1LQBC

Crystal structure of a hydroxylated hif-1 alpha peptide bound to the pvhl/elongin-c/elongin-b complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongin B
publication title Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 40
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 1lqbC01
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 1lqbC02
3ZTCC 4BKTC 4B95C 4W9JC 1VCBC 4B9KC 1LM8V 4W9FC 3ZUNC 4W9IC 4BKSC 4WQOA 4W9CC 4W9KC 4W9EC 4AWJC 4W9DC 3ZRFC 1LQBC 5LLIC 4W9GC 4AJYV 3ZTDC 4W9LC 4W9HC 3ZRCC
chains in the Genus database with same CATH superfamily
4URTB 3QDJD 3I02A 1AGEB 4N2BA 3ATFA 3OAUH 4LLAA 5ABDE 4K71B 2Y06L 4GRLC 3PV7A 2E46A 4X6BB 4N8VG 5CIPA 4G1EA 4G8GE 3JUZA 5D1QB 1NDGA 4X83A 5E7FA 1S9YB 4HH9B 4BA8A 1P5UB 4KKCD 3IFOA 2EEDA 4JE0A 5TDNB 5I6KA 4ZI8A 3SDCD 3Q2WA 3N3EA 3E80A 3SY6A 2UZIH 4ZUTA 4AXWA 5DHYA 1E28A 3MRHB 5KSUA 4XO9A 1C1EH 3TT1H 2VM4A 4NZFA 4Y4HB 3CZLA 2BJML 2DL2A 2VXQL 2BC4B 4JRXB 4KNUA 3V52L 3W2DH 1YHPA 2XWBB 1JPFA 1KJMA 4Q6IB 3QJOA 1ZT4A 3LTVA 4KX8A 5J0BA 1DVSA 4ORGA 3WFHB 3CFJA 1G7PA 2W0KA 3Q6GH 2Q6WA 1ZE3H 3UTPD 1KXVC 4IDJH 1NGWB 5I76B 3IWUA 2B1HH 3NIFB 4PGBB 3VXTB 1VSCA 1IQWH 4MAZA 1N5AA 4P2QA 4LHQB 1J1OH 3L48A 5AWNL 5A2LH 3H4HA 3M8OH 3N55A 2BK8A 3QS2A 4S10A 1FFTB 2M8XA 4G59C 1S78C 3FSVA 4LLMB 3BSGA 1KTLB 3AS2A 1HL9A 4PRIA 4A67A 5JYMA 2Y22A 2Z6FA 5SX5H 4WEUD 3GC3A 3WKML 4ZTOL 3IXTA 3T08A 2RCSL 4PJ9D 2WXJA 3I3DA 4Q4EA 3U4EB 2NT1A 1IJ9A 2XWCA 3F04A 1NJ9A 4IIQB 5FYKU 2G5UA 4OCRL 4KJWC 5DZPA 1SYSA 1WJ3A 3HR5B 4LF3B 4JAMB 4PTUA 1MQKL 4H8UA 1A9EA 2CJTA 3FQRA 4NQEA 1MVFA 1S7TB 5ANMB 2HXAA 2KDGA 2AABH 5DC2A 1DSWA 2X4OB 4WHYG 3GI9H 1YYMH 4PJAF 5F9AC 1JERA 2F1BA 3Q0HA 4A04A 3F2LA 4J12A 2VKXA 4KO6A 4OZIF 1LD9B 2GW5A 3EYVA 4P23D 4WUUE 3RA7H 5I1IH 3BP4A 4Z7NE 1U9KA 2WANA 3FH8A 4HC1H 4J4PC 4JFYB 4KKPA 4NQCB 5DZLA 4YSQA 3UGUA 4G8AC 1OO2A 2HFEB 2I5YH 5F44A 4OCWH 2D3NA 2P24B 1BAWA 1S7RA 2DLHA 1SLWA 1R3KA 3D4GA 2BVPA 5HPOA 2PKDA 3L4ZA 4JGMA 1DQMH 3EH4B 3GS7A 3HA0A 2BCKB 3FYEB 5I19H 5IR1A 5JW5A 3FONB 1XF2A 1IGFL 4JZOB 2ZE0A 5GGTH 5TQ0L 4HGMA 3UBFA 1AGEA 3AFLA 5L4MA 4NZRL 1ZDSA 4WJG3 1ZWIA 3MXWH 4X6BA 1QSFD 5D1QA 2W60A 3VXUD 5EN3A 1S9YA 1AOZA 4JFUA 2K4WA 4HH9A 4BK8A 4LVNB 2A77L 2XVGA 2ZNWA 3BP7B 3LRGA 2UZXB 1P5UA 3FJTA 4KKAD 5ALBL 1ZLWK 1FQ9C 5TDNA 4UBDD 1KZYA 4HEPA 5DYFA 3KBEA 3TV8A 3IGLA 3ULSA 2P1YA 3BE1L 4K5MA 1YZZA 1U8IB 2ZICA 4UOW1 1PAMA 4S1SL 1U8JB 4U3CA 2XN0A 2WZPA 1JZ2A 1IGTB 4A2EA 1WFOA 3MRHA 2PO6D 1YC7A 1MDAA 1WF5A 1AQKH 1JJUA 1WT5A 3CV5A 3GLAA 4Y4HA 3SO3B 4ES9A 4HMEA 1J5OL 3ZQWA 4L3FA 2BC4A 4JRXA 2K8QA 2KPNA 4YSTA 4NC1C 1TMQA 2NY7H 1JZ6A 4MCYB 2XWBA 2Y07H 3OF6D 4FNLL 4Q6IA 4ZW6A 3VD7A 1FRGL 2FECL 5T1KB 3WFHA 3PHOB 3VQ1C 3SODB 3UG5A 1IFGA 4A2DA 1KJVB 4HLEA 1NGWA 2A9NH 1JSYA 3ZKXC 4PGBA 4TQPA 3VXTA 4HS8H 5JXAL 2B14A 1ZLUH 1OCCB 3MODH 1NBCA 3PGDB 4IRJB 1MPAH 4U4BA 1IBGL 4FG4A 4LLMA 5I5JA 4FEIA 3TZVC 1KTLA 3NEXA 4A66A 2RMNA 1GKOA 3ARFC 3ZXAC 2VYRE 3T2OA 4PJGB 4YBLB 3HZVB 4XVUD 3OLGA 4YZFF 2MHAB 4O51B 1M6UA 3RKDD 3FHQA 4A55A 3CFTA 1MCOH 3DUSB 3SJVE 1F4AA 1NFDF 1I9IL 1RULL 3NCWA 3NZSA 2IOMA 1YMMB 4P9HL 3U4EA 1LMKA 3EYSH 5EPMB 3SGJC 5FECB 5JDJA 5K69A 5SWZB 4DKFH 2JB5H 1HI6B 1QACA 2A9ML 3FF8A 4G8IB 4IIQA 4CDHA 4GO9A 4AG4H 3F58H 3HR5A 4G7YL 4JAMA 1JGLH 1M7IB 3ZYZA 1RZ7H 3ZBMA 2VC2L 2WO2B 1ZIBA 1OANA 1S7TA 5ANMA 4JFPB 4ILDA 2X4OA 3TBBA 4DT2A 4MS8D 3UPCA 4CADB 5LHDA 3STBA 2DYSB 4F2ME 1BQLH 3PLYA 3JT2A 4L0ZA 1LD9A 1N18A 1FGNL 3IMVA 2V2XB 4KO7A 5BUPA 2W95A 4Z3HA 3GXFA 2KERA 4JFYA 4NQCA 4FRWA 1WE5A 3I2CH 4AYFB 1DQQB 4DUWA 1J18A 4B41A 1YNKL 2HFEA 5FCSH 2V3EA 2X44D 2Z4TA 2PWEA 5C09B 5E2VL 2UYLB 2P24A 3UO1L 2IMMA 4AMWA 3UAAA 3B2VL 1TG8A 3VGBA 2EJ1A 2VDKH 4M1CC 1KIPB 2KKQA 2BCKA 4XPBL 5F9WC 4DP8X 1HESA 4JZOA 1HILB 4NIKB 3VCLA 4IBWA 2C1OB 3BAXA 2GC7C 4ECNA 3LHPL 5E6IC 4LPXA 1EAOA 3U46B 1NBQA 3BP7A 2UZXA 4F9PA 1U8CA 4PVLA 1NCAL 4M6OL 4HV8B 4X5WB 2F8VA 5I23A 1Q0XH 1TJHL 5D2NB 1S78D 1U8IA 1U8JA 4AYSA 4CDGC 1IGTA 4PBVC 3AS0A 2X9XA 1NUFA 4TSAL 3FO0H 4CSTA 4PUBL 1TQCC 4M1DH 1XXFC 4OCLC 4S0SD 4MCYA 4W70A 5CXPA 2B4CH 4FXTA 1G9MC 4IQHA 5T1KA 3WMSA 2E7MA 2RA1A 3PHOA 2WXMA 2F5AL 2WINB 4LVHB 1KJVA 3LPGA 4MDJB 5D6DA 1MIMH 5F7EL 2DQCH 4JRYB 2CIIB 4OM0L 4CSSA 3BW9B 1DJIA 4YJZL 2H3XC 3PGDA 4IRJA 3DHMA 2XBZA 2Y25A 3QJUB 2WUBH 3FTWA 3ARGC 5T3XD 4PJGA 3D3VD 2AQPA 2MHAA 3R19A 4O51A 2GUOB 3LNFA 4X4KA 4J4PD 5JHDB 1U8QB 4JM2B 3U79A 2BPBA 1YMMA 4QRRE 3ZZSA 5EPMA 5FECA 3RUGF 2PTUA 5SWZA 5TE6L 5L2KD 1J0KA 3Q13A 2DTSA 1HI6A 4XVJL 1RK7A 3OMAB 4TTDD 3WIHH 5FO7B 2R0WH 5AW6B 2GPZA 3N41F 5MHSD 3IE4A 5IY5B 3KMDA 5GZNA 1W16A 1AMXA 3LN5B 2J6WA 4Z7IA 4NAQA 5ESVB 1L9QA 3U0TB 3KVPA 1RUML 3NJNA 5EIVA 3GRWH 1G6VK 4JFPA 2YMTA 1JF5A 1YEGL 5GS0C 4MMZB 2FEEI 3QDMD 4Y2DC 3RWJB 4CADA 2OA9A 3HAEH 4HIQA 1OP5K 1XR9B 4LQFL 4C4UA 3S9DB 4X42A 5F1SA 3L4CA 5I9QC 2V2XA 1BZ8A 1VPOL 4HEMA 4BGLA 3NA4A 4AYFA 2F1EA 3FPXA 1TTAA 1DQQA 2C4XA 4W1TA 5C09A 3DOHA 2UYLA 2G3NA 2Q3ZA 5IESL 1DP0A 3AABA 4A2HA 5K9QI 2HSIA 1KIPA 1Z9OA 3KLAB 3MNVB 1X7TA 1JNJA 3ETBJ 3FSZA 1UKTA 4RAVB 2XY2A 4WJKB 4X4ME 3NP3A 1G9ML 4UMSA 1RLWA 1HILA 4DGUA 1N19A 1ZVYA 4FHJA 3P0VH 2C1OA 4E41D 1F86A 4PRHA 5C9KA 3U46A 3UFIA 1MVUB 1KV7A 2GFBA 4HSQA 2J43A 4HV8A 4X5WA 4BUHA 4WGWB 5HJ3B 5D2NA 1BM7A 4CJ0A 4OIFA 3IJEB 1NAMB 1MG3C 3ARFD 2A6JB 1IAIL 3B2UC 2A74C 2ODHA 4PJ5B 3S3JA 3VQ2C 1F58L 1OTUC 3L81A 1LNUB 3C60B 4AQZA 2R83A 2GY5A 3HJ0A 4F15C 2COVD 4RMUA 2GT9B 1CK0H 4ZUUB 5C0CD 1NCHA 4QKXB 2Q8BL 4NQDB 1G9HA 4U3XA 1IVTA 4L29B 2TSAA 4RA3A 4RRPA 3V6OE 3GHEL 4PJFE 1XB3A 4BCYA 3LEXB 3W57A 3O6FC 2WO4A 3QNZB 5CEXB 2WINA 3JT0A 2D0GA 4HF5H 4MDJA 5AENA 2AERT 3BWAB 5GS0L 3NZHH 4JRYA 2CIIA 1E4WL 3BW9A 2D2CC 2D9CA 1CO1A 3V4PB 2VXUH 2ZWLT 5DWUL 5CM1A 4HLJA 2AAAA 1WAPA 4UT7L 4LPWA 1LDSA 3RZWA 4AIOA 4IOSA 2GUOA 4AMXA 2P7TB 3FUMA 4OIIL 4WV1B 5JHDA 5A6LA 1U8QA 4JM2A 2JELL 3O3BB 5I17B 2MSPA 1TNMA 3DX6B 1VKXB 3VJ6B 4KZDH 4H25B 4OFIA 5FO7A 4NQTA 4G8EB 5E1HB 1AD0B 5EFIB 3LN5A 2YSTA 3FN0H 4FG0A 5ESVA 3U0TA 4V1DE 4XHQA 3KH3A 4GW5B 3S36H 2DYPD 3ZDWA 4ZFFB 1JGUL 1MCLA 4ONOA 4Z78B 4Z3IA 4MMZA 4TVPH 2V8MA 3RWJA 2VDMH 4OD3H 1S7WB 2EP6A 4BK5A 1EO7A 4R90H 3TBSB 5I1KL 5IVOA 3VXSE 1NKOA 1XR9A 3SE8L 3DHPA 1I1RA 4E9YA 4FA6A 1WTGT 3EH2A 5DF0A 2BP8A 4I8DA 5E95B 1RERA 3ALPA 3NJHA 2OCCB 1I82A 3MGOB 3NCMA 3MMEB 2X28A 2NX5D 2FATL 2QFPA 1A6TB 2VDRL 3PU7A 3VI4F 4QRTB 4GNKB 5K59E 4GMTH 3QUKB 3BGMA 4IRZA 1R3JB 1C8PA 1FAKT 5I18H 2MOGA 3MZTA 3KLAA 4Z3GA 3MNVA 4AJ0A 1YNLL 1TVDA 1KV3A 3RHWF 1NDTA 2EVGA 4RAVA 4Y9BA 2X4TA 4HDIB 5D6CB 1ET5A 4TXVB 2JCCF 2BVUA 3LPWA 4I0KA 4C57C 2QT6A 1XF3B 3T71A 2EC9T 1RUKH 2LTQC 5C6TH 4WWID 3UABA 4MA3B 3HCVB 4YSDA 1A02N 1PX4A 4C56D 3QAZC 2TRHA 5EUOE 5HJ3A 3LMJL 5A43C 4JW3A 4RDQF 3IJEA 1KIUB 1NAMA 4TL4A 1AI1L 4XVTL 2A6JA 4RFNB 2XV3A 4OJCA 4PJ5A 1UWFA 4FKKA 2BNRE 2AK4D 1LNUA 3C60A 2LU3A 3FUEA 2X0WA 2YZ8A 2ADJB 1OSPH 3U6RB 2C9PA 2GT9A 4ZUUA 3DOSB 5ECJE 1KN4H 4NQDA 3GSOB 1CJYA 3DARA 4L29A 2RBLA 2R4RL 2Y69B 2AQTA 1H6TA 2ZF9A 3KGRA 3TCXA 4RSYA 12E8H 3LEXA 4GEIA 4K3EH 1QTSA 1ADQL 3SOBH 1DJZA 3ELQA 3HE7C 2YUXA 1A7BA 2YD0A 3QNZA 5CEXA 2F58H 3B8YA 3BWAA 3D0AA 1QFWI 4Y2DD 3V4PA 5I1DB 4AEIL 4BFJA 4H1LG 1CT8B 2XTJB 2V7HB 3AGVA 2Q7AA 2MNWA 3EO1B 4NO2B 4EBQH 2V0AA 1G1CA 2JK5B 3PUCA 2P7TA 4WV1A 4KDWA 5CNHA 5EOTB 1KOAA 1JK8B 25C8L 4KRLB 1UXMA 3O3BA 5I17A 4Y19B 5E6YA 1F6FB 4YC2C 1VKXA 3VJ6A 2BNQD 4H25A 4BZ2L 5D96C 5JIHA 1GC1C 4G8EA 1Y18B 1AO7E 1DJSA 2JJWA 5AB2A 1T1XB 4ZFFA 2UVFA 4GW5A 4NOBA 2H0PA 2VMDA 3VM7A 5KWYC 1E4KA 3MLVL 1QKZH 2VKWA 4Z78A 2YD5A 1G7IB 1S7WA 3JSSA 5E2TL 3VW3L 1COBA 4N9GB 2D73A 3TBSA 3DDGA 2ZJSH 4R26L 1X5GA 2Q76B 1ZHBB 4B97A 4N3TA 1BFOB 3AGWA 1JBJA 3GBMH 2ZXQA 3MGOA 3ZY7A 1WA2X 3MMEA 2CK0L 4AX3A 1TU2B 1U3HC 3VFMA 4EKJA 2LT9A 1A6TA 3AS3A 5EIIB 4QRTA 2K7PA 2QTVA 2CWRA 4N2OA 1BFVL 2V3DA 3Q1SH 3QUKA 1YVLA 1R3JA 2ICEC 4L9LC 3ZKQD 3P9MB 4OLZH 1RZFL 2CXGA 4UIKL 4EE2A 4HDIA 2WLYA 5D6CA 3MRMB 3CVIL 4R4BB 1KTDB 2X9WA 1YEEL 4AW4A 1D5IH 4N0RA 1SEQL 1XF3A 4UM8B 5AW2B 4R83A 5ID1B 3UC0L 1KB9J 4J28A 4MA3A 2E0PA 3HCVA 3GSNB 4GUOA 1H3PL 1U6AL 3CMOL 4L4TE 3VFVA 4U6XB 1R6VA 3RWIB 5FFOA 1XTLA 3U7WL 2GIXA 1KIUA 4F57L 1A0QL 2MFNA 5C07E 1EERB 2NXYB 1L9PA 2H6OA 1NC4A 4AIEA 5CJQL 4HJ1A 1U58B 3K6SB 2J5LC 3O2WH 1DJXA 1L7IL 1IVLA 4QTHB 2ADJA 3U6RA 2A9AA 5B8CB 4OR1A 2OBGA 4ZQKB 2NZ1A 5FLVA 2GSMB 3SDYL 3VWKD 3DOSA 2FBOJ 4TL5A 1W0WB 1XH0A 2HN7B 3GSOA 4QRAA 5BNXD 3TH4T 3ISWA 1MSPA 1GC1L 4U1JB 4GG6B 4K5PA 4PFEA 1PKQE 2KBGA 2Z64C 2QGDA 3U9PL 2RQ8A 4IHOB 4DSYA 4N6RB 4FLRA 4TLSA 3OD3A 1KSRA 4QLRA 1D9KD 1C16B 5I1DA 3ZRSA 4K2UH 4DNLA 4JG1H 3RI5F 3I6LD 1CT8A 5DQDL 4K4KA 4WTZA 3BAYA 4YL4A 2V7HA 3IJ7A 1VCAA 5IFJB 1J1XH 1E5BA 2LAAA 4M48H 3EO1A 4NO2A 3ZDZE 2JK5A 4X8CA 3HZKB 4FX5A 5EOTA 1JK8A 6PAZA 4FTVE 3TYGL 5GJTL 5GRUH 4Y19A 3B83A 1ITCA 1CG9B 1A9BB 2EDLA 1OAYL 15C8L 5FOJA 1XSOA 2O5ZH 1CN4A 2R7EB 3E38A 3FXIC 2CBMA 3BKCH 1Y18A 3S37H 5IB4B 1T1XA 3QWNA 3HJEA 2V3FA 4B9GA 1RMFL 1BFTA 2UY6B 3SDDC 4JHVA 1KBGH 4TQEH 4YN3A 5I66B 1AJ7H 1H15B 2LHAA 1G7IA 3MROB 1OHQA 2LVEA 1E6JH 4N9GA 2AI0L 2XWTB 2Q76A 4I87A 5C0AD 3TS8A 4Z7OE 1RZJH 5CLZA 1X4XA 4ODSL 5F7MC 5JIKA 3RY5A 5C7ZA 4QJ3B 3O41A 5L8JB 1QYGH 2ZKHH 3KWVA 2DQTH 1EBPA 1JD7A 2DI8A 3TVMB 1FZMB 2Y36H 3QEGL 5FYJH 5EIIA 2DMKA 4GB9A 4KDVA 4B7IA 3KPLB 3ARXA 4AOFA 1DN0B 1U41A 1AS8A 4IJ3C 2R0ZL 3Q8CA 1CFVL 3N6YA 3ZKSD 3KHQA 3D4ZA 1TF4A 4FG6C 3P9MA 4PG2C 4UOZA 2P42B 1F00I 2AEQL 3Q1EA 3VGEA 1UWXH 3QPXH 3DO3A 4G6ML 3MRMA 4R4BA 3I75B 3W9DB 1KTDA 4LL9A 1I7ZA 3M88A 3ORJA 5HI3C 3QDGB 2E3VA 2CNZA 5LUMA 2W0FB 1EX0A 2ZKYA 4UM8A 3MBXH 1MAMH 3D12B 4PJBB 1YECH 4JFOB 5E5LA 2OR9L 3GSNA 3N5AA 2P49B 4WFHD 5E2WL 5LN4A 3UTSE 4DEWA 1I8LC 2ZYRA 4OCSL 5BPPA 1JTTA 4U6XA 1UACH 3RWIA 3MUGB 2LR4A 3SIKA 2DIEA 3ZE1F 4Q74A 4M1GH 4ZAKC 1U58A 3K6SA 4EEEA 4QTHA 5B8CA 2LU4A 3WI9A 4KZCA 4ZQKA 4YO0B 4QRFA 5D5ME 3EOBB 4HCRA 1W0WA 2HN7A 2R0KH 4LOVA 5D7KD 1A3QA 2DKSA 4PLKD 4QXUL 4U1JA 1ZSDB 2QKIC 4LCWB 4GG6A 3JXAA 1V7NH 3GM8A 4TNFA 1QLEH 4UV7L 3IAQA 2XWEA 5F71A 1WZMA 4X98B 4IHOA 4N6RA 3CH8A 1PU0A 1C16A 3IRZA 3DBXB 3EDFA 5LB1A 4G6KL 5E4IA 3NESA 2XA3A 3HE6D 2CO7B 3F6JA 2ZOKA 2NNCA 3MRFB 3NDYE 3DVGB 2ZPKL 4ZMQA 4KQ4H 1ETB1 4U31A 3WELA 3HZKA 5EZPA 2OTPA 3BESR 3JQOB 1EFXD 2CGYA 4JO4H 3FFDB 5IFAH 4Z7NF 1CG9A 1A9BA 2G30A 3L3KB 5LBSH 5TJWK 5FHBH 4ZFGH 4MZRA 3N85H 2DV6A 3BRDA 1OKEA 2J57A 1LHZA 1TFPA 2R7EA 4NBXB 4PEEA 4POUB 5JOPD 1FL3B 1R9FA 5IB4A 1EANA 2MTPA 1JGIA 2UY6A 4TQIA 1JMXA 1DL7L 2PCXA 3EGSB 4S2SB 5I66A 1H15A 2NZ9D 4RWYH 5KVFE 4HCGA 4DN4L 1U2CA 2WQAA 1I7TB 2LU7A 3MROA 4WNQB 3D9AH 5D7LB 3J07A 2XWTA 3JWNG 4FFWD 4QY8B 1TTCA 5LNDA 1YEHL 3TYFB 2V5MA 2MRYA 2B15A 4LP8A 1TTRA 3V6OC 2DM7A 2SEBB 1AIZA 5ES4B 5IGXH 4X7CC 3LS5H 4PJCA 2G0LA 1FZMA 3TVMA 3VD5A 2HG0A 3NH7H 2LLLA 3KPLA 4DETA 1DN0A 4GBXC 2ZTBA 3AY4A 3CK0H 5DMGC 2XTSA 4QHLB 4HLZG 1WITA 1AY1H 5FV1L 2WXLA 2E27H 3MLRL 4MDIB 1HDMB 4LCYB 4APQB 4GO8A 1W6LA 2MQCA 3KPRE 3ECQA 4WCYH 3O6MH 3I75A 4F7PB 1UJ3B 1CI5A 3QDGA 3QIUC 2F9BT 1VESA 3VG0H 1UWYA 2W0FA 4HIPA 4PJ7B 3T8VA 1X5XA 4F1SA 4AM0Q 4PJBA 3MCLL 3EYQC 1C5BL 1YEKL 4LSUH 3LEVH 3BDYH 1QWUA 4ESKA 2CJUL 4E9TA 1OY3B 2UUDK 2Y5QA 3MUGA 3P3RA 2E6QA 1G4RA 4JUSA 4AKPA 4MAYB 3WUZA 4HUNB 4MJID 3VFRB 2CRYA 1ND0B 4RMRA 4YO0A 4I18C 5AD0B 3EOBA 5FHAH 1DLFL 2ADIB 3L2NA 1B2WL 1BQKA 4K07A 3NIGB 1MEXL 3UO8B 4N20A 1ZSDA 4LCWA 5DJAB 2HX7A 4Z23A 1QBLL 3WTVA 1R5IB 4AYBA 2F54D 1QW8A 5B38G 2ZP0T 4X98A 2APTA 3BH4A 5DUPH 5ICXB 2R2EB 4B7LA 4GS7C 3D39E 1A1OB 2IBZX 3HW7A 4F8PA 1CGSH 4J6IA 2EDXA 5J12B 2QLYA 4NWTH 3DBXA 5IW3A 1B0WA 1IRAY 2CO7A 4NRYB 4HPOH 4OF5A 1QUNB 1F1DA 3MOAL 5IWLC 3ALWA 3DBSA 5I0VA 5EF2A 3MRFA 3R0NA 3DVGA 4MJ6B 4BKTC 4X6DE 5HPMB 2ZX6A 3QWQB 1RJZB 4LEXL 3FFDA 4HHWA 3TXAA 4YVNA 4N0YL 1T2XA 3L3KA 4YFEA 2AV1B 2B7DT 5E56A 5IHHA 4W81A 2ZAHA 3CN4A 4MJJA 2W07B 2C9QA 4XXWA 5FYJD 2WLMA 1AXTL 3CFKB 1FL3A 1MCKA 5JHBA 1MCBA 1BSIA 1E27B 4UQ2B 3VSTA 5E9DE 4P4RB 1FJ1B 2XDHA 3BH8B 1CICD 3P3YA 4B9PA 4Y2LA 2XX0A 1SY6L 3WS6C 5C08B 3EGSA 4S2SA 5FA3B 1BQUA 2QV2A 4PJXE 4CBPA 2ZXWB 5DLML 2R9HC 3QJHB 1IIKA 2XV0A 1I7TA 4M3JA 3LNEA 3WTYA 4WNQA 3HOGA 1CU4H 5FK9B 5AVYB 3B7RL 5FXCH 4QY8A 4CU6A 1MCQA 1TR7A 3TYFA 3TEZA 1H6UA 2F53E 3KPTA 5CP3A 3ULAB 2SEBA 2A2QT 2XLLA 5CILH 5T3ZH 3VTTA 3NPSB 4Y4FB 1TYRA 1MFVA 4JKLA 4ALAL 2R39A 5LAPA 3ZO0A 4DP6X 4S11A 3TEXA 1B9ZA 1MHCB 3EYUL 2BY2A 1BFSA 1T20B 1X5LA 3FRUB 3GMPB 2VSDA 1XH3B 2JQAA 2PCFB 5D1ZC 5DFTA 4QHLA 4KK6C 1J8RA 3AQZA 5KSAB 1T03H 1T4KB 3KL0A 5DD5H 3ABZA 4MDIA 1HDMA 4LCYA 5IUCA 4APQA 1A6WH 3PY9A 2NY1D 1IKNA 4M7JH 1DQKA 3DI2B 4F7PA 1MCHA 5EO9A 1UJ3A 1E40A 5HDBF 4LZKA 4GUCA 4B3EA 3LZPA 4R4FL 3P02A 1FLTX 4MZIA 4PJ7A 1GGBL 4MFHA 1LLAA 4QR7A 1UXSB 1FFOB 3G5WA 1EXHA 5L8LB 3GFUA 1FYHB 35C8H 4FFZH 3VSQA 2CLZB 4L5FE 1XMEB 5B1BB 3ZE0E 1XH1A 3QI9D 3BQUD 3EF7A 2HVKB 4HQQL 4CN6A 4MAYA 5CZVL 1U4FA 3ML9A 3VFRA 3WFCL 3CX5K 3VWJC 1GGIH 1A4AA 1ND0A 1YQVL 3FOMB 3HZYB 3FF7A 4D8PB 1FNFA 5AD0A 1NICA 1RURL 1NGPL 2ADIA 3NK4A 3FPYA 2ESVB 1I8UA 1E0OB 1QRNB 1MRFL 2Z3FA 4GXVH 2YAMA 3PL6A 3P2BA 1KCSH 5DJAA 4PVNA 1HCVA 3WIFB 3KR3L 1R5IA 5E94B 3WNMA 1JZIA 5ICXA 2R2EA 1IKOP 3SBWA 1A1OA 4D9QD 1T5XB 3EOAB 1SYVB 1AHWC 4YDKH 4QRQB 1LM8V 3BAWA 4NRYA 3DXAD 3KWTA 1QUNA 2IOIA 1FN4B 4ORZC 3DPDA 4G9FD 4ZO7A 3UBXI 4MJ6A 4UM9B 5HHOA 1V10A 1QI5A 5HPMA 1RJZA 3JV5A 5GGQL 3KM2A 5IVXB 4NIYE 2EDQA 2YXWA 1H8SA 4YHZL 2FHBA 2YA2A 1XAKA 2AV1A 1BD2B 2JF1A 4QTFA 4EZJA 4GSDL 2WMPB 5BQDA 5E8DH 2J1WA 2W07A 2VXTH 3CFKA 4GBXD 3QG7H 5L7XL 3FRPG 4PWEA 4HG4J 2OS7A 3S3SA 2FBJH 3U1SL 3WLWD 1E27A 4UQ2A 4YHLL 4D9RE 1EEUA 3MOBH 4P4RA 1FJ1A 2Z0UA 3BH8A 3QYCA 4NNXB 2E7CA 5C08A 5FA3A 1W80A 1ET7A 5CBEB 4G82A 3QJHA 1INQB 3B3BA 1CR9L 1XIWD 3TCTA 5FK9A 1Z9SB 2EQDA 2K8MA 4GKOA 2XKNB 1NAKL 1AGCB 2KZWA 2UX6A 4Y4FA 3L9BA 4DP9X 3MV8B 3RGVD 4BJLA 2XVLA 4DP7X 5DD6B 1IUZA 4KK9C 2Y06H 1MHCA 1QBMH 5T8IA 2WWKT 3DGCR 1T20A 2IQ9L 1UXLA 3FRUA 3GMPA 1ZXQA 2H45A 2NYZA 1OD9A 1XH3A 2PCFA 4DN3L 4DUXA 4PD4K 5ELIA 5KSAA 3VXSD 3HZMB 1T4KA 2DH2A 2CKBB 4AWJC 1I85C 4F58L 3JTBA 4E0RB 1ZEAL 1G5AA 1TQUA 3I9AA 3VXMB 1KPRB 3UTTE 4WI4A 1RI8A 1NANH 2VQ1B 4A68A 2N1TE 2BFGA 1VA9A 1XVSA 3QC6X 1F3JB 2KQNA 2BJMH 1F2QA 2VXQH 4WI5A 1MW2A 1UXSA 4ZW7A 1FFOA 3EJUA 3V52H 3MFGB 2OI9B 4LRIC 5AKTA 5KAQG 2CLZA 4UNIA 2HVKA 5FM8A 5DXWA 5JPNB 5C6WH 4NWUH 3DRTB 3C08L 4BZYA 3II1A 3S48A 4Q0XL 3FOMA 4D8PA 3NT0A 5EBLB 1L9OA 1F90L 3DDFA 5DU7A 5ITFB 4M61B 5AWNH 3VSUA 2ESVA 2BIOA 3WFZA 4DO4A 2J73A 1QRNA 2JJTA 2DQGL 1RY7B 4TNGA 4OJEH 2ITFA 1XGRB 5D1ZI 5ENWB 2FEJA 3WIFA 1F8TL 2FGWL 4B9JA 4YHNB 3EBAA 5E94A 4EN3D 3UCQA 3EOYG 4ZTOH 3WKMH 2RCSH 1E5YA 5KSBF 1T5XA 3EOAA 3FQYA 1WUNT 3SYAA 1SYVA 4P5RA 4QRQA 3PJLA 1OLZA 4YGVB 2APFA 4UTBA 1Y07A 4ATTA 4OCRH 3BC9A 5CD5C 2AVFA 1FN4A 4PJIB 1PIGA 1KLUB 4PJDE 1E9PA 4UM9A 5FFLA 3ETSA 1MQKH 3VFUA 5J8OA 4MA1B 3QDHA 5IVXA 2JJSA 3RY6A 1WICA 3TBVA 5T3ZD 3ZN6A 2R27A 4R7NB 4UILH 3IGKA 1BD2A 3VXRD 2WMPA 4XPFH 1ILUA 2H0EA 2YUWA 4HP5A 1E3XA 3IETB 4NNXA 1PLAA 2GCYB 1OSEA 1P0SE 1LK2B 1AQDB 4NKQB 1J5IA 2FX7L 3US9A 5MENE 3FU9A 4KXCA 5HHPB 5CBEA 3VRIA 1EBAA 1M7DB 1INQA 3B1UA 3HLKA 2D3JA 4KY2A 3WKPA 1Z9SA 4L48A 3ECWA 3QAQA 1XGPB 2XKNA 1JK9B 1AGCA 1B3JA 1W8EA 4U2YA 1ODUA 1OAZL 4NBYB 1XZWA 1OM9A 2RD0A 1NPNA 3CFEA 5HXMA 3M6DA 1KJ3L 1KCUL 1IGFH 5TQ0H 5A3ID 3MV8A 5CZXC 3BUBA 4DO6A 2JFCA 5MI0C 5AW0B 4X5PA 3ZR6A 2YA0A 5DD6A 1CD0A 1XXDC 5EUOF 2K6ZA 2ITDB 2VT0A 4GRWE 3CDGA 3TIDA 3HC0B 4NN5B 4A2FA 4I3SL 2P47B 1UTDA 1UYWL 2A77H 5ALBH 3HZMA 2CKBA 2XQYK 4ZXBC 2FD6H 4E0RA 3C5ZB 3QFJB 4NFDA 3AREA 3WHE1 3BE1H 3NEOA 4NZ8A 4O4YL 3AG3B 5I71B 3OB0H 3VXMA 1KPRA 2W92A 3QFGA 4S1SH 4BUGA 1CLVA 2PW1B 2VQ1A 1HQRB 3NRFA 1BJ1J 2VL5B 3KBFA 5IQOA 1LO0L 2Q3AA 1T4WA 2YXMA 4W9CC 1F3JA 1J5OH 4L8DB 1N4XH 1X6NA 3CZFB 3HUJF 3DO4A 3STLB 1WO2A 3W11D 4FNLH 4G6FB 3ZDXF 1NEZG 4Z7VE 2VLMD 3K91A 3KPPB 4WVRA 1WK0A 5JPNA 1HIML 3DC0A 3FCGA 3HVNA 1MKFA 2IWGA 3JBG7 3DRTA 4M03A 5I6PA 2I27N 3ZTNL 4LSRL 1U21A 1XDTT 3TO4B 4H13C 5EBLA 5JXAH 5ITFA 7TAAA 1QHPA 4R8WL 1N70A 4M61A 4H8VA 1ID2A 3ARQA 5LBGA 4ZW3A 4FQJL 1I9RL 1IBGH 1O9ZA 1TIUA 3FTXA 2OMBA 5ENWA 1E2ZA 1R75A 5DQJB 4PIBA 3LCYA 4YHNA 4KROB 5DZNA 2PUQT 4W9DC 2BSDA 2Y2WA 1R1CA 1OOWA 1OQXA 1RULH 3P2TA 2GJPA 4P9HH 3CLWA 4F37K 4DKTA 4H1LB 2A9MH 1G1KA 4YGVA 1T66C 1F5WA 4LVNC 1JWMB 1OK8A 3CHRA 1ZRUA 3MV9E 4N2HA 4PJIA 3CBRA 1KLUA 2P8MB 4AKQA 4G7YH 5EEWA 1A25A 3B9AA 4GOSA 3O6LL 2BOCB 1E2VA 1BXAA 1HXKA 3MLUH 4O2CB 4FKEA 5TE4H 2NSMA 4P57B 2ORBL 2NNFA 2R29L 2KUTA 3AU1B 4ZO8A 4QGTA 4PRID 4R7NA 4X6CF 5KVGH 1XD0A 4KK9D 3RWDB 4Z76B 1ZOXA 2BVEA 3Q2CA 1VRSA 1XSKA 2OSYA 5FKAB 2BHYA 4Z3FA 3L95B 2W94A 1OTSD 4TM9A 1FGNH 3IETA 4JHBA 2ZG1A 1G0YR 3GSWB 1H19A 4ZTPL 2GCYA 3LXBA 1LK2A 1AQDA 1BX2A 1Y6KR 5HHPA 1YNKH 2VDOB 2WXFA 1M7DA 1BHGA 4NUPA 3E2HB 1BVNP 3D4CA 2VL4A 3GTTA 4NQED 4G71B 2BZDA 3B2VH 5IBLD 1JK9A 5J06A 4KK8D 1D7BA 5JW4R 4XPBH 2EC8A 1JVLA 5TQ2L 3DJZA 1HNFA 2DLIA 2FX8L 5CD3B 3OAZH 5A2FA 4XB3A 2VLRB 3FCBA 4X5RA 1UM6L 4PREB 4IK7A 5KVFL 3RJDA 4E9QA 2G2PA 2WBWB 1KG0B 2ITDA 4PJEE 3GT6A 3HC0A 1JG9A 2D7NA 2X2YA 3LHPH 3COOA 4FNPA 4DEPC 3VFSB 4QD2E 4PRBB 3NIDB 4N2CA 4DJMA 2WPGA 4M6OH 1PZSA 4MVBD 3C5ZA 3EJYD 3QFJA 4XMUA 1J5HA 1TJHH 2HTLD 4X6FB 5HD8D 3QPQD 5MERB 4XE0A 4CC1A 3QZNA 4F8LA 2PW1A 1HQRA 4GLRI 4YK4C 2Q9OA 2VL5A 4L05A 3ROOB 4IGBA 5DT1L 2DMBA 3HMXA 4JGUA 3WNPA 5J6HA 3EJTA 5ICYB 3KPQB 2I7OA 4L8DA 4NPYB 1CGTA 5E24E 2UXFA 2Y2TA 1NUGA 4PUBH 4YDLB 3KLHD 3CZFA 4GUPB 5C0BB 3STLA 3RVTD 4YDZA 5D1QD 5FB8B 5D8JH 3QARA 5KUMA 4NUQA 1GJIA 1SOXA 3KPPA 3D48R 4PPTA 4NKOB 2F5AH 4K94C 4YE4L 4XO5A 1OALA 3LD8B 1SLVA 5E23A 4OM0H 3IE9A 3TO4A 2JXMB 2WZPD 1HK6A 4JN1L 1UZ6E 3ZDZF 5SWSB 2ZAGA 2IDFA 5LCVA 2F8OA 7PAZA 2FL5B 3QFDB 1TTGA 3OKKB 4Y4HD 5HGDB 4LSVL 1YEIH 5DQJA 4JRXD 4OGAD 4NM4L 3CBKB 1PJWA 2HLFC 2JLLA 1DVFC 2YHGA 2GKIA 1YJDC 5E8OB 1NC2B 1OP9A 2FLBT 4JFFB 5TE6H 4H1LA 4AQ8A 4XVJH 2GSGB 5C0NC 2QQQA 3U6XS 3D1MC 3UP6A 4MDRA 4ZMYA 1KBWA 1XD1A 5JW4N 1L9MA 2BOCA 2VMJA 1P7KB 3H4FA 3B34A 4O2CA 3A24A 4TNWK 1OCOB 1RUMH 4P57A 5D1XB 3AU1A 3A23A 3Q48A 1A22B 1YEGH 4F8QA 2JI3A 2QDWA 1RVFH 3RWDA 4Z76A 2DZEA 5FKAA 3L95A 4LQFH 4EZKA 4QXGL 3HB3C 1KUMA 1UOVA 1VPOH 3GSWA 3CVHL 2EC9U 2NY6C 3QCUL 3O4LB 3NJGA 4JVPA 3MNWB 4MYWB 2P80A 1OAQL 3HAEG 3WY1A 4JQXA 5ERWA 5IESH 4XPTL 2WC7A 2G60L 4WWKB 1RU9L 3N43B 3IPEA 4HFWB 5CD3A 2YWZA 2VW6A 5BV7B 2VLRA 1IBFA 1G9MH 5GRJL 1DQTA 3HI1B 1NL0H 5T1JA 3LOWA 3K0YA 1AQHA 4PREA 4OI8A 4NQCD 1GHFL 1KG0A 3D0LB 4JM2C 2BSTB 5KBPA 1JE6A 2KPWA 3O2VH 3ESMA 3VFSA 1SRDA 4PRBA 2J3SA 2Y0SA 2YZ1A 5KYYB 4L9DA 3HMWL 3T4YB 4LIQE 1DBML 1KCKA 4X6FA 5MERA 2QPEB 1CMOA 4PP1D 3SQOL 3ZTCC 4FKHA 1IAIH 1F58H 3N44F 2E76C 1YJDL 3ROOA 1XCXA 1XTMA 3C12A 5ICYA 3KPQA 4NPYA 3F7LA 2B2XH 1IAOB 2Q8BH 4GUPA 5C0BA 5JMRA 1ACZA 4NERA 2IQAB 4J3TA 3TN0B 3GHEH 3MLWL 2PTTB 4AV0A 2LVCA 4JFXB 1PZCA 4NKOA 3MACL 5AVWB 4JQIA 1E43A 4KO9A 5HTSA 4DKDC 4X7SL 5GS0H 3QISA 3F8UB 3MJ8B 4KUZL 4UAOC 1E4WH 1EJ6A 2JXMA 4Z0BL 4XMPL 3SE4A 5SWSA 4OZHB 2VGLM 2NY5C 5CEZE 5DWUH 1BMWA 1ZAGA 2FL5A 3QFDA 2OJEB 4AC4A 3OKKA 5HGDA 3LXUX 4UT7H 3J8F7 4HK0B 4L5FL 4CSZA 3GHPA 3DUHA 1JFHA 1U8HB 2ICWB 1DJGA 1J0IA 2HYMA 2CQVA 4ZX5A 5K1VA 2C1PB 2CCWA 2K6WA 2VDLB 4OIIH 4O2EB 5E8OA 1E50A 5T1KD 3MA9L 1NC2A 5KYXB 3BGFC 1T7VA 4PLNC 4JFFA 4K3GA 1QVOB 1NPUA 2GSGA 1JZ5A 4N4YB 4FQHA 4QWWC 2X2HA 5AVSB 2GABA 3KAAA 1KT2B 4IRJD 4K7PX 1NBVL 5ADOL 1P7KA 4BWUA 4ZYKB 5HVGB 4LXFA 1JGUH 2GJ6B 5D1XA 3PP3H 5F1NB 1QOKA 4Y8AA 4DQAA 4I4WB 4AEEA 1M9SA 1K3ZA 3S6CA 1AXSB 2ZUVA 3K6DA 1DJYA 1E65A 5T5FL 4ZQTA 3SE8H 1YMMD 5D7LE 2CUAA 1CPUA 3EJJX 5SWZD 3CQQA 1GAFL 5D7JC 3IBEA 3CZEA 3DX7B 2L7EA 2NDGA 4NKIL 3T4AC 2OMTB 3O4LA 2IPKB 3MNWA 5GZND 4ZK8A 5INDB 2R59A 4LLUB 2E7LA 2KHAA 5BVPL 5FKPB 2IANB 1KNOB 2Y24A 2IAMC 2VDRH 3LDBB 5FF6B 4UNVA 1DZ0A 2DRUA 3V0IA 3A0OA 5LGHH 3V9FA 1VDGA 3L5HA 2ZUQB 3K4DA 4WWKA 1HSAB 4HFWA 1SN0A 1QQDB 4M6NL 1YNLH 5I74B 1LO2L 3QT2A 3L8QA 4AGNA 3HI1A 4JFEE 4A7TA 3K2KA 3RX8A 1CD1B 3TC9A 4TRPL 1TJXA 5B39B 4KNQA 3D0LA 4HFUH 4ERSL 1VF5C 3MLPA 2BSTA 3VG9B 4EI5C 1BM3L 4WAFA 1RZKH 4K3JL 4HX1A 3GQFA 4FMFA 2DYRB 5C09D 4DF9A 2CD0A 2WV3A 2ZX5A 4FAAB 5KYYA 1DO6A 3VDBA 2NY5L 3IDXL 3T4YA 4I88A 2NOYA 2H3KA 5EN2B 2PYFA 4Y9GA 4C83B 3LMJH 3MLZL 1EEYB 1OARL 1JZGA 1OWWA 1JHLL 3NJFA 4XVTH 3Q8AA 1AI1H 4J2QA 2H2PC 4KK5C 1TQBB 2OCJA 4JO3L 4RFEB 2C9RA 3GJFK 4Z95L 3BUYB 4LHUB 5T5FA 5JW4Q 3NDZE 1IAOA 5ANHA 2XXCB 4MRBA 4PRHD 2R4RH 2XVKA 4NZUL 1JPEA 2IQAA 5DK3A 4B60A 3TN0A 5KBMA 5AKRA 1MIEL 5BS0B 4IDLA 3VDCA 2PTTA 4UQDA 4ENED 2VZUA 2WWNA 4CVWA 1ADQH 4JFXA 4P06A 1PKOA 3G5VB 2AQ1A 4KXZH 1UHVA 3MJ8A 3V7AG 4JY5L 3AM8A 2EYSB 1RPQA 4OZHA 4AEIH 1TO5A 3P73B 4GIAA 4A39A 4ISVB 5KBDA 2OJEA 2P8PA 2O5YL 2DEXX 3VNYA 2XHNA 4HK0A 3SGKC 1V05A 3GXTA 1U8HA 2ICWA 2P5EB 2Y7QB 3P2DA 2C1PA 4O2EA 25C8H 1T0MB 2WVSA 4OZFB 5KYXA 2Y6TE 5C0RL 1OF0A 2VCOA 3PQYE 1CVRA 4HD9A 1HX0A 3IGAB 4BZ2H 1QVOA 1IFHL 4JRYD 4PJXF 2DL9A 1N6VA 3MPCA 3ARYA 1S7QA 4FXGC 4GAAA 4PP2B 2AQ3A 1KT2A 3ULVL 3IDJB 2VDPB 1WFTA 4G3YL 3FZUC 4ZYKA 4F9LA 1X9UA 2GJ6A 3CDYA 5IM7B 3MLVH 4WW2C 5F1NA 3TWCL 1AGBB 1GJUA 4I4WA 4KRPC 4IOSD 3JUYA 3IMRA 3JVFC 5FGBA 1AXSA 4L8SC 2ZOUA 3WIAA 5DJCB 5JHDD 4PWKA 5LDUA 4NZTL 4JM2D 4WFFE 3RTLA 4ABVA 4MNQB 4R26H 4GXUM 5H2BB 4JPKL 4TULL 1VEPA 4Y7MA 3DGGA 4XHJC 2FK9A 1HL8A 1R3HB 4LL1A 1FBIL 3DX7A 1UD8A 3O2DA 5SX4I 1F6LL 2OMTA 4YHKL 5HDQL 2IPKA 5INDA 5FS5A 4LLUA 1IC5L 1P84K 5FKPA 2IANA 2J5WA 1KNOA 4AMKL 4NO0B 3UCRA 2XX1A 5FF6A 4C58B 2XQ0A 4AK2A 4DO5A 2MKLC 1BFVH 2JLPA 1FFPB 3BIBX 2FZ3B 1HSAA 4EPSA 1QQDA 5F6IB 1X4YA 2L04A 5EA0L 3VFPB 4OKDA 1JYNA 1P2CB 1WC7B 1RZFH 5CR1A 4WY7L 2O6PA 1XCQA 3NK3A 3CVIH 4IBYA 1CD1A 4ODVH 5B39A 5ADPL 2WOYA 3UC0H 4CC4A 5KS9B 5D9SB 5AVUB 4WTXA 1USQA 3IJYB 3X1EA 2BWQA 1H3PH 1U6AH 4N6QA 3CMOH 1ZLEA 5EN2A 1MFDL 2X6CA 5DR5L 4C83A 1EEYA 3O4OC 3U7WH 4H44C 4F57H 1A0QH 1ULVA 4E5XG 5CJQH 2MJWA 1OQOA 4L23A 3L3HB 4RFEA 1L7IH 4LOUC 5FYLE 5EU4B 1HCZA 3BUYA 4LHUA 4GINA 3AT9A 4TUOB 3ABKB 4L4JA 3SDYH 3DUUB 5BS0A 4N90E 3BN9C 3MREB 4HGKC 4JM2F 2OAAA 5C8JB 3GK8L 1W0YT 3U9PH 4N2KA 1N10A 3G5VA 5E2UL 3TTYA 4GAYB 3QNYB 1F45A 2EYSA 4PJ5D 5L9DL 3C60D 3O8XA 3P73A 2YEZB 4ISVA 5CZKA 2YPLE 5AZEL 4M5YL 4ACPA 1XCTB 3HRZC 1DQLL 4NQDD 4HBCL 1KBVA 2P5EA 2Y7QA 2R69A 3HNTL 3IJ9A 4QIRA 4H88L 4U6TA 1YEFH 4ZUVB 4EF3A 1T0MA 1NGXB 5GJTH 4OZFA 3TYGH 3ZOAA 1E8ZA 3V5KB 2O6FA 4GMSL 1Z9LA 4XMTA 3MRGB 1YAZA 2X70B 1G9NC 15C8H 1OAYH 3IGAA 3GSNH 5EDSA 4FC3E 5C97A 3Q44A 4PP2A 2EH7L 2I32A 1A14H 3IDJA 3EHBD 1RMFH 5T1DL 4BH8B 1DBBL 5JZ7D 1KGCE 1Y7VA 5F1KC 3ZYJA 5IM7A 2AW2A 3A6OA 1AFVH 2WLZA 2YMXL 1JVKA 1IM3B 3HBGA 4OD2B 1I75A 4LSPL 3ULUD 4HCRH 4NQQA 5EOCH 5DJCA 5FM5M 2HKHH 3F6LA 3FRPB 1QWHA 3CE1A 4MNQA 1QHOA 3RL2B 3RVUC 5H2BA 2GC4C 2D31B 1ZT7B 2IGLA 1A8JH 1F6AB 1R3HA 5DMKB 3OHMB 3QH3B 2XI9A 3IPFA 4YLBA 2IPTL 2ZNXA 1A3LL 1JWUB 2F5BH 4J2XA 4NO0A 3T04D 1AVAA 1TETH 3CQPA 2Z31C 4HWEL 4LSQH 5DFWH 4JZJB 1FFPA 4N8CL 1CFVH 2FZ3A 4MB4A 3G6JB 3AZUA 4K9JA 4AITA 3VFPA 3OL2A 1P2CA 1WC7A 4E9VA 4YMPA 3FTUA 1OOAA 3LB6C 2R2CA 4TV3A 1BAFL 4Z7QB 1UM4L 2NYYD 4LKCB 1NUNB 3F7QA 5F7AA 5KS9A 3WTUA 1U30A 3Q9QA 5D9SA 2OR9H 6CGTA 3IJYA 4OTXH 5E2WH 1BQHG 3KPSB 5K9OB 3CUPB 2IH9A 1A6UL 1PBYA 3FKUS 2CU9A 1HQ4B 1ZT1B 3MYZA 1RPKA 4IKIA 5CAYB 5H37G 3DO7B 1S5IL 3ZYIA 3ZZ1A 3L3HA 5ICZB 1JZ8A 1RV6X 3VQLA 5EU4A 1OCWL 5E1AB 4JFHD 4H8PA 4NFBA 4TUOA 3V79C 1T1ZB 2H0FA 1SVCP 1K2DB 4JVUA 4B53A 4QXUH 3ULUF 3PDOB 3KW7A 3MREA 4D3CL 5E03A 5C8JA 4UV7H 4L4VB 5DFVC 2ATKB 1CL7L 1YAIA 3DYPA 5E4EB 1KTCA 2YBGA 4GAYA 2FWLB 3QNYA 4A7SA 1HEJC 5CFAA 2OMWB 1NCBL 3WFBH 4G6KH 2YEZA 3LIZA 1ZV2A 1XCTA 4H5SB 2IDCA 4KVPA 5LGJB 3VI3B 1KB9K 2QKSA 2YKLL 2CG9X 2A0LC 5DS2A 4ZUVA 4QTIL 1NGXA 3ZHDA 2YQ2A 4JFDE 3V5KA 4PWGA 3F7VB 3BX7C 3CDFA 3MRGA 2X70A 5FUZL 4UT6L 5ACLA 2CHXA 4KI5D 4M8VA 5GRYA 3GM0A 5GS1B 3MV11 2VH5L 2YD6A 2YPVA 2ZWYA 4P5KB 2X4PB 4BH8A 4WSJA 1W8OA 4LESA 3U30B 1EEZB 2ZG2A 1DL7H 3E3QE 1QSZA 2XTJD 4HJSA 4FQIL 4FD0A 3F84A 3K74B 4JRWA 3LPFA 4NN7B 1IM3A 4OD2A 5CSGA 1VADA 4DN4H 4D94A 4WWPA 2XN9B 2IGFL 4LBAA 2J6EL 4KY1L 5F7LB 2PXYC 4Y19D 3O3UN 4IKKA 1YEHH 3RL2A 3WJLC 1IGCH 4OCMC 2D31A 2I60L 1H9VA 5I1AA 1F6AA 4GRWF 1B2YA 4N5ED 5DMKA 1JZ4A 2F68X 4WFED 2ZUXA 3IF1B 3K4ZA 1KFGA 2FQEA 1DVUA 2GBVA 2YSSB 3WCYA 4F24A 1GZHA 1JWUA 3QZWG 1NMBL 5F7HA 1HHJB 1MCEA 4OJFL 1KFAL 4JZJA 5D71L 3MYJB 4MNGE 3PWNB 1BF5A 2YJQA 1WCBB 1HZHH 5GHWL 3G6JA 3KLKA 4QYAA 3Q5OA 1WBXB 2E9GA 3MLRH 5DFAA 5B1JA 4DK6A 1AG0A 1MFCL 3GJEB 3PXLA 5F7DB 2BNUB 4H8WC 4U1IB 4JDTL 5I75C 4FADA 1I1AB 3AG4B 1IBBA 1UKQA 3ZL4L 2G5BB 4X7DC 1EVTC 4LKCA 2PR4H 1V55B 4M43H 4B0MB 4FFYL 3AB0C 2EDFA 1D6VL 3MCLH 3EUDA 3QNXB 3OLEA 1Y0LB 3GUFA 3KPSA 5F3BB 5K9OA 2CJUH 3CUPA 2AJYL 4I0PC 4P2OC 1HQ4A 4HT1L 3CG8A 4KI5F 1KEMH 4HPYL 3DO7A 5JPMB 1ASOA 4F7EB 5ICZA 2GB2A 3S5YA 5E1AA 4YE0A 2DS4A 1DLFH 1CFSA 5IJKA 1T1ZA 4IMKA 2HMIC 1B2WH 2W9LA 3F83A 1FORL 2XUWA 1K2DA 4N8PA 1UOKA 1MEXH 3FO9B 5CP3H 3HNSH 3PDOA 4LIQL 1NEZB 1TVHB 2PABA 1FZOB 4HGWB 1QBLH 5CJ8A 1NCDL 4L4VA 4E9LA 2ATKA 2ZXDA 5J6SA 4AH2B 4LCUB 2RR3A 2RGSA 2NXYD 3LJ3A 1OD7A 1AHKA 1P9MA 1QASA 1ZCRA 2X4UB 3SCMB 2OMWA 1V3KA 2DDQL 1GH7A 2FVNA 3K6OA 2XA8L 1OAKL 4L8BB 3PF2A 3MOAH 2J4WH 4H5SA 3O9WC 1U4EA 2L8AA 2WNGA 5DJ6B 3NCBB 5LGJA 3VI3A 3OB8A 1XX9C 2VXSH 4U0RB 4LEXH 3LH2L 4C55A 1RZGB 1T0NB 1UENA 1JPSH 1UJ3C 3F7VA 4N0YH 3OKOB 3ZPDA 4QRBA 5H8DA 2VLKE 1AAJA 4PJ8B 5EBMB 4FI6A 3A3YB 2PWGA 4BFNA 1AXTH 4BHUI 5GS1A 2PW2B 4WO4B 1TZIB 1I8KB 1NEUA 4P5KA 2X4PA 1EEZA 1CXLA 1SY6H 3IU4H 4H8WL 2OSLB 1CD8A 2FT8A 3X17A 5DLMH 1UD5A 3OVUB 4BFFA 5F9DC 1RHHB 3MRLB 2XN9A 2Z34A 3VMPA 4GXFA 4KHTL 4MQTB 4CNIB 1WS7A 1IT9L 4XVSH 1NINA 2CHZA 5FEBA 1N3NB 3IF1A 3Q2NA 1L0XA 1I3UA 2XC8A 3PGFL 4ALAH 1G6RL 1G7QB 1TVBB 2IC2A 3TTSA 1Q72H 4R84A 2L7QA 1RLBA 1ZLWH 3D87B 4LARL 1HHJA 3MZGB 3EYUH 2BOLA 2DIBA 4JO2H 1AZZC 3AWFA 3MYJA 3PWNA 5JMOC 1DQVA 1WCBA 5DEJA 2OM5A 1QEXA 1WBXA 3OR6B 1JI2A 4QOKA 2XFXB 1MELA 4Q9BA 2NYKA 3C6LB 4J7RA 4M29A 5F7DA 2BNUA 1D5ZB 4U1IA 3ZVVA 1FVDB 1I1AA 2B59A 2G5BA 4BSWB 4QKTA 2VDKB 5D7SH 4R7DB 4WRLA 5IVNA 1DJWA 4R4FH 4XCNB 1GGBH 4PJHE 4GG6F 3TVMD 4Q56A 3QXWA 2PP9A 4NO3B 2AFNA 2Q20A 2IWKA 3MAWA 3QNXA 4QJ4B 4HXBL 1I53A 1Y0LA 2FWOB 5F3BA 1YYLL 4YSOA 1UZ6F 4HQQH 5LKNA 3H2PA 5JPMA 4F5CE 2FX9L 1QNZH 5CZVH 3T8XB 3ZDYE 1UH3A 4F7EA 1KLGB 3LS4L 3WFCH 1X9QA 2YR3A 1YQVH 4P4KB 4HD5A 3T2NH 2UWEB 1EO8L 1RURH 3QDGD 3FO9A 2IH3B 1MRFH 3UAJC 1GOFA 1A7NL 4ZMWA 4O58L 3L4YA 5MP6L 4IRSB 3K0WA 1TVHA 5C3IA 1FZOA 3KR3H 4HGWA 4U33A 3BCDA 1UB6B 3WKQA 5L4JA 2OMZB 3DSNA 5GGRB 1PCXA 4RETB 3BFQG 4AH2A 2IBBA 3CCHB 4LCUA 2ZX8A 4YHIB 3EBHA 3ELAT 2X4UA 3SCMA 4X50A 4JFVA 1S7XB 1SF3A 5TF0A 4XN1A 1FO0B 4C4BA 4L8BA 3WEMA 1DCLA 3DMMB 5DEZA 5DJ6A 4RZCB 4C56B 3NSJA 4BQ9A 4KHXL 5D7IB 5GGQH 4LCWD 3KJ4C 5FO8B 3EBIA 3TA3B 4BFOA 1TT6A 1RZGA 3MUZ1 1CXEA 1OT2A 3QEQB 4ZS7L 1AXIB 1C7TA 4KX7A 3OKOA 5LG6A 4WF7A 4XPAL 5GJSL 5IZ7A 4PJ8A 5EBMA 4M9PA 4Z18A 2CDFB 1KGIA 2X2UA 3SGDH 5KYWB 5L7XH 2PW2A 4WO4A 3ZMRA 1TZIA 3U1SH 4P2RB 2NR6A 4YHLH 1I8KA 3ZYOA 1I31A 4FXKB 2ZSVB 4ABQA 2OSLA 4ICXA 5HGHB 5J13C 1BF2A 1RHHA 1G43A 1CR9H 3G5XB 3MRLA 2ISDA 2EICA 4RGNE 3WXWL 5EU6E 4F80A 5FYKH 5J56B 1NAKH 4CNIA 1F97A 1CE1L 2EDOA 3V6ZB 4DOHE 3RFZC 2B9AA 1N3NA 5FPIA 3IXAB 2WD0A 4FFVC 3QUXC 1DDTA 2XYBA 3OMNB 1I7RB 1G7QA 1GA2A 1TVBA 4J39A 3MRDB 2EIZB 4QI3A 3UZQB 1UQSB 5E2JA 1G9EA 4YGAB 4YUEL 5IMLA 3NCEB 2IQ9H 2W59A 4DN3H 1JRHI 1E4XI 1PFOA 4DK5A 4XMZA 1LQSR 1KYDA 5DHVB 3SPVB 2X87A 3OR6A 5DK0B 2VJ0A 2HUEA 3ZKNC 4EIBA 2XFXA 4F58H 2H5UA 5EZOL 1ZEAH 1L7TL 1PGRB 2PYEE 2UZYB 3C6LA 1D5ZA 1FVDA 3OWRA 2CNYA 2VAAB 4Z7UB 3SKNB 5CMAB 4BSWA 4XP5L 4R7DA 2EXWD 4XCNA 4XP9L 2AXFB 5FCUH 5HVWA 3GF8A 3QUZA 4NO3A 3WD5L 4F27A 2C26A 1GMEA 3QUYC 1BEXA 1PTZA 2QADB 3GSUB 2FWOA 3EBGA 5AQ0A 5I82A 2WNWA 3HC2A 3W0WE 4HUCA 1F3RB 5F2FA 1FGVL 1G7JB 2X12A 5EEUA 1EZUA 2HT4C 3IDGB 5CBAB 1QFPA 1TZHB 3T8XA 4MLIA 4XT1C 3C08H 1IO4C 2UX7A 1IGJB 1KLGA 5DVLA 4YOKA 3VGAC 3GEFA 4APQD 5IOKA 4NCDA 4Q0XH 4XXCC 4K7FB 4P4KA 2KL6A 2UWEA 4NOFA 1E3ZA 1F90H 3VRJB 1U8MB 5HYJE 5JHAA 3ARSA 1EUTA 5BW7C 2IH3A 1OLLA 3CWGA 4AQAB 4IRSA 3VD3A 4QRPB 3WLBB 1RIVL 3WO4C 5ICUA 5EZJB 1QHQA 4JG9A 1MI5E 3Q8EA 2OMZA 4JUTA 5GGRA 1Q90A 3CCHA 4DTGL 4YHIA 5LNEA 4OB5L 3CH1B 4MAYD 5FYLL 2KZBA 5J11B 3ECBB 1S7XA 1FO0A 4C8XA 2CKBH 3RTQB 2Y7SA 3DMMA 3O3AB 4YQXL 3FULA 5JNYB 4RZCA 4BWTA 4Y1SA 2IALB 1A47A 5D7IA 2WZ6A 3K71B 1BYNA 1WG3A 1H3GA 2F74B 1ZMYA 2AXJA 3PL6D 4PSRA 1OP5H 3QORC 5HHMB 3TA3A 5FO8A 4R4NC 3QEQA 4OCXL 4L3EE 3L4WA 1REIA 2ZKWA 4UINL 4HEPG 1RIHL 2CDFA 1KBBA 5K33A 5KYWA 2CO4A 3KLDA 3VSVA 1IC0A 2FQFA 4P2RA 3RL1B 2VR6A 5GSVB 3V0HA 4AEHL 4K23L 1PD1A 2FX7H 2ZSVA 4FXKA 4Z7WB 1ZPUA 4AGMA 2WM0A 5HGHA 4W6XB 5HHOD 3HR6A 4GW1B 3G5XA 2X6AA 2RJMA 4ZFOL 4G6AC 5KBLA 3BWSA 2QZQA 2ALWA 3ZKJA 2X2IA 2YD8A 3JWNE 3MLSL 3V6ZA 3II2A 1DHKA 1OAZH 2HLAB 3GRWA 2HPTA 1CTNA 5CU9A 5F0LB 1KJ3H 1UD6A 3BSZL 5G4OA 4PJ7F 2VDMB 4P8QA 3C09B 1I7RA 4XZUA 4J27A 3MBEC 1U92B 3L13A 2AZUA 3MRDA 2EDHA 2NZIA 1D2OA 2EIZA 2P5PA 3BD5A 2XWDA 4KXDA 1UQSA 5IQ9B 5SX5K 1JFQL 5C08D 1ZJAA 1TCMA 1UYWH 2CH8A 4S1DC 5ISZB 2EIMB 5DHVA 4TUKL 1GW0A 3SPVA 5DK0A 2R1XB 4F7TB 3KS0H 4WK0B 2G75B 7FABL 3W5NA 2UZYA 4JHWL 4O4YH 3RPKA 4YWGH 5DMIL 2VAAA 4J3BA 4Z7UA 3SKNA 3PWPB 4LU5L 1YMHB 4N2DA 5CMAA 4MMXC 4Y4FD 5FFGA 4HG4K 5I8CB 2AXFA 4Q9CA 1LO0H 1HNGA 2PP7A 2PPAA 2E6JA 4FA7B 1JZ7A 1UZ8B 3GMOB 3PDDA 1N12A 3GSUA 4I5BA 4MHHG 1WD8A 3MFFB 3TBCA 5BJTB 5C92A 4Y1AE 4JGJA 3UBGA 1G7JA 1WFUA 5KSAD 3ESPA 3E3QC 3IDGA 3RURA 3VMOA 1TZHA 2BH0A 1HIMH 2VUOA 5CBAA 2K6YA 1LEKB 1IGJA 3ZTNH 1TENA 4LSRH 1Y6NR 4K7FA 4NT6B 1USZA 3QDJE 3VRJA 4PVMA 5D2LA 2A4EA 1U8MA 1ZKAA 4QRSB 3SYQA 3FNKA 1B4LA 2MOQA 4FQJH 4AQAA 3CHSA 1I9RH 5FDWB 1UCTA 3PREA 4QRPA 3WLBA 4LEEA 2UVEA 5EZJA 5JYLA 2VRQA 5EUKB 1X9RA 3BSZA 5KG9B 4HPHA 4P46C 4CAGA 2DM3A 4R2GB 4J3XA 5F8RC 5IMOB 2O30A 3LQAC 4E9RA 3CH1A 2AQRA 5BOPA 1PZDA 3UIZA 1GS6X 2LABA 3ECBA 1A7QL 3Q6FB 2IADB 4NN5C 3ABGA 3W81A 3RTQA 3KPOB 3QUML 4JGHA 1GKEA 3O3AA 4OZIE 2Z9TA 3NAAL 5HI4C 1C8QA 1KYFA 2ESVD 3MUHL 5AEAA 3ATEA 2IALA 1QRND 4UQ3B 1AZRA 1UEYA 3O6LH 2UXGA 5FYKD 5JIIA 3K71A 3I85A 2F74A 1M05B 4FFVD 2ORBH 4ZT1A 3HG2A 1EHAA 3CPLB 5EOQL 3QQ9D 1PLBA 1EZVY 5ACZB 5F9JB 1K5NB 2IEPA 1SDYA 2FUQA 3C87A 3UTPE 4Q14A 3UJIL 1F4WL 1EAPB 3RL1A 4N2FA 5GSVA 4ZTPH 4R6UA 4ZX4A 1Z3GL 3AWEA 4Z7WA 1BMZA 3OXRB 3VE0B 5EWIL 2NTSP 4UM9D 4PW3A 4GW1A 3RVWD 3LZQA 2NTFA 3TNNB 3ARDB 1T7WA 2VJ8A 3BYYA 1JV5B 3IM1A 1VB9A 1ACXA 4RFOL 2HLAA 1BD2D 5I1EL 3MXVH 5TQ2H 4F7CB 4Y4KB 1TPXC 1ZIAA 2WUCH 4KI1A 1U92A 4YXLL 3LRHA 4XBEL 2FLMA 1J8HB 5IQ9A 5KVFH 3NZUA 3V9CA 3FB6B 5TD4A 4GP4B 1AYRA 5ISZA 3SBPA 1G87A 2DQFB 2R1XA 1VZIA 3QUMA 4F7TA 1YYCA 2HB0A 2G75A 3RGBA 1NLDL 4TNWF 1EDYA 4ZZFA 3PWPA 2YK1H 1YMHA 5I8CA 4I1PA 4FQCL 4BV1A 4UQAA 4YZWA 2FNBA 3MV8D 4I3GA 5CJXA 5I1JL 5DT1H 4BK4A 2NY4B 3SE9H 1BEYL 5LVEA 1UZ8A 3GMOA 3LNGA 4HK3J 1JPGB 2A4CA 3AMKA 3K1KC 2BHFA 3MFFA 5GQBA 2EYTB 4OSUL 5BJTA 2N7BA 3DOIA 5JQ6H 2LAGB 4B9KC 1AR2A 2HWZL 2D7PA 3P11L 4UMGA 4XX1G 3TJHC 2ZF8A 3X1BA 5IIEB 2NY3B 3HC4L 5DMYA 3R8QA 4YE4H 2X0UA 2ZOTA 4OQ1A 4FQLH 4YXKL 3UP1A 3ASNB 4KKLC 3EFOB 2LFEA 1NFDE 4NT6A 4POYA 4M5ZL 3VXMD 1MWOA 1KYAA 4QRSA 4JN1H 4AQ1B 3ME0B 4OF8A 5DC4B 4JDZB 3B9KB 4MXQD 5F7YC 5FDWA 5IVXF 5FOBB 2VQUA 4LSVH 1QSFE 1RUPL 2CBOA 3L16A 5AB9A 1NWPA 5EU5B 3VXUE 4NM4H 1WTLA 5EUKA 4HYTB 1XQ4A 5KG9A 1G7LB 5TTRA 2Z91B 5ESQB 1A21A 1BA9A 3DYMA 5TGBB 3D09A 5IHUL 4NP4H 2JKWA 3II3A 1WDAA 3G08B 3Q6FA 2IADA 4YDMA 2AJ3B 1NKRA 1QD0A 1UB5B 3KPOA 5FUOH 3H42L 3J27A 4W9KC 2MCMA 2O72A 1FDLL 4UQ3A 1EEQA 1IC7L 1M05A 4OU3A 1H9DA 5DSCB 3BLBA 4XI5C 3H9ZA 1WS8A 3CPLA 5F9JA 5ACZA 1K5NA 4Y5YB 2H1PL 2WXOA 4RGMC 4ZO9A 1WPCA 1T22B 3ABLB 4QXGH 1EAPA 1DR9A 2KDYA 4NN6C 1DE4A 2E8ZA 3JTTB 3D2UB 3MRKB 2QR0A 5GIRB 3CVHH 4XMWA 2YJLA 2OR7A 3QCUH 4NM8L 2R56L 5HBBA 4XPHL 3TLRA 5IQNA 1BOYA 4M7ZB 1WGVA 3MNDA 2OULB 4KPHL 4RRPG 3TNNA 3ARDA 1FNEB 1U2HA 1PD0A 4XPTH 5H4YA 1JV5A 3UDWA 5DD0L 4AGOA 1MY5A 4LOEA 3MQIA 2G60H 2K4AA 3BHBA 3DJRA 1RK1B 3PRZA 5EIQA 5I8OH 1A4CA 1IB5A 2ZIDA 1D6EB 1SMAA 3LZNA 4Y4KA 3P3TA 5GRJH 1JF1B 4B3VA 1JZDC 1J8HA 1UJTA 2EEXA 2Y1AA 1GHFH 5DC9B 4HKBB 1M2VB 4UIMB 3OKEB 4OFPA 3FB6A 4TN9A 2DQFA 1QRKA 1ZHNB 3HMWH 1J9RA 1DBMH 5FR3A 3ML8A 2APXA 1HJBC 4EDWH 4NO5B 3SQOH 3TIEB 2AJZB 4UNUA 3ATDA 4F20A 3RVVD 1MJ7L 4E9XA 4S0HA 3B2XA 1DBAH 3H54A 4H20H 3ZZLA 5I15L 1JPGA 3KH4A 2EYTA 2IVFC 3QCTL 4BXSV 2WB1A 5IIEA 1LP9B 5GXBB 5BRQA 2BIQA 3SHSA 3TF4A 2D7TL 2HRPL 3CFBB 1AYOA 3C5ZD 1UT2A 3MACH 3QFJD 5IB3B 3EFOA 3VQMA 3GZPA 4HJ0D 4AVIA 3WAJA 4RGNC 4HCIA 3VB9A 4Z0BH 1P5VB 4XMPH 4AQ1A 3ME0A 3BVVA 4JDZA 1KY7A 3B9KA 3NG5A 1LTXA 4G7VL 4ZPVB 2E6PA 1P1VA 4IGBD 5FOBA 2CPUA 2BW5A 1VGEL 3N1GC 2KLSA 4TSCL 4NQUA 5EU5A 4L5FH 4HAFA 2Y6SC 1QA9B 3QIBB 4PM1A 2Z91A 3IMUA 4D2NA 5ESQA 1A2YB 2IMNA 4G6FD 4NQSB 2DMCA 3ZU8A 5TGBA 5FGCE 2FUTA 4JREB 5SV4A 5KZCB 4X8JA 3FOLB 1FG9C 5KW9L 3BRGC 3G08A 1J11A 1TO4A 1QPKA 2WBJB 1MLBB 1T3FB 2AJ3A 4UQ9A 2QZ5A 1UB5A 3TO4D 1T0PB 3SDXB 1EFQA 5C0IB 4DHLA 3BFOA 4D0CB 1DANT 3G7TA 1U42A 5ADOH 1NBVH 2NY0B 3SDAB 4P2YA 2GSIB 1M4KA 3BKYL 4HWBL 3RI5K 1PG7H 3BQUB 4PWJA 1PF3A 4KROD 5DSCA 5EORL 3RDTC 3SOTA 1LE9B 3JYBA 5GZOC 2AVGA 2MWCA 5T5FH 4Y5YA 1CUOA 2DJUA 4DP2X 3CN3A 3TEYA 4Q7DA 2BOBB 5L0QC 4QUOA 4GQ9H 5L6YL 5TK4A 1R3IL 1S8DB 1V3MA 3JTTA 3D2UA 1BXXA 2C4FT 3MRKA 2DI9A 2P45B 4MJ4A 5GIRA 3TN0C 4NKIH 4M3HA 3THML 4WI8A 4XNZB 4WEEA 4IW4C 3VXPA 2ZUUA 2ADFL 5BVPH 5DHDA 3C5SB 3RAJH 1Q4NX 4LFHG 4POZC 4X0KB 5T3XE 4PB9H 3D3VE 1FNEA 2R8SL 3B4NA 2E7DA 1M7UA 3AM8C 1CQKA 5DZVA 3CXHJ 4XP4L 1RK1A 2Q1EA 2VSMB 3FT9A 1D6EA 4M6NH 5GRVK 1AKJB 5L2KE 1UASA 2IPUG 1JF1A 2VDLH 1W6WA 2VN7A 5GGRY 1UATA 5TF1H 3TJHD 3W82A 5MHSE 1MCFA 4ODTL 4OZGB 2BSSB 4TRPH 1T89C 3S8FB 4U7MA 1B3IA 1I3RB 4ERSH 4HKBA 1XB6A 1M2VA 2P80D 3OKEA 4UIMA 2ZYSA 1NGZA 2WTRA 1ETZB 4K3JH 2OSWA 1E6OL 1J0HA 2C34A 3K4AA 2NY5H 1WFJA 1ZHNA 3BWZA 3QDME 3T65A 4UUJB 5E8PB 2K9FB 2K3HA 1CIUA 2PCYA 1IL1B 4NO5A 1JHLH 1WAAA 3TIEA 4HJUA 4PN6A 1E3FA 2YLHA 4EUPH 3IN0A 4HWBA 1U2YA 4JO3H 2VLRD 2Y7MA 2YRLA 4K8RC 1SJHB 4MBOA 3IFLL 3L5XL 2WQRA 4B0MM 1YEWA 2DWEB 3O81A 3PP4L 5K1JA 3RY4A 2XBDA 2XIIA 5DZOA 1MIEH 1SGKA 3O2DH 4NS0A 2BY3A 5JW4M 1EHLL 1IJNA 3NCXA 1LP9A 2PNDA 2JQMA 3QIWC 8CGTA 3CFBA 4JFZL 4MB3A 5E6UB 3P3SA 4X5XB 5IB3A 4FI8A 3FU5A 2WN2A 4JY5H 4MA8L 5BMFL 1P5VA 3DPBB 1BWMA 1B88A 3UJJL 2B5IB 3EG9B 2AJUH 3JWNC 4ODUB 4E41E 4O5LL 1KJ2L 4ZPVA 2ZUQC 2QPUA 2O5YH 1O6VA 3OKNB 4MZ2A 3AWGA 2EKJA 1U3ZA 2ZWZA 3UEZA 3EJZC 3WNOA 5EZIL 5C0BD 4OGXL 4ELMB 1QA9A 3QIBA 5A6IA 3P9LB 2JV6A 4PJ6A 4RDBA 1A2YA 4NQSA 2XWJB 5JQIB 2K0RA 5AAMC 2XCMC 3CX5J 5F3HB 2HKFL 2F18A 5C0RH 1JXJA 3FOLA 1B4TA 3V0WL 4WI2A 4N0UE 2XYCA 4QHPA 4B9IA 2CDGB 2WBJA 1IFHH 1MLBA 2CGZA 3OJVC 1T3FA 3QR1A 3SDXA 4U1NB 5C0IA 3VGHA 4AV4A 4D0CA 3LIUA 5SWSD 5PAZA 4LNRB 3S36X 3ULVH 1JGEB 5I73B 5C0CE 4G3YH 3SDAA 5CGYC 1KPUB 3T0EB 2GSIA 5CN3A 1KXQA 2P44B 5EZLB 2MNUA 1BBDL 1RH8A 3FT2B 1BIHA 3QS3A 1TQBC 1LE9A 2DH3A 3R1GL 3LVEA 4NZTH 1BQRA 3FB5B 1NC2D 2BOBA 2FSEB 4U1LB 4JFFD 3LEYH 2QQNH 4JPKH 1S8DA 3BPOC 4U1KB 1FBIH 1NLBL 4TOYL 5FO2A 5HDQH 2M26A 4QRUA 2H3NB 2OMXB 2JCCE 3C5SA 4XBPB 4KNTA 4EN3B 4Y7OC 4X0KA 3NIDF 1BLNB 1TEGA 4JPVL 5D1XD 3LZFL 1UM5H 4XTRD 1UH2A 1JP5A 1GS8A 2JNZA 5IT2H 5A16B 4XNAA 3CSBA 5EA0H 4PJHF 3DWTA 1AKJA 5FLUA 3WENA 4WY7H 3JWOC 3OX8B 4KKCC 2JE8A 2HA1A 1YPZA 3AROA 4OZFH 4OZGA 4I2XB 2BSSA 4TF4A 3SDCC 3O4LD 5ADPH 1I3RA 3T3PB 3OHXB 4WTZG 2UUDH 1KN2H 4XCCH 1E4JA 1ETZA 3ESNA 3ZDYF 1M1SA 1FNAA 3VXRB 5AAPA 4U1SB 2Y1ZA 3CVDA 1MFDH 4UUJA 5E8PA 2VDPH 4WWKD 1IL1A 2GTWB 3BO8B 3UZEC 2PN5A 3OM3B 1OW0C 2Y6SD 2CO3A 5DZJA 3ZTDC 2KI6A 2QLVB 5F7WC 4AL8C 4JQVA 3BGAA 1SJHA 4DFIA 5KJRL 4LAQL 5CLYA 4LVOB 5CN2A 4PD4J 2DWEA 4PJAB 1LJMA 2NX5E 1XHHA 4OIAA 5GRXG 3DVIA 1WBYB 3L9EA 2VW4A 1OAXL 4KH2A 4UDTB 2H6PB 2VDNL 3T6WA 1KC5H 2OJZL 1WFNA 3GK8H 4HOXA 3TFKD 3RJOA 4X5XA 4DERA 3WYRA 5E2UH 2ICWI 3ZGIA 4UTAA 3DPBA 3S98A 3CXFA 5L9DH 3EG9A 4ODUA 4PJ9C 5AZEH 1NM9A 4JX0A 4N26A 3OKNA 4XMKL 4M5YH 4OLWL 2W80C 3PCYA 1DQLH 4TUUA 4HBCH 4B95C 4X4YB 4ELMA 5FC9A 5L4FA 5AVXB 4TKWA 2KC0A 3B3IB 3TN0D 3P9LA 4C56E 3V4VL 2XWJA 4TQHA 4XCFL 5CWSB 1T80A 1OGAB 1ZPLA 1IE5A 5F3HA 1NMCB 2NT0A 3BPNC 4ZSOB 3GMNB 4FCAA 2OXGB 2R4SL 3UG3A 3HIZA 3U82B 4NAMA 2CDGA 3VXQA 2W9EL 3GKWH 3NJJA 5JXEA 3T3ME 2AK4E 5C0EB 3ARBB 4U1NA 5E70A 4P3CL 2EH7H 2VN5A 4LNRA 3CC1A 1Q1PA 1JGEA 5DEGA 5AYQA 1OZUA 4AGQA 5T1DH 1KPUA 1DBBH 3T0EA 4XMLL 2BP5M 3JWOL 4P23C 5EZLA 3FT2A 2YMXH 4MCMA 2AEPL 3UJTL 3N43F 4LSPH 4IU3B 3US1A 1Q94B 4YDNA 3Q2VA 3FB5A 3FU8A 2FSEA 4U1LA 3WAKA 1OE3A 2FRGP 4FHBD 4U1KA 3N04A 1BV8A 2WQWA 3TA4D 2VB5A 5GSRB 2IPTH 1A7OH 2X0VA 2WXGA 1M53A 2CRZA 1LMIA 2H3NA 1MCPL 2OMXA 4JLRB 4XBPA 4QXVA 1W8NA 1MNNA 3QWRA 1BLNA 4AL8L 2EO7A 2GJ6D 2Z7WA 1WLHA 4ONHB 5CLWA 4LASL 3B5TA 3I9GL 1J5DA 5A16A 1QPXA 3OXSB 2BNQE 3FU6A 3GMRB 4KKAC 4P2QB 3HS0B 3OX8A 3H9SB 4UBDC 1BAFH 1ZANL 1X5KA 4I2XA 3BIKB 4NPKA 4MSWB 4DH2A 1KGJA 1OGSA 2VOTA 2YOAA 3OHXA 1FH5H 5I1HL 4N85A 5B1KA 2IAND 2WP3O 1SN5A 2NY2B 2PO6C 3L3DB 2YPVH 4U1SA 1B4RA 5AZUA 5DZ9A 3FFCB 1A6UH 1OWRM 2EH8H 3MRPB 2GTWA 2A4ZA 3BO8A 5B7MA 1H8LA 4Z1PA 4LVEA 3HKZA 4TUJB 4FA8A 1OB0A 1S5IH 1JZHA 2PP8A 4TVSa 1OCWH 2ZCKL 3KBPA 4PRAB 2DIAA 4X0NA 1BPLB 2C7FA 4PJAA 5IB2B 1PZ3A 4WW1B 1WBYA 1L9TA 5DCCA 4PGJA 4H26B 1SFHA 4UDTA 3Q43A 2H6PA 4D3CH 4RZKA 4U7KA 3AMLA 4BFKA 2GK2A 5CGYD 5HJDA 5JW3L 1CL7H 4NNYB 4W4NA 5I0WA 3ULVD 2AKRB 4FFZA 4XVUC 5A2CA 3MUJA 2LGNA 5GISL 3HG0A 4N28A 3RKDC 1P4UA 4PV8B 1NCBH 5C6PB 4JO1L 4JZJC 3B7UX 3PHQB 3MV7B 3U2JA 1Q1JL 3GIVA 2ITCB 1KCRL 2AQQA 4LHUD 3R7QA 2H9GB 2H2SD 3MJ6A 1UA6L 4X4YA 1XEUA 4H0HB 2BVPB 5GS3A 2YUVA 2HPOA 5BS0D 5CCHE 5CWSA 4QTIH 2ENJA 2CRIA 1UWXK 1OGAA 2WLLB 1N6QL 3GMNA 5L88L 1KTBA 5HHME 2OXGA 4UT6H 1H5BC 5FUZH 4KITB 4EZLA 4PLJD 6TAAA 5GGVY 3KVQA 4JG5A 4WWOA 4ZMPA 1GIGL 2OP4L 1SOSA 3ARBA 3GXIA 5C0EA 3DLQR 4MS8C 3D06A 4PY7B 3C9NB 5IFHH 1T83A 1ZWIB 2VN3A 4FOMA 2GK0B 2W60B 3KLSA 4FQQB 2DM2A 4UAHA 5JUEL 1GY2A 4CMHB 3FQTB 4FQIH 4OT1H 2A7BA 3CDZB 2P5ED 1AANA 5AZ2L 2FNWA 3EJRA 4IU3A 5TFSL 2QJDA 3ULSB 1Q94A 2GJJA 2J6EH 4KY1H 3UBHA 4QO1B 4P05A 1N9PA 1BW8A 3QK0A 4IMKC 2I60H 4DEUA 4WEBH 1O9WA 2WVUA 2K3TA 2WXNA 1HOCB 1B0RB 4GRLB 4LCCC 1V8HA 2WCGA 4HJTA 5GSRA 2CO6B 2KZ1B 3I6LE 2EDEA 1XGUB 4JLRA 3LXCA 2AJSL 3S4SG 3UACA 1P6WA 1NMBH 2KMWA 1KCVH 2B9BA 2QVMA 4NGHL 1TEFA 4OJFH 1HCFX 1Y6MR 5D71H 4ONHA 2X1WL 1ZXKA 5GHWH 2F08A 1ZA3B 3K81A 3MLXL 4YIQB 4B6ZA 3T0DA 1LL1A 4J3OH 2BXZA 3OXSA 4LQ1A 1ZE3C 1MFCH 4MNQD 1MUJB 3GMRA 2F19L 3HS0A 3AACA 1YG9A 5JOFB 3H9SA 4JDTH 3ZE1E 3LN9A 3VYOA 2Y7NA 4LHJB 3ZL4H 3PHSA 3BIKA 4MSWA 3HG1B 4FFYH 2CALA 1E42A 1D6VH 5AOMA 3WE6B 1VENA 4NO0D 3RUGB 4O02L 3D52A 2DLGA 3L3DA 2I07B 3FFCA 3SGEI 4Z8FL 2AJYH 1IZKA 5IKCB 1AZVA 3MRPA 2J1ZA 4HT1H 2WYTA 2H1LM 2B16A 1P4IL 4HPYH 5C0AE 2OMNA 4TUJA 3FUIA 5EEZA 2RQEA 4GY4A 2VLJB 1FYTB 3TIDB 5F0PB 1S7SA 4OFKA 2YN5A 1NCGA 4PRAA 1G7MB 4ZOCA 3BP5B 1MHEA 1FORH 5IB2A 1IBDA 1GGYA 2G3XA 1X7QB 4WW1A 4H26A 3NQKA 4BZ1L 5C1MB 1AC6A 3BH9B 4HAGA 4XWGL 2VXQA 2JIXB 4NNYA 4KKNA 2AKRA 1V54B 1E5AA 3D08A 4DAGL 4LGSB 3M1CA 1BCIA 3ZUCA 4WFGD 4PV8A 2DDQH 4ZNEA 2J8UB 3PHQA 3MV7A 2XA8H 4FYRA 4HU2A 2ITCA 1OAKH 3GS4A 5CGMA 2H9GA 1BQ5A 4LCVA 4TTDC 4ZZKA 2LE9A 3BYTA 5LWYL 4WFHE 3LH2H 5K39B 4ADGA 5IW1B 4ABUA 1GS7A 1NFIB 2WLLA 3A6CL 2ED9A 1CGVA 3ERXA 3V8CA 3E7JA 6FABL 3AQYA 4I1NB 3KG5A 4LLQB 3R4RA 3BXNB 4W6WB 4B9ZA 1BVLB 2AANA 4RX4A 3VCLB 3KGTA 4PY7A 2DBLL 3C9NA 2X4NB 4FYSA 2ROXA 2GK0A 3CZKA 2EDMA 4FQQA 2W0PA 4M62L 5D7KE 2VM9A 3L17A 3U0PB 4H8WH 5ACMA 1U8CB 2B20A 3FQTA 4XMXA 5JPMC 1CFNB 3CDZA 3S8WA 1J1OL 4JM0A 3RX7A 4MXWL 1SJXA 1OCRB 4QO1A 4RLDA 2VC2B 3LRMA 1QP1A 2J21A 4KHTH 4JY4B 2DWSA 3I3BA 3QYMA 1LEIB 1HOCA 5F7BA 1B0RA 4GRLA 1RSFA 3ZIMA 4BZ1A 2J2ZB 2CO6A 2ZKMX 3PGFH 4KKBD 1G6RH 3M46A 3AC0A 1XGUA 3FTZA 3PGCB 5DJ8B 4LDOB 4CJ1A 5LXGL 1HINL 3ZE2E 5IP4A 2DAVA 1M9WA 2L0DA 1CZ8L 3FBKA 4MBRA 4PU2A 4G83A 1IM3D 4YIQA 1ZA3A 2FTAA 1JPST 3GO1H 5I6NA 4S1RL 3BJLA 3NSDA 3OR7B 4Z3EA 1MUJA 1FL5B 2BS9A 1OEZW 3T6QC 5JOFA 1ACYL 2AABL 3VFOB 5JOPE 4ZMAT 4GH7B 3WBDA 3HG1A 4FQPA 1I3GL 5T3XL 5T1LB 5E9AA 5EEVA 3WE6A 4WK2B 1JZEA 3RUGA 4PBWD 1NCWL 1ZVNA 2I07A 3N40P 4XB8A 5K5YA 1YYLH 1KGUA 2GITB 5IKCA 4MA7H 1KXVA 2I5YL 1JNLL 1JXGA 1O7DE 4U1MB 3ZKXB 3T6VA 3L4TA 2VLJA 2BRQA 1FYTA 3DJSA 3LS4H 2Q5BA 1CDBA 1F4YL 1DQML 3TZVB 1EO8H 1J0YA 1G7MA 3BP5A 5DVPA 4NC0B 3H56A 1X7QA 3IBOA 1A7NH 3R4DA 4O58H 5MP6H 4GQPH 3WJJC 5I1GL 5EC2B 1CDUA 1RUAL 3BH9A 1MQ8A 3KPSD 5LLIC 2X10A 4CRPA 3FUDA 4MD4B 1CYWA 2XWZA 2JIXA 3MXWL 4N87A 4V11A 2V5RA 4JN2B 1PNCA 2FAUA 3P30L 5IJDC 3LRLA 2BRRL 2J8UA 3FUJA 3I84A 1KXHA