The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
150
|
structure length |
150
|
Chain Sequence |
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
pubmed doi rcsb |
molecule keywords |
Elongin B
|
molecule tags |
Gene regulation
|
source organism |
Homo sapiens
|
total genus |
40
|
structure length |
150
|
sequence length |
150
|
ec nomenclature | |
pdb deposition date | 2002-05-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF01847 | VHL | VHL beta domain |
C | PF17211 | VHL_C | VHL box domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Elongin C; Chain C, domain 1 | von Hippel-Lindau disease tumour suppressor, alpha domain | ||
Mainly Beta | Sandwich | Immunoglobulin-like | von Hippel-Lindau disease tumour suppressor, beta domain |