1LQEA

Crystal structure of trypsin in complex with 79.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design and quantitative structure-activity relationship of 3-amidinobenzyl-1H-indole-2-carboxamides as potent, nonchiral, and selective inhibitors of blood coagulation factor Xa.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lqeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lqeA02
2UWLA 2KAIB 3SV9A 1IQMA 1J14A 2XBWA 1DFPA 4KTUA 1DWEH 3STJA 4A5TS 2VWLA 5GDSH 1GBDA 3GCTF 3N7OA 4IGDA 2AGIX 1DUEA 3TPIZ 1C5PA 1GHYH 1C1RA 2A7JA 2OLGA 4BAMB 3A85A 1J8AA 1QJ1B 3F9EA 4E06H 3B9FH 2QXGA 3PWBA 1A3BH 3LIWA 3QGJA 3EQ0H 7ESTE 2FODA 1IQGA 2VU8E 3EYDA 4AFSA 2A2XH 4TWYA 4OGXA 1TGTA 1ZZZA 1HAVA 3RDZA 5SGAE 4KTSA 4XBDA 1VITF 1XUFA 1LHDH 2A4QA 1A5HA 1QJ6B 4ZXXH 2BQ6B 4ABGA 1YLCA 2RA0A 1AU8A 1T4UH 5EOKA 3Q00A 3TK5A 1GI2A 1QJ7B 5F6MA 1MUEB 4H6SB 4X1NU 1XUJA 3BTTE 2H6MA 3RU4D 3MU0A 3F6UH 1ZRKA 5JDUB 3ATLA 1MTUA 1GMHF 3RU4T 1V2JT 4X2YA 1BCUH 5T6DA 5JBCS 4OS5A 2O8WA 1EJNA 1UVUH 1D9IA 4AGJA 1DDJA 3AAVA 1SQOA 1EASA 4GHTA 1O38A 3LGVA 3RM0H 2VWMA 1ABIH 1T4VH 1EAIA 4Y11E 1SOTA 3WY8A 1V2TT 2ZGCA 3MU1A 1DICA 2ZFQH 3BSQA 1A5GH 3M61U 1O2MA 2BDHA 1NO9H 2H9TH 5K7RA 1SLXB 4MG3A 2VH6A 2ZKSA 4X8SH 4INKA 2VINA 2ZFFH 5HM2A 1GBTA 2J4IA 3GISB 1O3BA 3QGNB 1XXFA 2UWPA 1E36B 3UR9A 4ZHLU 1AVGH 3I77A 4NSVA 1BHXF 4I32A 3KHVA 3C27B 2BLVA 1FN8A 3NWUA 1A4WH 2P93A 5I25A 5JBTA 4R0IA 2BDIA 1ZTLA 3LPRA 1FV9A 3GY5A 1GBLA 3RXBA 4B71A 3A7VA 4R8TB 5EQRA 2BB4A 1IQJA 2GX4A 4RSPA 1C2JA 2JH6D 1KLJH 4UFEH 1OWHA 4X0WU 1IOEA 2HNTF 2H5CA 1C5YB 2SFAA 2EA3A 1VR1H 2EI6A 5LPRA 1Z6EA 1Z1IA 1RTLA 3LGIA 1SBWA 2J95A 2M5TA 4NA9H 2FOGA 1WCZA 5FPSA 2HNTC 4Y7AA 1D3DB 1PPBH 3UNSA 3A8CA 2AFQB 5FXLA 3K2UA 1G37A 1GJ4H 5J4SA 4I8LA 2AMDA 3M35A 5HGGA 2O8TA 4I33A 4IMZA 5JB8S 3RXMA 3DUXH 1LHCH 3TNTA 1BTXA 1KXAA 5T6GA 1P2IA 1KXDA 3DD2H 3BEUA 1F7ZA 2IOTA 2XW9A 4Y8ZA 2ZDMA 5F03A 1WAYB 1BOQA 1E35B 3KL6A 1N6YA 1YPKH 2ANYA 4NGAH 3VB5A 1OSSA 2WYGA 4B74A 1SI5H 1BBRE 2CV3A 1AO5A 4OS6A 1UCYK 3GICB 1XUKA 2SGDE 1UTOA 3E91A 1TNLA 2ZQ1A 5DP9A 3AW0A 5A2MH 2Y5HA 3W94A 4B2BA 1T32A 2VWNA 3F1SB 2DE9A 1LPKB 2GCHF 1LVYA 2HALA 3U8RH 3FFGA 3RXKA 3SQHE 1K1PA 2AS9A 2Y82A 2FI4E 1ZPCA 4NZQA 5GCHF 1PYTC 1P3EA 1S84A 1KTSB 2WINI 4Y8YA 2C8YB 3LJJA 1GCTC 4AORA 2P94A 4JYVH 4ESTE 2BD4A 1CHOG 2PTNA 2ZTYA 2VJ1A 3LC5A 1TPAE 3VEQB 5EPNA 1LDTT 3EGKH 1MTNB 3M5NA 1HB0B 2ZPRA 3SV8A 3SV7A 1P9SA 2A5KA 1BIOA 1CA8B 1TFXA 1GGDC 2BX3A 6ESTA 1A7SA 1GJ7B 2V3OH 2STAE 2PGBB 1F92A 3TH3H 2NU4E 3A86A 1C5MD 1E0FD 1DITH 3LOXA 3MH5A 1O3KA 3GY2A 1EB1H 1L1NA 4Q7ZA 2A2QH 2F9PA 4GHQA 1DXWA 3URCA 2QYIA 1GWAA 1GPZA 2G52A 3SU0A 4CR9A 2FOBA 3BN9A 1W3CA 2P3UB 1W0YH 1ARBA 1F5RA 1AQ7A 1AUTC 5ABWA 1O2OA 3V12A 2BXUH 4F49A 2JETC 5A09A 1PJPA 3LT3A 3U98H 1WQVH 2C90B 1NZQH 2SNWA 3RXIA 3UOPA 4Y71A 3A8BA 4X8TH 3QN7A 3TVJB 2BY8X 4U2WA 1SGCA 5G4BA 1UTKA 4YT6H 2TGAA 4BNRA 3A87A 3ITIA 3P8OA 1F0RA 3SUDA 1P2NA 1TABE 1ZPZA 1TX8A 2D8WA 1XKBC 2WYJA 1AKSA 2OCVB 4YLQH 4Z6AH 5E0GA 1QNJA 1BRCE 1HAVB 5FPYA 4RN6A 4MNXA 2B9LA 5DJ7A 3RXGA 1QIXB 4UONA 1ZSJA 3QLPH 1O2PA 3D23A 3MO6A 2B7DH 3VB3A 1Q3XA 3GY3A 3PB1E 4ABBA 2RCEA 2ZWLH 3RXOA 1HJAB 1O3AA 4RKOB 1KYNA 3A8AA 1HPGA 3RXFA 4Y7BA 1B0EA 3SUEA 1MBQA 1OP8A 2BDCA 3CP7A 1C1PA 1TIOA 2NU3E 3U8TH 2JH5D 4HTCH 1LVMA 2WUBA 1JMOH 1C2DA 3NKKA 4MPXA 4GPGA 4FU8A 1K21H 2FX6A 3GY7A 2GZ9A 2ZI2H 3P95A 1FDPA 3ZVAA 1O3PB 2NWNA 3SUFA 2QF3A 4YTAA 3GY8A 2ULLA 2ANMH 3UWIA 2WPIS 1KIGH 2Z9GA 1T8OA 2P16A 1EPTC 3URDA 4MQAA 1GHAF 3SV2H 5EW2H 2PLXA 5JBBS 3H7OA 1HAOH 3ZZ7A 1EB2A 1SOZA 2GMTC 4BAHB 4ZHAA 2Z3CA 1P03A 3S0NA 3LGWA 2F91A 1GBJA 2P8OC 1QRZA 5A8YA 2GD4B 3SNBA 3KQCA 3TJOA 3GY4A 1QY6A 3M5OA 3TLOA 4ISLA 3S9CA 1O2KA 1V2OT 3LONA 4MNYA 1Y3VA 5LGOA 1QA7A 1KXBA 5EPYA 1UTMA 1HGTH 1L1GA 1NY22 3S9AA 1C5ZB 1FY4A 5TJXA 1VITH 2V35A 1QQUA 1H1BA 2HNTE 3RXRA 4LZ4B 1LQEA 2SGFE 1ETSH 2H2ZA 5HMAA 1X7AC 1DWBH 1GBBA 1SQAA 1C5RA 5F8ZA 3SJ9A 1SGRE 2EI7A 5EW1H 1HIAA 3LGTA 1D4PB 3SBKA 5LPEA 1HAPH 1PPEE 3MH6A 2ZNKH 3A80A 1EQ9A 4INHA 2BY6X 1E37B 1ABJH 1W8BH 5CHAC 1TQ0B 2NU1E 1EUFA 1THPB 5DP3A 4IMQA 1EPTA 2Y7XA 1ESTA 1WUNH 6CHAC 2SNVA 1AVXA 5E8EH 1C2FA 2GV7A 1BT7A 1C1OA 1D3PB 1O5FH 1TNHA 2F9VA 4I8JA 2HGTH 2J34A 1DVAH 2BDYA 1PPZA 4LXBH 2VVCA 1EP6A 3P8FA 3SNAA 4X1PU 4BXWA 1K28D 5C20A 1SFIA 3E16B 3P17H 4NWKA 1B7XB 1HAXB 2YNBA 9ESTA 4DY7B 1BHXB 3AW1A 1OWDA 4Q7XA 1DX5M 5TCAA 3VGCC 1H9HE 1C1QA 4HI3A 1JIRA 1O3LA 3TK6A 1KTTB 1QRWA 3TJNA 4LK4A 1TA2A 2Z9KA 1GBMA 1WV7H 2AMPA 3DFLA 1SB1H 4AZ2B 3SU3A 3V13A 3GY6A 1GMDF 1LPZB 1IQKA 1SGFG 1C2IA 2BZAA 2G8TA 4NWLA 2CMYA 4GCHF 4H4FA 1NTPA 1Y3YA 3BIUH 1YBWA 2A7CA 2ODQA 4H42U 1WU1A 5FAHA 2XBVA 1EZSC 1O2YA 2XTTB 3E0NB 3OY5U 1AIXH 1C2MA 1KXEA 3OYPA 3PM3A 3KQBA 4OS2A 4RKJB 3UNRA 5FCRA 1V2LT 3SU5A 2AH4X 3A7TA 4FUBA 3ELAH 2FOAA 5FX5A 2Y7ZA 3IITA 3M3SA 4KELA 3NCLA 5AHGH 1GBCA 2J94A 3FANA 2XWAA 4X6MA 1P0SH 1Z8GA 3UUZA 1TB6H 3OU0A 1HLTH 3F9FA 2C4FH 2FLBH 3FP8E 4MNVA 1QL8A 1RXPA 3P6ZB 5AFZH 3FAOA 1W10U 4NG9H 1VGCC 1CT4E 2HWLB 3UQVA 5ESTE 1C5VA 4ISHH 1J16A 3MU4A 2GZ7A 5DP8A 2FM2A 2HPPH 5E2PA 3M36A 1ELDE 5A0BA 5GXPA 1C5SA 1O2RA 1V2VT 1Y5AT 4IW4E 1BRBE 1NT1A 1CQQA 1BMNH 1MKXK 1V2RT 2C8WB 2G00A 1XVMA 1YPMH 2O8MA 1CGHA 4NIXA 1MTWA 1DY9A 4WY3A 3M5MA 2IJOB 3A81A 1AUJA 1K2I1 3S7KB 1RTFB 2Q6GA 3ENSB 1D6WA 1GI7B 1GCTB 3ZVEA 1GJ5H 1BQYA 1AKSB 4MPVA 3RMMH 1P57B 2FLRH 4ABFA 2FP7B 4AYYB 4DJZB 2FESH 1PQ7A 2I6QA 3S7HB 1O2SA 2QA9E 2PTCE 1NRPH 1GGDB 1GHZA 1B5GH 1LHGH 1RD3B 2FX4A 1T31A 4Y0ZE 3KQDA 3T62A 4B76A 2BDBA 4ABHA 1KY9A 1DXPA 3PLBA 3RP2A 1LVBA 3RXTA 1BTZA 2J2UA 2PR3A 4FXGH 4K1TA 1PPCE 1AWFH 2VIQA 4UFGH 3MI4A 2H5DA 1EATA 1F5LA 1O2VA 1FZZA 3SN8A 1H9IE 3EAJA 1C5QA 1Z8RA 1YCPH 3PYHA 1XVOA 1O2TA 1SL3A 4XBCA 1MD8A 4M7GA 4X8VH 2JETB 4CRCA 4FUHA 1UVSH 2OQUA 4BXSA 4BAQB 3BG8A 3O8CA 5E0JA 1NRNH 1ANBA 1NESE 1AFEH 3DHKH 3TIUA 1THSH 4H6TA 1KSNA 1GBIA 1P06A 3Q3YA 5J4QA 4DIHH 2BDGA 1K1IA 2GDEH 1FPHH 2A7HA 1XXDA 3TH4H 1O3MA 3ZYDA 4MTBA 1DM4B 3ESTA 1GJ8B 2PKSC 5GWZA 1S0QA 4Q7YA 2B8OH 1Q2WA 2BY5X 1O3IA 2QCYA 3LKWA 3RXDA 1O31A 2UUKB 1V2NT 3SJIA 1YP9A 1O39A 4AGKA 1L0ZA 1TRNA 2Y5FA 3SNCA 2VB0A 1A46H 1O3NA 3U8OH 3GCHC 3QTVH 1ESBA 3P92A 2BZ6H 2XCFA 3SUGA 1O3DA 1XUHA 3PV4A 3FP7E 4X6NA 2BLOA 3SGQE 3RU4E 5BRRE 1S6FA 5GIBA 1V2WT 1RRKA 2NU0E 2Z3DA 1C2KA 1RJXB 1HIAB 1ZSKA 5LH8A 1LVOA 3NUMA 4B2AA 4CR5A 2VWOA 2WPHS 5T6FA 3MNCA 4OS7A 1GI6A 5A8XA 1UMAH 3EDXB 1C2GA 1BB0B 3IG6B 1EPTB 1GCDA 1V2ST 1W7XH 1DWDH 2PW8H 1S83A 5A8ZA 1ZPBA 2VIVA 1GG6C 4IC6A 2ZU3A 3MH4A 2GMTB 4IN2A 1GI9B 3MNBA 8ESTE 3MU5A 1PPHE 1Y5UT 3SJKA 3SV6A 5HXFA 2A5AA 3UY9A 3A83A 3A7WA 3SU6A 1C5XB 2P8OB 2J9NA 2G55A 4DURA 2BTCE 2G51A 3AVZA 3P8GA 4K1SA 1OP0A 4X1RU 2QAAA 3PMAB 2FS8A 1Y5BT 3RLYH 1EZXC 1BMMH 4FUCA 2LPRA 3MFJA 1EZQA 5DO4H 5DGJA 3K6ZA 1OX1A 1AI8H 1GDUA 1XUIA 4X6OA 3BTFE 3UREA 3ZVDA 4ABAA 2ODPA 1IAUA 1GDNA 3CENA 1SHYA 1MU6B 3ZZCA 2OC0A 2ZFSA 3A88A 3BIVH 5JB9S 4BAKB 4WF8A 1W12U 3M5LA 3SHAH 1N6XA 3RXEA 3IWMA 4XFQA 1S6HA 2F83A 3TJUA 2BD8A 1ZGIA 1JWTA 4J1YA 4NIVA 3O8RA 2OC1A 3A7ZA 3L33A 1OWJA 2AEIH 2F9BH 1OWKA 3R3GB 4YOGA 5CHAB 1ELCA 2Z9JA 3RM2H 4NFEA 3TH2H 2YNAA 4ZKSU 3HK3B 3TGIE 2CN0H 2PHBA 4U32A 3MMGA 1N8OC 1QURH 6CHAB 3B23B 3C1KA 1TPSA 4KTCA 4Y76A 3SJ8A 1QFKH 1C5OH 2QV1A 2BLWA 5FBIA 1ZSLA 1WTHD 4WXIA 1CHOF 3UWJH 1V2KT 4UFDH 1V2QT 1Z71A 5CMXH 4ZKOU 4TYDA 4KP0A 4ABEA 3ZYEA 1AMHA 1YKTA 1TMBH 2O9QA 1GHVH 1EKBB 1TBRH 3DA9B 1VJ9U 2ZEBA 2GP9B 4F4OC 3TK9A 5B6OA 1P2KA 3VGCB 3I78A 3PTBA 1P3CA 2A0QB 3PTNA 5C5NA 2O8LA 3MH7A 1SFQB 2TPIZ 2ZG0H 1SC8U 3VB4A 2ILNA 1PFXC 3PMHB 1O3HA 2XRCA 1GMCG 2AERH 1ZJDA 4I31A 4WMEA 4AN7A 1G30B 1ZMJA 3RMLH 4B73A 2ZDVH 3QZRA 1ELTA 2TBSA 1FONA 4WMDA 1ANCA 2F9OA 1GI4A 3T26A 1HAZB 3SNEA 3QX5H 5L2YH 4XOJA 8LPRA 5C1UA 4K5ZA 3P70B 3ZV8A 1TBZH 1PQ8A 1Y59T 1K1LA 2ANWA 3T29A 2FTLE 1K1NA 4AYVB 1AWHB 3BTKE 5ETXA 1O30A 1BTPA 2O8UA 1O2ZA 1MCTA 2HRVA 4U01A 2XBXA 2GT8A 1OP2A 4GAWA 1XKAC 1P12E 2WPLS 5EG4A 5E2OA 1CBWC 4FUIA 8KME2 4ISNA 2GDDA 5EGMA 3T28A 1H8IH 1BBRH 4X6PA 4X2WA 2RA3A 2BVSH 1MTSA 3EA8A 2GKVE 1WBGB 3M3VA 3TGJE 4TY6A 4ZH8A 1VGCB 3Q77A 4GSOA 1JXPA 1TGCA 1AGJA 2FOMB 4IN1A 4Z0KA 5AVDA 1IHSH 3NXPA 3R0FA 3SI3H 3SU4A 1TPPA 2EEKA 1ELFA 1C2EA 1O5EH 1O3CA 1NN6A 5CE1A 1Y3WA 2ALPA 2BX4A 3BTQE 1OYQA 1TYNA 5DP5A 2XCNA 3GYMA 3KN2A 4AFUA 3GDSA 2ZGJA 1C1UH 2CGAA 2VGCC 1SPJA 1BDAA 2OUAA 1CT2E 4NZLA 1AB9B 1O2QA 1BRUP 2PUXB 1ELVA 2D1JA 1GBFA 3SGBE 2ZFPH 4DCDA 1SG8B 3A7XA 5AF9H 3OY6U 3RXUA 3VB6A 1YC0A 2VIDA 3RUOA 2FYRA 3GDVA 3LU9B 4YOJA 1S85A 1YPLH 1D3QB 4BTIB 3RMNH 1ZMNA 2Z9IA 1BRAA 1CT0E 2BD3A 3LGYA 1MQ5A 2ZA5A 1KLIH 1RS0A 1VCWA 1F0SA 3AASA 1FY8E 1DT2A 1WYKA 1EOLA 1O5AB 2C93B 1YPEH 1GL1A 2FOHA 4ZKRU 1KLTA 1QRXA 4TPIZ 1F5KU 2UUFB 4AFQA 4MDSA 1NFUA 1UJ1A 4QT8C 1TONA 5DKMA 1CHGA 4YOIA 1ACBE 5DP6A 2H9HA 1YPJH 3QDZB 1AN1E 2ASUB 1W2KH 7GCHG 2ZU1A 3ZZ9A 1TNKA 3BG4C 1VCQA 4ABJA 1SGTA 2P3TB 4AOQA 1FPCH 4INLA 1FY3A 2ZF0H 4FUFA 4X1SU 4JK5A 1GI8B 4BOHA 3BF6H 1LO6A 1G3CA 1HXFH 2ZCLP 4ZAEA 2CXVA 2ZGHA 2XC0A 2NU2E 1MMJN 1V2MT 1O35A 5PTPA 1BTWA 2Y80A 4O03A 4OS4A 4ZHMU 1K9OE 4NIYA 3HGPA 1C5WB 4A1XA 2ZO3H 3SORA 2R2WU 2PKSB 1OYTH 1QCPA 1YPHE 4WH6A 3T25A 1O3OA 1QB1A 3ZVGA 5DPAA 1B0FA 3L6PA 4O3UA 4FUDA 6GCHG 1MKWK 1DUAA 3E6PH 1JRTA 5L6NH 1Y3UA 3GCHB 1QHRB 1HXEH 4MPWA 3HATH 4JK6A 3GCOA 4Y79A 3KNXA 1E34B 2F9UA 4JCNA 3O8BA 1HAYB 3M7UA 1SLUB 4D76A 2EC9H 2W5EA 1A3EH 1SSXA 1ELBA 2I6SA 2AGEX 1EX3A 1O0DH 2Q1JA 1RGQA 3RXJA 1J15A 2VIPA 1TWXB 4NA8A 4TPYA 1UK2A 3DFJA 3LGUA 2W7UA 4UEHH 1O2IA 4ABDA 1MQ6A 1BTHH 2G5VA 1IHTH 4KGAA 3TITA 2BY9X 3F9HA 3ZZ8A 1HBTH 1GI1A 1GHBG 3MTYA 1OKXA 5FX6A 1P2JA 2OINA 5LPFA 2FYQA 3PO1C 3VXFH 1GG6B 4E7NA 3GCNA 5AFYH 2BMGB 2Y5GA 1NFXA 1C5TA 2ZC9H 2C8XB 1G2MA 1M9UA 5T3HA 1K1JA 2ZZUH 1HAGE 3PLPA 1K1OA 2AMQA 1P2MA 1ETTH 1MZAA 1YCPK 1J17T 4SGBE 2GCTC 4A6LA 2FEQH 1IQFA 1SGYE 1O34A 1O2XA 1Y8TA 1DWCH 2R3UA 1LTOA 2THFB 1DS2E 1D3TB 4DG4A 3SGAE 1YLDA 1C5NH 1GBAA 2GZ8A 1H8DH 1ZHRA 1CU1A 4LOYH 1P01A 4DVAU 4A92A 4K3JA 2ZU4A 1NFWA 3SO3A 1NRSH 2JH0D 2GVFA 1YM0A 4VGCC 2AIQA 2BD2A 3Q3XA 1ANDA 1W13U 4FU9A 1T8NA 4Y0YE 1GVKB 3A82A 1K1MA 2ZFTA 1O2WA 4CH8B 3K6YA 1G3DA 2D26C 3MYWA 2A31A 4XDEA 4E7RG 1AVWA 3BTEE 4OS1A 1SLWB 3VB7A 1S82A 2BDAA 1TOCB 5DP4A 1FY1A 4K8BA 4NSYA 1AHTH 2PWXA 1N8OB 1W14U 2QY0B 1LMWB 1NC6A 2FDAA 4ISOA 2PUQH 4ASHA 1QR3E 1KXFA 2WV5A 3VPKA 5DP7A 1KDQA 1UVTH 3FVFB 3MWIU 1IQNA 5EQSA 4I8GA 3RLWH 1S5SA 2VH0A 3QUMP 1YPGH 2BYAX 2FZZA 1SGFA 1AB9C 1THRH 1TGSZ 4D9QA 2A32A 1C2HA 4CH2B 2PGQB 3ATKA 1VCPA 3K65B 5IDKA 4UFFH 3A8DA 1NU9A 3I29A 2W3IA 1CVWH 2ZU5A 5BPEA 1O2UA 1G2LA 1QBOA 4HGCA 1P2QA 1MZDA 1C1TA 3SU1A 3UR6A 4ZROA 8GCHG 5JPMH 3RXAA 3BTME 3S9BA 4CREA 1DE7H 1HRTH 5A0CA 4MNWA 3NK8A 1A2CH 4Y10E 3UQOA 1TAWA 3SU2A 3F9GA 1TQ7B 1O33A 1CSOE 2BOKA 3B8JA 1SQTA 1OOKB 1MTVA 2VNTA 2OTVA 2SGQE 4B2CA 2ZGXH 3K9XB 1DANH 2Z7FE 5C67A 4FUGA 4ABIA 3NZIA 1FLEE 1UK3A 1EP5A 2SGAA 1G36A 5GJ4B 5EXNA 1RIWC 2BD9A 2PKAA 2QN5T 1TX6A 4CBNA 1A1RA 3MO3A 1LPGB 4NFFA 1P11E 5FPTA 2Q6DA 3GCTG 1FAXA 1TGNA 1CBWB 1HNEE 3STIA 1TNGA 2PSXA 1IQLA 1GJDB 4UD9H 2ZDAH 4XSKU 1OWEA 2JKHA 1A0JA 1O37A 2F3CE 1EXFA 3SZNA 1ZRBA 3ZZDA 2XXLA 4CRDA 2K1QA 1SGDE 3VFEA 2HLCA 3GOVB 1YYY1 1BJVA 4XE4A 4ZXYH 4SGAE 1O5CB 1ETRH 2W26A 3KQEA 4O9VA 3U69H 5I46H 2FI5E 1GJBB 3LH3A 1O3JA 2FOEA 1VITG 2TGPZ 3S69A 2VGCB 3LJOA 1AFQC 1A0LA 1L4ZA 2CF9H 4Q2KA 3ZZAA 1O5BB 3U1IB 1FY5A 1UHBA 1UTLM 4YZUA 1F0TA 3O8DA 2FTMA 4K69A 1G3EA 2C8ZB 1C1WH 2TGTA 3EA7A 2FIRH 2ODYB 4JZDH 1QBNA 2G5NA 2V6NA 1ARCA 1BZXE 1YCPM 1BMLA 1O2JA 4THNH 3SW2B 4FVBA 4CBOA 4DOQA 2OQ5A 3MNSA 1GMHG 1IQIA 3FP6E 4JZIA 3KF2A 1EAXA 3E8LA 2BY7X 1C9PA 3RMOH 1CA0C 1W7GH 5ESBA 2BHGA 7KMEH 2WPJS 2XYAA 4K2YA 3NPSA 1NU7B 4U30A 1C1SA 3QO6A 1MKXH 2LNCA 2OC7A 1H9LB 1DLEA 2WV4A 1MAXA 1TX7A 7LPRA 1JRSA 4OGYA 4CRBA 1L2EA 2AYWA 1FMGA 2R3YA 1SVPA 2Z6BD 1C5LH 1ESAA 4AB9A 1TRYA 3OX7U 2RDLA 2PFEA 3D65E 4DT7B 4E05H 2AIPA 3ZVFA 4FU7A 2FPZA 2Z3EA 1Q31A 4I8KA 1DSTA 2FMJA 5HM9A 3BTDE 5FBEA 1EZUC 3TJVA 3G01A 1HFDA 1CO7E 4CRGA 1TMUH 1LCYA 1UTQA 3BG4B 1XMNB 1OS8A 1V3XA 1QL9A 3RC5A 1EOJA 1TA6A 3AAUA 4FUJA 5F8TA 1WSSH 4HZHA 1BBRK 1YPHC 2FI3E 4MPUA 2WPKS 2OC8A 4Q80A 1G32B 3A84A 2H9EH 2FXRA 1ZGVA 4TY7A 5DG6A 3SOSA 1O2NA 1MH0A 2WPMS 5FHTA 2D2DA 2ZPSA 1O36A 2BM2A 1HAHH 2XC4A 4WJG2 2Q6FA 3H5CB 4X1QU 1UTPA 1W11U 4BANB 2Y6TA 4GVUA 2ZECA 1SGNE 1VJAU 2QF0A 3KCGH 1SMFE 2ZU2A 1PPFE 4AX9H 3PMBB 3GYLB 4D7GA 1Y3XA 3MHWU 1ZHPA 3PMJA 1QB6A 4JZEH 2VIOA 4CHAC 1SGPE 5K0HA 2DUCA 1TPOA 1YF4A 2OP9A 4LZ1H 5F8XA 1AZZA 1GJ9B 1BJUA 1P2OA 1FUJA 5C5OA 1S81A 1XUGA 2ZHEH 3BTWE 1NRRH 4DW2U 3UOUA 1Z7KA 3LH1A 2B0FA 3MU8A 1GMCF 1SGEE 2BXTH 1SLVB 2ZCKP 3KGPA 4PROA 4WVPE 1TGBA 3M37A 1L1JA 4A1VA 1V6DA 3PO1B 2CHAC 3QWCH 3UFAA 1WOFA 2BVXH 1O5DH 1EAUA 1KDQB 3UIRA 4NCYA 3E1XB 4YM9A 2R0KA 2B5TB 1UCYE 1MCVA 2GCTB 1VZQH 1GJCB 2ALVA 2GCHG 3Q3KA 2ANKH 1K22H 1HJ8A 4ZUHA 1Z8JB 1YGCH 3V7TA 1CGIE 3ZZ6A 5H4IB 2VIWA 3OSYA 1JIMA 5GCHG 1FJSA 2FO9A 1FNIA 2ZHQH 1XM1A 3ATIA 2BVRH 1FQ3A 3M7QA 3PLKA 4VGCB 4Y6DA 1TLDA 1Z8IB 4FUEA 3RXHA 1AZ8A 3KIDU 2A5IA 1J9CH 1FAKH 1TNJA 1P05A 2ZPQA 1L4DA 2FOFA 3LC3A 4WH8A 4AFZA 1FXYA 1W0ZU 3RXCA 1QA0A 1ZTJA 3TNSA 1XX9A 3F68H 2P59A 2G4TA 4ZMAH 1SGQE 3VXEH 9LPRA 3PWCA 2BQ7B 1NFYA 4B75A 1GVZA 2SGEE 3UPEA 4NA7A 2C3SA 4JMYA 2SGPE 4WWYA 1P8VC 4O3TA 3FZDA 2WUCA 2G4UA 2Z9LA 3ZV9A 2PKAB 4JZFH 2ZHWH 1NRQH 5JBAS 1GVLA 3RXVA 5JYIA 2P95A 1TRMA 2GT7A 1O2HA 1C2LA 1GI5A 2A4GA 3A7YA 4CRAA 4K60A 2H1UA 1LHEH 2HVXA 3T2NA 2ZTZA 2IN2A 4HFPB 5EODA 1QGFA 2KAIA 4WMFA 4IS5A 4UE7H 2OBOA 5C1YA 1ZOMA 1MAYA 1ID5H 1H4WA 4X8UH 1LQDB 1Z6JH 1UO6A 2PSYA 3V3MA 4I7YH 1P09A 3Q76A 1C1MA 1GBHA 1GL0E 1UCYH 1UTNA 1UVPA 5C1XA 2HOBA 1HJ9A 2UUJB 4WXVA 2A45B 3V0XA 1ZHMA 1ANEA 3U9AH 4YT7H 3RXLA 3JZ1B 4X2XA 1INCA 5TCCA 1C4U2 4TWWA 3ZVBA 2V3HH 1BMAA 1UHBB 2IPHA 3UNQA 1UVOA 3QZQA 5L30H 1IQEA 3ODFA 1GDQA 3UTUH 7GCHF 2TIOA 1DSUA 3M3TA 1LHFH 1O3EA 1ORFA 2TGDA 3P8NA 1TBQH 4UDWH 2R9PA 2AGGX 1EJMA 2R0LA 2FWWA 4YESB 1BTYA 1QBVH 2FS9A 3MNXA 4NIWA 3ZZBA 1RIWB 1SR5C 3BEFB 4A1TA 2EI8A 1DOJA 4JYUH 4DGJA 3SJOA 2ESTE 4DIIH 1OWIA 3QTOH 1HV7A 1LKBA 4JYTA 1ZJKA 2J38A 2BLQA 4IBLH 2P3FH 1GBKA 5EQQA 5EU8A 5C2ZA 1TNIA 1HDTH 1E38B 1ZLRA 2A4OA 3DT0H 1JOUB 1F2SE 3D62A 1GHAG 1O3FA 1MU8B 3T27A 1C1VH 6GCHF 1SHHB 1KXCA 2BD5A 2YOLA 3KEEA 3TU7H 1MBMA 1TE0A 1EAWA 3QK1A 3PROA 2W3KA 3EA9A 2RG3A 2ZHDA 3HK6B 1BUIA 1V2PT 4JZ1A 2Z94A 3ZZ5A 2CJIA 3SI4H 4KKDA 3E3TA 4YO9A 1AE5A 5HYOA 2ZDNA 1JBUH 3E90B 5C3NA 1QTFA 4D8NA 2OBQA 1AFQB 1NPMA 1C4Y2 3D49H 4XBBA 2BQWB 3RXQA 1HUTH 3BEIB 1ELEE 1ZMLA 2STBE 2GTBA 1QQ4A 3TGKE 1PQ5A 4GLYA 3EE0B 2ZHFH 4BAOB 2QC2A 3HKIB 1G3BA 1C5UA 1NS3A 1A61H 3CS7A 3ATWA 5E0HA 2VVUA 3SQEE 2OXSA 4O97A 5GPIB 1TMTH 3LDXH 2FOCA 3W95A 3T5FH 3ZZ4A 1CA0B 1GHBF 2Y81A 3RC6A 1ZYOA 1CE5A 1PYTD 4BTTB 2UUYA 1T8MA 4BTUB 2ZFRH 4X2VA 1U6QA 3ODDA 3H7TA 1TOMH 1O3GA 3U1JB 3HGNA 1TALA 2XBYA 1GHXH 1PPGE 1WQSA 1O2GH 1UTJA 2ZIQH 5EXLA 1QL7A 1BITA 1BA8B 1ZR0A 1N1LA 3MOCA 2QXJA 3M7TA 1DLKB 1DY8A 2BD7A 1O5GH 1GHWH 2W7SA 1OXGA 1FIWA 2G81E 1ZTKA 5L2ZH 1MD7A 2R2MB 3OTJE 1UK4A 3A89A 1P04A 2QXIA 4Y8XA 1F0UA 1EJAA 1MTNC 1V2UT 1AD8H 1O32A 2QXHA 5A0AE 1NM6A 3RXSA 3FZZA 3CS0A 4ZKNU 1HAIH 3SNDA 1P02A 5FCKA 1P9UA 4A7IB 2XWBI 2A1DB 1G9IE 2BOHB 1GI3A 3MO9A 1T7CA 2GV6A 1Z1JA 1LKAA 2OD3B 1O2LA 3BTGE 2DE8A 2UWOA 1T8LA 1GJ6A 1AY6H 1SGIB 1A5IA 4J2YB 3RXPA 3SHCH 2ZQ2A 2CF8H 4I8HA 1OPHB 2TRMA 1GMDG 5DK1A 2V0BA 4AG1A 5EXMA 3GDUA 1GJAB 4GCHG 4K8YA 1FN6A 3RC4A 4GUXA 2QGRA 1WTGH 2XNIA 4K1EA 1C1NA 2HPQH 4FVDA 1C4V2 1ELAA 1RFNA 2ZDLA 3E0PB 2J92A 3JZ2B 1HCGA 1HYLA 4B1TA 1GBEA 4CHAB 1P10A 6LPRA 3HPTB 2PV9B 1IQHA 2ZDKA 4YLUA 4ISIH 1FIZA 2A4RA 1BTUA 1NROH 2F9NA 3HKJB 4D9RA 3L3TA 1CGJE 4AG2A 8GCHF 3ATMA 1S0RA 3ZVCA 4IC5A 1MKWH 1ELGA 4AB8A 2CHAB 4MLFB 2XC5A 4MVNA 1FI8A 1A0HB 1D6RA 1HJAC 1C9TA 2GGVB 1DPOA 2ZTXA 3ZZ3A 2ZGBH 1GI0A 3BV9B 4CRFA 1PQAA 1RTKA 1AE8H 1QB9A 2ZCHP 3BTHE 2VVVA 2ZP0H 2QIQA 5IYTA 4D7FA
chains in the Genus database with same CATH superfamily
2UWLA 2KAIB 3ZIAD 1WDIA 3SV9A 1IQMA 1J14A 4Z1MD 2XBWA 1DFPA 4KTUA 1DWEH 3STJA 4A5TS 2VWLA 5GDSH 1GBDA 3GCTF 3N7OA 4IGDA 2AGIX 1DUEA 3TPIZ 1C5PA 1GHYH 1C1RA 2A7JA 2OLGA 4BAMB 3A85A 1J8AA 1QJ1B 3F9EA 4E06H 3B9FH 2QXGA 3PWBA 1A3BH 2V7QD 3LIWA 3QGJA 3EQ0H 7ESTE 2FODA 1IQGA 2VU8E 4Q63A 3EYDA 4AFSA 1FX0B 2A2XH 4TWYA 1SQRA 4OGXA 1TGTA 1ZZZA 1HAVA 3RDZA 3MQKC 4M9FA 5SGAE 4KTSA 4XBDA 1VITF 1XUFA 1LHDH 2A4QA 1A5HA 1QJ6B 4ZXXH 2BQ6B 4ABGA 1YLCA 2RA0A 1AU8A 1T4UH 5EOKA 3Q00A 3TK5A 1GI2A 1QJ7B 5F6MA 3OAAD 1MUEB 4H6SB 4X1NU 1XUJA 3BTTE 2H6MA 3RU4D 3MU0A 3F6UH 1ZRKA 5JDUB 3ATLA 1MTUA 1GMHF 2QE7D 3RU4T 1V2JT 4X2YA 1BCUH 5T6DA 5JBCS 4OS5A 2O8WA 1EJNA 1UVUH 1D9IA 4AGJA 1DDJA 3AAVA 1SQOA 1EASA 4GHTA 1COWD 1O38A 3FN8A 3LGVA 3RM0H 2VWMA 1ABIH 1T4VH 1EAIA 4Y11E 1UW7A 1SOTA 3WY8A 1V2TT 2ZGCA 3MU1A 1DICA 2ZFQH 3W1EA 1K0HA 3BSQA 1A5GH 3M61U 1O2MA 2BDHA 1NO9H 2H9TH 5K7RA 1SLXB 4MG3A 2VH6A 2ZKSA 2K0QA 4X8SH 4INKA 2VINA 2ZFFH 5HM2A 1GBTA 2J4IA 3GISB 1O3BA 3QGNB 1XXFA 2UWPA 1E36B 3UR9A 4ZHLU 1AVGH 3I77A 4NSVA 1BHXF 4I32A 3KHVA 3C27B 2BLVA 1FN8A 3NWUA 1A4WH 2P93A 5I25A 5JBTA 4R0IA 2BDIA 1ZTLA 3LPRA 4TSFD 1FV9A 3GY5A 5CHBA 1GBLA 3RXBA 4B71A 3A7VA 4R8TB 5EQRA 2BB4A 1IQJA 2GX4A 4RSPA 1C2JA 4XRNA 2JH6D 1KLJH 4UFEH 1OWHA 4X0WU 1IOEA 2HNTF 2H5CA 1C5YB 2SFAA 2EA3A 1VR1H 2EI6A 5LPRA 1Z6EA 1Z1IA 1RTLA 3LGIA 1SBWA 2J95A 2M5TA 4NA9H 2FOGA 1WCZA 5FPSA 2HNTC 2W6ID 4Y7AA 1D3DB 1PPBH 3UNSA 3A8CA 2AFQB 5FXLA 3K2UA 1G37A 1GJ4H 5J4SA 4I8LA 2AMDA 3M35A 5HGGA 2O8TA 4I33A 4IMZA 5JB8S 3RXMA 3DUXH 1LHCH 3TNTA 1BTXA 1KXAA 5T6GA 1P2IA 2JJ1D 1KXDA 3DD2H 3BEUA 1F7ZA 2IOTA 2XW9A 4Y8ZA 2ZDMA 5F03A 1WAYB 1BOQA 1E35B 3KL6A 1N6YA 3N99A 1YPKH 2ANYA 4NGAH 5F53A 3VB5A 1OSSA 2WYGA 4B74A 1SI5H 1BBRE 2CV3A 1AO5A 4OS6A 1UCYK 3GICB 1XUKA 2SGDE 1UTOA 2W6JD 3E91A 1TNLA 2ZQ1A 5DP9A 3AW0A 5A2MH 2Y5HA 3W94A 4B2BA 1T32A 2VWNA 3F1SB 2DE9A 1LPKB 2GCHF 1LVYA 2HALA 5GNDA 3U8RH 2HVYB 4AC9A 3FFGA 3RXKA 3DSPA 3SQHE 1K1PA 2AS9A 2Y82A 2K8IA 2FI4E 1ZPCA 4NZQA 5GCHF 1PYTC 1P3EA 1S84A 1KTSB 2WINI 4P02A 4Y8YA 2C8YB 3LJJA 1GCTC 4AORA 2P94A 4JYVH 4ESTE 2BD4A 1CHOG 2KZ4A 2PTNA 2ZTYA 2VJ1A 3LC5A 1TPAE 3VEQB 5EPNA 1LDTT 3EGKH 1MTNB 3M5NA 1HB0B 2ZPRA 3SV8A 3SV7A 1P9SA 2A5KA 1BIOA 1CA8B 1TFXA 1GGDC 2BX3A 6ESTA 1A7SA 1GJ7B 2V3OH 2STAE 2PGBB 1F92A 3TH3H 2NU4E 3A86A 1C5MD 1E0FD 1DITH 3LOXA 3MH5A 1O3KA 3GY2A 1EB1H 1L1NA 4Q7ZA 2A2QH 2F9PA 4GHQA 1DXWA 3URCA 2QYIA 1GWAA 1GPZA 2G52A 3SU0A 4CR9A 2FOBA 3BN9A 1W3CA 2XOKD 2P3UB 1W0YH 1ARBA 1F5RA 1AQ7A 1AUTC 5ABWA 1O2OA 3V12A 2BXUH 4F49A 2JETC 5A09A 1PJPA 3LT3A 3U98H 3F0OA 1WQVH 2C90B 2AHME 1NZQH 2SNWA 3RXIA 3UOPA 4Y71A 3A8BA 4X8TH 3QN7A 2YMSC 3TVJB 2BY8X 4U2WA 1SGCA 5G4BA 1UTKA 4YT6H 2TGAA 4BNRA 3A87A 3ITIA 3P8OA 1F0RA 3SUDA 1P2NA 1TABE 1ZPZA 1TX8A 4Q4LA 2D8WA 1XKBC 2WYJA 1AKSA 2OCVB 4YLQH 4Z6AH 5E0GA 1QNJA 1BRCE 1HAVB 5FPYA 5EIYA 4RN6A 4MNXA 4YXWD 2B9LA 5DJ7A 3RXGA 1QIXB 4UONA 1ZSJA 3QLPH 1O2PA 3D23A 3MO6A 2B7DH 3VB3A 1Q3XA 3GY3A 3PB1E 4ABBA 1W0JD 2RCEA 2ZWLH 3RXOA 1HJAB 1O3AA 4RKOB 1KYNA 3UB0A 3A8AA 1HPGA 3RXFA 4Y7BA 2OK5A 1B0EA 3SUEA 1MBQA 1OP8A 2BDCA 3CP7A 1C1PA 1TIOA 2NU3E 3U8TH 2JH5D 4HTCH 1LVMA 2WUBA 1JMOH 1C2DA 3NKKA 4MPXA 4GPGA 4FU8A 1K21H 5IK2D 2FX6A 3GY7A 2GZ9A 2ZI2H 3P95A 3KYFA 1FDPA 3ZVAA 1O3PB 2NWNA 3SUFA 2QF3A 4YTAA 3GY8A 2ULLA 2ANMH 3UWIA 2WPIS 5B6LA 1KIGH 2Z9GA 1T8OA 2P16A 2KM0A 1EPTC 3URDA 4MQAA 1GHAF 3SV2H 5EW2H 2PLXA 5JBBS 3H7OA 1HAOH 3ZZ7A 1EB2A 1SOZA 2GMTC 4BAHB 4ZHAA 2Z3CA 1P03A 3S0NA 3LGWA 2F91A 1GBJA 2P8OC 1QRZA 5A8YA 2GD4B 3SNBA 3KQCA 3TJOA 3NRLA 3GY4A 1QY6A 3M5OA 3TLOA 4ISLA 3S9CA 1O2KA 3N7DA 1V2OT 3LONA 1H8ED 4MNYA 1Y3VA 5LGOA 1QA7A 1KXBA 5EPYA 1UTMA 1HGTH 1L1GA 1NY22 3S9AA 1C5ZB 1FY4A 5TJXA 1VITH 2V35A 1QQUA 1H1BA 2HNTE 3RXRA 4LZ4B 1LQEA 2SGFE 1ETSH 2H2ZA 5HMAA 1X7AC 1DWBH 1GBBA 1SQAA 1C5RA 5F8ZA 3SJ9A 1SGRE 2EI7A 5EW1H 1HIAA 3LGTA 1D4PB 3SBKA 5LPEA 1HAPH 1PPEE 3MH6A 2ZNKH 3A80A 1EQ9A 4INHA 2BY6X 1E37B 1ABJH 1W8BH 5CHAC 1TQ0B 2NU1E 1EUFA 1THPB 5DP3A 4IMQA 1EPTA 2Y7XA 1ESTA 1WUNH 6CHAC 2SNVA 1AVXA 5E8EH 1C2FA 2GV7A 1BT7A 1C1OA 1D3PB 1O5FH 1TNHA 2F9VA 4I8JA 2HGTH 2J34A 1DVAH 2BDYA 1PPZA 4LXBH 2VVCA 1EP6A 3P8FA 3SNAA 4X1PU 4BXWA 1K28D 1VKYA 5C20A 1SFIA 3E16B 3P17H 4NWKA 1B7XB 1HAXB 2YNBA 9ESTA 3DSOA 4DY7B 1BHXB 3AW1A 1OWDA 4Q7XA 1DX5M 5TCAA 3VGCC 1H9HE 1C1QA 4HI3A 1JIRA 1O3LA 3TK6A 1KTTB 1QRWA 3TJNA 4LK4A 1TA2A 2Z9KA 2WHXA 1GBMA 1WV7H 2AMPA 3DFLA 1SB1H 4AZ2B 3SU3A 3V13A 3GY6A 1GMDF 1LPZB 1IQKA 1SGFG 1C2IA 2BZAA 2G8TA 4NWLA 2CMYA 4GCHF 4H4FA 1NTPA 1Y3YA 3BIUH 1YBWA 2L74A 2A7CA 2ODQA 4H42U 1WU1A 5FAHA 2XBVA 1EZSC 1O2YA 2XTTB 3E0NB 3OY5U 1AIXH 1C2MA 1KXEA 3OYPA 3PM3A 3KQBA 4OS2A 4ACBA 4RKJB 3UNRA 2LP6A 5FCRA 1V2LT 3SU5A 2AH4X 3A7TA 3N7EA 3ELAH 4FUBA 2FOAA 5FX5A 2Y7ZA 3IITA 3M3SA 4KELA 3NCLA 5AHGH 1GBCA 2J94A 3FANA 2XWAA 4X6MA 1P0SH 1Z8GA 3UUZA 1TB6H 3OU0A 1HLTH 3F9FA 2C4FH 4P00A 2FLBH 2JDID 3FP8E 4MNVA 1QL8A 1RXPA 3P6ZB 5AFZH 3WWBA 3SYJA 3FAOA 1W10U 4NG9H 1VGCC 2EY4C 1CT4E 2HWLB 3UQVA 1YLNA 5ESTE 1C5VA 4ISHH 1J16A 3MU4A 2GZ7A 5DP8A 2FM2A 2HPPH 5E2PA 3M36A 1ELDE 5A0BA 5GXPA 1C5SA 1O2RA 1V2VT 1Y5AT 4IW4E 1BRBE 1NT1A 1CQQA 1BMNH 1MKXK 1V2RT 2C8WB 2G00A 1XVMA 1YPMH 2O8MA 1CGHA 4NIXA 1MTWA 1DY9A 4WY3A 3M5MA 2IJOB 3A81A 1AUJA 1K2I1 3S7KB 1RTFB 2Q6GA 3ENSB 1D6WA 1GI7B 1GCTB 3ZVEA 1GJ5H 1BQYA 1AKSB 4MPVA 3RMMH 2KCOA 1P57B 2FLRH 4ABFA 2FP7B 4AYYB 4DJZB 2FESH 1PQ7A 2I6QA 2M2AA 3S7HB 1O2SA 2QA9E 2PTCE 3OTPA 1NRPH 1GGDB 1GHZA 1B5GH 1LHGH 1RD3B 2FX4A 1T31A 2J98A 4Y0ZE 2PP6A 3KQDA 3T62A 4B76A 2BDBA 4ABHA 4OM9A 1KY9A 1DXPA 3PLBA 3RP2A 1LVBA 3RXTA 1BTZA 2J2UA 2PR3A 4FXGH 1BMFD 4K1TA 1PPCE 1AWFH 2VIQA 4UFGH 3MI4A 2H5DA 1EATA 1F5LA 1O2VA 1FZZA 3SN8A 1H9IE 2CK3D 3EAJA 1C5QA 1Z8RA 3WW7A 1YCPH 5DN6D 3PYHA 1XVOA 1O2TA 1SL3A 4XBCA 1MD8A 4M7GA 4X8VH 2JETB 4CRCA 4FUHA 1UVSH 2OQUA 4BXSA 4BAQB 3BG8A 5T1VA 3O8CA 5E0JA 1NRNH 1ANBA 2JIZD 2YMSB 1NESE 1AFEH 3DHKH 3TIUA 1THSH 4H6TA 1KSNA 1GBIA 1P06A 3Q3YA 5J4QA 4DIHH 3U28C 3WWFA 2BDGA 1K1IA 2GDEH 1FPHH 2A7HA 1XXDA 3TH4H 1O3MA 3ZYDA 4MTBA 1DM4B 3ESTA 1GJ8B 2PKSC 5GWZA 1S0QA 4Q7YA 2B8OH 1Q2WA 2BY5X 1O3IA 2QCYA 3LKWA 3RXDA 1O31A 2UUKB 1V2NT 3SJIA 1YP9A 1O39A 4AGKA 1L0ZA 1TRNA 2Y5FA 3SNCA 2VB0A 1A46H 2WSSD 1O3NA 3U8OH 3GCHC 3QTVH 1ESBA 3P92A 4FETA 2BZ6H 2XCFA 3SUGA 1O3DA 2WV9A 1XUHA 3PV4A 3FP7E 4X6NA 2BLOA 3SGQE 3RU4E 5BRRE 3EE7A 1S6FA 5GIBA 1V2WT 4ACAA 1RRKA 2NU0E 2Z3DA 1C2KA 1RJXB 1HIAB 1ZSKA 5LH8A 2IJD1 1LVOA 3NUMA 4B2AA 4CR5A 2VWOA 5C0TA 2WPHS 5T6FA 3MNCA 4OS7A 1GI6A 5FL7D 5A8XA 1UMAH 3EDXB 1C2GA 1BB0B 3IG6B 1EPTB 1GCDA 3F2GA 1V2ST 1W7XH 1DWDH 2PW8H 1S83A 5A8ZA 1ZPBA 2VIVA 1GG6C 4IC6A 2ZU3A 3MH4A 2GMTB 4IN2A 1GI9B 3MNBA 8ESTE 3MU5A 1PPHE 1Y5UT 3SJKA 3SV6A 5HXFA 2A5AA 3UY9A 3A83A 3A7WA 3SU6A 1C5XB 2P8OB 2J9NA 2G55A 4DURA 2BTCE 2G51A 3AVZA 3P8GA 4K1SA 1OP0A 4X1RU 2QAAA 3PMAB 2FS8A 1Y5BT 3RLYH 1EZXC 1BMMH 4FUCA 2LPRA 3MFJA 1EZQA 5DO4H 5DGJA 3K6ZA 1OX1A 1AI8H 1GDUA 1XUIA 4X6OA 3BTFE 3UREA 3ZVDA 4ABAA 2ODPA 1IAUA 1GDNA 3CENA 1SHYA 1MU6B 3FOAA 3ZZCA 2OC0A 2ZFSA 3A88A 3BIVH 5JB9S 4BAKB 4WF8A 1W12U 3M5LA 3SHAH 1N6XA 3RXEA 3IWMA 4XFQA 1S6HA 2F83A 3TJUA 2BD8A 1ZGIA 1JWTA 4J1YA 4NIVA 3O8RA 2OC1A 3A7ZA 3L33A 1OWJA 2AEIH 2F9BH 1OWKA 3R3GB 4YOGA 5CHAB 1ELCA 2Z9JA 3RM2H 4NFEA 3PRBA 3TH2H 2YNAA 2VBCA 3HK3B 4ZKSU 3TGIE 2CN0H 2PHBA 4U32A 3MMGA 1N8OC 1QURH 3F2FA 6CHAB 3B23B 3C1KA 1TPSA 4KTCA 4Y76A 3SJ8A 1QFKH 1C5OH 2QV1A 2BLWA 5FBIA 1ZSLA 1WTHD 4WXIA 1CHOF 3UWJH 1V2KT 4UFDH 1V2QT 1Z71A 5CMXH 4ZKOU 4TYDA 4KP0A 4ABEA 3ZYEA 1AMHA 1YKTA 1TMBH 2O9QA 1GHVH 1EKBB 1TBRH 3DA9B 1VJ9U 2ZEBA 2GP9B 4F4OC 3TK9A 5B6OA 1P2KA 3VGCB 3I78A 3PTBA 1P3CA 2A0QB 3PTNA 5C5NA 2O8LA 3MH7A 2V3MA 1SFQB 2TPIZ 2ZG0H 1SC8U 3VB4A 2ILNA 1PFXC 3PMHB 5KECA 1O3HA 2XRCA 1GMCG 2AERH 1ZJDA 4I31A 4WMEA 4AN7A 1G30B 1ZMJA 3RMLH 4B73A 2ZDVH 3QZRA 1ELTA 1NBMD 2J97A 2TBSA 1FONA 4WMDA 1ANCA 2F9OA 1GI4A 3T26A 1HAZB 3SNEA 3QX5H 5L2YH 4XOJA 8LPRA 5C1UA 4K5ZA 3P70B 3ZV8A 1TBZH 1PQ8A 1Y59T 1K1LA 1SKYE 2ANWA 2WZQA 3GS9A 3T29A 2FTLE 1K1NA 4AYVB 1AWHB 3BTKE 5ETXA 1O30A 1BTPA 2F4LA 2O8UA 1O2ZA 1MCTA 2HRVA 2J98B 4U01A 2XBXA 2GT8A 1OP2A 4GAWA 1XKAC 1P12E 2WPLS 5EG4A 5E2OA 1CBWC 4FUIA 8KME2 4ISNA 2GDDA 5EGMA 3T28A 1H8IH 1BBRH 4X6PA 4X2WA 2RA3A 2BVSH 1MTSA 1QZ8A 3EA8A 2GKVE 1WBGB 3M3VA 3TGJE 4TY6A 4ZH8A 1VGCB 3Q77A 4GSOA 1JXPA 1TGCA 1AGJA 2FOMB 4IN1A 4Z0KA 5AVDA 1IHSH 3NXPA 3R0FA 3SI3H 3SU4A 1TPPA 2EEKA 1ELFA 1C2EA 1O5EH 1O3CA 2HLDD 1NN6A 5CE1A 1Y3WA 2ALPA 2BX4A 3BTQE 1OYQA 1TYNA 5DP5A 2XCNA 3GYMA 3KN2A 4AFUA 3GDSA 2ZGJA 1C1UH 2CGAA 2LELA 2VGCC 1SPJA 1BDAA 2OUAA 1CT2E 4NZLA 1AB9B 1O2QA 1BRUP 2PUXB 1ELVA 2D1JA 1GBFA 2EQNA 3SGBE 3PV5A 2ZFPH 4DCDA 1SG8B 3A7XA 5AF9H 3OY6U 3RXUA 3VB6A 1YC0A 2VIDA 3RUOA 2FYRA 3GDVA 3LU9B 4YOJA 1S85A 1YPLH 1D3QB 4BTIB 3RMNH 1ZMNA 2Z9IA 5EJ1A 3OEHD 1BRAA 1CT0E 2BD3A 3LGYA 1MQ5A 2ZA5A 1KLIH 1RS0A 1VCWA 1F0SA 3AASA 1FY8E 1DT2A 1WYKA 1EOLA 1O5AB 2C93B 1YPEH 1GL1A 2FOHA 4ZKRU 1KLTA 1QRXA 4TPIZ 1F5KU 2UUFB 4AFQA 4MDSA 1NFUA 1UJ1A 4QT8C 1TONA 5DKMA 1CHGA 4YOIA 4ASUD 1ACBE 5DP6A 2H9HA 1YPJH 3QDZB 1AN1E 2ASUB 1W2KH 7GCHG 2ZU1A 3ZZ9A 1TNKA 3BG4C 1VCQA 4ABJA 1SGTA 2P3TB 4AOQA 1FPCH 5CDFE 4INLA 1FY3A 2ZF0H 4FUFA 4X1SU 4JK5A 1GI8B 4BOHA 3BF6H 1LO6A 1G3CA 1HXFH 2ZCLP 4ZAEA 2CXVA 2ZGHA 2XC0A 2NU2E 1MMJN 1V2MT 1O35A 5PTPA 1BTWA 2Y80A 4O03A 4OS4A 4ZHMU 1K9OE 4NIYA 3HGPA 1C5WB 4A1XA 2ZO3H 3SORA 2R2WU 2PKSB 1OYTH 1QCPA 1YPHE 4WH6A 3T25A 1O3OA 1QB1A 3ZVGA 5DPAA 1B0FA 3L6PA 4O3UA 4FUDA 6GCHG 1MKWK 1DUAA 3E6PH 1JRTA 5L6NH 1Y3UA 3GCHB 1QHRB 1HXEH 4MPWA 3HATH 4JK6A 3GCOA 4Y79A 3KNXA 1E34B 2F9UA 2WPDD 4JCNA 3O8BA 1HAYB 3M7UA 1SLUB 4D76A 2EC9H 2W5EA 1A3EH 1SSXA 1ELBA 2I6SA 2AGEX 1EX3A 1O0DH 2Q1JA 1RGQA 3RXJA 1J15A 2VIPA 1TWXB 4NA8A 4TPYA 1UK2A 3DFJA 3LGUA 2W7UA 4UEHH 1O2IA 4ABDA 1MQ6A 1BTHH 2G5VA 1IHTH 4KGAA 3TITA 2BY9X 3F9HA 3ZZ8A 1HBTH 1GI1A 1GHBG 3MTYA 1OKXA 5FX6A 1P2JA 2OINA 5LPFA 2FYQA 3PO1C 3VXFH 1GG6B 4E7NA 3GCNA 5AFYH 2BMGB 3AK5A 2Y5GA 1NFXA 1C5TA 2ZC9H 2C8XB 1G2MA 3DCLA 1M9UA 5T3HA 1K1JA 2ZZUH 1HAGE 3PLPA 1K1OA 2AMQA 1P2MA 1ETTH 1MZAA 1YCPK 1J17T 4SGBE 2GCTC 4A6LA 2FEQH 1IQFA 1SGYE 1O34A 1O2XA 1Y8TA 1DWCH 2R3UA 1LTOA 2THFB 1DS2E 1D3TB 4DG4A 3SGAE 1YLDA 1C5NH 1GBAA 2GZ8A 1H8DH 1ZHRA 1CU1A 4LOYH 1P01A 4DVAU 4A92A 4K3JA 2ZU4A 1NFWA 3SO3A 1NRSH 1EFRD 2GVFA 1YM0A 2JH0D 4VGCC 2AIQA 2BD2A 3Q3XA 1ANDA 1W13U 3OEED 4FU9A 1T8NA 4Y0YE 1GVKB 3A82A 1K1MA 2ZFTA 1O2WA 4CH8B 3K6YA 1G3DA 2D26C 3MYWA 2A31A 1E1RD 4XDEA 4E7RG 1AVWA 3BTEE 4OS1A 1SLWB 3VB7A 1S82A 2BDAA 1TOCB 5DP4A 1FY1A 4K8BA 4NSYA 1AHTH 2PWXA 1N8OB 1W14U 2QY0B 1LMWB 1NC6A 2FDAA 4ISOA 2PUQH 4ASHA 1QR3E 1KXFA 2WV5A 3VPKA 5DP7A 1KDQA 1UVTH 3FVFB 3MWIU 1IQNA 5EQSA 4I8GA 3RLWH 1S5SA 2VH0A 3QUMP 1YPGH 2KFWA 2BYAX 2FZZA 1SGFA 1AB9C 1THRH 1TGSZ 4D9QA 2A32A 1C2HA 4CH2B 2PGQB 3ATKA 1VCPA 3K65B 5IDKA 4UFFH 3A8DA 1NU9A 3I29A 2W3IA 1CVWH 2ZU5A 5BPEA 1O2UA 1G2LA 1QBOA 4HGCA 1P2QA 1MZDA 1C1TA 5KEDA 3SU1A 2JJ2D 3UR6A 4ZROA 8GCHG 5JPMH 3RXAA 3BTME 3S9BA 4CREA 1DE7H 1HRTH 5A0CA 4MNWA 3NK8A 1A2CH 4Y10E 3UQOA 1TAWA 3SU2A 3F9GA 1TQ7B 1O33A 1CSOE 4F55A 2BOKA 3B8JA 1SQTA 1OOKB 1MTVA 2VNTA 2OTVA 3KYGA 5C0UA 2SGQE 4B2CA 2ZGXH 3K9XB 5C94A 1DANH 2Z7FE 5C67A 4FUGA 4ABIA 3NZIA 1FLEE 1UK3A 2QF5A 1EP5A 2SGAA 1G36A 5GJ4B 5EXNA 1RIWC 2BD9A 2PKAA 2QN5T 1TX6A 4CBNA 1A1RA 3MO3A 1LPGB 4NFFA 1P11E 5FPTA 2Q6DA 3GCTG 1FAXA 1TGNA 1CBWB 1HNEE 3STIA 1TNGA 2PSXA 1YWUA 1IQLA 1GJDB 4UD9H 2ZDAH 4XSKU 1OWEA 2JKHA 1A0JA 1O37A 2F3CE 1EXFA 3SZNA 1ZRBA 3ZZDA 2XXLA 4CRDA 2K1QA 1SGDE 3VFEA 2HLCA 3GOVB 1YYY1 1BJVA 4RT1A 4XE4A 4ZXYH 4SGAE 1O5CB 1ETRH 4B6FA 2W26A 3KQEA 4O9VA 3U69H 5I46H 2FI5E 1GJBB 3LH3A 3DSGA 1O3JA 2FOEA 1VITG 2TGPZ 3S69A 2VGCB 3LJOA 1AFQC 1A0LA 1L4ZA 2CF9H 4Q2KA 3ZZAA 1O5BB 3U1IB 1FY5A 1UHBA 1UTLM 4YZUA 1F0TA 3O8DA 2FTMA 3F0PA 4I86A 4K69A 1G3EA 2C8ZB 1C1WH 2TGTA 3EA7A 2FIRH 2ODYB 4JZDH 1QBNA 2G5NA 2V6NA 1ARCA 1BZXE 1YCPM 1BMLA 1O2JA 4THNH 3SW2B 4FVBA 4CBOA 4DOQA 2OQ5A 3MNSA 5KGOA 1GMHG 1IQIA 3FP6E 4JZIA 3KF2A 1EAXA 3E8LA 2BY7X 1C9PA 3RMOH 1CA0C 1W7GH 5ESBA 2BHGA 7KMEH 2WPJS 2XYAA 4K2YA 3NPSA 1NU7B 4U30A 1C1SA 3QO6A 1MKXH 2LNCA 2OC7A 1H9LB 1DLEA 2WV4A 1MAXA 1TX7A 7LPRA 1JRSA 4OGYA 4CRBA 1L2EA 2AYWA 1FMGA 2R3YA 1SVPA 2Z6BD 1C5LH 1ESAA 4AB9A 1TRYA 3OX7U 2RDLA 2PFEA 3D65E 4DT7B 4E05H 2AIPA 3ZVFA 4FU7A 2FPZA 1W0KD 2Z3EA 1Q31A 2F43B 4I8KA 1DSTA 2FMJA 5HM9A 3BTDE 5FBEA 1EZUC 3TJVA 3G01A 1HFDA 1CO7E 4CRGA 1TMUH 1LCYA 1UTQA 3BG4B 4ZCNA 1XMNB 1OS8A 1V3XA 1QL9A 3RC5A 1EOJA 1TA6A 3AAUA 4FUJA 5F8TA 1WSSH 4HZHA 1BBRK 1YPHC 2FI3E 4MPUA 2WPKS 4DT4A 2OC8A 4Q80A 1G32B 3A84A 2H9EH 2FXRA 1ZGVA 4TY7A 5DG6A 1S6LA 3SOSA 1O2NA 1MH0A 3H09A 2WPMS 5FHTA 2D2DA 2ZPSA 1O36A 2BM2A 1HAHH 2XC4A 4WJG2 2Q6FA 3H5CB 4X1QU 1UTPA 1W11U 4BANB 2Y6TA 4GVUA 2ZECA 1SGNE 1VJAU 2QF0A 3KCGH 1SMFE 2ZU2A 1PPFE 4AX9H 3PMBB 3GYLB 4D7GA 1Y3XA 3MHWU 1ZHPA 3PMJA 1QB6A 4JZEH 2VIOA 4CHAC 1SGPE 5K0HA 2DUCA 1TPOA 1YF4A 2OP9A 4LZ1H 5F8XA 1AZZA 1GJ9B 3UAIC 1BJUA 1P2OA 1FUJA 5C5OA 1S81A 1XUGA 2ZHEH 3BTWE 1NRRH 4DW2U 3UOUA 5HIYA 1Z7KA 4B6EA 3LH1A 2B0FA 3MU8A 1GMCF 1SGEE 2BXTH 1SLVB 2ZCKP 3KGPA 4PROA 4WVPE 1TGBA 3M37A 1L1JA 4A1VA 1V6DA 3PO1B 2CHAC 3QWCH 3UFAA 1WOFA 2BVXH 1O5DH 1EAUA 1KDQB 3UIRA 4NCYA 3E1XB 4YM9A 2R0KA 2B5TB 1UCYE 1MCVA 2GCTB 1VZQH 1GJCB 2ALVA 2GCHG 3Q3KA 2ANKH 1K22H 1HJ8A 4ZUHA 1Z8JB 1YGCH 3V7TA 1CGIE 3ZZ6A 5H4IB 2VIWA 3OSYA 1JIMA 5C17A 5GCHG 1FJSA 2FO9A 1FNIA 2ZHQH 1XM1A 5HIZA 3ATIA 2QF4A 2BVRH 1FQ3A 3M7QA 3PLKA 4VGCB 2KCAA 4Y6DA 1TLDA 1Z8IB 4FUEA 3RXHA 1AZ8A 3KIDU 2A5IA 3OE7D 1J9CH 1FAKH 1TNJA 1P05A 2ZPQA 1L4DA 5EJLA 2FOFA 3LC3A 4WH8A 4AFZA 1FXYA 1W0ZU 3RXCA 1QA0A 1ZTJA 3TNSA 1NBME 1XX9A 3F68H 5EJZA 2P59A 2G4TA 4ZMAH 1SGQE 3VXEH 9LPRA 3PWCA 2BQ7B 1NFYA 4B75A 1GVZA 2SGEE 3UPEA 4NA7A 2C3SA 4JMYA 2SGPE 4WWYA 1P8VC 4O3TA 3FZDA 2WUCA 2G4UA 2Z9LA 3ZV9A 2PKAB 4RT0A 4JZFH 2ZHWH 3CNRA 1NRQH 5JBAS 1GVLA 3RXVA 5JYIA 2P95A 1TRMA 2GT7A 1O2HA 1C2LA 1GI5A 2A4GA 3A7YA 4CRAA 4K60A 2H1UA 1LHEH 2HVXA 3T2NA 3F3BA 2ZTZA 2IN2A 4HFPB 5EODA 1QGFA 2KAIA 4WMFA 4IS5A 4UE7H 2OBOA 5C1YA 1ZOMA 1MAYA 1ID5H 1H4WA 4X8UH 1LQDB 1Z6JH 1UO6A 2PSYA 3V3MA 4I7YH 1P09A 3Q76A 3FO8D 1C1MA 1GBHA 1GL0E 1UCYH 1UTNA 1UVPA 5C1XA 2HOBA 1HJ9A 2UUJB 4WXVA 2A45B 3V0XA 1ZHMA 1ANEA 3U9AH 4HG6A 3RXLA 4YT7H 3JZ1B 1MABB 4X2XA 1INCA 5TCCA 1C4U2 4TWWA 3ZVBA 2V3HH 1BMAA 1UHBB 2IPHA 3UNQA 1UVOA 3QZQA 5L30H 1IQEA 3ODFA 1GDQA 3UTUH 7GCHF 2TIOA 1DSUA 3M3TA 1LHFH 1O3EA 1ORFA 2TGDA 3P8NA 1TBQH 4UDWH 2R9PA 2AGGX 1EJMA 2R0LA 2FWWA 4YESB 1BTYA 1QBVH 2FS9A 3MNXA 4NIWA 2XNDD 3ZZBA 1RIWB 1SR5C 3BEFB 4A1TA 2EI8A 1DOJA 4JYUH 4DGJA 3SJOA 2ESTE 4DIIH 1OWIA 3QTOH 1HV7A 1LKBA 4JYTA 1ZJKA 2J38A 2BLQA 4IBLH 2P3FH 1GBKA 5EQQA 5EU8A 5C2ZA 1TNIA 1HDTH 1E38B 1ZLRA 2A4OA 3DT0H 1JOUB 1F2SE 3D62A 1GHAG 1O3FA 1MU8B 3T27A 1C1VH 6GCHF 1SHHB 1KXCA 2BD5A 2YOLA 3KEEA 3TU7H 1MBMA 1TE0A 1EAWA 3QK1A 3PROA 2W3KA 3EA9A 2RG3A 2ZHDA 3HK6B 1BUIA 1V2PT 4JZ1A 2Z94A 3ZZ5A 2CJIA 4RI0A 3SI4H 4KKDA 3E3TA 5DSFA 4YO9A 1AE5A 5HYOA 2ZDNA 1JBUH 3F2HA 3E90B 5C3NA 1QTFA 4D8NA 2OBQA 1AFQB 1NPMA 1C4Y2 3D49H 4XBBA 2BQWB 3RXQA 1HUTH 3BEIB 1ELEE 1ZMLA 2STBE 2GTBA 1QQ4A 3TGKE 1PQ5A 4GLYA 3EE0B 2ZHFH 4BAOB 2KX4A 2QC2A 3HKIB 3PRDA 1G3BA 1C5UA 1NS3A 1A61H 3CS7A 3ATWA 5E0HA 2VVUA 3SQEE 2OXSA 4O97A 5GPIB 1TMTH 3LDXH 2GJGA 2FOCA 3W95A 4F48B 1KMHB 3T5FH 1E79D 3ZZ4A 1CA0B 1GHBF 2Y81A 2KCYA 3RC6A 1ZYOA 1CE5A 1PYTD 4BTTB 1OHHD 2UUYA 1T8MA 4BTUB 2ZFRH 4X2VA 1U6QA 3ODDA 4TT3D 3H7TA 1TOMH 1O3GA 1WXRA 3U1JB 3HGNA 1TALA 2XBYA 1GHXH 1PPGE 1WQSA 1O2GH 1UTJA 2ZIQH 5EXLA 1QL7A 3VG8A 1BITA 1BA8B 1ZR0A 1N1LA 3MOCA 2QXJA 3M7TA 1DLKB 1DY8A 2BD7A 1O5GH 1GHWH 3SZEA 2W7SA 1OXGA 5HKKD 1FIWA 2G81E 1ZTKA 5L2ZH 1MD7A 2R2MB 4FOUC 3OTJE 1UK4A 3A89A 1P04A 1YY3A 2QXIA 4Y8XA 1F0UA 1EJAA 2J5UA 1MTNC 1V2UT 1AD8H 1O32A 2QXHA 5A0AE 1NM6A 3RXSA 3FZZA 3CS0A 4ZKNU 1HAIH 3SNDA 1P02A 5FCKA 1P9UA 4A7IB 2XWBI 2A1DB 1G9IE 2BOHB 1GI3A 3MO9A 1T7CA 2GV6A 1Z1JA 2KCPA 1LKAA 2OD3B 3PV2A 1O2LA 3BTGE 2DE8A 2UWOA 1T8LA 1GJ6A 2RFKC 1AY6H 1SGIB 1A5IA 4J2YB 2YMSD 3RXPA 3SHCH 2ZQ2A 2CF8H 4I8HA 1OPHB 2TRMA 1GMDG 5DK1A 3KQ5A 2V0BA 4AG1A 5EXMA 3GDUA 1GJAB 4GCHG 4K8YA 3OFND 1FN6A 3RC4A 4GUXA 2QGRA 1WTGH 2XNIA 4K1EA 1C1NA 2HPQH 4FVDA 1C4V2 1ELAA 1RFNA 2ZDLA 3E0PB 2J92A 3JZ2B 1HCGA 1HYLA 4B1TA 1GBEA 3FKSD 4CHAB 1P10A 6LPRA 3HPTB 2IPQX 2RDEA 2PV9B 1IQHA 2ZDKA 1E1QD 2L6OA 4YLUA 4ISIH 1FIZA 2A4RA 1H8HD 1BTUA 1NROH 2F9NA 3HKJB 4D9RA 3L3TA 1CGJE 4AG2A 8GCHF 3ATMA 2KR7A 1S0RA 3ZVCA 4IC5A 1MKWH 4XD7D 1ELGA 4AB8A 2CHAB 4MLFB 2XC5A 4MVNA 1FI8A 1A0HB 1D6RA 1HJAC 2GGVB 1C9TA 1DPOA 2ZTXA 3ZZ3A 2ZGBH 1GI0A 3BV9B 4CRFA 1PQAA 1RTKA 1AE8H 1QB9A 2ZCHP 3BTHE 2VVVA 2ZP0H 2QIQA 5IYTA 4D7FA
chains in the Genus database with same CATH topology
2UWLA 2KAIB 3SV9A 1IQMA 1J14A 2XBWA 1DFPA 4KTUA 1DWEH 3STJA 4A5TS 2VWLA 5GDSH 1GBDA 3GCTF 3N7OA 4IGDA 2AGIX 1DUEA 3TPIZ 1C5PA 1GHYH 1C1RA 2A7JA 2OLGA 4BAMB 3A85A 1J8AA 1QJ1B 3F9EA 4E06H 3B9FH 2QXGA 3PWBA 1A3BH 3LIWA 3QGJA 3EQ0H 7ESTE 2FODA 1IQGA 2VU8E 3EYDA 4AFSA 2A2XH 4TWYA 4OGXA 1TGTA 1ZZZA 1HAVA 3RDZA 5SGAE 4KTSA 4XBDA 1VITF 1XUFA 1LHDH 2A4QA 1A5HA 1QJ6B 4ZXXH 2BQ6B 4ABGA 1YLCA 2RA0A 1AU8A 1T4UH 5EOKA 3Q00A 3TK5A 1GI2A 1QJ7B 5F6MA 1MUEB 4H6SB 4X1NU 1XUJA 3BTTE 2H6MA 3RU4D 3MU0A 3F6UH 1ZRKA 5JDUB 3ATLA 1MTUA 1GMHF 3RU4T 1V2JT 4X2YA 1BCUH 5T6DA 5JBCS 4OS5A 2O8WA 1EJNA 1UVUH 1D9IA 4AGJA 1DDJA 3AAVA 1SQOA 1EASA 4GHTA 1O38A 3LGVA 3RM0H 2VWMA 1ABIH 1T4VH 1EAIA 4Y11E 1SOTA 3WY8A 1V2TT 2ZGCA 3MU1A 1DICA 2ZFQH 3BSQA 1A5GH 3M61U 1O2MA 2BDHA 1NO9H 2H9TH 5K7RA 1SLXB 4MG3A 2VH6A 2ZKSA 4X8SH 4INKA 2VINA 2ZFFH 5HM2A 1GBTA 2J4IA 3GISB 1O3BA 3QGNB 1XXFA 2UWPA 1E36B 3UR9A 4ZHLU 1AVGH 3I77A 4NSVA 1BHXF 4I32A 3KHVA 3C27B 2BLVA 1FN8A 3NWUA 1A4WH 2P93A 5I25A 5JBTA 4R0IA 2BDIA 1ZTLA 3LPRA 1FV9A 3GY5A 1GBLA 3RXBA 4B71A 3A7VA 4R8TB 5EQRA 2BB4A 1IQJA 2GX4A 4RSPA 1C2JA 2JH6D 1KLJH 4UFEH 1OWHA 4X0WU 1IOEA 2HNTF 2H5CA 1C5YB 2SFAA 2EA3A 1VR1H 2EI6A 5LPRA 1Z6EA 1Z1IA 1RTLA 3LGIA 1SBWA 2J95A 2M5TA 4NA9H 2FOGA 1WCZA 5FPSA 2HNTC 4Y7AA 1D3DB 1PPBH 3UNSA 3A8CA 2AFQB 5FXLA 3K2UA 1G37A 1GJ4H 5J4SA 4I8LA 2AMDA 3M35A 5HGGA 2O8TA 4I33A 4IMZA 5JB8S 3RXMA 3DUXH 1LHCH 3TNTA 1BTXA 1KXAA 5T6GA 1P2IA 1KXDA 3DD2H 3BEUA 1F7ZA 2IOTA 2XW9A 4Y8ZA 2ZDMA 5F03A 1WAYB 1BOQA 1E35B 3KL6A 1N6YA 1YPKH 2ANYA 4NGAH 3VB5A 1OSSA 2WYGA 4B74A 1SI5H 1BBRE 2CV3A 1AO5A 4OS6A 1UCYK 3GICB 1XUKA 2SGDE 1UTOA 3E91A 1TNLA 2ZQ1A 5DP9A 3AW0A 5A2MH 2Y5HA 3W94A 4B2BA 1T32A 2VWNA 3F1SB 2DE9A 1LPKB 2GCHF 1LVYA 2HALA 3U8RH 3FFGA 3RXKA 3SQHE 1K1PA 2AS9A 2Y82A 2FI4E 1ZPCA 4NZQA 5GCHF 1PYTC 1P3EA 1S84A 1KTSB 2WINI 4Y8YA 2C8YB 3LJJA 1GCTC 4AORA 2P94A 4JYVH 4ESTE 2BD4A 1CHOG 2PTNA 2ZTYA 2VJ1A 3LC5A 1TPAE 3VEQB 5EPNA 1LDTT 3EGKH 1MTNB 3M5NA 1HB0B 2ZPRA 3SV8A 3SV7A 1P9SA 2A5KA 1BIOA 1CA8B 1TFXA 1GGDC 2BX3A 6ESTA 1A7SA 1GJ7B 2V3OH 2STAE 2PGBB 1F92A 3TH3H 2NU4E 3A86A 1C5MD 1E0FD 1DITH 3LOXA 3MH5A 1O3KA 3GY2A 1EB1H 1L1NA 4Q7ZA 2A2QH 2F9PA 4GHQA 1DXWA 3URCA 2QYIA 1GWAA 1GPZA 2G52A 3SU0A 4CR9A 2FOBA 3BN9A 1W3CA 2P3UB 1W0YH 1ARBA 1F5RA 1AQ7A 1AUTC 5ABWA 1O2OA 3V12A 2BXUH 4F49A 2JETC 5A09A 1PJPA 3LT3A 3U98H 1WQVH 2C90B 1NZQH 2SNWA 3RXIA 3UOPA 4Y71A 3A8BA 4X8TH 3QN7A 3TVJB 2BY8X 4U2WA 1SGCA 5G4BA 1UTKA 4YT6H 2TGAA 4BNRA 3A87A 3ITIA 3P8OA 1F0RA 3SUDA 1P2NA 1TABE 1ZPZA 1TX8A 2D8WA 1XKBC 2WYJA 1AKSA 2OCVB 4YLQH 4Z6AH 5E0GA 1QNJA 1BRCE 1HAVB 5FPYA 4RN6A 4MNXA 2B9LA 5DJ7A 3RXGA 1QIXB 4UONA 1ZSJA 3QLPH 1O2PA 3D23A 3MO6A 2B7DH 3VB3A 1Q3XA 3GY3A 3PB1E 4ABBA 2RCEA 2ZWLH 3RXOA 1HJAB 1O3AA 4RKOB 1KYNA 3A8AA 1HPGA 3RXFA 4Y7BA 1B0EA 3SUEA 1MBQA 1OP8A 2BDCA 3CP7A 1C1PA 1TIOA 2NU3E 3U8TH 2JH5D 4HTCH 1LVMA 2WUBA 1JMOH 1C2DA 3NKKA 4MPXA 4GPGA 4FU8A 1K21H 2FX6A 3GY7A 2GZ9A 2ZI2H 3P95A 1FDPA 3ZVAA 1O3PB 2NWNA 3SUFA 2QF3A 4YTAA 3GY8A 2ULLA 2ANMH 3UWIA 2WPIS 1KIGH 2Z9GA 1T8OA 2P16A 1EPTC 3URDA 4MQAA 1GHAF 3SV2H 5EW2H 2PLXA 5JBBS 3H7OA 1HAOH 3ZZ7A 1EB2A 1SOZA 2GMTC 4BAHB 4ZHAA 2Z3CA 1P03A 3S0NA 3LGWA 2F91A 1GBJA 2P8OC 1QRZA 5A8YA 2GD4B 3SNBA 3KQCA 3TJOA 3GY4A 1QY6A 3M5OA 3TLOA 4ISLA 3S9CA 1O2KA 1V2OT 3LONA 4MNYA 1Y3VA 5LGOA 1QA7A 1KXBA 5EPYA 1UTMA 1HGTH 1L1GA 1NY22 3S9AA 1C5ZB 1FY4A 5TJXA 1VITH 2V35A 1QQUA 1H1BA 2HNTE 3RXRA 4LZ4B 1LQEA 2SGFE 1ETSH 2H2ZA 5HMAA 1X7AC 1DWBH 1GBBA 1SQAA 1C5RA 5F8ZA 3SJ9A 1SGRE 2EI7A 5EW1H 1HIAA 3LGTA 1D4PB 3SBKA 5LPEA 1HAPH 1PPEE 3MH6A 2ZNKH 3A80A 1EQ9A 4INHA 2BY6X 1E37B 1ABJH 1W8BH 5CHAC 1TQ0B 2NU1E 1EUFA 1THPB 5DP3A 4IMQA 1EPTA 2Y7XA 1ESTA 1WUNH 6CHAC 2SNVA 1AVXA 5E8EH 1C2FA 2GV7A 1BT7A 1C1OA 1D3PB 1O5FH 1TNHA 2F9VA 4I8JA 2HGTH 2J34A 1DVAH 2BDYA 1PPZA 4LXBH 2VVCA 1EP6A 3P8FA 3SNAA 4X1PU 4BXWA 1K28D 5C20A 1SFIA 3E16B 3P17H 4NWKA 1B7XB 1HAXB 2YNBA 9ESTA 4DY7B 1BHXB 3AW1A 1OWDA 4Q7XA 1DX5M 5TCAA 3VGCC 1H9HE 1C1QA 4HI3A 1JIRA 1O3LA 3TK6A 1KTTB 1QRWA 3TJNA 4LK4A 1TA2A 2Z9KA 1GBMA 1WV7H 2AMPA 3DFLA 1SB1H 4AZ2B 3SU3A 3V13A 3GY6A 1GMDF 1LPZB 1IQKA 1SGFG 1C2IA 2BZAA 2G8TA 4NWLA 2CMYA 4GCHF 4H4FA 1NTPA 1Y3YA 3BIUH 1YBWA 2A7CA 2ODQA 4H42U 1WU1A 5FAHA 2XBVA 1EZSC 1O2YA 2XTTB 3E0NB 3OY5U 1AIXH 1C2MA 1KXEA 3OYPA 3PM3A 3KQBA 4OS2A 4RKJB 3UNRA 5FCRA 1V2LT 3SU5A 2AH4X 3A7TA 4FUBA 3ELAH 2FOAA 5FX5A 2Y7ZA 3IITA 3M3SA 4KELA 3NCLA 5AHGH 1GBCA 2J94A 3FANA 2XWAA 4X6MA 1P0SH 1Z8GA 3UUZA 1TB6H 3OU0A 1HLTH 3F9FA 2C4FH 2FLBH 3FP8E 4MNVA 1QL8A 1RXPA 3P6ZB 5AFZH 3FAOA 1W10U 4NG9H 1VGCC 1CT4E 2HWLB 3UQVA 5ESTE 1C5VA 4ISHH 1J16A 3MU4A 2GZ7A 5DP8A 2FM2A 2HPPH 5E2PA 3M36A 1ELDE 5A0BA 5GXPA 1C5SA 1O2RA 1V2VT 1Y5AT 4IW4E 1BRBE 1NT1A 1CQQA 1BMNH 1MKXK 1V2RT 2C8WB 2G00A 1XVMA 1YPMH 2O8MA 1CGHA 4NIXA 1MTWA 1DY9A 4WY3A 3M5MA 2IJOB 3A81A 1AUJA 1K2I1 3S7KB 1RTFB 2Q6GA 3ENSB 1D6WA 1GI7B 1GCTB 3ZVEA 1GJ5H 1BQYA 1AKSB 4MPVA 3RMMH 1P57B 2FLRH 4ABFA 2FP7B 4AYYB 4DJZB 2FESH 1PQ7A 2I6QA 3S7HB 1O2SA 2QA9E 2PTCE 1NRPH 1GGDB 1GHZA 1B5GH 1LHGH 1RD3B 2FX4A 1T31A 4Y0ZE 3KQDA 3T62A 4B76A 2BDBA 4ABHA 1KY9A 1DXPA 3PLBA 3RP2A 1LVBA 3RXTA 1BTZA 2J2UA 2PR3A 4FXGH 4K1TA 1PPCE 1AWFH 2VIQA 4UFGH 3MI4A 2H5DA 1EATA 1F5LA 1O2VA 1FZZA 3SN8A 1H9IE 3EAJA 1C5QA 1Z8RA 1YCPH 3PYHA 1XVOA 1O2TA 1SL3A 4XBCA 1MD8A 4M7GA 4X8VH 2JETB 4CRCA 4FUHA 1UVSH 2OQUA 4BXSA 4BAQB 3BG8A 3O8CA 5E0JA 1NRNH 1ANBA 1NESE 1AFEH 3DHKH 3TIUA 1THSH 4H6TA 1KSNA 1GBIA 1P06A 3Q3YA 5J4QA 4DIHH 2BDGA 1K1IA 2GDEH 1FPHH 2A7HA 1XXDA 3TH4H 1O3MA 3ZYDA 4MTBA 1DM4B 3ESTA 1GJ8B 2PKSC 5GWZA 1S0QA 4Q7YA 2B8OH 1Q2WA 2BY5X 1O3IA 2QCYA 3LKWA 3RXDA 1O31A 2UUKB 1V2NT 3SJIA 1YP9A 1O39A 4AGKA 1L0ZA 1TRNA 2Y5FA 3SNCA 2VB0A 1A46H 1O3NA 3U8OH 3GCHC 3QTVH 1ESBA 3P92A 2BZ6H 2XCFA 3SUGA 1O3DA 1XUHA 3PV4A 3FP7E 4X6NA 2BLOA 3SGQE 3RU4E 5BRRE 1S6FA 5GIBA 1V2WT 1RRKA 2NU0E 2Z3DA 1C2KA 1RJXB 1HIAB 1ZSKA 5LH8A 1LVOA 3NUMA 4B2AA 4CR5A 2VWOA 2WPHS 5T6FA 3MNCA 4OS7A 1GI6A 5A8XA 1UMAH 3EDXB 1C2GA 1BB0B 3IG6B 1EPTB 1GCDA 1V2ST 1W7XH 1DWDH 2PW8H 1S83A 5A8ZA 1ZPBA 2VIVA 1GG6C 4IC6A 2ZU3A 3MH4A 2GMTB 4IN2A 1GI9B 3MNBA 8ESTE 3MU5A 1PPHE 1Y5UT 3SJKA 3SV6A 5HXFA 2A5AA 3UY9A 3A83A 3A7WA 3SU6A 1C5XB 2P8OB 2J9NA 2G55A 4DURA 2BTCE 2G51A 3AVZA 3P8GA 4K1SA 1OP0A 4X1RU 2QAAA 3PMAB 2FS8A 1Y5BT 3RLYH 1EZXC 1BMMH 4FUCA 2LPRA 3MFJA 1EZQA 5DO4H 5DGJA 3K6ZA 1OX1A 1AI8H 1GDUA 1XUIA 4X6OA 3BTFE 3UREA 3ZVDA 4ABAA 2ODPA 1IAUA 1GDNA 3CENA 1SHYA 1MU6B 3ZZCA 2OC0A 2ZFSA 3A88A 3BIVH 5JB9S 4BAKB 4WF8A 1W12U 3M5LA 3SHAH 1N6XA 3RXEA 3IWMA 4XFQA 1S6HA 2F83A 3TJUA 2BD8A 1ZGIA 1JWTA 4J1YA 4NIVA 3O8RA 2OC1A 3A7ZA 3L33A 1OWJA 2AEIH 2F9BH 1OWKA 3R3GB 4YOGA 5CHAB 1ELCA 2Z9JA 3RM2H 4NFEA 3TH2H 2YNAA 4ZKSU 3HK3B 3TGIE 2CN0H 2PHBA 4U32A 3MMGA 1N8OC 1QURH 6CHAB 3B23B 3C1KA 1TPSA 4KTCA 4Y76A 3SJ8A 1QFKH 1C5OH 2QV1A 2BLWA 5FBIA 1ZSLA 1WTHD 4WXIA 1CHOF 3UWJH 1V2KT 4UFDH 1V2QT 1Z71A 5CMXH 4ZKOU 4TYDA 4KP0A 4ABEA 3ZYEA 1AMHA 1YKTA 1TMBH 2O9QA 1GHVH 1EKBB 1TBRH 3DA9B 1VJ9U 2ZEBA 2GP9B 4F4OC 3TK9A 5B6OA 1P2KA 3VGCB 3I78A 3PTBA 1P3CA 2A0QB 3PTNA 5C5NA 2O8LA 3MH7A 1SFQB 2TPIZ 2ZG0H 1SC8U 3VB4A 2ILNA 1PFXC 3PMHB 1O3HA 2XRCA 1GMCG 2AERH 1ZJDA 4I31A 4WMEA 4AN7A 1G30B 1ZMJA 3RMLH 4B73A 2ZDVH 3QZRA 1ELTA 2TBSA 1FONA 4WMDA 1ANCA 2F9OA 1GI4A 3T26A 1HAZB 3SNEA 3QX5H 5L2YH 4XOJA 8LPRA 5C1UA 4K5ZA 3P70B 3ZV8A 1TBZH 1PQ8A 1Y59T 1K1LA 2ANWA 3T29A 2FTLE 1K1NA 4AYVB 1AWHB 3BTKE 5ETXA 1O30A 1BTPA 2O8UA 1O2ZA 1MCTA 2HRVA 4U01A 2XBXA 2GT8A 1OP2A 4GAWA 1XKAC 1P12E 2WPLS 5EG4A 5E2OA 1CBWC 4FUIA 8KME2 4ISNA 2GDDA 5EGMA 3T28A 1H8IH 1BBRH 4X6PA 4X2WA 2RA3A 2BVSH 1MTSA 3EA8A 2GKVE 1WBGB 3M3VA 3TGJE 4TY6A 4ZH8A 1VGCB 3Q77A 4GSOA 1JXPA 1TGCA 1AGJA 2FOMB 4IN1A 4Z0KA 5AVDA 1IHSH 3NXPA 3R0FA 3SI3H 3SU4A 1TPPA 2EEKA 1ELFA 1C2EA 1O5EH 1O3CA 1NN6A 5CE1A 1Y3WA 2ALPA 2BX4A 3BTQE 1OYQA 1TYNA 5DP5A 2XCNA 3GYMA 3KN2A 4AFUA 3GDSA 2ZGJA 1C1UH 2CGAA 2VGCC 1SPJA 1BDAA