1LR9A

Structure of fs1, the heparin-binding domain of follistatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr9A00
1LR8A 1TGSI 3B4VC 1M8BA 3SGQI 2ERWA 1PJUA 2GKRI 1CT4I 2NU2I 2KMPA 1SGDI 1SGQI 4SGBI 1KMAA 1OMUA 1PPFI 1TUSA 1M8CA 2KMOA 2SGPI 2OVOA 1TURA 1YTPA 2SGFI 2SGDI 2P6AC 1OMTA 1CT2I 2SGEI 2LEOA 2NU3I 2JYYA 1IW4A 1DS3I 1TIHA 5JHWC 1HJAI 1CGII 3SGBI 1PCEA 2ARPF 2M5XA 3OVOA 3SEKC 2QQCA 2NU0I 1LR7A 2BUSA 1SGRI 1CSOI 4OVOA 1OYVI 1AN1I 1CHOI 1Y1BA 2WCYA 3QTLD 5DAEA 1NUBA 1CT0I 1Z7KB 2SGQI 1Y1CA 3TJQA 1DS2I 4HGUA 1OVOA 1IY6A 1CGJI 1BUSA 1FYBA 1SGPI 1HDLA 1IY5A 1SGYI 2N17A 2F3CI 2N52A 1TBRR 2NU1I 2GKVA 2N71A 2KMQA 1UVFA 2JZMA 2KCXA 1MT1A 2JXDA 2KMRA 1H0ZA 1TBQR 1YU6C 1SGNI 1UUCA 1CE3A 2QQDA 2B0UC 1BMOA 2XRCA 4GI3C 2NU4I 2GKTI 1R0RI 1SGEI 3HH2C 1UVGA 2V53A 1HPTA 1N13A 1LR9A
chains in the Genus database with same CATH superfamily
1LR8A 1TGSI 1ULKA 1WGCA 1MJ9A 3B4VC 1M8BA 3R5AA 3SGQI 2RIJA 2CWGA 1PTQA 2ERWA 3BJIA 1PJUA 1NXUA 2ODDA 2GKRI 1CT4I 2NU2I 2DKVA 2KMPA 5E3PA 1SGDI 1W3SA 3PDNA 1SGQI 1W4RA 3QAHA 4SGBI 1KMAA 2W0TA 2DIPA 1OMUA 1PPFI 2L8EA 3OXGA 1TUSA 1M8CA 1K7VA 2A20A 2KMOA 4UXIA 5FUYA 1P9GA 2UZ3A 3TO9A 2SGPI 4L9MA 2OVOA 1TURA 4MPIA 1MJAA 1YTPA 2SGFI 3UEYA 2OZUA 1ULMA 4E1RA 1XX6A 2FNFX 5FUXA 2V1CA 1PTRA 2SGDI 2P6AC 4FKDA 3VDPA 2YQPA 1OMTA 1CT2I 2ELIA 3UOEA 2B8TA 2SGEI 1RFHA 2LEOA 2NU3I 2JYYA 1IW4A 3OL0A 1FY7A 3UEJA 1VDDA 2CWFA 1TBOA 4DNCA 1DS3I 5FUVA 3MEKA 9WGAA 1TIHA 5CCMA 5JHWC 2X52A 1HJAI 1CGII 1UHAA 3SGBI 1TBNA 1PCEA 2ARPF 2M5XA 3OVOA 3SEKC 1KBFA 1S20A 2QQCA 3UGIA 3TOAA 1V1HA 2NU0I 1LR7A 1FARA 2BUSA 2CWHA 2E5RA 1SGRI 1CSOI 4OVOA 3UGLA 2DB6A 2ROWA 1K7UA 1OYVI 1WGTA 5HI7A 1AN1I 1CHOI 3OXFA 1X4SA 1Y1BA 1Z2IA 1R79A 2WCYA 3QTLD 1MJBA 2PQ8A 5DAEA 1NUBA 1CT0I 2K9HA 1Z7KB 2JA1A 3R5DA 2SGQI 3QWPA 4WP4A 3KY9A 1Y1CA 2VRWB 3TJQA 2RC4A 1X74A 5EX0A 3FC3A 1DS2I 1XBTA 2V1CC 4HGUA 1OVOA 2N1AB 3OXLA 1IY6A 1CGJI 1BUSA 1FYBA 1SGPI 1HDLA 2J87A 1IY5A 2ORVA 2YUUA 1K7TA 1SGYI 1WTJA 1TOTA 2F3CI 2LB7A 2N17A 2N52A 2ORWA 1P9ZA 1TBRR 1FAQA 1KBEA 2NU1I 3VDUA 2OD1A 2LUYA 3FSXA 3RU0A 2GKVA 2J9RA 4AMLA 1V1IA 3UGDA 2N71A 4A24A 1Y8FA 5E3QA 2KMQA 3GOXA 1U5KA 1UVFA 2ENNA 2JZMA 3TO6A 2KCXA 3VE5A 3R5CA 5J8CA 1MT1A 2JXDA 3TO7A 2KMRA 2UVOA 7WGAA 2WVJA 2WGCA 5CCLA 1ULNA 2CJSC 2GVIA 5E3RA 1Q9BA 2L7XA 2OU2A 2Y0MA 1H0ZA 1TBQR 1YU6C 1SGNI 1UUCA 2QQ0A 5FUWA 3TOBA 1CE3A 2QQEA 2QQDA 2B0UC 1HEVA 1BMOA 2GIVA 2XRCA 4GI3C 4B6DA 2QPOA 2NU4I 4JCVE 3E59A 4E1PA 3D00A 3E2IA 2GKTI 1R0RI 1SGEI 3FSYA 2ENZA 3HH2C 1UVGA 2V53A 2E73A 4UXHA 2JW6A 3CXLA 3UFFA 1HPTA 1N13A 3R5BA 5EX3A 1WKXA 4UXJA 5J8FA 5HQ8A 1XA6A 2X3TA 1LR9A
chains in the Genus database with same CATH topology
1LR8A 1TGSI 3B4VC 1M8BA 3SGQI 1PTQA 2ERWA 3BJIA 1PJUA 2ODDA 2GKRI 1CT4I 2NU2I 2KMPA 1SGDI 1W3SA 3PDNA 1SGQI 1W4RA 4SGBI 1KMAA 2W0TA 2DIPA 1OMUA 1PPFI 2L8EA 3OXGA 1TUSA 1M8CA 2A20A 2KMOA 4UXIA 5FUYA 2UZ3A 2SGPI 4L9MA 2OVOA 1TURA 1YTPA 2SGFI 3UEYA 4E1RA 1XX6A 2FNFX 5FUXA 2V1CA 1PTRA 2SGDI 2P6AC 4FKDA 3VDPA 2YQPA 1OMTA 1CT2I 2ELIA 2B8TA 2SGEI 1RFHA 2LEOA 2NU3I 2JYYA 1IW4A 3OL0A 3UEJA 1VDDA 1TBOA 1DS3I 5FUVA 3MEKA 1TIHA 5CCMA 5JHWC 1HJAI 1CGII 3SGBI 1TBNA 1PCEA 2ARPF 2M5XA 3OVOA 3SEKC 1KBFA 2QQCA 3UGIA 1V1HA 2NU0I 1LR7A 1FARA 2BUSA 2E5RA 1SGRI 1CSOI 4OVOA 3UGLA 2DB6A 2ROWA 5HI7A 1OYVI 1AN1I 1CHOI 3OXFA 1Y1BA 1X4SA 1R79A 2WCYA 3QTLD 5DAEA 1NUBA 1CT0I 2K9HA 1Z7KB 2JA1A 2SGQI 3QWPA 3KY9A 1Y1CA 2VRWB 3TJQA 1X74A 5EX0A 3FC3A 1DS2I 1XBTA 2V1CC 4HGUA 1OVOA 2N1AB 3OXLA 1IY6A 1CGJI 1BUSA 1FYBA 1SGPI 1HDLA 2J87A 1IY5A 2ORVA 2YUUA 1SGYI 2N17A 1TOTA 2F3CI 2N52A 2ORWA 1TBRR 1FAQA 1KBEA 2NU1I 3VDUA 2OD1A 2LUYA 3RU0A 2GKVA 2J9RA 1V1IA 3UGDA 2N71A 4A24A 1Y8FA 2KMQA 3GOXA 1U5KA 1UVFA 2ENNA 2JZMA 2KCXA 3VE5A 1MT1A 2JXDA 2KMRA 2WVJA 5CCLA 2CJSC 2GVIA 2L7XA 1H0ZA 1TBQR 1YU6C 1SGNI 1UUCA 2QQ0A 5FUWA 1CE3A 2QQEA 2QQDA 2B0UC 1BMOA 2XRCA 4GI3C 4B6DA 2QPOA 2NU4I 4JCVE 3E59A 4E1PA 3D00A 3E2IA 2GKTI 1R0RI 1SGEI 2ENZA 3HH2C 1UVGA 2V53A 2E73A 4UXHA 2JW6A 3CXLA 3UFFA 1HPTA 1N13A 5EX3A 4UXJA 5HQ8A 1XA6A 1LR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LR8 A;  1TGS I;  3B4V C;  1M8B A;  3SGQ I;  2ERW A;  1PJU A;  2GKR I;  1CT4 I;  2NU2 I;  2KMP A;  1SGD I;  1SGQ I;  4SGB I;  1KMA A;  1OMU A;  1PPF I;  1TUS A;  1M8C A;  2KMO A;  2SGP I;  2OVO A;  1TUR A;  1YTP A;  2SGF I;  2SGD I;  2P6A C;  1OMT A;  1CT2 I;  2SGE I;  2LEO A;  2NU3 I;  2JYY A;  1IW4 A;  1DS3 I;  1TIH A;  5JHW C;  1HJA I;  1CGI I;  3SGB I;  1PCE A;  2ARP F;  2M5X A;  3OVO A;  3SEK C;  2QQC A;  2NU0 I;  1LR7 A;  2BUS A;  1SGR I;  1CSO I;  4OVO A;  1OYV I;  1AN1 I;  1CHO I;  1Y1B A;  2WCY A;  3QTL D;  5DAE A;  1NUB A;  1CT0 I;  1Z7K B;  2SGQ I;  1Y1C A;  3TJQ A;  1DS2 I;  4HGU A;  1OVO A;  1IY6 A;  1CGJ I;  1BUS A;  1FYB A;  1SGP I;  1HDL A;  1IY5 A;  1SGY I;  2N17 A;  2F3C I;  2N52 A;  1TBR R;  2NU1 I;  2GKV A;  2N71 A;  2KMQ A;  1UVF A;  2JZM A;  2KCX A;  1MT1 A;  2JXD A;  2KMR A;  1H0Z A;  1TBQ R;  1YU6 C;  1SGN I;  1UUC A;  1CE3 A;  2QQD A;  2B0U C;  1BMO A;  2XRC A;  4GI3 C;  2NU4 I;  2GKT I;  1R0R I;  1SGE I;  3HH2 C;  1UVG A;  2V53 A;  1HPT A;  1N13 A;  1LR9 A; 
#chains in the Genus database with same CATH topology
 1LR8 A;  1TGS I;  1ULK A;  1WGC A;  1MJ9 A;  3B4V C;  1M8B A;  3R5A A;  3SGQ I;  2RIJ A;  2CWG A;  1PTQ A;  2ERW A;  3BJI A;  1PJU A;  1NXU A;  2ODD A;  2GKR I;  1CT4 I;  2NU2 I;  2DKV A;  2KMP A;  5E3P A;  1SGD I;  1W3S A;  3PDN A;  1SGQ I;  1W4R A;  3QAH A;  4SGB I;  1KMA A;  2W0T A;  2DIP A;  1OMU A;  1PPF I;  2L8E A;  3OXG A;  1TUS A;  1M8C A;  1K7V A;  2A20 A;  2KMO A;  4UXI A;  5FUY A;  1P9G A;  2UZ3 A;  3TO9 A;  2SGP I;  4L9M A;  2OVO A;  1TUR A;  4MPI A;  1MJA A;  1YTP A;  2SGF I;  3UEY A;  2OZU A;  1ULM A;  4E1R A;  1XX6 A;  2FNF X;  5FUX A;  2V1C A;  1PTR A;  2SGD I;  2P6A C;  4FKD A;  3VDP A;  2YQP A;  1OMT A;  1CT2 I;  2ELI A;  3UOE A;  2B8T A;  2SGE I;  1RFH A;  2LEO A;  2NU3 I;  2JYY A;  1IW4 A;  3OL0 A;  1FY7 A;  3UEJ A;  1VDD A;  2CWF A;  1TBO A;  4DNC A;  1DS3 I;  5FUV A;  3MEK A;  9WGA A;  1TIH A;  5CCM A;  5JHW C;  2X52 A;  1HJA I;  1CGI I;  1UHA A;  3SGB I;  1TBN A;  1PCE A;  2ARP F;  2M5X A;  3OVO A;  3SEK C;  1KBF A;  1S20 A;  2QQC A;  3UGI A;  3TOA A;  1V1H A;  2NU0 I;  1LR7 A;  1FAR A;  2BUS A;  2CWH A;  2E5R A;  1SGR I;  1CSO I;  4OVO A;  3UGL A;  2DB6 A;  2ROW A;  1K7U A;  1OYV I;  1WGT A;  5HI7 A;  1AN1 I;  1CHO I;  3OXF A;  1X4S A;  1Y1B A;  1Z2I A;  1R79 A;  2WCY A;  3QTL D;  1MJB A;  2PQ8 A;  5DAE A;  1NUB A;  1CT0 I;  2K9H A;  1Z7K B;  2JA1 A;  3R5D A;  2SGQ I;  3QWP A;  4WP4 A;  3KY9 A;  1Y1C A;  2VRW B;  3TJQ A;  2RC4 A;  1X74 A;  5EX0 A;  3FC3 A;  1DS2 I;  1XBT A;  2V1C C;  4HGU A;  1OVO A;  2N1A B;  3OXL A;  1IY6 A;  1CGJ I;  1BUS A;  1FYB A;  1SGP I;  1HDL A;  2J87 A;  1IY5 A;  2ORV A;  2YUU A;  1K7T A;  1SGY I;  1WTJ A;  1TOT A;  2F3C I;  2LB7 A;  2N17 A;  2N52 A;  2ORW A;  1P9Z A;  1TBR R;  1FAQ A;  1KBE A;  2NU1 I;  3VDU A;  2OD1 A;  2LUY A;  3FSX A;  3RU0 A;  2GKV A;  2J9R A;  4AML A;  1V1I A;  3UGD A;  2N71 A;  4A24 A;  1Y8F A;  5E3Q A;  2KMQ A;  3GOX A;  1U5K A;  1UVF A;  2ENN A;  2JZM A;  3TO6 A;  2KCX A;  3VE5 A;  3R5C A;  5J8C A;  1MT1 A;  2JXD A;  3TO7 A;  2KMR A;  2UVO A;  7WGA A;  2WVJ A;  2WGC A;  5CCL A;  1ULN A;  2CJS C;  2GVI A;  5E3R A;  1Q9B A;  2L7X A;  2OU2 A;  2Y0M A;  1H0Z A;  1TBQ R;  1YU6 C;  1SGN I;  1UUC A;  2QQ0 A;  5FUW A;  3TOB A;  1CE3 A;  2QQE A;  2QQD A;  2B0U C;  1HEV A;  1BMO A;  2GIV A;  2XRC A;  4GI3 C;  4B6D A;  2QPO A;  2NU4 I;  4JCV E;  3E59 A;  4E1P A;  3D00 A;  3E2I A;  2GKT I;  1R0R I;  1SGE I;  3FSY A;  2ENZ A;  3HH2 C;  1UVG A;  2V53 A;  2E73 A;  4UXH A;  2JW6 A;  3CXL A;  3UFF A;  1HPT A;  1N13 A;  3R5B A;  5EX3 A;  1WKX A;  4UXJ A;  5J8F A;  5HQ8 A;  1XA6 A;  2X3T A;  1LR9 A; 
#chains in the Genus database with same CATH homology
 1LR8 A;  1TGS I;  3B4V C;  1M8B A;  3SGQ I;  1PTQ A;  2ERW A;  3BJI A;  1PJU A;  2ODD A;  2GKR I;  1CT4 I;  2NU2 I;  2KMP A;  1SGD I;  1W3S A;  3PDN A;  1SGQ I;  1W4R A;  4SGB I;  1KMA A;  2W0T A;  2DIP A;  1OMU A;  1PPF I;  2L8E A;  3OXG A;  1TUS A;  1M8C A;  2A20 A;  2KMO A;  4UXI A;  5FUY A;  2UZ3 A;  2SGP I;  4L9M A;  2OVO A;  1TUR A;  1YTP A;  2SGF I;  3UEY A;  4E1R A;  1XX6 A;  2FNF X;  5FUX A;  2V1C A;  1PTR A;  2SGD I;  2P6A C;  4FKD A;  3VDP A;  2YQP A;  1OMT A;  1CT2 I;  2ELI A;  2B8T A;  2SGE I;  1RFH A;  2LEO A;  2NU3 I;  2JYY A;  1IW4 A;  3OL0 A;  3UEJ A;  1VDD A;  1TBO A;  1DS3 I;  5FUV A;  3MEK A;  1TIH A;  5CCM A;  5JHW C;  1HJA I;  1CGI I;  3SGB I;  1TBN A;  1PCE A;  2ARP F;  2M5X A;  3OVO A;  3SEK C;  1KBF A;  2QQC A;  3UGI A;  1V1H A;  2NU0 I;  1LR7 A;  1FAR A;  2BUS A;  2E5R A;  1SGR I;  1CSO I;  4OVO A;  3UGL A;  2DB6 A;  2ROW A;  5HI7 A;  1OYV I;  1AN1 I;  1CHO I;  3OXF A;  1Y1B A;  1X4S A;  1R79 A;  2WCY A;  3QTL D;  5DAE A;  1NUB A;  1CT0 I;  2K9H A;  1Z7K B;  2JA1 A;  2SGQ I;  3QWP A;  3KY9 A;  1Y1C A;  2VRW B;  3TJQ A;  1X74 A;  5EX0 A;  3FC3 A;  1DS2 I;  1XBT A;  2V1C C;  4HGU A;  1OVO A;  2N1A B;  3OXL A;  1IY6 A;  1CGJ I;  1BUS A;  1FYB A;  1SGP I;  1HDL A;  2J87 A;  1IY5 A;  2ORV A;  2YUU A;  1SGY I;  2N17 A;  1TOT A;  2F3C I;  2N52 A;  2ORW A;  1TBR R;  1FAQ A;  1KBE A;  2NU1 I;  3VDU A;  2OD1 A;  2LUY A;  3RU0 A;  2GKV A;  2J9R A;  1V1I A;  3UGD A;  2N71 A;  4A24 A;  1Y8F A;  2KMQ A;  3GOX A;  1U5K A;  1UVF A;  2ENN A;  2JZM A;  2KCX A;  3VE5 A;  1MT1 A;  2JXD A;  2KMR A;  2WVJ A;  5CCL A;  2CJS C;  2GVI A;  2L7X A;  1H0Z A;  1TBQ R;  1YU6 C;  1SGN I;  1UUC A;  2QQ0 A;  5FUW A;  1CE3 A;  2QQE A;  2QQD A;  2B0U C;  1BMO A;  2XRC A;  4GI3 C;  4B6D A;  2QPO A;  2NU4 I;  4JCV E;  3E59 A;  4E1P A;  3D00 A;  3E2I A;  2GKT I;  1R0R I;  1SGE I;  2ENZ A;  3HH2 C;  1UVG A;  2V53 A;  2E73 A;  4UXH A;  2JW6 A;  3CXL A;  3UFF A;  1HPT A;  1N13 A;  5EX3 A;  4UXJ A;  5HQ8 A;  1XA6 A;  1LR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...