A;  3VFK A;  3QIJ A;  3JSV B;  3DQV A;  2K6Q A;  2EMT A;  4DHJ D;  4EOY A;  1EUV B;  3QK0 A;  5AZF A;  3WAO A;  4M0W B;  4KZC A;  5J2R A;  3VAW A;  1UBQ A;  3VHT C;  3H1U A;  5CHW A;  5G2N A;  4A3P A;  2JXX A;  3GOE A;  4NJ6 A;  2O2V B;  3DBS A;  5DPW A;  1H8C A;  1WXA A;  4MSQ B;  5JZE B;  2CHW A;  3PGE A;  3ZNZ B;  4AP4 C;  2Y5B B;  3W1S C;  2MLB A;  1WY8 A;  2EKE C;  4NQL B;  2RR9 A;  4PYU A;  2XBB C;  3O65 B;  4DHZ E;  3NHE B;  3KW5 B;  4BFR A;  2DHZ A;  1YIW A;  4DK5 A;  4K1R B;  1UEL A;  2M1M A;  2PJH A;  4IG7 B;  4ANV A;  5GMV A;  4XX5 A;  2KTR B;  2LWP A;  3QWZ B;  2RPQ A;  3A9K B;  3ZO5 B;  4HCN B;  2DEN B;  3KYC D;  4CO7 A;  4MDK E;  3A1Q A;  5CHV C;  1OEY A;  1WZ3 A;  2DAF A;  2GBJ A;  1R4N I;  2HJ8 A;  2KX3 A;  3VUW A;  4AUQ C;  3N3K B;  3D32 A;  1WXS A;  1LQB A;  2HE7 A;  2PPH A;  3ML9 A;  5AEK B;  3JW0 X;  3L0W B;  3VTU A;  1V2Y A;  3BY4 B;  5JHA A;  4PS3 A;  1IP9 A;  1NI2 A;  1WR6 E;  2KVR A;  2RSU A;  4KIK A;  5DCN A;  3JYU A;  2MSE D;  3NY5 A;  3ZNI D;  2K8C A;  4HJK A;  2A4Z A;  4W9K A;  1UH6 A;  3M3J A;  2ZZP B;  1IPG A;  3WAL A;  2IY1 B;  5AZG A;  2LD9 A;  3CMM B;  3JSV A;  4GDK B;  4AWJ A;  4WJN A;  2BYF A;  1E7V A;  3RCZ A;  1WI0 A;  2N7D A;  3KYD D;  3OJ4 B;  4ZRI A;  4K7U A;  2N9X A;  4FBJ B;  4WJP A;  3T8M A;  3NZU A;  4IM0 A;  1T0Y A;  5LXH A;  4WQO B;  1Q0W B;  5E6P A;  2PE6 B;  5EDS A;  4IC7 B;  2O2V A;  1XT9 B;  2PE9 A;  3SU8 X;  2L05 A;  1Q1O A;  2L0T A;  3ZNG C;  2KK8 A;  1WJ6 A;  3HM6 X;  1ISN A;  3R7Q A;  3MJW A;  4MJS A;  2Z0E B;  3DVG X;  2A5U A;  4MGY E;  4NY0 A;  4GMV A;  3SDL C;  2D11 A;  3APD A;  1KJT A;  5G55 A;  3W1S A;  1WX7 A;  3PLV A;  1NBF C;  1UD7 A;  1WE7 A;  4JQW C;  2L7R A;  3HHM A;  4KZ0 A;  1WJN A;  3DVN V;  5AZH A;  2C7M B;  4II3 B;  2KD0 A;  2JUO A;  4PS7 A;  3V61 A;  3VH4 B;  2C9W B;  2IBI B;  2KHW B;  2NR2 A;  4DHZ B;  3VTW A;  3RT3 B;  2G4D B;  2LXA A;  3A4S C;  4JLC A;  3WIM A;  3T9L A;  4HLE A;  5FR6 A;  3WAN A;  4IWO A;  3PZD A;  4WWO A;  2MA9 B;  3RUI B;  3H7S A;  1WXM A;  2I1J A;  3ZDT A;  2DAJ A;  3DOW A;  1K8R B;  4WWN A;  3TJP A;  4G11 A;  3A33 B;  4GDL A;  4BKS A;  2L00 B;  1C3T A;  1ZGU B;  4GDK A;  1RLF A;  2LUE A;  2YLM A;  2LJ5 A;  5IAA C;  3UIO B;  2N4F A;  1YJ1 A;  2C7N B;  4GB9 A;  2J7Q B;  3UIN B;  4K81 A;  4XC2 A;  4EKU A;  1UGM A;  1SGH A;  3A1Q B;  4GOC A;  1IYF A;  5CTR C;  2M4N A;  2MQJ A;  4G0N B;  3H9D A;  2CKH B;  4TQ0 A;  2HTH A;  1YQB A;  4FHK A;  4HPL B;  3X0W A;  2D07 B;  1MG8 A;  2LVO A;  4KIK B;  3DBR I;  3BIN A;  4ICV A;  4MSM B;  2KC2 A;  1YX6 B;  3GZN I;  1WE6 A;  4AJY B;  1GNU A;  4IWP A;  3K9O B;  5HKH A;  1WGR A;  3APF A;  4W9D A;  3ZDM C;  3IFW B;  2CHZ A;  2MBB B;  3ZKJ C;  2REX A;  4KV2 A;  2KDB A;  1WYW B;  2FCM A;  2D2Q A;  4K7W A;  4CHK A;  2MX2 A;  1J19 A;  2AL6 A;  4TKN A;  4BBN F;  2JZZ A;  1X1M A;  2LGD A;  1PQS A;  3L16 A;  3QJZ A;  1E8X A;  3N32 A;  4HCP B;  2VRR B;  4A20 A;  4HVB A;  2OOB B;  1D3Z A;  2NBV B;  4ASW C;  1L7Y A;  2KO3 A;  2Z0D B;  2ZVN A;  3LJ3 A;  1FXT B;  1C1Y B;  5CX3 A;  2MBH A;  4P7I A;  4N9F 4;  4MEL A;  2L0F A;  4NJ7 A;  2KWU B;  2MRP A;  3CF6 E;  1GG3 A;  2CR5 A;  1S3S G;  2K8B A;  2N1W A;  2R2O A;  4FJY A;  2KJR A;  4GIV A;  4MJS B;  4ZRK A;  4AOF A;  2KXJ A;  4RMA A;  3U7D A;  2DZI A;  4LJO B;  2MBQ A;  3ZRC A;  4NQK E;  5CHF A;  4FJV B;  2CS4 A;  5D6J B;  1OTR B;  5C23 A;  4B95 A;  1WGG A;  3K9P B;  3ZTC A;  3LDZ E;  3U8Z A;  3UGB B;  3VQI A;  4W9F A;  2M0X A;  2KQ7 A;  3PRM B;  2DZM A;  4X57 B;  1I42 A;  2LVP A;  5E6N A;  3AU4 A;  3RZF A;  5D2M B;  2JVC A;  3PLU A;  2K25 A;  3L08 A;  4LCD E;  3ZTD A;  2EMS A;  1H4R A;  2BKR B;  1E8Z A;  3UIP B;  2IO2 B;  3AUL A;  3VTV A;  4CYE A;  5L95 C;  1V9J A;  3NOB A;  2KNB A;  3R7R A;  2GBK A;  4KDL B;  1WXV A;  4GDL B;  2DX5 B;  4HXD A;  4W9G A;  2JF5 A;  3EFU A;  2KDE B;  4JGH B;  4FN2 A;  3WAM A;  2KJ6 A;  1J0G A;  2M8S A;  4XZ4 A;  1WMH A;  4HWI B;  4DXA B;  1WR1 A;  1P0R A;  3PHW B;  2JY6 A;  3DBH I;  4BKS D;  3MTN B;  5J17 A;  2W9N A;  1E8Y A;  3QQ8 B;  1V80 A;  2NPT A;  1Q5W B;  2FCQ A;  2BPS A;  1GUA B;  2C7H A;  4KSL C;  2JRH A;  3NZS A;  4DWF A;  1AAR A;  2IYD B;  4WJO A;  2K8H A;  3AI5 A;  4G50 A;  4NPN A;  2GBN A;  4II2 B;  2KMA A;  3VH3 B;  1OGW A;  1BT0 A;  3PRE A;  4KDI C;  2BWF A;  2ZVO A;  5E6O A;  2WDT B;  3HK0 A;  2KDI A;  5KHQ A;  1ZW7 A;  1LM8 B;  2AL3 A;  2M17 A;  2C5L C;  2IZV B;  4BKT A;  3RZW C;  3TIX A;  2NVU I;  4FHJ A;  3EC8 A;  3KUD B;  4GN1 A;  4TUU A;  3VVW B;  4KSK C;  3KH0 A;  4BKG A;  2HD5 B;  3UF8 A;  2FAZ A;  3OAW A;  4ZRJ A;  3RD2 A;  2DZK A;  2GBR A;  1NDD A;  3QC8 B;  2L8J A;  3KUC B;  3HIZ A;  2FCN A;  3AU5 A;  4BOZ B;  2ZCC A;  3ZRF A;  2IO1 B;  2PEA A;  4WWP A;  3PTF C;  4ANX A;  2ZEQ A;  5DPS A;  5D94 A;  3RUL A;  1YD8 U;  4EZL A;  1EF1 A;  4MGI E;  3V62 A;  4WAA A;  1WM2 A;  1LFD A;  1P98 A;  4F7Z A;  3TBL D;  3ZNH B;  1QZE A;  2KTF A;  1RRB A;  4TQ1 A;  2KZR A;  4W9C A;  5JHB A;  3C0R B;  1WX9 A;  2KWV B;  2JT4 B;  2ZNV C;  4ICU A;  2N9P C;  3P2B A;  4IUM B;  2N7E A;  2FID A;  4FJZ A;  4W9L A;  1OEY J;  2D10 A;  4I6L B;  2ZNV B;  3JVZ X;  3B0A A;  1E5W A;  3ZW3 A;  3VDZ A;  2MP2 A;  2G3Q B;  2K6D B;  2KKC A;  1Z5S B;  2LGY A;  2JZ3 B;  3CST A;  4NAW A;  1E8W A;  2LRW A;  1WJ4 A;  2R2Q A;  3ALB A;  3EHV A;  1YX5 B;  3PVL A;  3SHQ A;  5IA7 A;  1P3Q U;  2J0J A;  4EEW A;  3IG3 A;  5DPR A;  2Z59 B;  1JRU A;  2FUH B;  2YVC A;  2GMI C;  3DDC B;  2KQS A;  1VD2 A;  2FCS A;  2KWC A;  1WJU A;  1EO6 A;  3A9J B;  3QX1 A;  3QHT A;  3OJ3 A;  2AWT A;  1F9J A;  1WMH B;  4FLH A;  1GC6 A;  4MGZ E;  3VUX A;  1GJZ A;  4OVV A;  5D7G A;  4ANW A;  2LXC A;  2NPT B;  2ZCB A;  4JL9 A;  3UQA A;  2ZPN A;  1A5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...