1LQVA

Crystal structure of the endothelial protein c receptor with phospholipid in the groove in complex with gla domain of protein c.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
GLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial protein C receptor
publication title The crystal structure of the endothelial protein C receptor and a bound phospholipid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 52
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1lqvA00
5HGBA 4HX1A 3KXFA 4CW1A 4GKSA 1W0WA 4PV9A 3GMRA 4MXQA 1HHGA 1DUZA 3FOMA 4Y4KA 3SCMA 5C0FA 3CDGA 3BH9A 1T7VA 2Q7YA 5INCA 5IB3A 1BD2A 4MJ5A 1TVHA 3PWPA 3UTSA 4F7EA 3RWCA 4IIQC 4ELMA 4QRUA 2AV1A 3UBXA 1KPRA 1ZAGA 1KCGC 5C0EA 3O3BA 5J6HA 4L29A 4K71B 5BJTA 2BNQA 2VAAA 4NNYA 1S7QA 4JQVA 1AGBA 5EO0A 5DEFA 3U0PA 1P7QA 4LNRA 4PJ7A 5IB4A 2YPKA 1RJZA 3AREA 4GUPA 2HJKA 1BIIA 3E3QA 2VLKA 4QRQA 5J1AA 1KTLA 3BEWA 3MYJA 3QUYA 5SWQA 4PG2A 3VFTA 3TBWA 5J6GA 4LCWA 2H26A 3VXOA 4NNXA 3MRQA 5EO1A 2P5WA 3D25A 3QULA 3BWAA 5DEGA 3QFJA 2CKBH 5EOTA 5MEQA 1CD1A 1B0GA 2GT9A 4NQCA 1FFOA 3LKOA 4PP8C 3CC5A 2BNRA 2BVOA 3OV6A 3O9WA 4PJ9A 3KYNA 3ROOA 3RWGA 1GZQA 2AKRA 3KPSA 4O2FA 3VXNA 3DX6A 4HS3A 3H9HA 4IRSA 4JRXA 1YDPA 3BO8A 1T0MA 3PWUA 4G59A 2D31A 2F74A 4NO2A 1QEWA 2AK4A 3GSQA 2ZSWA 1N2RA 5C0BA 4D0DA 1AGCA 4G43A 3E2HA 4PJIA 4X6DA 4NSKA 3LV3A 1I1AA 3QFDA 5B38A 4I48A 2E7LE 1I1YA 2CIKA 3JTCA 1T7WA 3X11A 4HKJA 3D18A 5L2JA 4PJGA 1I7UA 2BVPA 3MRMA 2VE6A 4PJHA 1YN6A 3TIEA 2C7UA 3KPRA 3X12A 5IEKA 3FOLA 3D3VA 3SKMA 5MEPA 1NANH 3GMOA 3KPPA 4Z78A 3D39A 3QQ4A 1FZKA 3LKQA 3W39A 1U58A 3L3HA 1RJYA 5B39A 3VFWA 2OI9A 3REWA 2OL3H 3AM8A 5H94A 5BXFA 4PRNA 3E6HA 1S9WA 1W72A 2XPGA 3HE7A 1T80A 3E6FA 4I4WA 3FRUA 4L3CA 5FA3A 3PWJA 1UXSA 1A9EA 2AXGA 4PG9A 5C09A 1QLFA 4JFQA 3QDJA 4QRTA 4U1HA 5E9DA 1C16A 1LD9A 1X7QA 1FZOA 2VLRA 1S9YA 4JFPA 3PWNA 2GTWA 5C0GA 5L2KA 3C8KA 4E5XA 4F7TA 1WBYA 3MGTA 4U1SA 3GMNA 3MRRA 1AGEA 5F9JA 4U1IA 2X4SA 1S7XA 1IM9A 3L9RA 5IM7A 2CLZA 2VLJA 2P5EA 1OGAA 1PQZA 3H7BA 2YPLA 4MS8A 4NO3A 4PJXA 4X6EA 3VWKA 1XR8A 3WS6A 5BS0A 1XR9A 1ZT4A 3FQNA 3QUXA 1N5AA 1KPVA 1XZ0A 3DXAA 3SDDA 3CH1A 4PRDA 3FQWA 3VFRA 1MI5A 4QRPA 4L8DA 3GMPA 3AU1A 3FT2A 3O3DA 1VGKA 3O3AA 3P9MA 1RK1A 5MERA 1G7QA 3SKOA 4D0BA 3IXAA 3QUZA 3ROLA 1OGTA 2XFXA 3BHBA 5EU4A 4F7CA 5FKPA 3WL9A 3IT8D 4NQEA 1MHEA 2FZ3A 3X13A 1UXWA 1T1YA 3UTQA 2F53A 4MX7A 1JGDA 1RK0A 3MRGA 2FIKA 5F1IA 3FTGA 3LKNA 3BZEA 1BZ9A 2NW3A 3MROA 1L8JA 1T1ZA 5E8NA 3QI9A 4F7MA 3HG1A 3MR9A 3I6KA 1LEGA 4UQ3A 5MENA 1I7TA 3QQ3A 4L4TA 4G8IA 2FWOA 3VFMA 5C0JA 1FFNA 2BCKA 4PJ5A 1ED3A 5EFIA 1AO7A 3RWHA 2CIIA 3RWEA 1NEZA 3B3IA 3LN5A 4PRAA 5HGHA 3HUJA 1S9XA 4U1JA 3TBYA 1T0NA 2FYYA 1BQHA 3L3DA 1EXUA 2GAZA 4PJ8A 4U1KA 5ACZA 5IB2A 3VXMA 3BVNA 3DX7A 1HYRC 1IM3A 3VXRA 5JHDA 5D9SA 1YPZA 4ZUVA 3MRHA 4N5EA 2VLLA 5DDHA 5F7DA 1FO0H 1N59A 3B6SA 5E8OA 1VACA 3QDMA 2X4TA 4L3EA 1ONQA 3ARDA 4K7FA 3ES6A 3MRJA 3RL2A 4XXCA 4X6FA 4PJEA 3JVGA 1A9BA 3CZFA 2A83A 5HHQA 2V2XA 3KPOA 4PGEA 3BXNA 1T7YA 3C9NA 3GSNH 3V5DA 2X4RA 3H9SA 1I4FA 3GMQA 4IRJA 3WUWA 4NQVA 2H6PA 5ISZA 3TBSA 4NO0A 4UQ2A 1HHKA 3SDAA 1MHCA 3L3JA 4FTVA 5D2NA 5IB1A 4JFDA 3VFUA 4JFOA 3RWIA 1TVBA 2ESVA 4MVBA 4O2CA 3VFSA 5C0AA 5EUOA 1N3NA 4FFEX 1JE6A 3TBVA 5C07A 3P4OA 3KPMA 3TN0A 1YN7A 1HSBA 4HWZA 3DBXA 5F1NA 3O3EA 1JPGA 4LCYA 1HHIA 1T22A 3LKSA 2BSTA 1KJVA 3LKPA 4ZFZA 3PWVA 1T1WA 1ZT1A 4MJ6A 1EEYA 1I1FA 3UPRA 1K8DA 1S7SA 3DX8A 5ENWA 4MJIA 4N0UA 5FDWA 4MNGA 1M6OA 3VFOA 5D7IA 1GZPA 1OSZA 2X4UA 3RWJA 4EI5A 3TO2A 1A1OA 2PO6A 1S7WA 2UWEA 3P4MA 1QRNA 2X4QA 4G8GA 1S7RA 4WU7A 4WW2C 4L8CA 1T7ZA 1FFPA 3MV8A 1KPUA 1QR1A 3RZCA 4L8BA 5HYJA 3BP7A 3I6GA 3FQXA 3GMLA 3WS3A 1QVOA 4ZUWA 1S8DA 4QRSA 4WJ5A 3VXPA 3JTTA 1KJ3H 1DE4A 3GJFA 1T1XA 3GSVA 5D5MA 3P9LA 5MEOA 3VFPA 3MRDA 5C08A 2AXFA 3VCLA 1ZSDA 3FQRA 3GSXA 4MNQA 5E8PA 2MHAA 4PJCA 3OX8A 4EN3C 1E28A 3D2UA 3GMMA 1ZHBA 4NHUE 4O2EA 3DTXA 1G6RH 4X6CA 2CLRA 5EU6A 3O4LA 3KLAA 3V5KA 5EU5A 5C0DA 1LDPH 3BGMA 4HV8A 3CVHA 1WBZA 2WY3A 1S7UA 4N0FA 3O8XA 4ZAKA 4Y4FA 1ZVSA 1DUYA 1JFMA 5C0IA 3T1FA 4WWKC 1UQSA 1INQA 2ZOKA 4PRIA 5C0CA 3VFNA 3CCHA 4JFFA 3ILQC 3GSRA 4F7PA 3M17A 1A6ZA 3QUKA 4IHOA 3MRBA 5GSRA 4ZUTA 2X4PA 2AV7A 4PJBA 5D7LA 1P4LA 3RUGA 1I7RA 1W0VA 5EU3A 2HJLA 1WBXA 4U1LA 1EFXA 3BP4A 3MRLA 1S7VA 4PJFA 2YEZA 4CVXA 1CE6A 3OXRA 4HUUA 5D7JC 2PYEA 3PQYA 3RGVC 3RTQA 3VXUA 5C9JA 4LHUA 4APQA 4PJAA 3SJVA 3GSUA 3MRKA 4MQ7A 3P73A 3BUYA 1M05A 1LQVA 3TA3A 2JCCA 4NQXA 4PRHA 4NO5A 1P1ZA 3ARGA 3MRPA 4Z76A 4Y4HA 3BH8A 3HE6A 1A1NA 4G9DA 5IB5A 4HUVA 1QSFA 1JHTA 1TMCA 3W0WA 4QRRA 1FZMA 3P77A 5HGDA 4Y2DA 2F54A 2BSSA 4PREA 3P4NA 4Z77A 4PGDA 1CG9A 1VADA 3KPQA 3ERYA 1HHHA 4JRYA 5FA4A 2V2WA 1T7XA 5HHOA 3JTSA 2DYPA 3BW9A 3G08A 3MGOA 3I6LD 1ZS8A 1MWAH 5AD0A 3VJ6A 3MRNA 1KBGH 5IEHA 2FO4A 3ARFA 3OXSA 1EEZA 1JF1A 3FT3A 3LKRA 4U6YA 4ONOA 5IVXA 1ZT7A 4NT6A 4WDIA 1A1MA 4PRBA 1E27A 4PRPA 3ARBA 4QOKA 3TJHA 2X4NA 4EUPA 1B0RA 4PGCA 3TF7A 3KWWA 1LK2A 4WU5A 3VRIA 3V5HA 1B3JA 3MREA 3BEVA 1ZHKA 3KPNA 3ILPA 4WO4A 3PABA 4V3EB 2BSRA 1ZHNA 3L3GA 5SWSA 3HAEA 3T8XA 1K5NA 3CPLA 1FZJA 5INDA 3FQUA 2RFXA 3TVMA 3MRFA 2GITA 3MA7A 4N8VA 4ZUUA 2X70A 4V3DB 1QQDA 3M1BA 2NX5A 3VWJA 3WLBA 1DDHA 1SYSA 4JFEA 3TBTA 1OF2A 2HLAA 2VABA 4HUWA 4L4VA 3LN4A 1S7TA 3DMMA 5HHNA 4PR5A 1JUFA 1LP9A 1XH3A 3PWLA 4PDCE 3MV7A 3X14A 1QO3A 5GSVA 3VH8A 3SDXA 3QDGA 1AGDA 2J8UA 3VFVA 1R3HA 1ZHLA 4GKNA 4L9LC 4U6XA 5HHMA 3TPUE 1JGEA 3VXSA 3RWFA 3HCVA 3ECBA 4L8SC 1T20A 3FQTA 4G42A 3GIVA 4U1NA 4WUUA 3KYOA 1QSEA 3SDCA 2GUOA 4NQDA 3FFCA 2GJ6A 3SPVA 3UTTA 1AGFA 3RWDA 4ZUSA 3HLAA 3QEQA 4PGBA 4U1MA 5HGAA 3MRCA 4LCCC 1HOCA 2CLVA 1LEKA 5IROA 3L3KA 2HN7A 2BVQA 3FT4A 4JQXA 2X4OA 3BZFA 3KPLA 2GTZA 4G9FA 3S6CA 1HSAA 3L3IA 1Q94A 2ZOLA 1G7PA 5SWZA 4D0CA 1FG2A 5E00A 5HHPA 1KJMA 5D2LA 3TIDA 2ZSVA 1Z5LA 3NFNA 3TO4A 3MV9A 3HPJA 4N0CA 3RL1A 3FONA 3TFKA 3TZVC 4E0RA 4HUXA 1SYVA 3VRJA 1JPFA 4PJDA 5E6IC 1T21A 4PV8A 4S0UC 3GSOA 5BRZA 1NAMH 3GSWA 3MRIA 4CVZA 1HHJA 3QZWA 4Y16A 1AKJA 1KJ2H
chains in the Genus database with same CATH superfamily
5HGBA 4HX1A 3KXFA 4CW1A 4GKSA 1W0WA 4PV9A 3GMRA 4MXQA 1HHGA 1DUZA 3FOMA 4Y4KA 3SCMA 5C0FA 3CDGA 3BH9A 1T7VA 2Q7YA 5INCA 5IB3A 1BD2A 4MJ5A 1TVHA 3PWPA 3UTSA 4F7EA 3RWCA 4IIQC 4ELMA 4QRUA 2AV1A 3UBXA 1KPRA 1ZAGA 1KCGC 5C0EA 3O3BA 5J6HA 4L29A 4K71B 5BJTA 2BNQA 2VAAA 4NNYA 1S7QA 4JQVA 1AGBA 5EO0A 5DEFA 3U0PA 1P7QA 4LNRA 4PJ7A 5IB4A 2YPKA 1RJZA 3AREA 4GUPA 2HJKA 1BIIA 3E3QA 2VLKA 4QRQA 5J1AA 1KTLA 3BEWA 3MYJA 3QUYA 5SWQA 4PG2A 3VFTA 3TBWA 5J6GA 4LCWA 2H26A 3VXOA 4NNXA 3MRQA 5EO1A 2P5WA 3D25A 3QULA 3BWAA 5DEGA 3QFJA 2CKBH 5EOTA 5MEQA 1CD1A 1B0GA 2GT9A 4NQCA 1FFOA 3LKOA 4PP8C 3CC5A 2BNRA 2BVOA 3OV6A 3O9WA 4PJ9A 3KYNA 3ROOA 3RWGA 1GZQA 2AKRA 3KPSA 4O2FA 3VXNA 3DX6A 4HS3A 3H9HA 4IRSA 2IA1A 4JRXA 1YDPA 3BO8A 1T0MA 3PWUA 4G59A 2D31A 2F74A 4NO2A 1QEWA 2AK4A 3GSQA 2ZSWA 1N2RA 5C0BA 4D0DA 1AGCA 4G43A 3E2HA 4PJIA 4X6DA 4NSKA 3LV3A 1I1AA 3QFDA 5B38A 4I48A 2E7LE 1I1YA 2CIKA 3JTCA 1T7WA 3X11A 4HKJA 3D18A 5L2JA 4PJGA 1I7UA 2BVPA 3MRMA 2VE6A 4PJHA 1YN6A 3TIEA 2C7UA 3KPRA 3X12A 5IEKA 3FOLA 3D3VA 3SKMA 5MEPA 1NANH 3GMOA 3KPPA 4Z78A 3D39A 3QQ4A 1FZKA 3LKQA 3W39A 1U58A 3L3HA 1RJYA 5B39A 3VFWA 2OI9A 3REWA 2OL3H 3AM8A 5H94A 5BXFA 4PRNA 3E6HA 1S9WA 1W72A 2XPGA 3HE7A 1T80A 3E6FA 4I4WA 3FRUA 4L3CA 5FA3A 3PWJA 1UXSA 1A9EA 2AXGA 4PG9A 5C09A 1QLFA 4JFQA 3QDJA 4QRTA 4U1HA 5E9DA 1C16A 1LD9A 1X7QA 1FZOA 2VLRA 1S9YA 4JFPA 3PWNA 2GTWA 5C0GA 5L2KA 3C8KA 4E5XA 4F7TA 1WBYA 3MGTA 4U1SA 3GMNA 3MRRA 1AGEA 5F9JA 4U1IA 2X4SA 1S7XA 1IM9A 3L9RA 5IM7A 2CLZA 2VLJA 2P5EA 1OGAA 1PQZA 3H7BA 2YPLA 4MS8A 4NO3A 4PJXA 4X6EA 3VWKA 1XR8A 3WS6A 5BS0A 1XR9A 1ZT4A 3FQNA 3QUXA 1N5AA 1KPVA 1XZ0A 3DXAA 3SDDA 3CH1A 4PRDA 3FQWA 3VFRA 1MI5A 4QRPA 4L8DA 4BKWA 3GMPA 3AU1A 3FT2A 3O3DA 1VGKA 3O3AA 3P9MA 1RK1A 5MERA 1G7QA 3SKOA 4D0BA 3IXAA 3QUZA 3ROLA 1OGTA 2XFXA 3BHBA 5EU4A 4F7CA 5FKPA 3WL9A 3IT8D 4NQEA 1MHEA 2FZ3A 3X13A 1UXWA 1T1YA 3UTQA 2F53A 4MX7A 1JGDA 1RK0A 3MRGA 2FIKA 5F1IA 3FTGA 3LKNA 3BZEA 1BZ9A 2NW3A 3MROA 1L8JA 1T1ZA 5E8NA 3QI9A 4F7MA 3HG1A 3MR9A 3I6KA 1LEGA 4UQ3A 5MENA 1I7TA 3QQ3A 4L4TA 4G8IA 2FWOA 3VFMA 5C0JA 1FFNA 2BCKA 4G59C 4PJ5A 1ED3A 5EFIA 1AO7A 3RWHA 2CIIA 3RWEA 1NEZA 3B3IA 3LN5A 4PRAA 5HGHA 3HUJA 1S9XA 4U1JA 3TBYA 1T0NA 2FYYA 1BQHA 3L3DA 1EXUA 2GAZA 4PJ8A 4U1KA 5ACZA 5IB2A 3VXMA 3BVNA 3DX7A 1HYRC 1IM3A 3VXRA 5JHDA 5D9SA 1YPZA 4ZUVA 3MRHA 4N5EA 2VLLA 5DDHA 5F7DA 1FO0H 1N59A 3B6SA 3I0TA 2O5NA 5E8OA 1VACA 3QDMA 2X4TA 4L3EA 1ONQA 3ARDA 4K7FA 3ES6A 3MRJA 3RL2A 4XXCA 4X6FA 4PJEA 3JVGA 1A9BA 3CZFA 2A83A 5HHQA 2V2XA 3KPOA 4PGEA 3BXNA 1T7YA 3C9NA 3GSNH 3V5DA 2X4RA 3H9SA 1I4FA 3GMQA 4IRJA 3WUWA 4NQVA 2H6PA 5ISZA 3TBSA 4NO0A 4UQ2A 1HHKA 3SDAA 1MHCA 3L3JA 4FTVA 5D2NA 5IB1A 4JFDA 3VFUA 4JFOA 3RWIA 1TVBA 2ESVA 4MVBA 4O2CA 3VFSA 5C0AA 5EUOA 1N3NA 4FFEX 1JE6A 3TBVA 5C07A 3P4OA 3KPMA 3TN0A 1YN7A 1HSBA 4HWZA 3DBXA 5F1NA 3O3EA 1JPGA 4LCYA 1HHIA 1T22A 3LKSA 2BSTA 1KJVA 3LKPA 4ZFZA 3PWVA 1T1WA 1ZT1A 4MJ6A 1EEYA 1I1FA 3UPRA 1K8DA 1S7SA 3DX8A 5ENWA 4MJIA 4N0UA 5FDWA 4MNGA 1M6OA 3VFOA 5D7IA 1GZPA 1OSZA 2X4UA 3RWJA 4EI5A 3TO2A 1A1OA 2PO6A 1S7WA 2UWEA 3P4MA 1QRNA 2X4QA 4G8GA 1S7RA 4WU7A 4WW2C 4L8CA 1T7ZA 1FFPA 3MV8A 1KPUA 1QR1A 3RZCA 4L8BA 5HYJA 3BP7A 3I6GA 3FQXA 3GMLA 3WS3A 1QVOA 4ZUWA 1S8DA 4QRSA 4WJ5A 3VXPA 3JTTA 1KJ3H 1DE4A 3GJFA 1T1XA 3GSVA 5D5MA 3P9LA 5MEOA 3VFPA 3MRDA 5C08A 2AXFA 3VCLA 1ZSDA 3FQRA 3GSXA 4MNQA 5E8PA 2MHAA 4PJCA 3OX8A 4EN3C 1E28A 3D2UA 3GMMA 1ZHBA 4NHUE 4O2EA 3DTXA 1G6RH 4X6CA 2CLRA 5EU6A 3O4LA 3KLAA 3V5KA 5EU5A 5C0DA 1LDPH 3BGMA 4HV8A 3CVHA 1WBZA 2WY3A 1S7UA 4N0FA 3O8XA 4ZAKA 4Y4FA 1ZVSA 1DUYA 1JFMA 5C0IA 3T1FA 4WWKC 1UQSA 1INQA 2ZOKA 4PRIA 5C0CA 3VFNA 3CCHA 4JFFA 3ILQC 3GSRA 4F7PA 3M17A 1A6ZA 3QUKA 4IHOA 3MRBA 5GSRA 4ZUTA 2X4PA 2AV7A 4PJBA 5D7LA 1P4LA 3RUGA 1I7RA 1W0VA 2NYKA 5EU3A 2HJLA 1WBXA 4U1LA 1EFXA 3BP4A 3MRLA 1S7VA 4PJFA 2YEZA 4CVXA 1CE6A 3OXRA 4HUUA 5D7JC 2PYEA 3PQYA 3RGVC 3RTQA 3VXUA 5C9JA 4LHUA 4APQA 4PJAA 3SJVA 3GSUA 3MRKA 4MQ7A 3P73A 3BUYA 1M05A 1LQVA 3TA3A 2JCCA 4NQXA 4PRHA 4NO5A 1P1ZA 3ARGA 3MRPA 4Z76A 4Y4HA 3BH8A 3HE6A 1A1NA 4G9DA 4JO8A 5IB5A 4HUVA 1QSFA 1JHTA 1TMCA 3W0WA 4QRRA 1FZMA 3P77A 5HGDA 4Y2DA 2F54A 2BSSA 4PREA 3P4NA 4Z77A 4PGDA 1CG9A 1VADA 3KPQA 3ERYA 1HHHA 4JRYA 5FA4A 2V2WA 1T7XA 5HHOA 3JTSA 2DYPA 3BW9A 3G08A 3MGOA 3I6LD 1ZS8A 1MWAH 5AD0A 3VJ6A 3MRNA 1KBGH 5IEHA 2FO4A 3ARFA 3OXSA 1EEZA 1JF1A 3FT3A 3LKRA 4U6YA 4ONOA 5IVXA 1ZT7A 4NT6A 4WDIA 1A1MA 4PRBA 1E27A 4PRPA 3ARBA 4QOKA 3TJHA 2X4NA 4EUPA 1B0RA 4PGCA 3TF7A 3KWWA 1LK2A 4WU5A 3VRIA 3V5HA 1B3JA 3MREA 3BEVA 1ZHKA 3KPNA 3ILPA 4WO4A 3PABA 4V3EB 2BSRA 1ZHNA 3L3GA 5SWSA 3HAEA 3T8XA 1K5NA 3CPLA 1FZJA 5INDA 3FQUA 2RFXA 3TVMA 3MRFA 2GITA 3MA7A 4N8VA 4ZUUA 2X70A 4V3DB 1QQDA 3M1BA 2NX5A 3VWJA 3WLBA 1DDHA 1SYSA 4JFEA 3TBTA 1OF2A 2HLAA 2VABA 4HUWA 4L4VA 3LN4A 1S7TA 3DMMA 5HHNA 4PR5A 1JUFA 1LP9A 1XH3A 3PWLA 4PDCE 3MV7A 3X14A 1QO3A 5GSVA 3VH8A 3SDXA 3QDGA 1AGDA 2J8UA 3VFVA 1R3HA 1ZHLA 4GKNA 4L9LC 4U6XA 5HHMA 3TPUE 1JGEA 3VXSA 3RWFA 3HCVA 3ECBA 4L8SC 1T20A 3FQTA 4G42A 3GIVA 4U1NA 4WUUA 3KYOA 1QSEA 3SDCA 2GUOA 4NQDA 3FFCA 2GJ6A 3SPVA 3UTTA 1AGFA 3RWDA 4ZUSA 3HLAA 3QEQA 4PGBA 4U1MA 5HGAA 3MRCA 4LCCC 1HOCA 2CLVA 1LEKA 5IROA 3L3KA 2HN7A 2BVQA 3FT4A 4JQXA 2X4OA 3BZFA 3KPLA 2GTZA 4G9FA 3S6CA 1HSAA 3L3IA 1Q94A 2ZOLA 1G7PA 5SWZA 4D0CA 1FG2A 5E00A 5HHPA 1KJMA 5D2LA 3TIDA 2ZSVA 1Z5LA 3NFNA 3TO4A 3MV9A 3HPJA 4N0CA 3RL1A 3FONA 3TFKA 3TZVC 4E0RA 4HUXA 1SYVA 3VRJA 1JPFA 4PJDA 5E6IC 1T21A 4PV8A 4S0UC 3GSOA 5BRZA 1NAMH 3GSWA 3MRIA 4CVZA 1HHJA 3QZWA 4Y16A 1AKJA 1KJ2H
chains in the Genus database with same CATH topology
5HGBA 4HX1A 3KXFA 4CW1A 4GKSA 1W0WA 4PV9A 3GMRA 4MXQA 1HHGA 1DUZA 3FOMA 4Y4KA 3SCMA 5C0FA 3CDGA 3BH9A 1T7VA 2Q7YA 5INCA 5IB3A 1BD2A 4MJ5A 1TVHA 3PWPA 3UTSA 4F7EA 3RWCA 4IIQC 4ELMA 4QRUA 2AV1A 3UBXA 1KPRA 1ZAGA 1KCGC 5C0EA 3O3BA 5J6HA 4L29A 4K71B 5BJTA 2BNQA 2VAAA 4NNYA 1S7QA 4JQVA 1AGBA 5EO0A 5DEFA 3U0PA 1P7QA 4LNRA 4PJ7A 5IB4A 2YPKA 1RJZA 3AREA 4GUPA 2HJKA 1BIIA 3E3QA 2VLKA 4QRQA 5J1AA 1KTLA 3BEWA 3MYJA 3QUYA 5SWQA 4PG2A 3VFTA 3TBWA 5J6GA 4LCWA 2H26A 3VXOA 4NNXA 3MRQA 5EO1A 2P5WA 3D25A 3QULA 3BWAA 5DEGA 3QFJA 2CKBH 5EOTA 5MEQA 1CD1A 1B0GA 2GT9A 4NQCA 1FFOA 3LKOA 4PP8C 3CC5A 2BNRA 2BVOA 3OV6A 3O9WA 4PJ9A 3KYNA 3ROOA 3RWGA 1GZQA 2AKRA 3KPSA 4O2FA 3VXNA 3DX6A 4HS3A 3H9HA 4IRSA 4JRXA 1YDPA 3BO8A 1T0MA 3PWUA 4G59A 2D31A 2F74A 4NO2A 1QEWA 2AK4A 3GSQA 2ZSWA 1N2RA 5C0BA 4D0DA 1AGCA 4G43A 3E2HA 4PJIA 4X6DA 4NSKA 3LV3A 1I1AA 3QFDA 5B38A 4I48A 2E7LE 1I1YA 2CIKA 3JTCA 1T7WA 3X11A 4HKJA 3D18A 5L2JA 4PJGA 1I7UA 2BVPA 3MRMA 2VE6A 4PJHA 1YN6A 3TIEA 2C7UA 3KPRA 3X12A 5IEKA 3FOLA 3D3VA 3SKMA 5MEPA 1NANH 3GMOA 3KPPA 4Z78A 3D39A 3QQ4A 1FZKA 3LKQA 3W39A 1U58A 3L3HA 1RJYA 5B39A 3VFWA 2OI9A 3REWA 2OL3H 3AM8A 5H94A 5BXFA 4PRNA 3E6HA 1S9WA 1W72A 2XPGA 3HE7A 1T80A 3E6FA 4I4WA 3FRUA 4L3CA 5FA3A 3PWJA 1UXSA 1A9EA 2AXGA 4PG9A 5C09A 1QLFA 4JFQA 3QDJA 4QRTA 4U1HA 5E9DA 1C16A 1LD9A 1X7QA 1FZOA 2VLRA 1S9YA 4JFPA 3PWNA 2GTWA 5C0GA 5L2KA 3C8KA 4E5XA 4F7TA 1WBYA 3MGTA 4U1SA 3GMNA 3MRRA 1AGEA 5F9JA 4U1IA 2X4SA 1S7XA 1IM9A 3L9RA 5IM7A 2CLZA 2VLJA 2P5EA 1OGAA 1PQZA 3H7BA 2YPLA 4MS8A 4NO3A 4PJXA 4X6EA 3VWKA 1XR8A 3WS6A 5BS0A 1XR9A 1ZT4A 3FQNA 3QUXA 1N5AA 1KPVA 1XZ0A 3DXAA 3SDDA 3CH1A 4PRDA 3FQWA 3VFRA 1MI5A 4QRPA 4L8DA 3GMPA 3AU1A 3FT2A 3O3DA 1VGKA 3O3AA 3P9MA 1RK1A 5MERA 1G7QA 3SKOA 4D0BA 3IXAA 3QUZA 3ROLA 1OGTA 2XFXA 3BHBA 5EU4A 4F7CA 5FKPA 3WL9A 3IT8D 4NQEA 1MHEA 2FZ3A 3X13A 1UXWA 1T1YA 3UTQA 2F53A 4MX7A 1JGDA 1RK0A 3MRGA 2FIKA 5F1IA 3FTGA 3LKNA 3BZEA 1BZ9A 2NW3A 3MROA 1L8JA 1T1ZA 5E8NA 3QI9A 4F7MA 3HG1A 3MR9A 3I6KA 1LEGA 4UQ3A 5MENA 1I7TA 3QQ3A 4L4TA 4G8IA 2FWOA 3VFMA 5C0JA 1FFNA 2BCKA 4PJ5A 1ED3A 5EFIA 1AO7A 3RWHA 2CIIA 3RWEA 1NEZA 3B3IA 3LN5A 4PRAA 5HGHA 3HUJA 1S9XA 4U1JA 3TBYA 1T0NA 2FYYA 1BQHA 3L3DA 1EXUA 2GAZA 4PJ8A 4U1KA 5ACZA 5IB2A 3VXMA 3BVNA 3DX7A 1HYRC 1IM3A 3VXRA 5JHDA 5D9SA 1YPZA 4ZUVA 3MRHA 4N5EA 2VLLA 5DDHA 5F7DA 1FO0H 1N59A 3B6SA 5E8OA 1VACA 3QDMA 2X4TA 4L3EA 1ONQA 3ARDA 4K7FA 3ES6A 3MRJA 3RL2A 4XXCA 4X6FA 4PJEA 3JVGA 1A9BA 3CZFA 2A83A 5HHQA 2V2XA 3KPOA 4PGEA 3BXNA 1T7YA 3C9NA 3GSNH 3V5DA 2X4RA 3H9SA 1I4FA 3GMQA 4IRJA 3WUWA 4NQVA 2H6PA 5ISZA 3TBSA 4NO0A 4UQ2A 1HHKA 3SDAA 1MHCA 3L3JA 4FTVA 5D2NA 5IB1A 4JFDA 3VFUA 4JFOA 3RWIA 1TVBA 2ESVA 4MVBA 4O2CA 3VFSA 5C0AA 5EUOA 1N3NA 4FFEX 1JE6A 3TBVA 5C07A 3P4OA 3KPMA 3TN0A 1YN7A 1HSBA 4HWZA 3DBXA 5F1NA 3O3EA 1JPGA 4LCYA 1HHIA 1T22A 3LKSA 2BSTA 1KJVA 3LKPA 4ZFZA 3PWVA 1T1WA 1ZT1A 4MJ6A 1EEYA 1I1FA 3UPRA 1K8DA 1S7SA 3DX8A 5ENWA 4MJIA 4N0UA 5FDWA 4MNGA 1M6OA 3VFOA 5D7IA 1GZPA 1OSZA 2X4UA 3RWJA 4EI5A 3TO2A 1A1OA 2PO6A 1S7WA 2UWEA 3P4MA 1QRNA 2X4QA 4G8GA 1S7RA 4WU7A 4WW2C 4L8CA 1T7ZA 1FFPA 3MV8A 1KPUA 1QR1A 3RZCA 4L8BA 5HYJA 3BP7A 3I6GA 3FQXA 3GMLA 3WS3A 1QVOA 4ZUWA 1S8DA 4QRSA 4WJ5A 3VXPA 3JTTA 1KJ3H 1DE4A 3GJFA 1T1XA 3GSVA 5D5MA 3P9LA 5MEOA 3VFPA 3MRDA 5C08A 2AXFA 3VCLA 1ZSDA 3FQRA 3GSXA 4MNQA 5E8PA 2MHAA 4PJCA 3OX8A 4EN3C 1E28A 3D2UA 3GMMA 1ZHBA 4NHUE 4O2EA 3DTXA 1G6RH 4X6CA 2CLRA 5EU6A 3O4LA 3KLAA 3V5KA 5EU5A 5C0DA 1LDPH 3BGMA 4HV8A 3CVHA 1WBZA 2WY3A 1S7UA 4N0FA 3O8XA 4ZAKA 4Y4FA 1ZVSA 1DUYA 1JFMA 5C0IA 3T1FA 4WWKC 1UQSA 1INQA 2ZOKA 4PRIA 5C0CA 3VFNA 3CCHA 4JFFA 3ILQC 3GSRA 4F7PA 3M17A 1A6ZA 3QUKA 4IHOA 3MRBA 5GSRA 4ZUTA 2X4PA 2AV7A 4PJBA 5D7LA 1P4LA 3RUGA 1I7RA 1W0VA 5EU3A 2HJLA 1WBXA 4U1LA 1EFXA 3BP4A 3MRLA 1S7VA 4PJFA 2YEZA 4CVXA 1CE6A 3OXRA 4HUUA 5D7JC 2PYEA 3PQYA 3RGVC 3RTQA 3VXUA 5C9JA 4LHUA 4APQA 4PJAA 3SJVA 3GSUA 3MRKA 4MQ7A 3P73A 3BUYA 1M05A 1LQVA 3TA3A 2JCCA 4NQXA 4PRHA 4NO5A 1P1ZA 3ARGA 3MRPA 4Z76A 4Y4HA 3BH8A 3HE6A 1A1NA 4G9DA 5IB5A 4HUVA 1QSFA 1JHTA 1TMCA 3W0WA 4QRRA 1FZMA 3P77A 5HGDA 4Y2DA 2F54A 2BSSA 4PREA 3P4NA 4Z77A 4PGDA 1CG9A 1VADA 3KPQA 3ERYA 1HHHA 4JRYA 5FA4A 2V2WA 1T7XA 5HHOA 3JTSA 2DYPA 3BW9A 3G08A 3MGOA 3I6LD 1ZS8A 1MWAH 5AD0A 3VJ6A 3MRNA 1KBGH 5IEHA 2FO4A 3ARFA 3OXSA 1EEZA 1JF1A 3FT3A 3LKRA 4U6YA 4ONOA 5IVXA 1ZT7A 4NT6A 4WDIA 1A1MA 4PRBA 1E27A 4PRPA 3ARBA 4QOKA 3TJHA 2X4NA 4EUPA 1B0RA 4PGCA 3TF7A 3KWWA 1LK2A 4WU5A 3VRIA 3V5HA 1B3JA 3MREA 3BEVA 1ZHKA 3KPNA 3ILPA 4WO4A 3PABA 4V3EB 2BSRA 1ZHNA 3L3GA 5SWSA 3HAEA 3T8XA 1K5NA 3CPLA 1FZJA 5INDA 3FQUA 2RFXA 3TVMA 3MRFA 2GITA 3MA7A 4N8VA 4ZUUA 2X70A 4V3DB 1QQDA 3M1BA 2NX5A 3VWJA 3WLBA 1DDHA 1SYSA 4JFEA 3TBTA 1OF2A 2HLAA 2VABA 4HUWA 4L4VA 3LN4A 1S7TA 3DMMA 5HHNA 4PR5A 1JUFA 1LP9A 1XH3A 3PWLA 4PDCE 3MV7A 3X14A 1QO3A 5GSVA 3VH8A 3SDXA 3QDGA 1AGDA 2J8UA 3VFVA 1R3HA 1ZHLA 4GKNA 4L9LC 4U6XA 5HHMA 3TPUE 1JGEA 3VXSA 3RWFA 3HCVA 3ECBA 4L8SC 1T20A 3FQTA 4G42A 3GIVA 4U1NA 4WUUA 3KYOA 1QSEA 3SDCA 2GUOA 4NQDA 3FFCA 2GJ6A 3SPVA 3UTTA 1AGFA 3RWDA 4ZUSA 3HLAA 3QEQA 4PGBA 4U1MA 5HGAA 3MRCA 4LCCC 1HOCA 2CLVA 1LEKA 5IROA 3L3KA 2HN7A 2BVQA 3FT4A 4JQXA 2X4OA 3BZFA 3KPLA 2GTZA 4G9FA 3S6CA 1HSAA 3L3IA 1Q94A 2ZOLA 1G7PA 5SWZA 4D0CA 1FG2A 5E00A 5HHPA 1KJMA 5D2LA 3TIDA 2ZSVA 1Z5LA 3NFNA 3TO4A 3MV9A 3HPJA 4N0CA 3RL1A 3FONA 3TFKA 3TZVC 4E0RA 4HUXA 1SYVA 3VRJA 1JPFA 4PJDA 5E6IC 1T21A 4PV8A 4S0UC 3GSOA 5BRZA 1NAMH 3GSWA 3MRIA 4CVZA 1HHJA 3QZWA 4Y16A 1AKJA 1KJ2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGB A;  4HX1 A;  3KXF A;  4CW1 A;  4GKS A;  1W0W A;  4PV9 A;  3GMR A;  4MXQ A;  1HHG A;  1DUZ A;  3FOM A;  4Y4K A;  3SCM A;  5C0F A;  3CDG A;  3BH9 A;  1T7V A;  2Q7Y A;  5INC A;  5IB3 A;  1BD2 A;  4MJ5 A;  1TVH A;  3PWP A;  3UTS A;  4F7E A;  3RWC A;  4IIQ C;  4ELM A;  4QRU A;  2AV1 A;  3UBX A;  1KPR A;  1ZAG A;  1KCG C;  5C0E A;  3O3B A;  5J6H A;  4L29 A;  4K71 B;  5BJT A;  2BNQ A;  2VAA A;  4NNY A;  1S7Q A;  4JQV A;  1AGB A;  5EO0 A;  5DEF A;  3U0P A;  1P7Q A;  4LNR A;  4PJ7 A;  5IB4 A;  2YPK A;  1RJZ A;  3ARE A;  4GUP A;  2HJK A;  1BII A;  3E3Q A;  2VLK A;  4QRQ A;  5J1A A;  1KTL A;  3BEW A;  3MYJ A;  3QUY A;  5SWQ A;  4PG2 A;  3VFT A;  3TBW A;  5J6G A;  4LCW A;  2H26 A;  3VXO A;  4NNX A;  3MRQ A;  5EO1 A;  2P5W A;  3D25 A;  3QUL A;  3BWA A;  5DEG A;  3QFJ A;  2CKB H;  5EOT A;  5MEQ A;  1CD1 A;  1B0G A;  2GT9 A;  4NQC A;  1FFO A;  3LKO A;  4PP8 C;  3CC5 A;  2BNR A;  2BVO A;  3OV6 A;  3O9W A;  4PJ9 A;  3KYN A;  3ROO A;  3RWG A;  1GZQ A;  2AKR A;  3KPS A;  4O2F A;  3VXN A;  3DX6 A;  4HS3 A;  3H9H A;  4IRS A;  4JRX A;  1YDP A;  3BO8 A;  1T0M A;  3PWU A;  4G59 A;  2D31 A;  2F74 A;  4NO2 A;  1QEW A;  2AK4 A;  3GSQ A;  2ZSW A;  1N2R A;  5C0B A;  4D0D A;  1AGC A;  4G43 A;  3E2H A;  4PJI A;  4X6D A;  4NSK A;  3LV3 A;  1I1A A;  3QFD A;  5B38 A;  4I48 A;  2E7L E;  1I1Y A;  2CIK A;  3JTC A;  1T7W A;  3X11 A;  4HKJ A;  3D18 A;  5L2J A;  4PJG A;  1I7U A;  2BVP A;  3MRM A;  2VE6 A;  4PJH A;  1YN6 A;  3TIE A;  2C7U A;  3KPR A;  3X12 A;  5IEK A;  3FOL A;  3D3V A;  3SKM A;  5MEP A;  1NAN H;  3GMO A;  3KPP A;  4Z78 A;  3D39 A;  3QQ4 A;  1FZK A;  3LKQ A;  3W39 A;  1U58 A;  3L3H A;  1RJY A;  5B39 A;  3VFW A;  2OI9 A;  3REW A;  2OL3 H;  3AM8 A;  5H94 A;  5BXF A;  4PRN A;  3E6H A;  1S9W A;  1W72 A;  2XPG A;  3HE7 A;  1T80 A;  3E6F A;  4I4W A;  3FRU A;  4L3C A;  5FA3 A;  3PWJ A;  1UXS A;  1A9E A;  2AXG A;  4PG9 A;  5C09 A;  1QLF A;  4JFQ A;  3QDJ A;  4QRT A;  4U1H A;  5E9D A;  1C16 A;  1LD9 A;  1X7Q A;  1FZO A;  2VLR A;  1S9Y A;  4JFP A;  3PWN A;  2GTW A;  5C0G A;  5L2K A;  3C8K A;  4E5X A;  4F7T A;  1WBY A;  3MGT A;  4U1S A;  3GMN A;  3MRR A;  1AGE A;  5F9J A;  4U1I A;  2X4S A;  1S7X A;  1IM9 A;  3L9R A;  5IM7 A;  2CLZ A;  2VLJ A;  2P5E A;  1OGA A;  1PQZ A;  3H7B A;  2YPL A;  4MS8 A;  4NO3 A;  4PJX A;  4X6E A;  3VWK A;  1XR8 A;  3WS6 A;  5BS0 A;  1XR9 A;  1ZT4 A;  3FQN A;  3QUX A;  1N5A A;  1KPV A;  1XZ0 A;  3DXA A;  3SDD A;  3CH1 A;  4PRD A;  3FQW A;  3VFR A;  1MI5 A;  4QRP A;  4L8D A;  3GMP A;  3AU1 A;  3FT2 A;  3O3D A;  1VGK A;  3O3A A;  3P9M A;  1RK1 A;  5MER A;  1G7Q A;  3SKO A;  4D0B A;  3IXA A;  3QUZ A;  3ROL A;  1OGT A;  2XFX A;  3BHB A;  5EU4 A;  4F7C A;  5FKP A;  3WL9 A;  3IT8 D;  4NQE A;  1MHE A;  2FZ3 A;  3X13 A;  1UXW A;  1T1Y A;  3UTQ A;  2F53 A;  4MX7 A;  1JGD A;  1RK0 A;  3MRG A;  2FIK A;  5F1I A;  3FTG A;  3LKN A;  3BZE A;  1BZ9 A;  2NW3 A;  3MRO A;  1L8J A;  1T1Z A;  5E8N A;  3QI9 A;  4F7M A;  3HG1 A;  3MR9 A;  3I6K A;  1LEG A;  4UQ3 A;  5MEN A;  1I7T A;  3QQ3 A;  4L4T A;  4G8I A;  2FWO A;  3VFM A;  5C0J A;  1FFN A;  2BCK A;  4PJ5 A;  1ED3 A;  5EFI A;  1AO7 A;  3RWH A;  2CII A;  3RWE A;  1NEZ A;  3B3I A;  3LN5 A;  4PRA A;  5HGH A;  3HUJ A;  1S9X A;  4U1J A;  3TBY A;  1T0N A;  2FYY A;  1BQH A;  3L3D A;  1EXU A;  2GAZ A;  4PJ8 A;  4U1K A;  5ACZ A;  5IB2 A;  3VXM A;  3BVN A;  3DX7 A;  1HYR C;  1IM3 A;  3VXR A;  5JHD A;  5D9S A;  1YPZ A;  4ZUV A;  3MRH A;  4N5E A;  2VLL A;  5DDH A;  5F7D A;  1FO0 H;  1N59 A;  3B6S A;  5E8O A;  1VAC A;  3QDM A;  2X4T A;  4L3E A;  1ONQ A;  3ARD A;  4K7F A;  3ES6 A;  3MRJ A;  3RL2 A;  4XXC A;  4X6F A;  4PJE A;  3JVG A;  1A9B A;  3CZF A;  2A83 A;  5HHQ A;  2V2X A;  3KPO A;  4PGE A;  3BXN A;  1T7Y A;  3C9N A;  3GSN H;  3V5D A;  2X4R A;  3H9S A;  1I4F A;  3GMQ A;  4IRJ A;  3WUW A;  4NQV A;  2H6P A;  5ISZ A;  3TBS A;  4NO0 A;  4UQ2 A;  1HHK A;  3SDA A;  1MHC A;  3L3J A;  4FTV A;  5D2N A;  5IB1 A;  4JFD A;  3VFU A;  4JFO A;  3RWI A;  1TVB A;  2ESV A;  4MVB A;  4O2C A;  3VFS A;  5C0A A;  5EUO A;  1N3N A;  4FFE X;  1JE6 A;  3TBV A;  5C07 A;  3P4O A;  3KPM A;  3TN0 A;  1YN7 A;  1HSB A;  4HWZ A;  3DBX A;  5F1N A;  3O3E A;  1JPG A;  4LCY A;  1HHI A;  1T22 A;  3LKS A;  2BST A;  1KJV A;  3LKP A;  4ZFZ A;  3PWV A;  1T1W A;  1ZT1 A;  4MJ6 A;  1EEY A;  1I1F A;  3UPR A;  1K8D A;  1S7S A;  3DX8 A;  5ENW A;  4MJI A;  4N0U A;  5FDW A;  4MNG A;  1M6O A;  3VFO A;  5D7I A;  1GZP A;  1OSZ A;  2X4U A;  3RWJ A;  4EI5 A;  3TO2 A;  1A1O A;  2PO6 A;  1S7W A;  2UWE A;  3P4M A;  1QRN A;  2X4Q A;  4G8G A;  1S7R A;  4WU7 A;  4WW2 C;  4L8C A;  1T7Z A;  1FFP A;  3MV8 A;  1KPU A;  1QR1 A;  3RZC A;  4L8B A;  5HYJ A;  3BP7 A;  3I6G A;  3FQX A;  3GML A;  3WS3 A;  1QVO A;  4ZUW A;  1S8D A;  4QRS A;  4WJ5 A;  3VXP A;  3JTT A;  1KJ3 H;  1DE4 A;  3GJF A;  1T1X A;  3GSV A;  5D5M A;  3P9L A;  5MEO A;  3VFP A;  3MRD A;  5C08 A;  2AXF A;  3VCL A;  1ZSD A;  3FQR A;  3GSX A;  4MNQ A;  5E8P A;  2MHA A;  4PJC A;  3OX8 A;  4EN3 C;  1E28 A;  3D2U A;  3GMM A;  1ZHB A;  4NHU E;  4O2E A;  3DTX A;  1G6R H;  4X6C A;  2CLR A;  5EU6 A;  3O4L A;  3KLA A;  3V5K A;  5EU5 A;  5C0D A;  1LDP H;  3BGM A;  4HV8 A;  3CVH A;  1WBZ A;  2WY3 A;  1S7U A;  4N0F A;  3O8X A;  4ZAK A;  4Y4F A;  1ZVS A;  1DUY A;  1JFM A;  5C0I A;  3T1F A;  4WWK C;  1UQS A;  1INQ A;  2ZOK A;  4PRI A;  5C0C A;  3VFN A;  3CCH A;  4JFF A;  3ILQ C;  3GSR A;  4F7P A;  3M17 A;  1A6Z A;  3QUK A;  4IHO A;  3MRB A;  5GSR A;  4ZUT A;  2X4P A;  2AV7 A;  4PJB A;  5D7L A;  1P4L A;  3RUG A;  1I7R A;  1W0V A;  5EU3 A;  2HJL A;  1WBX A;  4U1L A;  1EFX A;  3BP4 A;  3MRL A;  1S7V A;  4PJF A;  2YEZ A;  4CVX A;  1CE6 A;  3OXR A;  4HUU A;  5D7J C;  2PYE A;  3PQY A;  3RGV C;  3RTQ A;  3VXU A;  5C9J A;  4LHU A;  4APQ A;  4PJA A;  3SJV A;  3GSU A;  3MRK A;  4MQ7 A;  3P73 A;  3BUY A;  1M05 A;  1LQV A;  3TA3 A;  2JCC A;  4NQX A;  4PRH A;  4NO5 A;  1P1Z A;  3ARG A;  3MRP A;  4Z76 A;  4Y4H A;  3BH8 A;  3HE6 A;  1A1N A;  4G9D A;  5IB5 A;  4HUV A;  1QSF A;  1JHT A;  1TMC A;  3W0W A;  4QRR A;  1FZM A;  3P77 A;  5HGD A;  4Y2D A;  2F54 A;  2BSS A;  4PRE A;  3P4N A;  4Z77 A;  4PGD A;  1CG9 A;  1VAD A;  3KPQ A;  3ERY A;  1HHH A;  4JRY A;  5FA4 A;  2V2W A;  1T7X A;  5HHO A;  3JTS A;  2DYP A;  3BW9 A;  3G08 A;  3MGO A;  3I6L D;  1ZS8 A;  1MWA H;  5AD0 A;  3VJ6 A;  3MRN A;  1KBG H;  5IEH A;  2FO4 A;  3ARF A;  3OXS A;  1EEZ A;  1JF1 A;  3FT3 A;  3LKR A;  4U6Y A;  4ONO A;  5IVX A;  1ZT7 A;  4NT6 A;  4WDI A;  1A1M A;  4PRB A;  1E27 A;  4PRP A;  3ARB A;  4QOK A;  3TJH A;  2X4N A;  4EUP A;  1B0R A;  4PGC A;  3TF7 A;  3KWW A;  1LK2 A;  4WU5 A;  3VRI A;  3V5H A;  1B3J A;  3MRE A;  3BEV A;  1ZHK A;  3KPN A;  3ILP A;  4WO4 A;  3PAB A;  4V3E B;  2BSR A;  1ZHN A;  3L3G A;  5SWS A;  3HAE A;  3T8X A;  1K5N A;  3CPL A;  1FZJ A;  5IND A;  3FQU A;  2RFX A;  3TVM A;  3MRF A;  2GIT A;  3MA7 A;  4N8V A;  4ZUU A;  2X70 A;  4V3D B;  1QQD A;  3M1B A;  2NX5 A;  3VWJ A;  3WLB A;  1DDH A;  1SYS A;  4JFE A;  3TBT A;  1OF2 A;  2HLA A;  2VAB A;  4HUW A;  4L4V A;  3LN4 A;  1S7T A;  3DMM A;  5HHN A;  4PR5 A;  1JUF A;  1LP9 A;  1XH3 A;  3PWL A;  4PDC E;  3MV7 A;  3X14 A;  1QO3 A;  5GSV A;  3VH8 A;  3SDX A;  3QDG A;  1AGD A;  2J8U A;  3VFV A;  1R3H A;  1ZHL A;  4GKN A;  4L9L C;  4U6X A;  5HHM A;  3TPU E;  1JGE A;  3VXS A;  3RWF A;  3HCV A;  3ECB A;  4L8S C;  1T20 A;  3FQT A;  4G42 A;  3GIV A;  4U1N A;  4WUU A;  3KYO A;  1QSE A;  3SDC A;  2GUO A;  4NQD A;  3FFC A;  2GJ6 A;  3SPV A;  3UTT A;  1AGF A;  3RWD A;  4ZUS A;  3HLA A;  3QEQ A;  4PGB A;  4U1M A;  5HGA A;  3MRC A;  4LCC C;  1HOC A;  2CLV A;  1LEK A;  5IRO A;  3L3K A;  2HN7 A;  2BVQ A;  3FT4 A;  4JQX A;  2X4O A;  3BZF A;  3KPL A;  2GTZ A;  4G9F A;  3S6C A;  1HSA A;  3L3I A;  1Q94 A;  2ZOL A;  1G7P A;  5SWZ A;  4D0C A;  1FG2 A;  5E00 A;  5HHP A;  1KJM A;  5D2L A;  3TID A;  2ZSV A;  1Z5L A;  3NFN A;  3TO4 A;  3MV9 A;  3HPJ A;  4N0C A;  3RL1 A;  3FON A;  3TFK A;  3TZV C;  4E0R A;  4HUX A;  1SYV A;  3VRJ A;  1JPF A;  4PJD A;  5E6I C;  1T21 A;  4PV8 A;  4S0U C;  3GSO A;  5BRZ A;  1NAM H;  3GSW A;  3MRI A;  4CVZ A;  1HHJ A;  3QZW A;  4Y16 A;  1AKJ A;  1KJ2 H; 
#chains in the Genus database with same CATH topology
 5HGB A;  4HX1 A;  3KXF A;  4CW1 A;  4GKS A;  1W0W A;  4PV9 A;  3GMR A;  4MXQ A;  1HHG A;  1DUZ A;  3FOM A;  4Y4K A;  3SCM A;  5C0F A;  3CDG A;  3BH9 A;  1T7V A;  2Q7Y A;  5INC A;  5IB3 A;  1BD2 A;  4MJ5 A;  1TVH A;  3PWP A;  3UTS A;  4F7E A;  3RWC A;  4IIQ C;  4ELM A;  4QRU A;  2AV1 A;  3UBX A;  1KPR A;  1ZAG A;  1KCG C;  5C0E A;  3O3B A;  5J6H A;  4L29 A;  4K71 B;  5BJT A;  2BNQ A;  2VAA A;  4NNY A;  1S7Q A;  4JQV A;  1AGB A;  5EO0 A;  5DEF A;  3U0P A;  1P7Q A;  4LNR A;  4PJ7 A;  5IB4 A;  2YPK A;  1RJZ A;  3ARE A;  4GUP A;  2HJK A;  1BII A;  3E3Q A;  2VLK A;  4QRQ A;  5J1A A;  1KTL A;  3BEW A;  3MYJ A;  3QUY A;  5SWQ A;  4PG2 A;  3VFT A;  3TBW A;  5J6G A;  4LCW A;  2H26 A;  3VXO A;  4NNX A;  3MRQ A;  5EO1 A;  2P5W A;  3D25 A;  3QUL A;  3BWA A;  5DEG A;  3QFJ A;  2CKB H;  5EOT A;  5MEQ A;  1CD1 A;  1B0G A;  2GT9 A;  4NQC A;  1FFO A;  3LKO A;  4PP8 C;  3CC5 A;  2BNR A;  2BVO A;  3OV6 A;  3O9W A;  4PJ9 A;  3KYN A;  3ROO A;  3RWG A;  1GZQ A;  2AKR A;  3KPS A;  4O2F A;  3VXN A;  3DX6 A;  4HS3 A;  3H9H A;  4IRS A;  2IA1 A;  4JRX A;  1YDP A;  3BO8 A;  1T0M A;  3PWU A;  4G59 A;  2D31 A;  2F74 A;  4NO2 A;  1QEW A;  2AK4 A;  3GSQ A;  2ZSW A;  1N2R A;  5C0B A;  4D0D A;  1AGC A;  4G43 A;  3E2H A;  4PJI A;  4X6D A;  4NSK A;  3LV3 A;  1I1A A;  3QFD A;  5B38 A;  4I48 A;  2E7L E;  1I1Y A;  2CIK A;  3JTC A;  1T7W A;  3X11 A;  4HKJ A;  3D18 A;  5L2J A;  4PJG A;  1I7U A;  2BVP A;  3MRM A;  2VE6 A;  4PJH A;  1YN6 A;  3TIE A;  2C7U A;  3KPR A;  3X12 A;  5IEK A;  3FOL A;  3D3V A;  3SKM A;  5MEP A;  1NAN H;  3GMO A;  3KPP A;  4Z78 A;  3D39 A;  3QQ4 A;  1FZK A;  3LKQ A;  3W39 A;  1U58 A;  3L3H A;  1RJY A;  5B39 A;  3VFW A;  2OI9 A;  3REW A;  2OL3 H;  3AM8 A;  5H94 A;  5BXF A;  4PRN A;  3E6H A;  1S9W A;  1W72 A;  2XPG A;  3HE7 A;  1T80 A;  3E6F A;  4I4W A;  3FRU A;  4L3C A;  5FA3 A;  3PWJ A;  1UXS A;  1A9E A;  2AXG A;  4PG9 A;  5C09 A;  1QLF A;  4JFQ A;  3QDJ A;  4QRT A;  4U1H A;  5E9D A;  1C16 A;  1LD9 A;  1X7Q A;  1FZO A;  2VLR A;  1S9Y A;  4JFP A;  3PWN A;  2GTW A;  5C0G A;  5L2K A;  3C8K A;  4E5X A;  4F7T A;  1WBY A;  3MGT A;  4U1S A;  3GMN A;  3MRR A;  1AGE A;  5F9J A;  4U1I A;  2X4S A;  1S7X A;  1IM9 A;  3L9R A;  5IM7 A;  2CLZ A;  2VLJ A;  2P5E A;  1OGA A;  1PQZ A;  3H7B A;  2YPL A;  4MS8 A;  4NO3 A;  4PJX A;  4X6E A;  3VWK A;  1XR8 A;  3WS6 A;  5BS0 A;  1XR9 A;  1ZT4 A;  3FQN A;  3QUX A;  1N5A A;  1KPV A;  1XZ0 A;  3DXA A;  3SDD A;  3CH1 A;  4PRD A;  3FQW A;  3VFR A;  1MI5 A;  4QRP A;  4L8D A;  4BKW A;  3GMP A;  3AU1 A;  3FT2 A;  3O3D A;  1VGK A;  3O3A A;  3P9M A;  1RK1 A;  5MER A;  1G7Q A;  3SKO A;  4D0B A;  3IXA A;  3QUZ A;  3ROL A;  1OGT A;  2XFX A;  3BHB A;  5EU4 A;  4F7C A;  5FKP A;  3WL9 A;  3IT8 D;  4NQE A;  1MHE A;  2FZ3 A;  3X13 A;  1UXW A;  1T1Y A;  3UTQ A;  2F53 A;  4MX7 A;  1JGD A;  1RK0 A;  3MRG A;  2FIK A;  5F1I A;  3FTG A;  3LKN A;  3BZE A;  1BZ9 A;  2NW3 A;  3MRO A;  1L8J A;  1T1Z A;  5E8N A;  3QI9 A;  4F7M A;  3HG1 A;  3MR9 A;  3I6K A;  1LEG A;  4UQ3 A;  5MEN A;  1I7T A;  3QQ3 A;  4L4T A;  4G8I A;  2FWO A;  3VFM A;  5C0J A;  1FFN A;  2BCK A;  4G59 C;  4PJ5 A;  1ED3 A;  5EFI A;  1AO7 A;  3RWH A;  2CII A;  3RWE A;  1NEZ A;  3B3I A;  3LN5 A;  4PRA A;  5HGH A;  3HUJ A;  1S9X A;  4U1J A;  3TBY A;  1T0N A;  2FYY A;  1BQH A;  3L3D A;  1EXU A;  2GAZ A;  4PJ8 A;  4U1K A;  5ACZ A;  5IB2 A;  3VXM A;  3BVN A;  3DX7 A;  1HYR C;  1IM3 A;  3VXR A;  5JHD A;  5D9S A;  1YPZ A;  4ZUV A;  3MRH A;  4N5E A;  2VLL A;  5DDH A;  5F7D A;  1FO0 H;  1N59 A;  3B6S A;  3I0T A;  2O5N A;  5E8O A;  1VAC A;  3QDM A;  2X4T A;  4L3E A;  1ONQ A;  3ARD A;  4K7F A;  3ES6 A;  3MRJ A;  3RL2 A;  4XXC A;  4X6F A;  4PJE A;  3JVG A;  1A9B A;  3CZF A;  2A83 A;  5HHQ A;  2V2X A;  3KPO A;  4PGE A;  3BXN A;  1T7Y A;  3C9N A;  3GSN H;  3V5D A;  2X4R A;  3H9S A;  1I4F A;  3GMQ A;  4IRJ A;  3WUW A;  4NQV A;  2H6P A;  5ISZ A;  3TBS A;  4NO0 A;  4UQ2 A;  1HHK A;  3SDA A;  1MHC A;  3L3J A;  4FTV A;  5D2N A;  5IB1 A;  4JFD A;  3VFU A;  4JFO A;  3RWI A;  1TVB A;  2ESV A;  4MVB A;  4O2C A;  3VFS A;  5C0A A;  5EUO A;  1N3N A;  4FFE X;  1JE6 A;  3TBV A;  5C07 A;  3P4O A;  3KPM A;  3TN0 A;  1YN7 A;  1HSB A;  4HWZ A;  3DBX A;  5F1N A;  3O3E A;  1JPG A;  4LCY A;  1HHI A;  1T22 A;  3LKS A;  2BST A;  1KJV A;  3LKP A;  4ZFZ A;  3PWV A;  1T1W A;  1ZT1 A;  4MJ6 A;  1EEY A;  1I1F A;  3UPR A;  1K8D A;  1S7S A;  3DX8 A;  5ENW A;  4MJI A;  4N0U A;  5FDW A;  4MNG A;  1M6O A;  3VFO A;  5D7I A;  1GZP A;  1OSZ A;  2X4U A;  3RWJ A;  4EI5 A;  3TO2 A;  1A1O A;  2PO6 A;  1S7W A;  2UWE A;  3P4M A;  1QRN A;  2X4Q A;  4G8G A;  1S7R A;  4WU7 A;  4WW2 C;  4L8C A;  1T7Z A;  1FFP A;  3MV8 A;  1KPU A;  1QR1 A;  3RZC A;  4L8B A;  5HYJ A;  3BP7 A;  3I6G A;  3FQX A;  3GML A;  3WS3 A;  1QVO A;  4ZUW A;  1S8D A;  4QRS A;  4WJ5 A;  3VXP A;  3JTT A;  1KJ3 H;  1DE4 A;  3GJF A;  1T1X A;  3GSV A;  5D5M A;  3P9L A;  5MEO A;  3VFP A;  3MRD A;  5C08 A;  2AXF A;  3VCL A;  1ZSD A;  3FQR A;  3GSX A;  4MNQ A;  5E8P A;  2MHA A;  4PJC A;  3OX8 A;  4EN3 C;  1E28 A;  3D2U A;  3GMM A;  1ZHB A;  4NHU E;  4O2E A;  3DTX A;  1G6R H;  4X6C A;  2CLR A;  5EU6 A;  3O4L A;  3KLA A;  3V5K A;  5EU5 A;  5C0D A;  1LDP H;  3BGM A;  4HV8 A;  3CVH A;  1WBZ A;  2WY3 A;  1S7U A;  4N0F A;  3O8X A;  4ZAK A;  4Y4F A;  1ZVS A;  1DUY A;  1JFM A;  5C0I A;  3T1F A;  4WWK C;  1UQS A;  1INQ A;  2ZOK A;  4PRI A;  5C0C A;  3VFN A;  3CCH A;  4JFF A;  3ILQ C;  3GSR A;  4F7P A;  3M17 A;  1A6Z A;  3QUK A;  4IHO A;  3MRB A;  5GSR A;  4ZUT A;  2X4P A;  2AV7 A;  4PJB A;  5D7L A;  1P4L A;  3RUG A;  1I7R A;  1W0V A;  2NYK A;  5EU3 A;  2HJL A;  1WBX A;  4U1L A;  1EFX A;  3BP4 A;  3MRL A;  1S7V A;  4PJF A;  2YEZ A;  4CVX A;  1CE6 A;  3OXR A;  4HUU A;  5D7J C;  2PYE A;  3PQY A;  3RGV C;  3RTQ A;  3VXU A;  5C9J A;  4LHU A;  4APQ A;  4PJA A;  3SJV A;  3GSU A;  3MRK A;  4MQ7 A;  3P73 A;  3BUY A;  1M05 A;  1LQV A;  3TA3 A;  2JCC A;  4NQX A;  4PRH A;  4NO5 A;  1P1Z A;  3ARG A;  3MRP A;  4Z76 A;  4Y4H A;  3BH8 A;  3HE6 A;  1A1N A;  4G9D A;  4JO8 A;  5IB5 A;  4HUV A;  1QSF A;  1JHT A;  1TMC A;  3W0W A;  4QRR A;  1FZM A;  3P77 A;  5HGD A;  4Y2D A;  2F54 A;  2BSS A;  4PRE A;  3P4N A;  4Z77 A;  4PGD A;  1CG9 A;  1VAD A;  3KPQ A;  3ERY A;  1HHH A;  4JRY A;  5FA4 A;  2V2W A;  1T7X A;  5HHO A;  3JTS A;  2DYP A;  3BW9 A;  3G08 A;  3MGO A;  3I6L D;  1ZS8 A;  1MWA H;  5AD0 A;  3VJ6 A;  3MRN A;  1KBG H;  5IEH A;  2FO4 A;  3ARF A;  3OXS A;  1EEZ A;  1JF1 A;  3FT3 A;  3LKR A;  4U6Y A;  4ONO A;  5IVX A;  1ZT7 A;  4NT6 A;  4WDI A;  1A1M A;  4PRB A;  1E27 A;  4PRP A;  3ARB A;  4QOK A;  3TJH A;  2X4N A;  4EUP A;  1B0R A;  4PGC A;  3TF7 A;  3KWW A;  1LK2 A;  4WU5 A;  3VRI A;  3V5H A;  1B3J A;  3MRE A;  3BEV A;  1ZHK A;  3KPN A;  3ILP A;  4WO4 A;  3PAB A;  4V3E B;  2BSR A;  1ZHN A;  3L3G A;  5SWS A;  3HAE A;  3T8X A;  1K5N A;  3CPL A;  1FZJ A;  5IND A;  3FQU A;  2RFX A;  3TVM A;  3MRF A;  2GIT A;  3MA7 A;  4N8V A;  4ZUU A;  2X70 A;  4V3D B;  1QQD A;  3M1B A;  2NX5 A;  3VWJ A;  3WLB A;  1DDH A;  1SYS A;  4JFE A;  3TBT A;  1OF2 A;  2HLA A;  2VAB A;  4HUW A;  4L4V A;  3LN4 A;  1S7T A;  3DMM A;  5HHN A;  4PR5 A;  1JUF A;  1LP9 A;  1XH3 A;  3PWL A;  4PDC E;  3MV7 A;  3X14 A;  1QO3 A;  5GSV A;  3VH8 A;  3SDX A;  3QDG A;  1AGD A;  2J8U A;  3VFV A;  1R3H A;  1ZHL A;  4GKN A;  4L9L C;  4U6X A;  5HHM A;  3TPU E;  1JGE A;  3VXS A;  3RWF A;  3HCV A;  3ECB A;  4L8S C;  1T20 A;  3FQT A;  4G42 A;  3GIV A;  4U1N A;  4WUU A;  3KYO A;  1QSE A;  3SDC A;  2GUO A;  4NQD A;  3FFC A;  2GJ6 A;  3SPV A;  3UTT A;  1AGF A;  3RWD A;  4ZUS A;  3HLA A;  3QEQ A;  4PGB A;  4U1M A;  5HGA A;  3MRC A;  4LCC C;  1HOC A;  2CLV A;  1LEK A;  5IRO A;  3L3K A;  2HN7 A;  2BVQ A;  3FT4 A;  4JQX A;  2X4O A;  3BZF A;  3KPL A;  2GTZ A;  4G9F A;  3S6C A;  1HSA A;  3L3I A;  1Q94 A;  2ZOL A;  1G7P A;  5SWZ A;  4D0C A;  1FG2 A;  5E00 A;  5HHP A;  1KJM A;  5D2L A;  3TID A;  2ZSV A;  1Z5L A;  3NFN A;  3TO4 A;  3MV9 A;  3HPJ A;  4N0C A;  3RL1 A;  3FON A;  3TFK A;  3TZV C;  4E0R A;  4HUX A;  1SYV A;  3VRJ A;  1JPF A;  4PJD A;  5E6I C;  1T21 A;  4PV8 A;  4S0U C;  3GSO A;  5BRZ A;  1NAM H;  3GSW A;  3MRI A;  4CVZ A;  1HHJ A;  3QZW A;  4Y16 A;  1AKJ A;  1KJ2 H; 
#chains in the Genus database with same CATH homology
 5HGB A;  4HX1 A;  3KXF A;  4CW1 A;  4GKS A;  1W0W A;  4PV9 A;  3GMR A;  4MXQ A;  1HHG A;  1DUZ A;  3FOM A;  4Y4K A;  3SCM A;  5C0F A;  3CDG A;  3BH9 A;  1T7V A;  2Q7Y A;  5INC A;  5IB3 A;  1BD2 A;  4MJ5 A;  1TVH A;  3PWP A;  3UTS A;  4F7E A;  3RWC A;  4IIQ C;  4ELM A;  4QRU A;  2AV1 A;  3UBX A;  1KPR A;  1ZAG A;  1KCG C;  5C0E A;  3O3B A;  5J6H A;  4L29 A;  4K71 B;  5BJT A;  2BNQ A;  2VAA A;  4NNY A;  1S7Q A;  4JQV A;  1AGB A;  5EO0 A;  5DEF A;  3U0P A;  1P7Q A;  4LNR A;  4PJ7 A;  5IB4 A;  2YPK A;  1RJZ A;  3ARE A;  4GUP A;  2HJK A;  1BII A;  3E3Q A;  2VLK A;  4QRQ A;  5J1A A;  1KTL A;  3BEW A;  3MYJ A;  3QUY A;  5SWQ A;  4PG2 A;  3VFT A;  3TBW A;  5J6G A;  4LCW A;  2H26 A;  3VXO A;  4NNX A;  3MRQ A;  5EO1 A;  2P5W A;  3D25 A;  3QUL A;  3BWA A;  5DEG A;  3QFJ A;  2CKB H;  5EOT A;  5MEQ A;  1CD1 A;  1B0G A;  2GT9 A;  4NQC A;  1FFO A;  3LKO A;  4PP8 C;  3CC5 A;  2BNR A;  2BVO A;  3OV6 A;  3O9W A;  4PJ9 A;  3KYN A;  3ROO A;  3RWG A;  1GZQ A;  2AKR A;  3KPS A;  4O2F A;  3VXN A;  3DX6 A;  4HS3 A;  3H9H A;  4IRS A;  4JRX A;  1YDP A;  3BO8 A;  1T0M A;  3PWU A;  4G59 A;  2D31 A;  2F74 A;  4NO2 A;  1QEW A;  2AK4 A;  3GSQ A;  2ZSW A;  1N2R A;  5C0B A;  4D0D A;  1AGC A;  4G43 A;  3E2H A;  4PJI A;  4X6D A;  4NSK A;  3LV3 A;  1I1A A;  3QFD A;  5B38 A;  4I48 A;  2E7L E;  1I1Y A;  2CIK A;  3JTC A;  1T7W A;  3X11 A;  4HKJ A;  3D18 A;  5L2J A;  4PJG A;  1I7U A;  2BVP A;  3MRM A;  2VE6 A;  4PJH A;  1YN6 A;  3TIE A;  2C7U A;  3KPR A;  3X12 A;  5IEK A;  3FOL A;  3D3V A;  3SKM A;  5MEP A;  1NAN H;  3GMO A;  3KPP A;  4Z78 A;  3D39 A;  3QQ4 A;  1FZK A;  3LKQ A;  3W39 A;  1U58 A;  3L3H A;  1RJY A;  5B39 A;  3VFW A;  2OI9 A;  3REW A;  2OL3 H;  3AM8 A;  5H94 A;  5BXF A;  4PRN A;  3E6H A;  1S9W A;  1W72 A;  2XPG A;  3HE7 A;  1T80 A;  3E6F A;  4I4W A;  3FRU A;  4L3C A;  5FA3 A;  3PWJ A;  1UXS A;  1A9E A;  2AXG A;  4PG9 A;  5C09 A;  1QLF A;  4JFQ A;  3QDJ A;  4QRT A;  4U1H A;  5E9D A;  1C16 A;  1LD9 A;  1X7Q A;  1FZO A;  2VLR A;  1S9Y A;  4JFP A;  3PWN A;  2GTW A;  5C0G A;  5L2K A;  3C8K A;  4E5X A;  4F7T A;  1WBY A;  3MGT A;  4U1S A;  3GMN A;  3MRR A;  1AGE A;  5F9J A;  4U1I A;  2X4S A;  1S7X A;  1IM9 A;  3L9R A;  5IM7 A;  2CLZ A;  2VLJ A;  2P5E A;  1OGA A;  1PQZ A;  3H7B A;  2YPL A;  4MS8 A;  4NO3 A;  4PJX A;  4X6E A;  3VWK A;  1XR8 A;  3WS6 A;  5BS0 A;  1XR9 A;  1ZT4 A;  3FQN A;  3QUX A;  1N5A A;  1KPV A;  1XZ0 A;  3DXA A;  3SDD A;  3CH1 A;  4PRD A;  3FQW A;  3VFR A;  1MI5 A;  4QRP A;  4L8D A;  3GMP A;  3AU1 A;  3FT2 A;  3O3D A;  1VGK A;  3O3A A;  3P9M A;  1RK1 A;  5MER A;  1G7Q A;  3SKO A;  4D0B A;  3IXA A;  3QUZ A;  3ROL A;  1OGT A;  2XFX A;  3BHB A;  5EU4 A;  4F7C A;  5FKP A;  3WL9 A;  3IT8 D;  4NQE A;  1MHE A;  2FZ3 A;  3X13 A;  1UXW A;  1T1Y A;  3UTQ A;  2F53 A;  4MX7 A;  1JGD A;  1RK0 A;  3MRG A;  2FIK A;  5F1I A;  3FTG A;  3LKN A;  3BZE A;  1BZ9 A;  2NW3 A;  3MRO A;  1L8J A;  1T1Z A;  5E8N A;  3QI9 A;  4F7M A;  3HG1 A;  3MR9 A;  3I6K A;  1LEG A;  4UQ3 A;  5MEN A;  1I7T A;  3QQ3 A;  4L4T A;  4G8I A;  2FWO A;  3VFM A;  5C0J A;  1FFN A;  2BCK A;  4PJ5 A;  1ED3 A;  5EFI A;  1AO7 A;  3RWH A;  2CII A;  3RWE A;  1NEZ A;  3B3I A;  3LN5 A;  4PRA A;  5HGH A;  3HUJ A;  1S9X A;  4U1J A;  3TBY A;  1T0N A;  2FYY A;  1BQH A;  3L3D A;  1EXU A;  2GAZ A;  4PJ8 A;  4U1K A;  5ACZ A;  5IB2 A;  3VXM A;  3BVN A;  3DX7 A;  1HYR C;  1IM3 A;  3VXR A;  5JHD A;  5D9S A;  1YPZ A;  4ZUV A;  3MRH A;  4N5E A;  2VLL A;  5DDH A;  5F7D A;  1FO0 H;  1N59 A;  3B6S A;  5E8O A;  1VAC A;  3QDM A;  2X4T A;  4L3E A;  1ONQ A;  3ARD A;  4K7F A;  3ES6 A;  3MRJ A;  3RL2 A;  4XXC A;  4X6F A;  4PJE A;  3JVG A;  1A9B A;  3CZF A;  2A83 A;  5HHQ A;  2V2X A;  3KPO A;  4PGE A;  3BXN A;  1T7Y A;  3C9N A;  3GSN H;  3V5D A;  2X4R A;  3H9S A;  1I4F A;  3GMQ A;  4IRJ A;  3WUW A;  4NQV A;  2H6P A;  5ISZ A;  3TBS A;  4NO0 A;  4UQ2 A;  1HHK A;  3SDA A;  1MHC A;  3L3J A;  4FTV A;  5D2N A;  5IB1 A;  4JFD A;  3VFU A;  4JFO A;  3RWI A;  1TVB A;  2ESV A;  4MVB A;  4O2C A;  3VFS A;  5C0A A;  5EUO A;  1N3N A;  4FFE X;  1JE6 A;  3TBV A;  5C07 A;  3P4O A;  3KPM A;  3TN0 A;  1YN7 A;  1HSB A;  4HWZ A;  3DBX A;  5F1N A;  3O3E A;  1JPG A;  4LCY A;  1HHI A;  1T22 A;  3LKS A;  2BST A;  1KJV A;  3LKP A;  4ZFZ A;  3PWV A;  1T1W A;  1ZT1 A;  4MJ6 A;  1EEY A;  1I1F A;  3UPR A;  1K8D A;  1S7S A;  3DX8 A;  5ENW A;  4MJI A;  4N0U A;  5FDW A;  4MNG A;  1M6O A;  3VFO A;  5D7I A;  1GZP A;  1OSZ A;  2X4U A;  3RWJ A;  4EI5 A;  3TO2 A;  1A1O A;  2PO6 A;  1S7W A;  2UWE A;  3P4M A;  1QRN A;  2X4Q A;  4G8G A;  1S7R A;  4WU7 A;  4WW2 C;  4L8C A;  1T7Z A;  1FFP A;  3MV8 A;  1KPU A;  1QR1 A;  3RZC A;  4L8B A;  5HYJ A;  3BP7 A;  3I6G A;  3FQX A;  3GML A;  3WS3 A;  1QVO A;  4ZUW A;  1S8D A;  4QRS A;  4WJ5 A;  3VXP A;  3JTT A;  1KJ3 H;  1DE4 A;  3GJF A;  1T1X A;  3GSV A;  5D5M A;  3P9L A;  5MEO A;  3VFP A;  3MRD A;  5C08 A;  2AXF A;  3VCL A;  1ZSD A;  3FQR A;  3GSX A;  4MNQ A;  5E8P A;  2MHA A;  4PJC A;  3OX8 A;  4EN3 C;  1E28 A;  3D2U A;  3GMM A;  1ZHB A;  4NHU E;  4O2E A;  3DTX A;  1G6R H;  4X6C A;  2CLR A;  5EU6 A;  3O4L A;  3KLA A;  3V5K A;  5EU5 A;  5C0D A;  1LDP H;  3BGM A;  4HV8 A;  3CVH A;  1WBZ A;  2WY3 A;  1S7U A;  4N0F A;  3O8X A;  4ZAK A;  4Y4F A;  1ZVS A;  1DUY A;  1JFM A;  5C0I A;  3T1F A;  4WWK C;  1UQS A;  1INQ A;  2ZOK A;  4PRI A;  5C0C A;  3VFN A;  3CCH A;  4JFF A;  3ILQ C;  3GSR A;  4F7P A;  3M17 A;  1A6Z A;  3QUK A;  4IHO A;  3MRB A;  5GSR A;  4ZUT A;  2X4P A;  2AV7 A;  4PJB A;  5D7L A;  1P4L A;  3RUG A;  1I7R A;  1W0V A;  5EU3 A;  2HJL A;  1WBX A;  4U1L A;  1EFX A;  3BP4 A;  3MRL A;  1S7V A;  4PJF A;  2YEZ A;  4CVX A;  1CE6 A;  3OXR A;  4HUU A;  5D7J C;  2PYE A;  3PQY A;  3RGV C;  3RTQ A;  3VXU A;  5C9J A;  4LHU A;  4APQ A;  4PJA A;  3SJV A;  3GSU A;  3MRK A;  4MQ7 A;  3P73 A;  3BUY A;  1M05 A;  1LQV A;  3TA3 A;  2JCC A;  4NQX A;  4PRH A;  4NO5 A;  1P1Z A;  3ARG A;  3MRP A;  4Z76 A;  4Y4H A;  3BH8 A;  3HE6 A;  1A1N A;  4G9D A;  5IB5 A;  4HUV A;  1QSF A;  1JHT A;  1TMC A;  3W0W A;  4QRR A;  1FZM A;  3P77 A;  5HGD A;  4Y2D A;  2F54 A;  2BSS A;  4PRE A;  3P4N A;  4Z77 A;  4PGD A;  1CG9 A;  1VAD A;  3KPQ A;  3ERY A;  1HHH A;  4JRY A;  5FA4 A;  2V2W A;  1T7X A;  5HHO A;  3JTS A;  2DYP A;  3BW9 A;  3G08 A;  3MGO A;  3I6L D;  1ZS8 A;  1MWA H;  5AD0 A;  3VJ6 A;  3MRN A;  1KBG H;  5IEH A;  2FO4 A;  3ARF A;  3OXS A;  1EEZ A;  1JF1 A;  3FT3 A;  3LKR A;  4U6Y A;  4ONO A;  5IVX A;  1ZT7 A;  4NT6 A;  4WDI A;  1A1M A;  4PRB A;  1E27 A;  4PRP A;  3ARB A;  4QOK A;  3TJH A;  2X4N A;  4EUP A;  1B0R A;  4PGC A;  3TF7 A;  3KWW A;  1LK2 A;  4WU5 A;  3VRI A;  3V5H A;  1B3J A;  3MRE A;  3BEV A;  1ZHK A;  3KPN A;  3ILP A;  4WO4 A;  3PAB A;  4V3E B;  2BSR A;  1ZHN A;  3L3G A;  5SWS A;  3HAE A;  3T8X A;  1K5N A;  3CPL A;  1FZJ A;  5IND A;  3FQU A;  2RFX A;  3TVM A;  3MRF A;  2GIT A;  3MA7 A;  4N8V A;  4ZUU A;  2X70 A;  4V3D B;  1QQD A;  3M1B A;  2NX5 A;  3VWJ A;  3WLB A;  1DDH A;  1SYS A;  4JFE A;  3TBT A;  1OF2 A;  2HLA A;  2VAB A;  4HUW A;  4L4V A;  3LN4 A;  1S7T A;  3DMM A;  5HHN A;  4PR5 A;  1JUF A;  1LP9 A;  1XH3 A;  3PWL A;  4PDC E;  3MV7 A;  3X14 A;  1QO3 A;  5GSV A;  3VH8 A;  3SDX A;  3QDG A;  1AGD A;  2J8U A;  3VFV A;  1R3H A;  1ZHL A;  4GKN A;  4L9L C;  4U6X A;  5HHM A;  3TPU E;  1JGE A;  3VXS A;  3RWF A;  3HCV A;  3ECB A;  4L8S C;  1T20 A;  3FQT A;  4G42 A;  3GIV A;  4U1N A;  4WUU A;  3KYO A;  1QSE A;  3SDC A;  2GUO A;  4NQD A;  3FFC A;  2GJ6 A;  3SPV A;  3UTT A;  1AGF A;  3RWD A;  4ZUS A;  3HLA A;  3QEQ A;  4PGB A;  4U1M A;  5HGA A;  3MRC A;  4LCC C;  1HOC A;  2CLV A;  1LEK A;  5IRO A;  3L3K A;  2HN7 A;  2BVQ A;  3FT4 A;  4JQX A;  2X4O A;  3BZF A;  3KPL A;  2GTZ A;  4G9F A;  3S6C A;  1HSA A;  3L3I A;  1Q94 A;  2ZOL A;  1G7P A;  5SWZ A;  4D0C A;  1FG2 A;  5E00 A;  5HHP A;  1KJM A;  5D2L A;  3TID A;  2ZSV A;  1Z5L A;  3NFN A;  3TO4 A;  3MV9 A;  3HPJ A;  4N0C A;  3RL1 A;  3FON A;  3TFK A;  3TZV C;  4E0R A;  4HUX A;  1SYV A;  3VRJ A;  1JPF A;  4PJD A;  5E6I C;  1T21 A;  4PV8 A;  4S0U C;  3GSO A;  5BRZ A;  1NAM H;  3GSW A;  3MRI A;  4CVZ A;  1HHJ A;  3QZW A;  4Y16 A;  1AKJ A;  1KJ2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...