1LQBA

Crystal structure of a hydroxylated hif-1 alpha peptide bound to the pvhl/elongin-c/elongin-b complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongin B
publication title Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 27
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1lqbA00
5J2RA 1OEYA 3WAPA 4FLHA 2JPHA 1WMHA 3O65B 4XX5A 3ZNGC 4IM3A 4GN1A 1QZEA 2NBWB 3HHMA 3IVFA 2LXCA 4M8MA 3M3JA 5JHBA 2G45B 2IY0B 2BWFA 4DBGA 4BKGA 1OEYJ 4HPLB 3A9KB 1TGZB 3DVNU 2C9WB 2LGXA 3QAQA 2MBQA 4KVGB 2CKHB 4YL8A 2J0KA 2LVQA 2M4NA 2UYZB 4HDQA 4F8CB 1WJUA 4ICUA 5G55A 3WANA 2KZRA 2WYQA 1J8CA 1VCBA 2IO3B 3V6EB 1ZKHA 1TZ1A 3DPDA 1WR1A 2KJHB 3DVGY 2HJ8A 4B95A 2K6DB 1C1YB 1ZW7A 3NZUA 2RSUA 3R66C 1LXDA 3NZSA 5JH5C 4I6LB 5HKHA 2KDBA 3H1UA 5L83A 3WAOA 5KHOA 1OQYA 2MCNB 3HK0A 1WY8A 4GIVA 3R7RA 3OJ3A 4FJVB 1LFDA 5TR5A 2WX0A 2D3GA 4TV3A 2R2QA 1RLFA 3X23A 4WWNA 4KZ0A 4E74A 3L08A 2N9EB 1PQSA 2RR9A 1S1QB 1WRDB 3JW0X 3A4SC 2MLBA 1CMXB 5CHFA 2BGFA 4MGYE 1WYWB 4HJKA 3ZLZA 2BYVE 2K8CA 2C60A 2PE6B 1P3QU 2G4DB 4GXBA 2MW5A 2KC1A 3TIXA 1IYFA 4HPMB 1GG3A 4ICVA 2NPTA 2ZZPB 2EMTA 3JSVB 3QX1A 2IY1B 1P0RA 2G3QB 2DYOA 1WMHB 4MGZE 3U30A 2LGDA 3IG3A 5E6PA 1YX6B 2LI5A 3EFUA 2D10A 3DQVA 3ZO5B 2KOXA 2ZEQA 2A4ZA 4WJOA 4PS3A 4W9CA 4OVUA 3N30A 3A9JB 5AEKB 5DPWA 3DDCB 3PGEA 4CO7A 1P1AA 5GMVA 1WF9A 3OLMD 4K1RB 4ZRJA 4IC7B 2V1YA 1V6EA 1WXAA 1Y8RC 3OJ4B 4II2B 3VUXA 3WAMA 2XBBC 4XC2A 3ZIMA 3VUWA 3ZNHB 4LJPB 1RFAA 2C7HA 1SGHA 4LDTD 5DPSA 3ENEA 1D3ZA 3DCGA 3VQIA 2IZVB 4FJYA 3VH3B 1S3SG 1WIAA 1XD3B 5AZGA 3T9LA 3VHTC 2FNJB 4NY0A 5DCNA 4FHKA 2KMCA 3LJ3A 4EZJA 2JWZA 2KFKA 3T8MA 3B1LX 3D32A 4FJZA 4IWOA 1YJ1A 3NY5A 2L7RA 3KVFB 4FHJA 4K81A 4KSLC 3L17A 2CU1A 2MBHA 5EDSA 3L0WB 2NCNA 3C0RB 3HM6X 1E5WA 4G0NB 1KLVA 3PLUA 2KLGA 3QIJA 3QWZB 3TCAA 4IM2A 4DHJD 1WJ6A 1LQBA 3L13A 2GBMA 2CS4A 3PREA 4WWOA 4AUQC 2EKEC 1WI0A 3R7QA 2ASQA 2LGYA 5DPRA 3N3KB 2CR5A 5G2NA 3UF8A 1WXVA 2MP2B 1GJZA 2IBIB 2BKRB 3H9DA 2G4SA 3WALA 4RMAA 4DDID 1V86A 4HWIB 5LXIB 1I42A 4GDKA 4PS7A 1V2YA 2NBUA 2NS5A 4NQKE 4W9DA 4KDLB 2FUHB 2IO2B 3PSEB 4G11A 2KVRA 5C1ZA 1P98A 1BT0A 4ZRIA 1YQBA 1WGYA 2FCMA 4TQ1A 1UD7A 2FCQA 2JZZA 3DVGX 4A20A 4FBJB 2KNBA 3VTWA 1YX5B 4K7UA 3VTVA 3PVLA 2MBEA 3M62B 1UH6A 4ANVA 4DDGD 2NR2A 3DBHI 2JRIB 3H6NA 2KD0A 3QC8B 1V5OA 4NQLB 5JZEB 4MGIE 3V61A 4GB9A 4I6PA 2O2VB 5E6NA 2ZVNA 1MG8A 2KDEB 4II3B 4ZRKA 2N9XA 4KIKA 2K8HA 4M8NA 3AXCA 4E71A 3H7PB 2DENB 4EUTA 2KDIA 4EEWA 3UGBB 2KTRB 5CHVC 1IP9A 1GNUA 2JZ3B 4JLCA 4BOZB 1TBEA 2JVCA 3SU8X 4B9KA 3QQ8B 2JUOA 1OTRB 3TBLD 4HCPB 4AOFA 3CF6E 2MSED 1NDDA 1WE7A 2KQ7A 1V9JA 2KJ6A 4PS8A 4WQOB 1V49A 4DK5A 3UIOB 1EF1A 2K25A 4IWQA 4AP4C 3B0AA 4NAWA 2KX3A 2ZVOA 2BYEA 3IHPC 2CHZA 4MSQB 1KJTA 4JL9A 1H4RA 2EMSA 1WXMA 4GU2A 4LDTB 1WR6E 3GZNI 3QK0A 4HXDA 5D6JB 2J0JA 2KKCA 5DPTA 1Q5WB 2K6QA 2N7DA 3V62A 2FAZA 1E8YA 3Q3FA 2KWCA 4DWFA 5AZHA 3JYUA 2WX1A 1LM8B 3EHVA 3N32A 3B08A 4GOCA 2LRUA 2N9PC 4A3PA 1U4AA 3TJPA 2JT4B 3W1SA 4LCDE 5CTRC 1EUVB 2LZ6A 4EZLA 2FIDA 1YD8U 5IAAC 2LRWA 4ASWC 2GBKA 1RAXA 1NI2A 1HE8A 2MQJA 4LJOB 3L10B 5J17A 3MJWA 4XZ4A 2BWES 2JRHA 2MBBB 1WM3A 3R3MA 1WM2A 2ZCCA 2ZJDA 2HTHA 2BKFA 1C3TA 2Z0EB 4BVUC 2CHXA 5CX3A 1E8XA 4DHZB 4EOYA 4DHJB 4AJWA 2PE9A 3K9OB 3IFWB 4ANWA 2KQSA 3APFA 2KXJA 3ZTCA 1WE6A 2D11A 1M94A 2WDTB 3NOBA 3CSTA 3DBLI 4HCNB 1WZ3A 1XT9B 2WWZA 4P7IA 4BFRA 2Y5BB 1H8CA 1E90A 2L05A 4FADA 4EZKA 3VDZA 2AEHA 1WGGA 2MX2A 4CYEA 2W9NA 3PHXB 2M17A 1EF5A 4G3XB 5LLIA 2LD9A 4E3CA 1NBFC 2A5UA 2MBOA 2KJRA 2ZNVC 2XEWA 3L16A 1WJ4A 2L00B 2O6VD 5D94A 3UINB 5IA7A 1VD2A 2KFJA 2ZNVB 3PRMB 1UBQA 4HVBA 2LVOA 4HDOA 3A4RA 1F9JA 2NVUI 3S2AA 3W1YA 4W9KA 1L7YA 2VRRB 3I3TB 2DZKA 4BKSA 2N4FA 4JGHB 4RM9A 2M8SA 3ZDMC 2NPTB 3KH0A 3PRPB 4M0WB 3RULA 2HD5B 1KOTA 2YLMA 1P9DU 4KZCA 2KK8A 4WJPA 5E6OA 4W9IA 5BO4B 3DVNV 5AZFA 4PYZA 2HE7A 1KM7A 2N1VA 3UQAA 4EFOA 2REXA 3UQBA 2L3ZA 2DZIA 4KV2A 4W9FA 1V5TA 2KWVB 2Z0DB 3VUYA 2GMIC 4GDLA 3X0WA 1EO6A 3RT3B 2RD0A 2DZJA 4MGKE 2J0MA 2UWQA 3CSFA 4TQ0A 1Q0WB 2LXAA 4FN2A 2FCSA 2GOWA 2DYMA 2JF5A 2DZMA 2O6VA 4F1SA 2ZPNA 3KYDD 4RM8A 3JSVA 3L54A 3SHQA 2OOBB 3AI5A 3EC8A 3ML8A 4BBNC 4WJNA 1WX8A 2GBNA 3ZKJC 1Q1OA 3RYTA 2M0XA 2KLCA 1GC6A 4ANXA 2FIFA 1E8WA 2FCNA 1K8RB 4B6WA 3KUZA 3M95A 1WXSA 4MJSA 1X1MA 2LASA 3RZWC 5FR6A 3MHSD 2AL3A 3GOEA 1WFYA 2MA9B 4W9LA 4ZDVA 2KFKB 3Q3JA 4GSWA 3ZRFA 2DX5B 1RRBA 3V60A 3A9JA 4IUMB 1GC7A 4K7SA 2N7EA 3SDLC 2R2OA 4AWJA 2I1JA 2V4LA 3PRZA 2XK5A 4WJQA 2QHOA 4WWPA 4IG7B 3SD5A 3OAWA 3ZRCA 4MEMA 4MH0E 2ZCBA 2KWUB 4FULA 3EECA 3QCAA 1GUAB 3A1QA 3AU4A 1SIFA 2BF8B 2D2QA 2JXXA 4W9HA 5C23A 1JRUA 2C5LC 3ONSA 2B3AA 4W9JA 2GBRA 3PTFC 1E7VA 1SE9A 3P2BA 4GGQA 3ALBA 4AJYB 5JHAA 3QJZA 4GDKB 1TTNA 1XQQA 3H7SA 4N9F4 3VFKA 2DHZA 3ZW3A 2IYDB 2KN5A 4NJ6A 3ZDTA 4IWPA 4GDLB 3APDA 3U7DA 2PPHA 3V6CB 2PEAA 3BY4B 5L95C 4I6NB 3RUIB 1R4NI 1FXTB 3RD2A 2L76A 4IW0A 3AU5A 2DAFA 3VTUA 4F7ZA 2IO0B 4A3OA 3K9PB 4HK2A 2MRPA 1E7UA 2N1WA 4BKSD 2PJHA 1ISNA 4HLEA 2NBVB 3A33B 2O6VB 4BBNF 3BINA 1J0GA 4JIOU 3KUDB 4JQWC 3QARA 2KHWB 4TKNA 4GMVA 2MP2A 4W9GA 2J7QB 3JVZX 2K39A 3QA8A 4MELA 3LDZE 4KDIC 4IM0A 2KTFA 2JY6A 3AULA 4K7WA 1WGRA 4BOSC 4G50A 4KIKB 4MJSB 2OJRA 1A5RA 3TL5A 1V81A 1WH3A 2GBJA 2KX0A 3NHEB 4X57B 1IPGA 5LXHA 1G6JA 3PZDA 3RZFA 1Z2MA 4NPNA 1UBIA 3PHWB 3VVWB 3CMMB 1UZXB 3A9KA 1OGWA 4NJ7A 3PS6A 1UGMA 1J19A 2RGFA 3ML9A 4FA6A 2CHWA 3NS8A 2XK5B 4J6IA 3WIMA 4ZYNA 3PT2B 3M63B 2L8JA 3KUCB 1V80A 2MWSB 1L2NA 2K1FA 4PYUA 3HM3A 2DAJA 3A1QB 3RCZA 4TUUA 4NAWB 4BKTA 1T0YA 2O2VA 4DHZE 3VH4B 2L0FA 3VXWA 3ZNZB 3QHTA 3DOWA 1WX7A 1WJNA 3U8ZA 3VAWA 3WA0A 4ANUA 2V3SA 3DBSA 2Z59B 3ECIA 3H7PA 4URKA 2K8BA 2IO1B 3PV1A 2BYFA 2KO3A 2LUEA 1E8ZA 2I1KA 3ZUNA 4EKUA 5D2MB 2KTRA 1R4MI 3HIZA 3IBEA 4MSMB 2LWPA 5KHQA 2M1MA 3APCA 2C7NB 3PLVA 3MTNB 4OVVA 3W1SC 4CHKA 5CHWA 3KW5B 1WGDA 2D07B 3ZTDA 2C7MB 1WZ0A 1Z5SB 2AWTA 2LJ5A 3TMPB 4NNJB 4MM3A 5J18A 1I35A 1UELA 4MDKE 2AYOB 2AL6A 3PPAA 5D7GA 3ZNID 4KSKC 2KANA 2ZPYA 1AARA 2RPQA 2KMAA 1YIWA 2KDFB 3ZVVA 2KC2A 2DYBA 3DBRI 2LVPA 2YVCA 2BPSA 4WAAA 1WGHA 4W9EA 3KYCD 3UIPB 1ZGUB 4DXAB 1WX9A 2L0TA
chains in the Genus database with same CATH superfamily
5J2RA 4C80A 2JPHA 4XX5A 3IT6B 1QKZA 1V1PB 3Q8CA 1F1HA 2B76B 3A9KB 5TSSA 2MBQA 2GLSA 3SR6A 4F8CB 4ICUA 5G55A 2KYWA 3WANA 2KZRA 2WYQA 1J8CA 1RWSA 3EUB2 2PVGC 1FPYA 2K6DB 1ZW7A 2PW9A 3PZ8A 2RSUA 5JH5C 3RNFC 5L83A 1T5XD 4XDDA 1OQYA 2MCNB 4GIVA 4PT5A 1KFYB 1XLQA 4N6EB 4TV3A 3T3NA 4ACFA 2IGHA 1T0RC 5BMHA 3L08A 2PIAA 1PQSA 2N7JA 1S1QB 3JW0X 5HI1A 4YTMB 2MLBA 2FE8A 3ETRA 3ZJTA 1FNWA 3W2DA 5IO9A 2K8CA 2W3SA 2C60A 3E9SA 2G4DB 4GXBA 4N59A 3JSVB 3QX1A 1N5WA 2DYOA 3V05A 4M02A 3U30A 2RDBC 5E6PA 1YX6B 2LI5A 3ZO5B 2E3TA 2ON8A 3W9CB 2JU6X 3A9JB 3N1YC 3DDCB 1WXAA 3VUXA 3WAMA 3OG5A 1M4VA 4XC2A 2W54A 4KKIA 5DPSA 2C7HA 3ZQ4A 1D3ZA 4US8A 3Q3MC 2IJ0A 4FJYA 4XGAB 1N63A 1MVKA 1UWXA 3AMZA 2KMCA 4B0MA 4IKGA 4YXDB 4IWOA 4FJZA 3AECB 3NY5A 1PGBA 2WXNA 1TZOA 3L0WB 3HM6X 1E5WA 3QIJA 3QWZB 1YQ3B 1QOGA 2EKEC 1PYWD 3N3KB 2CR5A 3UF8A 3DWGC 2PMVA 2DLBA 2BKRB 4RMAA 1V86A 4HWIB 4GDKA 2NS5A 2DBYA 2KVRA 1IGCA 1YQBA 2FCMA 1T6BX 2WDQB 1YX5B 5AUIA 4K7UA 1F52A 3M62B 1VDVA 4NQLB 1D4BA 2FBWB 4MGIE 5BYRA 4I6PA 2KDEB 1MJDA 2KAJA 4KIKA 4E71A 3AE6B 2WP9B 1MG4A 2NTTA 2JVCA 1N61A 3BIID 3SU8X 3TBLD 4HCPB 2MSED 1NDDA 2KQ7A 1V9JA 2KJ6A 4KGTA 1QOFA 1GB4A 4DK5A 4MM3B 2K25A 1GB1A 4AP4C 3B0AA 4C56C 1NVID 1I4QA 2KX3A 3RFZB 1I4PA 2ZVOA 3IHPC 4MSQB 1HTQA 1KJTA 1WXMA 4LDTB 1K50A 1NI3A 3QK0A 3AV8A 1MI0A 5HFYA 1E8YA 3Q3FA 2QC8A 2BT6A 3EHVA 3B08A 3SFEB 2JSVX 5CTRC 1EUVB 3AE5B 1C76A 4ASWC 1FRDA 1NI2A 4LJOB 2MQJA 4MACA 2MBBB 2BKFA 4AJWA 2PE9A 3K9OB 3IFWB 2KQSA 4OZAA 1M94A 4BFRA 2WWZA 4IDIA 5EE1A 4FADA 3AEGB 4ZRPA 2L1AA 3PHXB 2LD9A 4E3CA 2A5UA 4HKZE 2L00B 5IA7A 2KFJA 2ZNVB 3PRMB 4HDOA 3S2AA 3W1YA 1L7YA 2VRRB 2IGGA 2RMMA 4BKSA 2M8SA 3ZDMC 2NPTB 3KH0A 4M0WB 4KZCA 4JWSC 2V3NA 3LYYA 3P1MA 1KM7A 2N1VA 1K51A 4Q2JA 2L3ZA 4A8XC 1SBBB 4KX6B 4KV2A 3E56A 2WDVB 4W9FA 2BB5A 2GMIC 4GDLA 3MFGA 4DXGA 2K9XA 4XWWA 3NZ3A 2UWQA 3CSFA 2O6VA 3JSVA 2OOBB 1PGXA 3RYTA 4B6WA 2WXKA 1D6EC 3U52E 3TEWA 1X1MA 2LASA 4N58A 2KWDA 1EWCA 1YNTE 1WFYA 2LHEA 2MA9B 2KFKB 4XE0A 4L23A 3A9JA 3AEBB 1SXTA 3SDLC 3Q14C 2MJDA 2V4LA 3PRZA 2JWUA 4HEA1 2QHOA 1TIFA 4IG7B 3SD5A 3OAWA 2ZCBA 3I57A 3QCAA 3MHZA 2XN9C 5H92C 1JRUA 2C5LC 3ZJVA 4W9JA 2QJLA 1SE9A 4C4VB 3ALBA 1TTNA 1XQQA 3H7SA 4ITKA 3ZW3A 2KN5A 2JX5A 1UUPA 5IN7A 3APDA 2PEAA 3CWIA 1OQRA 1FD6A 2FUG1 4A3OA 4BKSD 2MRPA 2PJHA 5LNK1 1B1ZA 2H88B 4BBNF 3BINA 1J0GA 2BBCA 3QARA 2HTME 4TKNA 2J7QB 2K39A 4MELA 2J42A 4K7WA 2CU3A 3BWUD 1V81A 1WH3A 5LXHA 1G6JA 1Z2MA 1UBIA 2BW2A 5EE3A 3VVWB 3CMMB 1OGWA 1J19A 4FA6A 3NS8A 2GRIA 4J6IA 1AWDA 2OJWA 4ZYNA 1V80A 5C2TB 2LEKA 2K1FA 1TY0A 2DAJA 3A1QB 3RCZA 3Q8EA 1NYQA 2BS4B 1TS4A 1WJNA 2LFIA 2ONQA 1YQ4B 1E8ZA 2I1KA 4EKUA 4P6VF 1R4MI 3IBEA 4MSMB 2KDMA 3APCA 4CHKA 3PLVA 4OVVA 1FCLA 3DHIC 3KW5B 2LJ5A 1WZ0A 1Z5SB 2YEPB 4MM3A 2QILA 1AARA 2RPQA 3ZVVA 2KDFB 1I4XA 2DYBA 2LVPA 4W9EA 3DWMA 1MPEA 4C7ZA 1WMHA 3O65B 3BYYB 4GLSC 4WQMA 3IVFA 3M3JA 4DBGA 1OEYJ 4HPLB 4P16A 5MPOA 1NYRA 3LB8C 2CKHB 3Q3NC 2J0KA 1EM7A 1CK1A 1XCTL 1QQRA 2KT7A 3V6EB 1YN3A 3WCQA 2WXHA 2KJHB 3DVGY 2HJ8A 3N1XC 3NZUA 3MJ5A 3R66C 1L0YB 3WAOA 5KHOA 2JZPA 2ZW1A 3HK0A 3R7RA 4NAMA 2I38A 1TYGB 2D3GA 1VRAB 1VLBA 2YEPF 4WWNA 4KGSA 1CMXB 1D5XC 4XWTA 3O13A 2BYVE 3GE8C 2PE6B 1P3QU 1C79A 4D2KA 2PKOA 1GG3A 4HPMB 2NPTA 4M0WA 2EMTA 2IY1B 2G3QB 1VZ8A 3SEBA 4TMAB 4M00A 4MGZE 2LGDA 2KACA 2D10A 2A4ZA 1F2RC 3AE2B 2LGIA 3N30A 3RNEC 3PGEA 1WF9A 3NJTA 4K1RB 4IC7B 2V1YA 5G5GA 2XBBC 3VUWA 4LDTD 3ENEA 1DOYA 3VQIA 2D3CA 1XD3B 5AZGA 1PFDA 1PDXA 4FHKA 4EZJA 2KFKA 3RI7C 1FO4A 4JX1C 1WYGA 1ZPSA 1FCCC 3TEYA 3P4RB 1FIQA 2MBHA 1ZOYB 2NCNA 3C0RB 2KLGA 5C3JB 3R2TA 3TCAA 4HROA 4WWOA 4K3BA 1WI0A 3R7QA 3CIRB 5G2NA 1WXVA 3H9DA 2G4SA 4PS7A 3GP7A 1V2YA 5C1ZA 4LNOA 4ZRIA 2D5GA 1WGYA 1UD7A 3DVGX 4WWMA 4YSZB 1J7AA 1LGRA 1D5ZC 1UH6A 4DDGD 2NR2A 1V8CA 3DBHI 2KD0A 5JZEB 2O2VB 5E6NA 1QT9A 4II3B 2N9XA 3N20C 3H7PB 1GOZA 2DENB 4EEWA 4EUTA 1BUIC 2UU7A 1TBEA 1PGAA 3RN9C 1JWMD 1OTRB 4AOFA 1WE7A 1ZDXA 1UF0A 1V49A 3UIOB 4FXCA 1J7CA 4XDCA 1EF1A 4IWQA 1KTKA 3Q8AA 2BYEA 3OWEB 2CHZA 4JL9A 2EMSA 3TSSA 1WR6E 4LK0M 2J0JA 5DPTA 2K6QA 1EU4A 2N9LA 3JYUA 1LM8B 2LRUA 2HJ1A 3N1ZC 4A3PA 2DWQA 3W1SA 4LCDE 1ZXHA 2OEDA 5EE0A 1RAXA 3URYA 3MJWA 2BYTA 2INPE 2ZCCA 1C3TA 3NVVA 4RNAA 1QLBB 2KXJA 3ZTCA 2RPVA 4A9AA 2WDTB 1H8CA 2CJNA 1E90A 2L05A 4EZKA 2WHIA 2W9NA 1EF5A 1C4PA 2LMCA 2MBOA 1WJ4A 3UINB 1UBQA 1YJJA 4WAFA 4HVBA 2LVOA 4NJCA 2N4FA 4JGHB 1I7HA 1KOTA 2JYEA 2AX5A 5BO4B 4W9IA 3DVNV 2HE7A 2BTEA 1BMLC 3RT3B 4A6QA 3DHGC 1TKGA 3P4SB 4TQ0A 1Q0WB 2LXAA 1CJEA 5T8IA 1ENFA 1DOXA 3HVDA 2JF5A 1Q10A 4RM8A 3AI5A 3EC8A 3ML8A 1WX8A 3ZJUA 2M0XA 2FIFA 3J9CA 2FCNA 1A70A 3KUZA 1WXSA 4MJSA 3RZWC 3MHSD 1L6VA 2W82A 3EFCA 4GSWA 2MH7A 3V60A 4IUMB 2DNFA 1GC7A 4S0RA 2GI9A 4K7SA 1VR9A 4AWJA 3C8YA 3ZRCA 4MH0E 2KWUB 2G9HD 3EECA 3AU4A 3TEZA 2D2QA 1JWSD 2B3AA 4LNKA 2X8XX 1KF6B 4C7YA 2QDFA 5JHAA 3QJZA 1LO5D 3ZDTA 3I9V1 1CZPA 1UWMA 3V6CB 1L0VB 4I6NB 3IT4B 2KN4A 1N6ZA 3Q6BA 2DAFA 2IO0B 4HK2A 1E7UA 2J4XA 2N1WA 4HLEA 3A33B 4JQWC 3KUDB 1HA5A 2M19A 4IM0A 1TKEA 3AULA 3BVZA 1WGRA 4BOSC 1ET9A 1A5RA 3TL5A 4X57B 2VH2A 1V1PA 2V4IB 1QOBA 4CQNA 1UZXB 3A9KA 4NJ7A 2RGFA 1R4MB 1FXAA 4KKJA 2XK5B 1I4RA 4O1NA 1T3QA 1VZ7A 4NAWB 2ZW0A 1T0YA 2O2VA 1SB3C 3QHTA 3WA0A 1XXGA 3ECIA 3H7PA 1GPXA 3PV1A 2BYFA 3ZUNA 3U4EG 2BS2B 2LWPA 5KHQA 2M1MA 1HQRD 4RGMA 5CHWA 4EE2A 2AWTA 2D3AA 1CQVA 2AYOB 3AE4B 4KSKC 1L4ZB 2PLPA 3U2SC 1WGHA 4DXAB 4HKQA 2L32A 3N9YC 3WAPA 2XNAC 3ZNGC 2WXPA 3P42A 1QZEA 3HHMA 1SEBD 1UNSA 2G45B 2IY0B 3Q69A 2MJEA 3VRAB 4YTNB 4BKGA 4ZHPA 2M0AA 1FEHA 2WU2B 3DVNU 4JE3B 2LGXA 4KVGB 4YL8A 2UYZB 1WJUA 1C9FA 4RGTA 2BB6A 1VCBA 1ZKHA 1WR1A 4B95A 2LHDA 4LNFA 2MJ3A 1VJKA 5HKHA 1ESFA 3AEEB 4YWGG 3I63C 3OJ3A 4FJVB 5TR5A 2WX0A 3EA6A 1N5XA 1RLFA 3H8HA 3AE8B 4E74A 2WGSA 2Q5WD 2N9EB 5CHFA 2BGFA 4MGYE 2QMTA 4HJKA 1L6UA 4J3OD 3AE7B 2MW5A 2KC1A 1IYFA 3NVWA 4ICVA 3T3OA 1P0RA 1PUTA 3IG3A 3DQVA 2ZEQA 3FILB 1UGJA 4WJOA 4S17A 4W9CA 2W3RA 3GS2A 4OVUA 5DPWA 4P1CC 3NRZA 3KLSX 4CO7A 3NG0A 4ZRJA 3OJ4B 1RFAA 1SGHA 1GAQB 3VH3B 1WIAA 1ZDVA 2FNJB 3R2IA 1F2RI 3LJ3A 3T8MA 1MFWA 1YJ1A 1HZ6A 3KVFB 2Y5CA 4FHJA 3L17A 1SE4A 5EDSA 5E6JA 1JW9D 1KLVA 1MHHE 3KQ4A 2WXOA 1WJ6A 1LQBA 2GBMA 2CS4A 4AUQC 1KRHA 4R3DA 5I4DA 2LGYA 2MP2B 1GJZA 4MH8A 3RPFC 1I42A 2NBUA 4KDLB 2WXJA 4G11A 4RH6A 2WDRB 1B9RA 3C19A 5IP4D 4TQ1A 3MP9A 4A20A 2JZZA 4IOIE 4FBJB 2KNBA 3TEXA 3VTWA 1WSPA 3VTVA 2V0GA 4ARIA 5IKCM 2MBEA 4ANVA 1F77A 3H6NA 3QC8B 3RNBC 3RNAC 3V61A 4GB9A 4ZRKA 1MG8A 2QCZA 4M8NA 3UGBB 4L2YA 4USAA 2WU5B 3B2FA 2KTRB 2JXTA 1IP9A 1GNUA 3AN1A 4PK1A 4JLCA 4BOZB 4B9KA 3QQ8B 2JUOA 4A55A 2VH1A 3CF6E 1OFFA 4WQOB 2IPKD 4C00A 4NAWA 3Q2AC 4OHJA 3NVYA 1H4RA 4JWUC 3GZNI 3Q8FA 5BYSA 2KKCA 3RNCC 2N7DA 2AQ1B 1E0ZA 3GE3C 3V62A 1ACCA 2JQRB 2WXQA 1WXQA 2KWCA 4DWFA 4GOCA 1U4AA 3TJPA 3VR8B 1JRPA 3Q8BA 2FIDA 1ZE3D 3AEFB 1HE8A 3SFDB 3L10B 1XLOA 5J17A 2JRHA 3R3MA 1WM3A 2ZJDA 1IUEA 5EE9A 4BVUC 2CHXA 5CX3A 1E8XA 1I4HA 4DHJB 4YSYB 4ANWA 2NMQA 3APFA 1WE6A 2D11A 3DBLI 1WZ3A 1XT9B 4P7IA 4ZYSA 1E6EB 1SE2A 2AEHA 1WGGA 2M17A 4G3XB 5LLIA 2ZNVC 2CJOA 3L16A 4HRSA 4MT5A 1F9JA 1IGDA 3I3TB 3MC9A 3BK1A 2Y5PA 2DZKA 3MC0B 4RM9A 3RULA 3PRPB 2HD5B 2YLMA 5E6OA 5AUKA 2KK8A 2INNE 2PVOD 5AZFA 3UQBA 4C4VA 3AB5A 2DZIA 2KWVB 2Z0DB 3VUYA 1T0SC 1I4GA 2R61A 2WNMA 2RD0A 2DZJA 4MGKE 2J0MA 1E7PB 2RDHA 4AS1A 2GOWA 4HPPA 1ET6A 2DZMA 4LLGM 1L5PA 3KYDD 3L54A 3SHQA 3ABVB 4BBNC 3BVGA 4BAXA 2GBNA 1Q1OA 2E6XA 1GC6A 1K8RB 1DGJA 3L4PA 3M95A 5FR6A 3FAHA 2AL3A 3IAS1 3FILA 3BYTB 3Q3JA 2IGDA 4ZOHC 5BYQA 1YN4A 1YN5A 2N7EA 1ROEA 2R2OA 4WJQA 1XLNA 1HXYD 4MEMA 4FULA 5HG2A 3A1QA 1SIFA 2BF8B 2JXXA 4W9HA 3DHHC 2GBRA 1TS5A 1E7VA 3P2BA 4QAYA 1HTOA 1SIJA 2DHZA 2IYDB 2J52A 4RF0A 4IWPA 3W5UB 4GDLB 4DXFA 3U7DA 1Y56A 2PPHA 3BY4B 3RUIB 1R4NI 1FXTB 3P4PB 3RD2A 3Q3OC 4IW0A 3AU5A 2GB1A 4F7ZA 5HHDG 3RNGC 1ISNA 3BVMA 2NBVB 1K53A 2O6VB 1KLUD 1WRIA 4OZBA 2KHWB 2MP2A 3QA8A 4JPSA 1JWAD 3LDZE 1TY2A 1D5MC 2JY6A 4G50A 2TSSA 2OJRA 2L83A 2IDYA 2INDC 1TJEA 3RZFA 2WXFA 4NPNA 3PHWB 3PS6A 3NS1A 3WIMA 1JCKB 3PT2B 2L8JA 3KUCB 2WXMA 4KGRA 4PYUA 4TUUA 2M56B 2Z8LA 5BMGA 3VXWA 4ANUA 1WX7A 3U8ZA 3DBSA 1JMLA 4URKA 2K8BA 3VRBB 1KH0A 2KO3A 2LUEA 4K3CA 4RGOS 5D2MB 2KTRA 3HIZA 3AH7A 3W1SC 2C7NB 5D3IB 4L1BA 1WGDA 3ZGZA 3TMPB 4NNJB 2L52A 4MDKE 2AL6A 3PPAA 1VZ6A 2WQYB 3FKYA 1TS3A 1IBXB 2KMAA 1YIWA 4A90A 1T0QC 2KC2A 3DBRI 2YVCA 4OW0A 1L4DB 3BZDB 3UIPB 1ZGUB 2L0TA 1OEYA 4WURA 1TT5B 4FLHA 2WXLA 2BS3B 4GN1A 4IM3A 2NBWB 2LXCA 4M8MA 5JHBA 2BWFA 2D3BA 3I5JC 3B9JA 1TGZB 2C9WB 3R8BA 3QAQA 2LVQA 2M4NA 4HDQA 1AN8A 1HZ5A 1SJHD 3GB1A 2IO3B 3DPDA 1TZ1A 2EELA 1XF5L 1C1YB 1LXDA 3NZSA 4I6LB 2KDBA 3H1UA 3VR9B 4TSSA 2I2YA 3W5VB 1WY8A 1LFDA 2R2QA 3X23A 1JWBD 4KZ0A 1YOVB 2RR9A 1WRDB 3KWVA 3A4SC 3BK2A 1C4AA 1WYWB 1C78A 3ZLZA 1E10A 1OQQA 3P63A 2KMMA 1SJED 3TIXA 1FM0D 2JYTA 2ZZPB 3KWLA 1TS2A 2QEJC 4US9A 1WMHB 3P4QB 3EFUA 2V3PA 2KOXA 1JALA 4PS3A 1L0XB 5AEKB 5FKAC 1P1AA 5GMVA 3OLMD 1V6EA 1Y8RC 4II2B 3ZIMA 3ZNHB 4LJPB 3AE3B 3HUIA 3DCGA 2IZVB 1S3SG 2N9KA 2EKIA 2VZKB 3T9LA 2SAKA 3VHTC 1N62A 4NY0A 1NEKB 5DCNA 2JWZA 3B1LX 3D32A 1SE3A 4RFBA 1V97A 2L7RA 4K81A 1YMHE 4KSLC 2CU1A 4G0NB 1BXTA 3PLUA 4P1BC 2NTSA 2J53A 4IM2A 4DHJD 2Y3AA 3L13A 3PREA 4LNIA 5FR3A 2ASQA 5DPRA 3AE9B 2WLBA 2IBIB 3WALA 4DDID 5LXIB 2WXRA 2SEBD 4NQKE 4W9DA 2FUHB 2IO2B 3PSEB 4NZLB 1EWYC 1P98A 1BT0A 2WS3B 2FCQA 2ICIA 3PVLA 4ZHOA 3AE1B 4XYCA 2JRIB 5BMIA 1V5OA 3HVZA 2ZVNA 5IOIA 2K0PA 1XCQL 2K8HA 2LUMA 3AXCA 2KDIA 1FMAD 4AQ7A 4LNNA 3AM9A 3GZNB 5CHVC 1JQ4A 2JZ3B 4LTUA 3UI3A 4PS8A 2BVCA 2K3UA 1QILA 2HDEA 1FXIA 2LJIA 2WXGA 5GXGB 4RGNA 4GU2A 4YTPB 4HXDA 5D6JB 3U7ZA 4YT0B 1Q5WB 2ACZB 2FAZA 2RDGA 5AZHA 2WX1A 3N32A 2N9PC 3RMKC 2JT4B 3EGRA 1ZP0B 2LZ6A 4EZLA 1YD8U 3DBLB 5IAAC 2LRWA 2GBKA 3MC8A 1IBXA 1QOAA 4XZ4A 2BWES 4B0EA 1WM2A 1SF0A 2HTHA 2AQ3B 1K52A 2Z0EB 1HEZE 4DHZB 1RM6C 4EOYA 2OHFA 2V9HA 4M01A 4H2AA 3V3XA 1J7BA 3NOBA 3CSTA 4HCNB 2Y5BB 2K22A 3VDZA 2MX2A 4CYEA 1JROA 1KLGD 1NBFC 3TUOA 2KJRA 2XEWA 4WIPA 5H8YE 2O6VD 5D94A 1VD2A 4ZRQA 3A4RA 2NVUI 4W9KA 1STEA 1WWTA 1FNUA 3LXFA 1ZXIA 2WXIA 3ZYYX 1P9DU 4WJPA 1XLPA 4PYZA 3DBHB 3UQAA 4EFOA 2MEKA 2REXA 1N60A 2INCC 1V5TA 2MHJA 1C77A 3X0WA 4ARCA 1EO6A 4REZA 1FFVA 2G1EA 5FK9C 2H89B 3IXSA 1FRRA 3NVZA 2KVZA 4FN2A 2FCSA 2DYMA 4F1SA 2ZPNA 1EU3A 4WJNA 3ZKJC 5G5HA 2PTLA 2KLCA 4ANXA 1E8WA 1QF6A 1ZUD2 1AYFA 3PO0A 1RYJA 3FC4A 2QSDA 3GOEA 4W9LA 4ZDVA 3ZRFA 2DX5B 1RRBA 4RCOA 2I1JA 2KQ4X 2XK5A 4WWPA 1P7EA 1RFKA 5JXVA 1R4NB 2AQ2B 1GUAB 4DQOC 4UDUC 1DYQA 1R7SA 5C23A 3ONSA 3IAM1 4WH4A 3PTFC 4GGQA 4HJGE 4AJYB 4GDKB 4N9F4 3VFKA 4NJ6A 3B2GA 1XEEA 4YSXB 5L95C 1DOIA 2BQQA 2L76A 3VTUA 3K9PB 1FNVA 1NENB 1F0ZA 4JIOU 1AW7A 4GMVA 4W9GA 3JVZX 4KDIC 2KTFA 1SSNA 4KIKB 4MJSB 2W55A 2KX0A 2GBJA 3NHEB 1IPGA 3PZDA 2X38A 1V1OA 4RF1A 1UGMA 4OZCA 3ML9A 2CHWA 2QIEB 3M63B 1E9MA 2N0SB 2MWSB 1L2NA 1P7FA 3HM3A 4BKTA 4DHZE 3VH4B 2L0FA 3ZNZB 3VAWA 3DOWA 2V3SA 1C4CA 2Z59B 3DBRB 2IO1B 1JWUD 1TKYA 3PZ7A 1MHXA 3HRDD 3MTNB 5D3DA 1XO3A 4BZAA 2D07B 3ZTDA 1FFUA 2C7MB 5J18A 1I35A 1UELA 3ZXVA 3NUHB 5D7GA 3ZNID 3ZXRA 2KANA 2ZPYA 2K5PA 2VZKD 1YJIA 2BPSA 2LGSA 4WAAA 1WGKA 3AEDB 3KYCD 3AEAB 1WX9A 4OVZA
chains in the Genus database with same CATH topology
5J2RA 1OEYA 3WAPA 4FLHA 2JPHA 1WMHA 3O65B 4XX5A 3ZNGC 4IM3A 4GN1A 1QZEA 2NBWB 3HHMA 3IVFA 2LXCA 4M8MA 3M3JA 5JHBA 2G45B 2IY0B 2BWFA 4DBGA 4BKGA 1OEYJ 4HPLB 3A9KB 1TGZB 3DVNU 2C9WB 2LGXA 3QAQA 2MBQA 4KVGB 2CKHB 4YL8A 2J0KA 2LVQA 2M4NA 2UYZB 4HDQA 4F8CB 1WJUA 4ICUA 5G55A 3WANA 2KZRA 2WYQA 1J8CA 1VCBA 2IO3B 3V6EB 1ZKHA 1TZ1A 3DPDA 1WR1A 2KJHB 3DVGY 2HJ8A 4B95A 2K6DB 1C1YB 1ZW7A 3NZUA 2RSUA 3R66C 1LXDA 3NZSA 5JH5C 4I6LB 5HKHA 2KDBA 3H1UA 5L83A 3WAOA 5KHOA 1OQYA 2MCNB 3HK0A 1WY8A 4GIVA 3R7RA 3OJ3A 4FJVB 1LFDA 5TR5A 2WX0A 2D3GA 4TV3A 2R2QA 1RLFA 3X23A 4WWNA 4KZ0A 4E74A 3L08A 2N9EB 1PQSA 2RR9A 1S1QB 1WRDB 3JW0X 3A4SC 2MLBA 1CMXB 5CHFA 2BGFA 4MGYE 1WYWB 4HJKA 3ZLZA 2BYVE 2K8CA 2C60A 2PE6B 1P3QU 2G4DB 4GXBA 2MW5A 2KC1A 3TIXA 1IYFA 4HPMB 1GG3A 4ICVA 2NPTA 2ZZPB 2EMTA 3JSVB 3QX1A 2IY1B 1P0RA 2G3QB 2DYOA 1WMHB 4MGZE 3U30A 2LGDA 3IG3A 5E6PA 1YX6B 2LI5A 3EFUA 2D10A 3DQVA 3ZO5B 2KOXA 2ZEQA 2A4ZA 4WJOA 4PS3A 4W9CA 4OVUA 3N30A 3A9JB 5AEKB 5DPWA 3DDCB 3PGEA 4CO7A 1P1AA 5GMVA 1WF9A 3OLMD 4K1RB 4ZRJA 4IC7B 2V1YA 1V6EA 1WXAA 1Y8RC 3OJ4B 4II2B 3VUXA 3WAMA 2XBBC 4XC2A 3ZIMA 3VUWA 3ZNHB 4LJPB 1RFAA 2C7HA 1SGHA 4LDTD 5DPSA 3ENEA 1D3ZA 3DCGA 3VQIA 2IZVB 4FJYA 3VH3B 1S3SG 1WIAA 1XD3B 5AZGA 3T9LA 3VHTC 2FNJB 4NY0A 5DCNA 4FHKA 2KMCA 3LJ3A 4EZJA 2JWZA 2KFKA 3T8MA 3B1LX 3D32A 4FJZA 4IWOA 1YJ1A 3NY5A 2L7RA 3KVFB 4FHJA 4K81A 4KSLC 3L17A 2CU1A 2MBHA 5EDSA 3L0WB 2NCNA 3C0RB 3HM6X 1E5WA 4G0NB 1KLVA 3PLUA 2KLGA 3QIJA 3QWZB 3TCAA 4IM2A 4DHJD 1WJ6A 1LQBA 3L13A 2GBMA 2CS4A 3PREA 4WWOA 4AUQC 2EKEC 1WI0A 3R7QA 2ASQA 2LGYA 5DPRA 3N3KB 2CR5A 5G2NA 3UF8A 1WXVA 2MP2B 1GJZA 2IBIB 2BKRB 3H9DA 2G4SA 3WALA 4RMAA 4DDID 1V86A 4HWIB 5LXIB 1I42A 4GDKA 4PS7A 1V2YA 2NBUA 2NS5A 4NQKE 4W9DA 4KDLB 2FUHB 2IO2B 3PSEB 4G11A 2KVRA 5C1ZA 1P98A 1BT0A 4ZRIA 1YQBA 1WGYA 2FCMA 4TQ1A 1UD7A 2FCQA 2JZZA 3DVGX 4A20A 4FBJB 2KNBA 3VTWA 1YX5B 4K7UA 3VTVA 3PVLA 2MBEA 3M62B 1UH6A 4ANVA 4DDGD 2NR2A 3DBHI 2JRIB 3H6NA 2KD0A 3QC8B 1V5OA 4NQLB 5JZEB 4MGIE 3V61A 4GB9A 4I6PA 2O2VB 5E6NA 2ZVNA 1MG8A 2KDEB 4II3B 4ZRKA 2N9XA 4KIKA 2K8HA 4M8NA 3AXCA 4E71A 3H7PB 2DENB 4EUTA 2KDIA 4EEWA 3UGBB 2KTRB 5CHVC 1IP9A 1GNUA 2JZ3B 4JLCA 4BOZB 1TBEA 2JVCA 3SU8X 4B9KA 3QQ8B 2JUOA 1OTRB 3TBLD 4HCPB 4AOFA 3CF6E 2MSED 1NDDA 1WE7A 2KQ7A 1V9JA 2KJ6A 4PS8A 4WQOB 1V49A 4DK5A 3UIOB 1EF1A 2K25A 4IWQA 4AP4C 3B0AA 4NAWA 2KX3A 2ZVOA 2BYEA 3IHPC 2CHZA 4MSQB 1KJTA 4JL9A 1H4RA 2EMSA 1WXMA 4GU2A 4LDTB 1WR6E 3GZNI 3QK0A 4HXDA 5D6JB 2J0JA 2KKCA 5DPTA 1Q5WB 2K6QA 2N7DA 3V62A 2FAZA 1E8YA 3Q3FA 2KWCA 4DWFA 5AZHA 3JYUA 2WX1A 1LM8B 3EHVA 3N32A 3B08A 4GOCA 2LRUA 2N9PC 4A3PA 1U4AA 3TJPA 2JT4B 3W1SA 4LCDE 5CTRC 1EUVB 2LZ6A 4EZLA 2FIDA 1YD8U 5IAAC 2LRWA 4ASWC 2GBKA 1RAXA 1NI2A 1HE8A 2MQJA 4LJOB 3L10B 5J17A 3MJWA 4XZ4A 2BWES 2JRHA 2MBBB 1WM3A 3R3MA 1WM2A 2ZCCA 2ZJDA 2HTHA 2BKFA 1C3TA 2Z0EB 4BVUC 2CHXA 5CX3A 1E8XA 4DHZB 4EOYA 4DHJB 4AJWA 2PE9A 3K9OB 3IFWB 4ANWA 2KQSA 3APFA 2KXJA 3ZTCA 1WE6A 2D11A 1M94A 2WDTB 3NOBA 3CSTA 3DBLI 4HCNB 1WZ3A 1XT9B 2WWZA 4P7IA 4BFRA 2Y5BB 1H8CA 1E90A 2L05A 4FADA 4EZKA 3VDZA 2AEHA 1WGGA 2MX2A 4CYEA 2W9NA 3PHXB 2M17A 1EF5A 4G3XB 5LLIA 2LD9A 4E3CA 1NBFC 2A5UA 2MBOA 2KJRA 2ZNVC 2XEWA 3L16A 1WJ4A 2L00B 2O6VD 5D94A 3UINB 5IA7A 1VD2A 2KFJA 2ZNVB 3PRMB 1UBQA 4HVBA 2LVOA 4HDOA 3A4RA 1F9JA 2NVUI 3S2AA 3W1YA 4W9KA 1L7YA 2VRRB 3I3TB 2DZKA 4BKSA 2N4FA 4JGHB 4RM9A 2M8SA 3ZDMC 2NPTB 3KH0A 3PRPB 4M0WB 3RULA 2HD5B 1KOTA 2YLMA 1P9DU 4KZCA 2KK8A 4WJPA 5E6OA 4W9IA 5BO4B 3DVNV 5AZFA 4PYZA 2HE7A 1KM7A 2N1VA 3UQAA 4EFOA 2REXA 3UQBA 2L3ZA 2DZIA 4KV2A 4W9FA 1V5TA 2KWVB 2Z0DB 3VUYA 2GMIC 4GDLA 3X0WA 1EO6A 3RT3B 2RD0A 2DZJA 4MGKE 2J0MA 2UWQA 3CSFA 4TQ0A 1Q0WB 2LXAA 4FN2A 2FCSA 2GOWA 2DYMA 2JF5A 2DZMA 2O6VA 4F1SA 2ZPNA 3KYDD 4RM8A 3JSVA 3L54A 3SHQA 2OOBB 3AI5A 3EC8A 3ML8A 4BBNC 4WJNA 1WX8A 2GBNA 3ZKJC 1Q1OA 3RYTA 2M0XA 2KLCA 1GC6A 4ANXA 2FIFA 1E8WA 2FCNA 1K8RB 4B6WA 3KUZA 3M95A 1WXSA 4MJSA 1X1MA 2LASA 3RZWC 5FR6A 3MHSD 2AL3A 3GOEA 1WFYA 2MA9B 4W9LA 4ZDVA 2KFKB 3Q3JA 4GSWA 3ZRFA 2DX5B 1RRBA 3V60A 3A9JA 4IUMB 1GC7A 4K7SA 2N7EA 3SDLC 2R2OA 4AWJA 2I1JA 2V4LA 3PRZA 2XK5A 4WJQA 2QHOA 4WWPA 4IG7B 3SD5A 3OAWA 3ZRCA 4MEMA 4MH0E 2ZCBA 2KWUB 4FULA 3EECA 3QCAA 1GUAB 3A1QA 3AU4A 1SIFA 2BF8B 2D2QA 2JXXA 4W9HA 5C23A 1JRUA 2C5LC 3ONSA 2B3AA 4W9JA 2GBRA 3PTFC 1E7VA 1SE9A 3P2BA 4GGQA 3ALBA 4AJYB 5JHAA 3QJZA 4GDKB 1TTNA 1XQQA 3H7SA 4N9F4 3VFKA 2DHZA 3ZW3A 2IYDB 2KN5A 4NJ6A 3ZDTA 4IWPA 4GDLB 3APDA 3U7DA 2PPHA 3V6CB 2PEAA 3BY4B 5L95C 4I6NB 3RUIB 1R4NI 1FXTB 3RD2A 2L76A 4IW0A 3AU5A 2DAFA 3VTUA 4F7ZA 2IO0B 4A3OA 3K9PB 4HK2A 2MRPA 1E7UA 2N1WA 4BKSD 2PJHA 1ISNA 4HLEA 2NBVB 3A33B 2O6VB 4BBNF 3BINA 1J0GA 4JIOU 3KUDB 4JQWC 3QARA 2KHWB 4TKNA 4GMVA 2MP2A 4W9GA 2J7QB 3JVZX 2K39A 3QA8A 4MELA 3LDZE 4KDIC 4IM0A 2KTFA 2JY6A 3AULA 4K7WA 1WGRA 4BOSC 4G50A 4KIKB 4MJSB 2OJRA 1A5RA 3TL5A 1V81A 1WH3A 2GBJA 2KX0A 3NHEB 4X57B 1IPGA 5LXHA 1G6JA 3PZDA 3RZFA 1Z2MA 4NPNA 1UBIA 3PHWB 3VVWB 3CMMB 1UZXB 3A9KA 1OGWA 4NJ7A 3PS6A 1UGMA 1J19A 2RGFA 3ML9A 4FA6A 2CHWA 3NS8A 2XK5B 4J6IA 3WIMA 4ZYNA 3PT2B 3M63B 2L8JA 3KUCB 1V80A 2MWSB 1L2NA 2K1FA 4PYUA 3HM3A 2DAJA 3A1QB 3RCZA 4TUUA 4NAWB 4BKTA 1T0YA 2O2VA 4DHZE 3VH4B 2L0FA 3VXWA 3ZNZB 3QHTA 3DOWA 1WX7A 1WJNA 3U8ZA 3VAWA 3WA0A 4ANUA 2V3SA 3DBSA 2Z59B 3ECIA 3H7PA 4URKA 2K8BA 2IO1B 3PV1A 2BYFA 2KO3A 2LUEA 1E8ZA 2I1KA 3ZUNA 4EKUA 5D2MB 2KTRA 1R4MI 3HIZA 3IBEA 4MSMB 2LWPA 5KHQA 2M1MA 3APCA 2C7NB 3PLVA 3MTNB 4OVVA 3W1SC 4CHKA 5CHWA 3KW5B 1WGDA 2D07B 3ZTDA 2C7MB 1WZ0A 1Z5SB 2AWTA 2LJ5A 3TMPB 4NNJB 4MM3A 5J18A 1I35A 1UELA 4MDKE 2AYOB 2AL6A 3PPAA 5D7GA 3ZNID 4KSKC 2KANA 2ZPYA 1AARA 2RPQA 2KMAA 1YIWA 2KDFB 3ZVVA 2KC2A 2DYBA 3DBRI 2LVPA 2YVCA 2BPSA 4WAAA 1WGHA 4W9EA 3KYCD 3UIPB 1ZGUB 4DXAB 1WX9A 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2R A;  1OEY A;  3WAP A;  4FLH A;  2JPH A;  1WMH A;  3O65 B;  4XX5 A;  3ZNG C;  4IM3 A;  4GN1 A;  1QZE A;  2NBW B;  3HHM A;  3IVF A;  2LXC A;  4M8M A;  3M3J A;  5JHB A;  2G45 B;  2IY0 B;  2BWF A;  4DBG A;  4BKG A;  1OEY J;  4HPL B;  3A9K B;  1TGZ B;  3DVN U;  2C9W B;  2LGX A;  3QAQ A;  2MBQ A;  4KVG B;  2CKH B;  4YL8 A;  2J0K A;  2LVQ A;  2M4N A;  2UYZ B;  4HDQ A;  4F8C B;  1WJU A;  4ICU A;  5G55 A;  3WAN A;  2KZR A;  2WYQ A;  1J8C A;  1VCB A;  2IO3 B;  3V6E B;  1ZKH A;  1TZ1 A;  3DPD A;  1WR1 A;  2KJH B;  3DVG Y;  2HJ8 A;  4B95 A;  2K6D B;  1C1Y B;  1ZW7 A;  3NZU A;  2RSU A;  3R66 C;  1LXD A;  3NZS A;  5JH5 C;  4I6L B;  5HKH A;  2KDB A;  3H1U A;  5L83 A;  3WAO A;  5KHO A;  1OQY A;  2MCN B;  3HK0 A;  1WY8 A;  4GIV A;  3R7R A;  3OJ3 A;  4FJV B;  1LFD A;  5TR5 A;  2WX0 A;  2D3G A;  4TV3 A;  2R2Q A;  1RLF A;  3X23 A;  4WWN A;  4KZ0 A;  4E74 A;  3L08 A;  2N9E B;  1PQS A;  2RR9 A;  1S1Q B;  1WRD B;  3JW0 X;  3A4S C;  2MLB A;  1CMX B;  5CHF A;  2BGF A;  4MGY E;  1WYW B;  4HJK A;  3ZLZ A;  2BYV E;  2K8C A;  2C60 A;  2PE6 B;  1P3Q U;  2G4D B;  4GXB A;  2MW5 A;  2KC1 A;  3TIX A;  1IYF A;  4HPM B;  1GG3 A;  4ICV A;  2NPT A;  2ZZP B;  2EMT A;  3JSV B;  3QX1 A;  2IY1 B;  1P0R A;  2G3Q B;  2DYO A;  1WMH B;  4MGZ E;  3U30 A;  2LGD A;  3IG3 A;  5E6P A;  1YX6 B;  2LI5 A;  3EFU A;  2D10 A;  3DQV A;  3ZO5 B;  2KOX A;  2ZEQ A;  2A4Z A;  4WJO A;  4PS3 A;  4W9C A;  4OVU A;  3N30 A;  3A9J B;  5AEK B;  5DPW A;  3DDC B;  3PGE A;  4CO7 A;  1P1A A;  5GMV A;  1WF9 A;  3OLM D;  4K1R B;  4ZRJ A;  4IC7 B;  2V1Y A;  1V6E A;  1WXA A;  1Y8R C;  3OJ4 B;  4II2 B;  3VUX A;  3WAM A;  2XBB C;  4XC2 A;  3ZIM A;  3VUW A;  3ZNH B;  4LJP B;  1RFA A;  2C7H A;  1SGH A;  4LDT D;  5DPS A;  3ENE A;  1D3Z A;  3DCG A;  3VQI A;  2IZV B;  4FJY A;  3VH3 B;  1S3S G;  1WIA A;  1XD3 B;  5AZG A;  3T9L A;  3VHT C;  2FNJ B;  4NY0 A;  5DCN A;  4FHK A;  2KMC A;  3LJ3 A;  4EZJ A;  2JWZ A;  2KFK A;  3T8M A;  3B1L X;  3D32 A;  4FJZ A;  4IWO A;  1YJ1 A;  3NY5 A;  2L7R A;  3KVF B;  4FHJ A;  4K81 A;  4KSL C;  3L17 A;  2CU1 A;  2MBH A;  5EDS A;  3L0W B;  2NCN A;  3C0R B;  3HM6 X;  1E5W A;  4G0N B;  1KLV A;  3PLU A;  2KLG A;  3QIJ A;  3QWZ B;  3TCA A;  4IM2 A;  4DHJ D;  1WJ6 A;  1LQB A;  3L13 A;  2GBM A;  2CS4 A;  3PRE A;  4WWO A;  4AUQ C;  2EKE C;  1WI0 A;  3R7Q A;  2ASQ A;  2LGY A;  5DPR A;  3N3K B;  2CR5 A;  5G2N A;  3UF8 A;  1WXV A;  2MP2 B;  1GJZ A;  2IBI B;  2BKR B;  3H9D A;  2G4S A;  3WAL A;  4RMA A;  4DDI D;  1V86 A;  4HWI B;  5LXI B;  1I42 A;  4GDK A;  4PS7 A;  1V2Y A;  2NBU A;  2NS5 A;  4NQK E;  4W9D A;  4KDL B;  2FUH B;  2IO2 B;  3PSE B;  4G11 A;  2KVR A;  5C1Z A;  1P98 A;  1BT0 A;  4ZRI A;  1YQB A;  1WGY A;  2FCM A;  4TQ1 A;  1UD7 A;  2FCQ A;  2JZZ A;  3DVG X;  4A20 A;  4FBJ B;  2KNB A;  3VTW A;  1YX5 B;  4K7U A;  3VTV A;  3PVL A;  2MBE A;  3M62 B;  1UH6 A;  4ANV A;  4DDG D;  2NR2 A;  3DBH I;  2JRI B;  3H6N A;  2KD0 A;  3QC8 B;  1V5O A;  4NQL B;  5JZE B;  4MGI E;  3V61 A;  4GB9 A;  4I6P A;  2O2V B;  5E6N A;  2ZVN A;  1MG8 A;  2KDE B;  4II3 B;  4ZRK A;  2N9X A;  4KIK A;  2K8H A;  4M8N A;  3AXC A;  4E71 A;  3H7P B;  2DEN B;  4EUT A;  2KDI A;  4EEW A;  3UGB B;  2KTR B;  5CHV C;  1IP9 A;  1GNU A;  2JZ3 B;  4JLC A;  4BOZ B;  1TBE A;  2JVC A;  3SU8 X;  4B9K A;  3QQ8 B;  2JUO A;  1OTR B;  3TBL D;  4HCP B;  4AOF A;  3CF6 E;  2MSE D;  1NDD A;  1WE7 A;  2KQ7 A;  1V9J A;  2KJ6 A;  4PS8 A;  4WQO B;  1V49 A;  4DK5 A;  3UIO B;  1EF1 A;  2K25 A;  4IWQ A;  4AP4 C;  3B0A A;  4NAW A;  2KX3 A;  2ZVO A;  2BYE A;  3IHP C;  2CHZ A;  4MSQ B;  1KJT A;  4JL9 A;  1H4R A;  2EMS A;  1WXM A;  4GU2 A;  4LDT B;  1WR6 E;  3GZN I;  3QK0 A;  4HXD A;  5D6J B;  2J0J A;  2KKC A;  5DPT A;  1Q5W B;  2K6Q A;  2N7D A;  3V62 A;  2FAZ A;  1E8Y A;  3Q3F A;  2KWC A;  4DWF A;  5AZH A;  3JYU A;  2WX1 A;  1LM8 B;  3EHV A;  3N32 A;  3B08 A;  4GOC A;  2LRU A;  2N9P C;  4A3P A;  1U4A A;  3TJP A;  2JT4 B;  3W1S A;  4LCD E;  5CTR C;  1EUV B;  2LZ6 A;  4EZL A;  2FID A;  1YD8 U;  5IAA C;  2LRW A;  4ASW C;  2GBK A;  1RAX A;  1NI2 A;  1HE8 A;  2MQJ A;  4LJO B;  3L10 B;  5J17 A;  3MJW A;  4XZ4 A;  2BWE S;  2JRH A;  2MBB B;  1WM3 A;  3R3M A;  1WM2 A;  2ZCC A;  2ZJD A;  2HTH A;  2BKF A;  1C3T A;  2Z0E B;  4BVU C;  2CHX A;  5CX3 A;  1E8X A;  4DHZ B;  4EOY A;  4DHJ B;  4AJW A;  2PE9 A;  3K9O B;  3IFW B;  4ANW A;  2KQS A;  3APF A;  2KXJ A;  3ZTC A;  1WE6 A;  2D11 A;  1M94 A;  2WDT B;  3NOB A;  3CST A;  3DBL I;  4HCN B;  1WZ3 A;  1XT9 B;  2WWZ A;  4P7I A;  4BFR A;  2Y5B B;  1H8C A;  1E90 A;  2L05 A;  4FAD A;  4EZK A;  3VDZ A;  2AEH A;  1WGG A;  2MX2 A;  4CYE A;  2W9N A;  3PHX B;  2M17 A;  1EF5 A;  4G3X B;  5LLI A;  2LD9 A;  4E3C A;  1NBF C;  2A5U A;  2MBO A;  2KJR A;  2ZNV C;  2XEW A;  3L16 A;  1WJ4 A;  2L00 B;  2O6V D;  5D94 A;  3UIN B;  5IA7 A;  1VD2 A;  2KFJ A;  2ZNV B;  3PRM B;  1UBQ A;  4HVB A;  2LVO A;  4HDO A;  3A4R A;  1F9J A;  2NVU I;  3S2A A;  3W1Y A;  4W9K A;  1L7Y A;  2VRR B;  3I3T B;  2DZK A;  4BKS A;  2N4F A;  4JGH B;  4RM9 A;  2M8S A;  3ZDM C;  2NPT B;  3KH0 A;  3PRP B;  4M0W B;  3RUL A;  2HD5 B;  1KOT A;  2YLM A;  1P9D U;  4KZC A;  2KK8 A;  4WJP A;  5E6O A;  4W9I A;  5BO4 B;  3DVN V;  5AZF A;  4PYZ A;  2HE7 A;  1KM7 A;  2N1V A;  3UQA A;  4EFO A;  2REX A;  3UQB A;  2L3Z A;  2DZI A;  4KV2 A;  4W9F A;  1V5T A;  2KWV B;  2Z0D B;  3VUY A;  2GMI C;  4GDL A;  3X0W A;  1EO6 A;  3RT3 B;  2RD0 A;  2DZJ A;  4MGK E;  2J0M A;  2UWQ A;  3CSF A;  4TQ0 A;  1Q0W B;  2LXA A;  4FN2 A;  2FCS A;  2GOW A;  2DYM A;  2JF5 A;  2DZM A;  2O6V A;  4F1S A;  2ZPN A;  3KYD D;  4RM8 A;  3JSV A;  3L54 A;  3SHQ A;  2OOB B;  3AI5 A;  3EC8 A;  3ML8 A;  4BBN C;  4WJN A;  1WX8 A;  2GBN A;  3ZKJ C;  1Q1O A;  3RYT A;  2M0X A;  2KLC A;  1GC6 A;  4ANX A;  2FIF A;  1E8W A;  2FCN A;  1K8R B;  4B6W A;  3KUZ A;  3M95 A;  1WXS A;  4MJS A;  1X1M A;  2LAS A;  3RZW C;  5FR6 A;  3MHS D;  2AL3 A;  3GOE A;  1WFY A;  2MA9 B;  4W9L A;  4ZDV A;  2KFK B;  3Q3J A;  4GSW A;  3ZRF A;  2DX5 B;  1RRB A;  3V60 A;  3A9J A;  4IUM B;  1GC7 A;  4K7S A;  2N7E A;  3SDL C;  2R2O A;  4AWJ A;  2I1J A;  2V4L A;  3PRZ A;  2XK5 A;  4WJQ A;  2QHO A;  4WWP A;  4IG7 B;  3SD5 A;  3OAW A;  3ZRC A;  4MEM A;  4MH0 E;  2ZCB A;  2KWU B;  4FUL A;  3EEC A;  3QCA A;  1GUA B;  3A1Q A;  3AU4 A;  1SIF A;  2BF8 B;  2D2Q A;  2JXX A;  4W9H A;  5C23 A;  1JRU A;  2C5L C;  3ONS A;  2B3A A;  4W9J A;  2GBR A;  3PTF C;  1E7V A;  1SE9 A;  3P2B A;  4GGQ A;  3ALB A;  4AJY B;  5JHA A;  3QJZ A;  4GDK B;  1TTN A;  1XQQ A;  3H7S A;  4N9F 4;  3VFK A;  2DHZ A;  3ZW3 A;  2IYD B;  2KN5 A;  4NJ6 A;  3ZDT A;  4IWP A;  4GDL B;  3APD A;  3U7D A;  2PPH A;  3V6C B;  2PEA A;  3BY4 B;  5L95 C;  4I6N B;  3RUI B;  1R4N I;  1FXT B;  3RD2 A;  2L76 A;  4IW0 A;  3AU5 A;  2DAF A;  3VTU A;  4F7Z A;  2IO0 B;  4A3O A;  3K9P B;  4HK2 A;  2MRP A;  1E7U A;  2N1W A;  4BKS D;  2PJH A;  1ISN A;  4HLE A;  2NBV B;  3A33 B;  2O6V B;  4BBN F;  3BIN A;  1J0G A;  4JIO U;  3KUD B;  4JQW C;  3QAR A;  2KHW B;  4TKN A;  4GMV A;  2MP2 A;  4W9G A;  2J7Q B;  3JVZ X;  2K39 A;  3QA8 A;  4MEL A;  3LDZ E;  4KDI C;  4IM0 A;  2KTF A;  2JY6 A;  3AUL A;  4K7W A;  1WGR A;  4BOS C;  4G50 A;  4KIK B;  4MJS B;  2OJR A;  1A5R A;  3TL5 A;  1V81 A;  1WH3 A;  2GBJ A;  2KX0 A;  3NHE B;  4X57 B;  1IPG A;  5LXH A;  1G6J A;  3PZD A;  3RZF A;  1Z2M A;  4NPN A;  1UBI A;  3PHW B;  3VVW B;  3CMM B;  1UZX B;  3A9K A;  1OGW A;  4NJ7 A;  3PS6 A;  1UGM A;  1J19 A;  2RGF A;  3ML9 A;  4FA6 A;  2CHW A;  3NS8 A;  2XK5 B;  4J6I A;  3WIM A;  4ZYN A;  3PT2 B;  3M63 B;  2L8J A;  3KUC B;  1V80 A;  2MWS B;  1L2N A;  2K1F A;  4PYU A;  3HM3 A;  2DAJ A;  3A1Q B;  3RCZ A;  4TUU A;  4NAW B;  4BKT A;  1T0Y A;  2O2V A;  4DHZ E;  3VH4 B;  2L0F A;  3VXW A;  3ZNZ B;  3QHT A;  3DOW A;  1WX7 A;  1WJN A;  3U8Z A;  3VAW A;  3WA0 A;  4ANU A;  2V3S A;  3DBS A;  2Z59 B;  3ECI A;  3H7P A;  4URK A;  2K8B A;  2IO1 B;  3PV1 A;  2BYF A;  2KO3 A;  2LUE A;  1E8Z A;  2I1K A;  3ZUN A;  4EKU A;  5D2M B;  2KTR A;  1R4M I;  3HIZ A;  3IBE A;  4MSM B;  2LWP A;  5KHQ A;  2M1M A;  3APC A;  2C7N B;  3PLV A;  3MTN B;  4OVV A;  3W1S C;  4CHK A;  5CHW A;  3KW5 B;  1WGD A;  2D07 B;  3ZTD A;  2C7M B;  1WZ0 A;  1Z5S B;  2AWT A;  2LJ5 A;  3TMP B;  4NNJ B;  4MM3 A;  5J18 A;  1I35 A;  1UEL A;  4MDK E;  2AYO B;  2AL6 A;  3PPA A;  5D7G A;  3ZNI D;  4KSK C;  2KAN A;  2ZPY A;  1AAR A;  2RPQ A;  2KMA A;  1YIW A;  2KDF B;  3ZVV A;  2KC2 A;  2DYB A;  3DBR I;  2LVP A;  2YVC A;  2BPS A;  4WAA A;  1WGH A;  4W9E A;  3KYC D;  3UIP B;  1ZGU B;  4DXA B;  1WX9 A;  2L0T A; 
#chains in the Genus database with same CATH topology
 5J2R A;  4C80 A;  2JPH A;  4XX5 A;  3IT6 B;  1QKZ A;  1V1P B;  3Q8C A;  1F1H A;  2B76 B;  3A9K B;  5TSS A;  2MBQ A;  2GLS A;  3SR6 A;  4F8C B;  4ICU A;  5G55 A;  2KYW A;  3WAN A;  2KZR A;  2WYQ A;  1J8C A;  1RWS A;  3EUB 2;  2PVG C;  1FPY A;  2K6D B;  1ZW7 A;  2PW9 A;  3PZ8 A;  2RSU A;  5JH5 C;  3RNF C;  5L83 A;  1T5X D;  4XDD A;  1OQY A;  2MCN B;  4GIV A;  4PT5 A;  1KFY B;  1XLQ A;  4N6E B;  4TV3 A;  3T3N A;  4ACF A;  2IGH A;  1T0R C;  5BMH A;  3L08 A;  2PIA A;  1PQS A;  2N7J A;  1S1Q B;  3JW0 X;  5HI1 A;  4YTM B;  2MLB A;  2FE8 A;  3ETR A;  3ZJT A;  1FNW A;  3W2D A;  5IO9 A;  2K8C A;  2W3S A;  2C60 A;  3E9S A;  2G4D B;  4GXB A;  4N59 A;  3JSV B;  3QX1 A;  1N5W A;  2DYO A;  3V05 A;  4M02 A;  3U30 A;  2RDB C;  5E6P A;  1YX6 B;  2LI5 A;  3ZO5 B;  2E3T A;  2ON8 A;  3W9C B;  2JU6 X;  3A9J B;  3N1Y C;  3DDC B;  1WXA A;  3VUX A;  3WAM A;  3OG5 A;  1M4V A;  4XC2 A;  2W54 A;  4KKI A;  5DPS A;  2C7H A;  3ZQ4 A;  1D3Z A;  4US8 A;  3Q3M C;  2IJ0 A;  4FJY A;  4XGA B;  1N63 A;  1MVK A;  1UWX A;  3AMZ A;  2KMC A;  4B0M A;  4IKG A;  4YXD B;  4IWO A;  4FJZ A;  3AEC B;  3NY5 A;  1PGB A;  2WXN A;  1TZO A;  3L0W B;  3HM6 X;  1E5W A;  3QIJ A;  3QWZ B;  1YQ3 B;  1QOG A;  2EKE C;  1PYW D;  3N3K B;  2CR5 A;  3UF8 A;  3DWG C;  2PMV A;  2DLB A;  2BKR B;  4RMA A;  1V86 A;  4HWI B;  4GDK A;  2NS5 A;  2DBY A;  2KVR A;  1IGC A;  1YQB A;  2FCM A;  1T6B X;  2WDQ B;  1YX5 B;  5AUI A;  4K7U A;  1F52 A;  3M62 B;  1VDV A;  4NQL B;  1D4B A;  2FBW B;  4MGI E;  5BYR A;  4I6P A;  2KDE B;  1MJD A;  2KAJ A;  4KIK A;  4E71 A;  3AE6 B;  2WP9 B;  1MG4 A;  2NTT A;  2JVC A;  1N61 A;  3BII D;  3SU8 X;  3TBL D;  4HCP B;  2MSE D;  1NDD A;  2KQ7 A;  1V9J A;  2KJ6 A;  4KGT A;  1QOF A;  1GB4 A;  4DK5 A;  4MM3 B;  2K25 A;  1GB1 A;  4AP4 C;  3B0A A;  4C56 C;  1NVI D;  1I4Q A;  2KX3 A;  3RFZ B;  1I4P A;  2ZVO A;  3IHP C;  4MSQ B;  1HTQ A;  1KJT A;  1WXM A;  4LDT B;  1K50 A;  1NI3 A;  3QK0 A;  3AV8 A;  1MI0 A;  5HFY A;  1E8Y A;  3Q3F A;  2QC8 A;  2BT6 A;  3EHV A;  3B08 A;  3SFE B;  2JSV X;  5CTR C;  1EUV B;  3AE5 B;  1C76 A;  4ASW C;  1FRD A;  1NI2 A;  4LJO B;  2MQJ A;  4MAC A;  2MBB B;  2BKF A;  4AJW A;  2PE9 A;  3K9O B;  3IFW B;  2KQS A;  4OZA A;  1M94 A;  4BFR A;  2WWZ A;  4IDI A;  5EE1 A;  4FAD A;  3AEG B;  4ZRP A;  2L1A A;  3PHX B;  2LD9 A;  4E3C A;  2A5U A;  4HKZ E;  2L00 B;  5IA7 A;  2KFJ A;  2ZNV B;  3PRM B;  4HDO A;  3S2A A;  3W1Y A;  1L7Y A;  2VRR B;  2IGG A;  2RMM A;  4BKS A;  2M8S A;  3ZDM C;  2NPT B;  3KH0 A;  4M0W B;  4KZC A;  4JWS C;  2V3N A;  3LYY A;  3P1M A;  1KM7 A;  2N1V A;  1K51 A;  4Q2J A;  2L3Z A;  4A8X C;  1SBB B;  4KX6 B;  4KV2 A;  3E56 A;  2WDV B;  4W9F A;  2BB5 A;  2GMI C;  4GDL A;  3MFG A;  4DXG A;  2K9X A;  4XWW A;  3NZ3 A;  2UWQ A;  3CSF A;  2O6V A;  3JSV A;  2OOB B;  1PGX A;  3RYT A;  4B6W A;  2WXK A;  1D6E C;  3U52 E;  3TEW A;  1X1M A;  2LAS A;  4N58 A;  2KWD A;  1EWC A;  1YNT E;  1WFY A;  2LHE A;  2MA9 B;  2KFK B;  4XE0 A;  4L23 A;  3A9J A;  3AEB B;  1SXT A;  3SDL C;  3Q14 C;  2MJD A;  2V4L A;  3PRZ A;  2JWU A;  4HEA 1;  2QHO A;  1TIF A;  4IG7 B;  3SD5 A;  3OAW A;  2ZCB A;  3I57 A;  3QCA A;  3MHZ A;  2XN9 C;  5H92 C;  1JRU A;  2C5L C;  3ZJV A;  4W9J A;  2QJL A;  1SE9 A;  4C4V B;  3ALB A;  1TTN A;  1XQQ A;  3H7S A;  4ITK A;  3ZW3 A;  2KN5 A;  2JX5 A;  1UUP A;  5IN7 A;  3APD A;  2PEA A;  3CWI A;  1OQR A;  1FD6 A;  2FUG 1;  4A3O A;  4BKS D;  2MRP A;  2PJH A;  5LNK 1;  1B1Z A;  2H88 B;  4BBN F;  3BIN A;  1J0G A;  2BBC A;  3QAR A;  2HTM E;  4TKN A;  2J7Q B;  2K39 A;  4MEL A;  2J42 A;  4K7W A;  2CU3 A;  3BWU D;  1V81 A;  1WH3 A;  5LXH A;  1G6J A;  1Z2M A;  1UBI A;  2BW2 A;  5EE3 A;  3VVW B;  3CMM B;  1OGW A;  1J19 A;  4FA6 A;  3NS8 A;  2GRI A;  4J6I A;  1AWD A;  2OJW A;  4ZYN A;  1V80 A;  5C2T B;  2LEK A;  2K1F A;  1TY0 A;  2DAJ A;  3A1Q B;  3RCZ A;  3Q8E A;  1NYQ A;  2BS4 B;  1TS4 A;  1WJN A;  2LFI A;  2ONQ A;  1YQ4 B;  1E8Z A;  2I1K A;  4EKU A;  4P6V F;  1R4M I;  3IBE A;  4MSM B;  2KDM A;  3APC A;  4CHK A;  3PLV A;  4OVV A;  1FCL A;  3DHI C;  3KW5 B;  2LJ5 A;  1WZ0 A;  1Z5S B;  2YEP B;  4MM3 A;  2QIL A;  1AAR A;  2RPQ A;  3ZVV A;  2KDF B;  1I4X A;  2DYB A;  2LVP A;  4W9E A;  3DWM A;  1MPE A;  4C7Z A;  1WMH A;  3O65 B;  3BYY B;  4GLS C;  4WQM A;  3IVF A;  3M3J A;  4DBG A;  1OEY J;  4HPL B;  4P16 A;  5MPO A;  1NYR A;  3LB8 C;  2CKH B;  3Q3N C;  2J0K A;  1EM7 A;  1CK1 A;  1XCT L;  1QQR A;  2KT7 A;  3V6E B;  1YN3 A;  3WCQ A;  2WXH A;  2KJH B;  3DVG Y;  2HJ8 A;  3N1X C;  3NZU A;  3MJ5 A;  3R66 C;  1L0Y B;  3WAO A;  5KHO A;  2JZP A;  2ZW1 A;  3HK0 A;  3R7R A;  4NAM A;  2I38 A;  1TYG B;  2D3G A;  1VRA B;  1VLB A;  2YEP F;  4WWN A;  4KGS A;  1CMX B;  1D5X C;  4XWT A;  3O13 A;  2BYV E;  3GE8 C;  2PE6 B;  1P3Q U;  1C79 A;  4D2K A;  2PKO A;  1GG3 A;  4HPM B;  2NPT A;  4M0W A;  2EMT A;  2IY1 B;  2G3Q B;  1VZ8 A;  3SEB A;  4TMA B;  4M00 A;  4MGZ E;  2LGD A;  2KAC A;  2D10 A;  2A4Z A;  1F2R C;  3AE2 B;  2LGI A;  3N30 A;  3RNE C;  3PGE A;  1WF9 A;  3NJT A;  4K1R B;  4IC7 B;  2V1Y A;  5G5G A;  2XBB C;  3VUW A;  4LDT D;  3ENE A;  1DOY A;  3VQI A;  2D3C A;  1XD3 B;  5AZG A;  1PFD A;  1PDX A;  4FHK A;  4EZJ A;  2KFK A;  3RI7 C;  1FO4 A;  4JX1 C;  1WYG A;  1ZPS A;  1FCC C;  3TEY A;  3P4R B;  1FIQ A;  2MBH A;  1ZOY B;  2NCN A;  3C0R B;  2KLG A;  5C3J B;  3R2T A;  3TCA A;  4HRO A;  4WWO A;  4K3B A;  1WI0 A;  3R7Q A;  3CIR B;  5G2N A;  1WXV A;  3H9D A;  2G4S A;  4PS7 A;  3GP7 A;  1V2Y A;  5C1Z A;  4LNO A;  4ZRI A;  2D5G A;  1WGY A;  1UD7 A;  3DVG X;  4WWM A;  4YSZ B;  1J7A A;  1LGR A;  1D5Z C;  1UH6 A;  4DDG D;  2NR2 A;  1V8C A;  3DBH I;  2KD0 A;  5JZE B;  2O2V B;  5E6N A;  1QT9 A;  4II3 B;  2N9X A;  3N20 C;  3H7P B;  1GOZ A;  2DEN B;  4EEW A;  4EUT A;  1BUI C;  2UU7 A;  1TBE A;  1PGA A;  3RN9 C;  1JWM D;  1OTR B;  4AOF A;  1WE7 A;  1ZDX A;  1UF0 A;  1V49 A;  3UIO B;  4FXC A;  1J7C A;  4XDC A;  1EF1 A;  4IWQ A;  1KTK A;  3Q8A A;  2BYE A;  3OWE B;  2CHZ A;  4JL9 A;  2EMS A;  3TSS A;  1WR6 E;  4LK0 M;  2J0J A;  5DPT A;  2K6Q A;  1EU4 A;  2N9L A;  3JYU A;  1LM8 B;  2LRU A;  2HJ1 A;  3N1Z C;  4A3P A;  2DWQ A;  3W1S A;  4LCD E;  1ZXH A;  2OED A;  5EE0 A;  1RAX A;  3URY A;  3MJW A;  2BYT A;  2INP E;  2ZCC A;  1C3T A;  3NVV A;  4RNA A;  1QLB B;  2KXJ A;  3ZTC A;  2RPV A;  4A9A A;  2WDT B;  1H8C A;  2CJN A;  1E90 A;  2L05 A;  4EZK A;  2WHI A;  2W9N A;  1EF5 A;  1C4P A;  2LMC A;  2MBO A;  1WJ4 A;  3UIN B;  1UBQ A;  1YJJ A;  4WAF A;  4HVB A;  2LVO A;  4NJC A;  2N4F A;  4JGH B;  1I7H A;  1KOT A;  2JYE A;  2AX5 A;  5BO4 B;  4W9I A;  3DVN V;  2HE7 A;  2BTE A;  1BML C;  3RT3 B;  4A6Q A;  3DHG C;  1TKG A;  3P4S B;  4TQ0 A;  1Q0W B;  2LXA A;  1CJE A;  5T8I A;  1ENF A;  1DOX A;  3HVD A;  2JF5 A;  1Q10 A;  4RM8 A;  3AI5 A;  3EC8 A;  3ML8 A;  1WX8 A;  3ZJU A;  2M0X A;  2FIF A;  3J9C A;  2FCN A;  1A70 A;  3KUZ A;  1WXS A;  4MJS A;  3RZW C;  3MHS D;  1L6V A;  2W82 A;  3EFC A;  4GSW A;  2MH7 A;  3V60 A;  4IUM B;  2DNF A;  1GC7 A;  4S0R A;  2GI9 A;  4K7S A;  1VR9 A;  4AWJ A;  3C8Y A;  3ZRC A;  4MH0 E;  2KWU B;  2G9H D;  3EEC A;  3AU4 A;  3TEZ A;  2D2Q A;  1JWS D;  2B3A A;  4LNK A;  2X8X X;  1KF6 B;  4C7Y A;  2QDF A;  5JHA A;  3QJZ A;  1LO5 D;  3ZDT A;  3I9V 1;  1CZP A;  1UWM A;  3V6C B;  1L0V B;  4I6N B;  3IT4 B;  2KN4 A;  1N6Z A;  3Q6B A;  2DAF A;  2IO0 B;  4HK2 A;  1E7U A;  2J4X A;  2N1W A;  4HLE A;  3A33 B;  4JQW C;  3KUD B;  1HA5 A;  2M19 A;  4IM0 A;  1TKE A;  3AUL A;  3BVZ A;  1WGR A;  4BOS C;  1ET9 A;  1A5R A;  3TL5 A;  4X57 B;  2VH2 A;  1V1P A;  2V4I B;  1QOB A;  4CQN A;  1UZX B;  3A9K A;  4NJ7 A;  2RGF A;  1R4M B;  1FXA A;  4KKJ A;  2XK5 B;  1I4R A;  4O1N A;  1T3Q A;  1VZ7 A;  4NAW B;  2ZW0 A;  1T0Y A;  2O2V A;  1SB3 C;  3QHT A;  3WA0 A;  1XXG A;  3ECI A;  3H7P A;  1GPX A;  3PV1 A;  2BYF A;  3ZUN A;  3U4E G;  2BS2 B;  2LWP A;  5KHQ A;  2M1M A;  1HQR D;  4RGM A;  5CHW A;  4EE2 A;  2AWT A;  2D3A A;  1CQV A;  2AYO B;  3AE4 B;  4KSK C;  1L4Z B;  2PLP A;  3U2S C;  1WGH A;  4DXA B;  4HKQ A;  2L32 A;  3N9Y C;  3WAP A;  2XNA C;  3ZNG C;  2WXP A;  3P42 A;  1QZE A;  3HHM A;  1SEB D;  1UNS A;  2G45 B;  2IY0 B;  3Q69 A;  2MJE A;  3VRA B;  4YTN B;  4BKG A;  4ZHP A;  2M0A A;  1FEH A;  2WU2 B;  3DVN U;  4JE3 B;  2LGX A;  4KVG B;  4YL8 A;  2UYZ B;  1WJU A;  1C9F A;  4RGT A;  2BB6 A;  1VCB A;  1ZKH A;  1WR1 A;  4B95 A;  2LHD A;  4LNF A;  2MJ3 A;  1VJK A;  5HKH A;  1ESF A;  3AEE B;  4YWG G;  3I63 C;  3OJ3 A;  4FJV B;  5TR5 A;  2WX0 A;  3EA6 A;  1N5X A;  1RLF A;  3H8H A;  3AE8 B;  4E74 A;  2WGS A;  2Q5W D;  2N9E B;  5CHF A;  2BGF A;  4MGY E;  2QMT A;  4HJK A;  1L6U A;  4J3O D;  3AE7 B;  2MW5 A;  2KC1 A;  1IYF A;  3NVW A;  4ICV A;  3T3O A;  1P0R A;  1PUT A;  3IG3 A;  3DQV A;  2ZEQ A;  3FIL B;  1UGJ A;  4WJO A;  4S17 A;  4W9C A;  2W3R A;  3GS2 A;  4OVU A;  5DPW A;  4P1C C;  3NRZ A;  3KLS X;  4CO7 A;  3NG0 A;  4ZRJ A;  3OJ4 B;  1RFA A;  1SGH A;  1GAQ B;  3VH3 B;  1WIA A;  1ZDV A;  2FNJ B;  3R2I A;  1F2R I;  3LJ3 A;  3T8M A;  1MFW A;  1YJ1 A;  1HZ6 A;  3KVF B;  2Y5C A;  4FHJ A;  3L17 A;  1SE4 A;  5EDS A;  5E6J A;  1JW9 D;  1KLV A;  1MHH E;  3KQ4 A;  2WXO A;  1WJ6 A;  1LQB A;  2GBM A;  2CS4 A;  4AUQ C;  1KRH A;  4R3D A;  5I4D A;  2LGY A;  2MP2 B;  1GJZ A;  4MH8 A;  3RPF C;  1I42 A;  2NBU A;  4KDL B;  2WXJ A;  4G11 A;  4RH6 A;  2WDR B;  1B9R A;  3C19 A;  5IP4 D;  4TQ1 A;  3MP9 A;  4A20 A;  2JZZ A;  4IOI E;  4FBJ B;  2KNB A;  3TEX A;  3VTW A;  1WSP A;  3VTV A;  2V0G A;  4ARI A;  5IKC M;  2MBE A;  4ANV A;  1F77 A;  3H6N A;  3QC8 B;  3RNB C;  3RNA C;  3V61 A;  4GB9 A;  4ZRK A;  1MG8 A;  2QCZ A;  4M8N A;  3UGB B;  4L2Y A;  4USA A;  2WU5 B;  3B2F A;  2KTR B;  2JXT A;  1IP9 A;  1GNU A;  3AN1 A;  4PK1 A;  4JLC A;  4BOZ B;  4B9K A;  3QQ8 B;  2JUO A;  4A55 A;  2VH1 A;  3CF6 E;  1OFF A;  4WQO B;  2IPK D;  4C00 A;  4NAW A;  3Q2A C;  4OHJ A;  3NVY A;  1H4R A;  4JWU C;  3GZN I;  3Q8F A;  5BYS A;  2KKC A;  3RNC C;  2N7D A;  2AQ1 B;  1E0Z A;  3GE3 C;  3V62 A;  1ACC A;  2JQR B;  2WXQ A;  1WXQ A;  2KWC A;  4DWF A;  4GOC A;  1U4A A;  3TJP A;  3VR8 B;  1JRP A;  3Q8B A;  2FID A;  1ZE3 D;  3AEF B;  1HE8 A;  3SFD B;  3L10 B;  1XLO A;  5J17 A;  2JRH A;  3R3M A;  1WM3 A;  2ZJD A;  1IUE A;  5EE9 A;  4BVU C;  2CHX A;  5CX3 A;  1E8X A;  1I4H A;  4DHJ B;  4YSY B;  4ANW A;  2NMQ A;  3APF A;  1WE6 A;  2D11 A;  3DBL I;  1WZ3 A;  1XT9 B;  4P7I A;  4ZYS A;  1E6E B;  1SE2 A;  2AEH A;  1WGG A;  2M17 A;  4G3X B;  5LLI A;  2ZNV C;  2CJO A;  3L16 A;  4HRS A;  4MT5 A;  1F9J A;  1IGD A;  3I3T B;  3MC9 A;  3BK1 A;  2Y5P A;  2DZK A;  3MC0 B;  4RM9 A;  3RUL A;  3PRP B;  2HD5 B;  2YLM A;  5E6O A;  5AUK A;  2KK8 A;  2INN E;  2PVO D;  5AZF A;  3UQB A;  4C4V A;  3AB5 A;  2DZI A;  2KWV B;  2Z0D B;  3VUY A;  1T0S C;  1I4G A;  2R61 A;  2WNM A;  2RD0 A;  2DZJ A;  4MGK E;  2J0M A;  1E7P B;  2RDH A;  4AS1 A;  2GOW A;  4HPP A;  1ET6 A;  2DZM A;  4LLG M;  1L5P A;  3KYD D;  3L54 A;  3SHQ A;  3ABV B;  4BBN C;  3BVG A;  4BAX A;  2GBN A;  1Q1O A;  2E6X A;  1GC6 A;  1K8R B;  1DGJ A;  3L4P A;  3M95 A;  5FR6 A;  3FAH A;  2AL3 A;  3IAS 1;  3FIL A;  3BYT B;  3Q3J A;  2IGD A;  4ZOH C;  5BYQ A;  1YN4 A;  1YN5 A;  2N7E A;  1ROE A;  2R2O A;  4WJQ A;  1XLN A;  1HXY D;  4MEM A;  4FUL A;  5HG2 A;  3A1Q A;  1SIF A;  2BF8 B;  2JXX A;  4W9H A;  3DHH C;  2GBR A;  1TS5 A;  1E7V A;  3P2B A;  4QAY A;  1HTO A;  1SIJ A;  2DHZ A;  2IYD B;  2J52 A;  4RF0 A;  4IWP A;  3W5U B;  4GDL B;  4DXF A;  3U7D A;  1Y56 A;  2PPH A;  3BY4 B;  3RUI B;  1R4N I;  1FXT B;  3P4P B;  3RD2 A;  3Q3O C;  4IW0 A;  3AU5 A;  2GB1 A;  4F7Z A;  5HHD G;  3RNG C;  1ISN A;  3BVM A;  2NBV B;  1K53 A;  2O6V B;  1KLU D;  1WRI A;  4OZB A;  2KHW B;  2MP2 A;  3QA8 A;  4JPS A;  1JWA D;  3LDZ E;  1TY2 A;  1D5M C;  2JY6 A;  4G50 A;  2TSS A;  2OJR A;  2L83 A;  2IDY A;  2IND C;  1TJE A;  3RZF A;  2WXF A;  4NPN A;  3PHW B;  3PS6 A;  3NS1 A;  3WIM A;  1JCK B;  3PT2 B;  2L8J A;  3KUC B;  2WXM A;  4KGR A;  4PYU A;  4TUU A;  2M56 B;  2Z8L A;  5BMG A;  3VXW A;  4ANU A;  1WX7 A;  3U8Z A;  3DBS A;  1JML A;  4URK A;  2K8B A;  3VRB B;  1KH0 A;  2KO3 A;  2LUE A;  4K3C A;  4RGO S;  5D2M B;  2KTR A;  3HIZ A;  3AH7 A;  3W1S C;  2C7N B;  5D3I B;  4L1B A;  1WGD A;  3ZGZ A;  3TMP B;  4NNJ B;  2L52 A;  4MDK E;  2AL6 A;  3PPA A;  1VZ6 A;  2WQY B;  3FKY A;  1TS3 A;  1IBX B;  2KMA A;  1YIW A;  4A90 A;  1T0Q C;  2KC2 A;  3DBR I;  2YVC A;  4OW0 A;  1L4D B;  3BZD B;  3UIP B;  1ZGU B;  2L0T A;  1OEY A;  4WUR A;  1TT5 B;  4FLH A;  2WXL A;  2BS3 B;  4GN1 A;  4IM3 A;  2NBW B;  2LXC A;  4M8M A;  5JHB A;  2BWF A;  2D3B A;  3I5J C;  3B9J A;  1TGZ B;  2C9W B;  3R8B A;  3QAQ A;  2LVQ A;  2M4N A;  4HDQ A;  1AN8 A;  1HZ5 A;  1SJH D;  3GB1 A;  2IO3 B;  3DPD A;  1TZ1 A;  2EEL A;  1XF5 L;  1C1Y B;  1LXD A;  3NZS A;  4I6L B;  2KDB A;  3H1U A;  3VR9 B;  4TSS A;  2I2Y A;  3W5V B;  1WY8 A;  1LFD A;  2R2Q A;  3X23 A;  1JWB D;  4KZ0 A;  1YOV B;  2RR9 A;  1WRD B;  3KWV A;  3A4S C;  3BK2 A;  1C4A A;  1WYW B;  1C78 A;  3ZLZ A;  1E10 A;  1OQQ A;  3P63 A;  2KMM A;  1SJE D;  3TIX A;  1FM0 D;  2JYT A;  2ZZP B;  3KWL A;  1TS2 A;  2QEJ C;  4US9 A;  1WMH B;  3P4Q B;  3EFU A;  2V3P A;  2KOX A;  1JAL A;  4PS3 A;  1L0X B;  5AEK B;  5FKA C;  1P1A A;  5GMV A;  3OLM D;  1V6E A;  1Y8R C;  4II2 B;  3ZIM A;  3ZNH B;  4LJP B;  3AE3 B;  3HUI A;  3DCG A;  2IZV B;  1S3S G;  2N9K A;  2EKI A;  2VZK B;  3T9L A;  2SAK A;  3VHT C;  1N62 A;  4NY0 A;  1NEK B;  5DCN A;  2JWZ A;  3B1L X;  3D32 A;  1SE3 A;  4RFB A;  1V97 A;  2L7R A;  4K81 A;  1YMH E;  4KSL C;  2CU1 A;  4G0N B;  1BXT A;  3PLU A;  4P1B C;  2NTS A;  2J53 A;  4IM2 A;  4DHJ D;  2Y3A A;  3L13 A;  3PRE A;  4LNI A;  5FR3 A;  2ASQ A;  5DPR A;  3AE9 B;  2WLB A;  2IBI B;  3WAL A;  4DDI D;  5LXI B;  2WXR A;  2SEB D;  4NQK E;  4W9D A;  2FUH B;  2IO2 B;  3PSE B;  4NZL B;  1EWY C;  1P98 A;  1BT0 A;  2WS3 B;  2FCQ A;  2ICI A;  3PVL A;  4ZHO A;  3AE1 B;  4XYC A;  2JRI B;  5BMI A;  1V5O A;  3HVZ A;  2ZVN A;  5IOI A;  2K0P A;  1XCQ L;  2K8H A;  2LUM A;  3AXC A;  2KDI A;  1FMA D;  4AQ7 A;  4LNN A;  3AM9 A;  3GZN B;  5CHV C;  1JQ4 A;  2JZ3 B;  4LTU A;  3UI3 A;  4PS8 A;  2BVC A;  2K3U A;  1QIL A;  2HDE A;  1FXI A;  2LJI A;  2WXG A;  5GXG B;  4RGN A;  4GU2 A;  4YTP B;  4HXD A;  5D6J B;  3U7Z A;  4YT0 B;  1Q5W B;  2ACZ B;  2FAZ A;  2RDG A;  5AZH A;  2WX1 A;  3N32 A;  2N9P C;  3RMK C;  2JT4 B;  3EGR A;  1ZP0 B;  2LZ6 A;  4EZL A;  1YD8 U;  3DBL B;  5IAA C;  2LRW A;  2GBK A;  3MC8 A;  1IBX A;  1QOA A;  4XZ4 A;  2BWE S;  4B0E A;  1WM2 A;  1SF0 A;  2HTH A;  2AQ3 B;  1K52 A;  2Z0E B;  1HEZ E;  4DHZ B;  1RM6 C;  4EOY A;  2OHF A;  2V9H A;  4M01 A;  4H2A A;  3V3X A;  1J7B A;  3NOB A;  3CST A;  4HCN B;  2Y5B B;  2K22 A;  3VDZ A;  2MX2 A;  4CYE A;  1JRO A;  1KLG D;  1NBF C;  3TUO A;  2KJR A;  2XEW A;  4WIP A;  5H8Y E;  2O6V D;  5D94 A;  1VD2 A;  4ZRQ A;  3A4R A;  2NVU I;  4W9K A;  1STE A;  1WWT A;  1FNU A;  3LXF A;  1ZXI A;  2WXI A;  3ZYY X;  1P9D U;  4WJP A;  1XLP A;  4PYZ A;  3DBH B;  3UQA A;  4EFO A;  2MEK A;  2REX A;  1N60 A;  2INC C;  1V5T A;  2MHJ A;  1C77 A;  3X0W A;  4ARC A;  1EO6 A;  4REZ A;  1FFV A;  2G1E A;  5FK9 C;  2H89 B;  3IXS A;  1FRR A;  3NVZ A;  2KVZ A;  4FN2 A;  2FCS A;  2DYM A;  4F1S A;  2ZPN A;  1EU3 A;  4WJN A;  3ZKJ C;  5G5H A;  2PTL A;  2KLC A;  4ANX A;  1E8W A;  1QF6 A;  1ZUD 2;  1AYF A;  3PO0 A;  1RYJ A;  3FC4 A;  2QSD A;  3GOE A;  4W9L A;  4ZDV A;  3ZRF A;  2DX5 B;  1RRB A;  4RCO A;  2I1J A;  2KQ4 X;  2XK5 A;  4WWP A;  1P7E A;  1RFK A;  5JXV A;  1R4N B;  2AQ2 B;  1GUA B;  4DQO C;  4UDU C;  1DYQ A;  1R7S A;  5C23 A;  3ONS A;  3IAM 1;  4WH4 A;  3PTF C;  4GGQ A;  4HJG E;  4AJY B;  4GDK B;  4N9F 4;  3VFK A;  4NJ6 A;  3B2G A;  1XEE A;  4YSX B;  5L95 C;  1DOI A;  2BQQ A;  2L76 A;  3VTU A;  3K9P B;  1FNV A;  1NEN B;  1F0Z A;  4JIO U;  1AW7 A;  4GMV A;  4W9G A;  3JVZ X;  4KDI C;  2KTF A;  1SSN A;  4KIK B;  4MJS B;  2W55 A;  2KX0 A;  2GBJ A;  3NHE B;  1IPG A;  3PZD A;  2X38 A;  1V1O A;  4RF1 A;  1UGM A;  4OZC A;  3ML9 A;  2CHW A;  2QIE B;  3M63 B;  1E9M A;  2N0S B;  2MWS B;  1L2N A;  1P7F A;  3HM3 A;  4BKT A;  4DHZ E;  3VH4 B;  2L0F A;  3ZNZ B;  3VAW A;  3DOW A;  2V3S A;  1C4C A;  2Z59 B;  3DBR B;  2IO1 B;  1JWU D;  1TKY A;  3PZ7 A;  1MHX A;  3HRD D;  3MTN B;  5D3D A;  1XO3 A;  4BZA A;  2D07 B;  3ZTD A;  1FFU A;  2C7M B;  5J18 A;  1I35 A;  1UEL A;  3ZXV A;  3NUH B;  5D7G A;  3ZNI D;  3ZXR A;  2KAN A;  2ZPY A;  2K5P A;  2VZK D;  1YJI A;  2BPS A;  2LGS A;  4WAA A;  1WGK A;  3AED B;  3KYC D;  3AEA B;  1WX9 A;  4OVZ A; 
#chains in the Genus database with same CATH homology
 5J2R A;  1OEY A;  3WAP A;  4FLH A;  2JPH A;  1WMH A;  3O65 B;  4XX5 A;  3ZNG C;  4IM3 A;  4GN1 A;  1QZE A;  2NBW B;  3HHM A;  3IVF A;  2LXC A;  4M8M A;  3M3J A;  5JHB A;  2G45 B;  2IY0 B;  2BWF A;  4DBG A;  4BKG A;  1OEY J;  4HPL B;  3A9K B;  1TGZ B;  3DVN U;  2C9W B;  2LGX A;  3QAQ A;  2MBQ A;  4KVG B;  2CKH B;  4YL8 A;  2J0K A;  2LVQ A;  2M4N A;  2UYZ B;  4HDQ A;  4F8C B;  1WJU A;  4ICU A;  5G55 A;  3WAN A;  2KZR A;  2WYQ A;  1J8C A;  1VCB A;  2IO3 B;  3V6E B;  1ZKH A;  1TZ1 A;  3DPD A;  1WR1 A;  2KJH B;  3DVG Y;  2HJ8 A;  4B95 A;  2K6D B;  1C1Y B;  1ZW7 A;  3NZU A;  2RSU A;  3R66 C;  1LXD A;  3NZS A;  5JH5 C;  4I6L B;  5HKH A;  2KDB A;  3H1U A;  5L83 A;  3WAO A;  5KHO A;  1OQY A;  2MCN B;  3HK0 A;  1WY8 A;  4GIV A;  3R7R A;  3OJ3 A;  4FJV B;  1LFD A;  5TR5 A;  2WX0 A;  2D3G A;  4TV3 A;  2R2Q A;  1RLF A;  3X23 A;  4WWN A;  4KZ0 A;  4E74 A;  3L08 A;  2N9E B;  1PQS A;  2RR9 A;  1S1Q B;  1WRD B;  3JW0 X;  3A4S C;  2MLB A;  1CMX B;  5CHF A;  2BGF A;  4MGY E;  1WYW B;  4HJK A;  3ZLZ A;  2BYV E;  2K8C A;  2C60 A;  2PE6 B;  1P3Q U;  2G4D B;  4GXB A;  2MW5 A;  2KC1 A;  3TIX A;  1IYF A;  4HPM B;  1GG3 A;  4ICV A;  2NPT A;  2ZZP B;  2EMT A;  3JSV B;  3QX1 A;  2IY1 B;  1P0R A;  2G3Q B;  2DYO A;  1WMH B;  4MGZ E;  3U30 A;  2LGD A;  3IG3 A;  5E6P A;  1YX6 B;  2LI5 A;  3EFU A;  2D10 A;  3DQV A;  3ZO5 B;  2KOX A;  2ZEQ A;  2A4Z A;  4WJO A;  4PS3 A;  4W9C A;  4OVU A;  3N30 A;  3A9J B;  5AEK B;  5DPW A;  3DDC B;  3PGE A;  4CO7 A;  1P1A A;  5GMV A;  1WF9 A;  3OLM D;  4K1R B;  4ZRJ A;  4IC7 B;  2V1Y A;  1V6E A;  1WXA A;  1Y8R C;  3OJ4 B;  4II2 B;  3VUX A;  3WAM A;  2XBB C;  4XC2 A;  3ZIM A;  3VUW A;  3ZNH B;  4LJP B;  1RFA A;  2C7H A;  1SGH A;  4LDT D;  5DPS A;  3ENE A;  1D3Z A;  3DCG A;  3VQI A;  2IZV B;  4FJY A;  3VH3 B;  1S3S G;  1WIA A;  1XD3 B;  5AZG A;  3T9L A;  3VHT C;  2FNJ B;  4NY0 A;  5DCN A;  4FHK A;  2KMC A;  3LJ3 A;  4EZJ A;  2JWZ A;  2KFK A;  3T8M A;  3B1L X;  3D32 A;  4FJZ A;  4IWO A;  1YJ1 A;  3NY5 A;  2L7R A;  3KVF B;  4FHJ A;  4K81 A;  4KSL C;  3L17 A;  2CU1 A;  2MBH A;  5EDS A;  3L0W B;  2NCN A;  3C0R B;  3HM6 X;  1E5W A;  4G0N B;  1KLV A;  3PLU A;  2KLG A;  3QIJ A;  3QWZ B;  3TCA A;  4IM2 A;  4DHJ D;  1WJ6 A;  1LQB A;  3L13 A;  2GBM A;  2CS4 A;  3PRE A;  4WWO A;  4AUQ C;  2EKE C;  1WI0 A;  3R7Q A;  2ASQ A;  2LGY A;  5DPR A;  3N3K B;  2CR5 A;  5G2N A;  3UF8 A;  1WXV A;  2MP2 B;  1GJZ A;  2IBI B;  2BKR B;  3H9D A;  2G4S A;  3WAL A;  4RMA A;  4DDI D;  1V86 A;  4HWI B;  5LXI B;  1I42 A;  4GDK A;  4PS7 A;  1V2Y A;  2NBU A;  2NS5 A;  4NQK E;  4W9D A;  4KDL B;  2FUH B;  2IO2 B;  3PSE B;  4G11 A;  2KVR A;  5C1Z A;  1P98 A;  1BT0 A;  4ZRI A;  1YQB A;  1WGY A;  2FCM A;  4TQ1 A;  1UD7 A;  2FCQ A;  2JZZ A;  3DVG X;  4A20 A;  4FBJ B;  2KNB A;  3VTW A;  1YX5 B;  4K7U A;  3VTV A;  3PVL A;  2MBE A;  3M62 B;  1UH6 A;  4ANV A;  4DDG D;  2NR2 A;  3DBH I;  2JRI B;  3H6N A;  2KD0 A;  3QC8 B;  1V5O A;  4NQL B;  5JZE B;  4MGI E;  3V61 A;  4GB9 A;  4I6P A;  2O2V B;  5E6N A;  2ZVN A;  1MG8 A;  2KDE B;  4II3 B;  4ZRK A;  2N9X A;  4KIK A;  2K8H A;  4M8N A;  3AXC A;  4E71 A;  3H7P B;  2DEN B;  4EUT A;  2KDI A;  4EEW A;  3UGB B;  2KTR B;  5CHV C;  1IP9 A;  1GNU A;  2JZ3 B;  4JLC A;  4BOZ B;  1TBE A;  2JVC A;  3SU8 X;  4B9K A;  3QQ8 B;  2JUO A;  1OTR B;  3TBL D;  4HCP B;  4AOF A;  3CF6 E;  2MSE D;  1NDD A;  1WE7 A;  2KQ7 A;  1V9J A;  2KJ6 A;  4PS8 A;  4WQO B;  1V49 A;  4DK5 A;  3UIO B;  1EF1 A;  2K25 A;  4IWQ A;  4AP4 C;  3B0A A;  4NAW A;  2KX3 A;  2ZVO A;  2BYE A;  3IHP C;  2CHZ A;  4MSQ B;  1KJT A;  4JL9 A;  1H4R A;  2EMS A;  1WXM A;  4GU2 A;  4LDT B;  1WR6 E;  3GZN I;  3QK0 A;  4HXD A;  5D6J B;  2J0J A;  2KKC A;  5DPT A;  1Q5W B;  2K6Q A;  2N7D A;  3V62 A;  2FAZ A;  1E8Y A;  3Q3F A;  2KWC A;  4DWF A;  5AZH A;  3JYU A;  2WX1 A;  1LM8 B;  3EHV A;  3N32 A;  3B08 A;  4GOC A;  2LRU A;  2N9P C;  4A3P A;  1U4A A;  3TJP A;  2JT4 B;  3W1S A;  4LCD E;  5CTR C;  1EUV B;  2LZ6 A;  4EZL A;  2FID A;  1YD8 U;  5IAA C;  2LRW A;  4ASW C;  2GBK A;  1RAX A;  1NI2 A;  1HE8 A;  2MQJ A;  4LJO B;  3L10 B;  5J17 A;  3MJW A;  4XZ4 A;  2BWE S;  2JRH A;  2MBB B;  1WM3 A;  3R3M A;  1WM2 A;  2ZCC A;  2ZJD A;  2HTH A;  2BKF A;  1C3T A;  2Z0E B;  4BVU C;  2CHX A;  5CX3 A;  1E8X A;  4DHZ B;  4EOY A;  4DHJ B;  4AJW A;  2PE9 A;  3K9O B;  3IFW B;  4ANW A;  2KQS A;  3APF A;  2KXJ A;  3ZTC A;  1WE6 A;  2D11 A;  1M94 A;  2WDT B;  3NOB A;  3CST A;  3DBL I;  4HCN B;  1WZ3 A;  1XT9 B;  2WWZ A;  4P7I A;  4BFR A;  2Y5B B;  1H8C A;  1E90 A;  2L05 A;  4FAD A;  4EZK A;  3VDZ A;  2AEH A;  1WGG A;  2MX2 A;  4CYE A;  2W9N A;  3PHX B;  2M17 A;  1EF5 A;  4G3X B;  5LLI A;  2LD9 A;  4E3C A;  1NBF C;  2A5U A;  2MBO A;  2KJR A;  2ZNV C;  2XEW A;  3L16 A;  1WJ4 A;  2L00 B;  2O6V D;  5D94 A;  3UIN B;  5IA7 A;  1VD2 A;  2KFJ A;  2ZNV B;  3PRM B;  1UBQ A;  4HVB A;  2LVO A;  4HDO A;  3A4R A;  1F9J A;  2NVU I;  3S2A A;  3W1Y A;  4W9K A;  1L7Y A;  2VRR B;  3I3T B;  2DZK A;  4BKS A;  2N4F A;  4JGH B;  4RM9 A;  2M8S A;  3ZDM C;  2NPT B;  3KH0 A;  3PRP B;  4M0W B;  3RUL A;  2HD5 B;  1KOT A;  2YLM A;  1P9D U;  4KZC A;  2KK8 A;  4WJP A;  5E6O A;  4W9I A;  5BO4 B;  3DVN V;  5AZF A;  4PYZ A;  2HE7 A;  1KM7 A;  2N1V A;  3UQA A;  4EFO A;  2REX A;  3UQB A;  2L3Z A;  2DZI A;  4KV2 A;  4W9F A;  1V5T A;  2KWV B;  2Z0D B;  3VUY A;  2GMI C;  4GDL A;  3X0W A;  1EO6 A;  3RT3 B;  2RD0 A;  2DZJ A;  4MGK E;  2J0M A;  2UWQ A;  3CSF A;  4TQ0 A;  1Q0W B;  2LXA A;  4FN2 A;  2FCS A;  2GOW A;  2DYM A;  2JF5 A;  2DZM A;  2O6V A;  4F1S A;  2ZPN A;  3KYD D;  4RM8 A;  3JSV A;  3L54 A;  3SHQ A;  2OOB B;  3AI5 A;  3EC8 A;  3ML8 A;  4BBN C;  4WJN A;  1WX8 A;  2GBN A;  3ZKJ C;  1Q1O A;  3RYT A;  2M0X A;  2KLC A;  1GC6 A;  4ANX A;  2FIF A;  1E8W A;  2FCN A;  1K8R B;  4B6W A;  3KUZ A;  3M95 A;  1WXS A;  4MJS A;  1X1M A;  2LAS A;  3RZW C;  5FR6 A;  3MHS D;  2AL3 A;  3GOE A;  1WFY A;  2MA9 B;  4W9L A;  4ZDV A;  2KFK B;  3Q3J A;  4GSW A;  3ZRF A;  2DX5 B;  1RRB A;  3V60 A;  3A9J A;  4IUM B;  1GC7 A;  4K7S A;  2N7E A;  3SDL C;  2R2O A;  4AWJ A;  2I1J A;  2V4L A;  3PRZ A;  2XK5 A;  4WJQ A;  2QHO A;  4WWP A;  4IG7 B;  3SD5 A;  3OAW A;  3ZRC A;  4MEM A;  4MH0 E;  2ZCB A;  2KWU B;  4FUL A;  3EEC A;  3QCA A;  1GUA B;  3A1Q A;  3AU4 A;  1SIF A;  2BF8 B;  2D2Q A;  2JXX A;  4W9H A;  5C23 A;  1JRU A;  2C5L C;  3ONS A;  2B3A A;  4W9J A;  2GBR A;  3PTF C;  1E7V A;  1SE9 A;  3P2B A;  4GGQ A;  3ALB A;  4AJY B;  5JHA A;  3QJZ A;  4GDK B;  1TTN A;  1XQQ A;  3H7S A;  4N9F 4;  3VFK A;  2DHZ A;  3ZW3 A;  2IYD B;  2KN5 A;  4NJ6 A;  3ZDT A;  4IWP A;  4GDL B;  3APD A;  3U7D A;  2PPH A;  3V6C B;  2PEA A;  3BY4 B;  5L95 C;  4I6N B;  3RUI B;  1R4N I;  1FXT B;  3RD2 A;  2L76 A;  4IW0 A;  3AU5 A;  2DAF A;  3VTU A;  4F7Z A;  2IO0 B;  4A3O A;  3K9P B;  4HK2 A;  2MRP A;  1E7U A;  2N1W A;  4BKS D;  2PJH A;  1ISN A;  4HLE A;  2NBV B;  3A33 B;  2O6V B;  4BBN F;  3BIN A;  1J0G A;  4JIO U;  3KUD B;  4JQW C;  3QAR A;  2KHW B;  4TKN A;  4GMV A;  2MP2 A;  4W9G A;  2J7Q B;  3JVZ X;  2K39 A;  3QA8 A;  4MEL A;  3LDZ E;  4KDI C;  4IM0 A;  2KTF A;  2JY6 A;  3AUL A;  4K7W A;  1WGR A;  4BOS C;  4G50 A;  4KIK B;  4MJS B;  2OJR A;  1A5R A;  3TL5 A;  1V81 A;  1WH3 A;  2GBJ A;  2KX0 A;  3NHE B;  4X57 B;  1IPG A;  5LXH A;  1G6J A;  3PZD A;  3RZF A;  1Z2M A;  4NPN A;  1UBI A;  3PHW B;  3VVW B;  3CMM B;  1UZX B;  3A9K A;  1OGW A;  4NJ7 A;  3PS6 A;  1UGM A;  1J19 A;  2RGF A;  3ML9 A;  4FA6 A;  2CHW A;  3NS8 A;  2XK5 B;  4J6I A;  3WIM A;  4ZYN A;  3PT2 B;  3M63 B;  2L8J A;  3KUC B;  1V80 A;  2MWS B;  1L2N A;  2K1F A;  4PYU A;  3HM3 A;  2DAJ A;  3A1Q B;  3RCZ A;  4TUU A;  4NAW B;  4BKT A;  1T0Y A;  2O2V A;  4DHZ E;  3VH4 B;  2L0F A;  3VXW A;  3ZNZ B;  3QHT A;  3DOW A;  1WX7 A;  1WJN A;  3U8Z A;  3VAW A;  3WA0 A;  4ANU A;  2V3S A;  3DBS A;  2Z59 B;  3ECI A;  3H7P A;  4URK A;  2K8B A;  2IO1 B;  3PV1 A;  2BYF A;  2KO3 A;  2LUE A;  1E8Z A;  2I1K A;  3ZUN A;  4EKU A;  5D2M B;  2KTR A;  1R4M I;  3HIZ A;  3IBE A;  4MSM B;  2LWP A;  5KHQ A;  2M1M A;  3APC A;  2C7N B;  3PLV A;  3MTN B;  4OVV A;  3W1S C;  4CHK A;  5CHW A;  3KW5 B;  1WGD A;  2D07 B;  3ZTD A;  2C7M B;  1WZ0 A;  1Z5S B;  2AWT A;  2LJ5 A;  3TMP B;  4NNJ B;  4MM3 A;  5J18 A;  1I35 A;  1UEL A;  4MDK E;  2AYO B;  2AL6 A;  3PPA A;  5D7G A;  3ZNI D;  4KSK C;  2KAN A;  2ZPY A;  1AAR A;  2RPQ A;  2KMA A;  1YIW A;  2KDF B;  3ZVV A;  2KC2 A;  2DYB A;  3DBR I;  2LVP A;  2YVC A;  2BPS A;  4WAA A;  1WGH A;  4W9E A;  3KYC D;  3UIP B;  1ZGU B;  4DXA B;  1WX9 A;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...