1LR9A

Structure of fs1, the heparin-binding domain of follistatin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
ETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Follistatin
publication title Crystal Structures of the Heparan Sulfate-binding Domain of Follistatin: Insights into ligand binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
A PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1lr9A00
1SGYI 1IY6A 1CT2I 2B0UC 2SGFI 3HH2C 2NU1I 1N13A 1PJUA 1KMAA 2BUSA 2ARPF 3B4VC 2SGEI 2KMPA 2F3CI 1LR7A 1BMOA 2QQCA 1Y1CA 2P6AC 2JYYA 1TBRR 1TUSA 2NU0I 1PCEA 1SGPI 1UVFA 1CHOI 2N52A 2KMRA 1NUBA 1M8CA 2GKVA 1BUSA 1OYVI 1IY5A 2KMOA 1CT4I 2KCXA 1SGDI 2N17A 1Y1BA 1FYBA 1YU6C 1SGQI 2N71A 1UUCA 3OVOA 1SGRI 1MT1A 3QTLD 1CGJI 1HDLA 4GI3C 1Z7KB 2QQDA 1DS2I 2LEOA 5JHWC 1CSOI 1TBQR 2JXDA 2KMQA 2OVOA 1LR8A 2SGPI 1OMTA 2SGDI 1AN1I 1TURA 4HGUA 1CGII 2V53A 1UVGA 1SGEI 2M5XA 1DS3I 2WCYA 1YTPA 1TIHA 2NU4I 1OVOA 3SGBI 2ERWA 5DAEA 1HPTA 2NU2I 1R0RI 1TGSI 2GKRI 1CT0I 1PPFI 4OVOA 1CE3A 1HJAI 2XRCA 2NU3I 3TJQA 1H0ZA 1LR9A 4SGBI 1OMUA 3SGQI 1IW4A 2SGQI 3SEKC 1M8BA 2JZMA 1SGNI 2GKTI
chains in the Genus database with same CATH superfamily
2ORVA 3UEJA 1SGYI 4L9MA 1CT2I 2B0UC 1IY6A 1ULMA 2CJSC 1Q9BA 2SGFI 1MJ9A 2GVIA 5CCLA 1WTJA 3HH2C 2NU1I 2YUUA 1N13A 1PJUA 3GOXA 4UXHA 1KMAA 3UOEA 2J9RA 2CWHA 5E3PA 2BUSA 2ENZA 5FUYA 4UXJA 2ARPF 2VRWB 3B4VC 5E3QA 2SGEI 2KMPA 2PQ8A 1HEVA 1U5KA 5E3RA 3TOAA 2DKVA 1WGTA 2F3CI 1VDDA 2GIVA 1MJAA 4MPIA 1K7UA 1TOTA 1LR7A 2ROWA 3TO7A 5HI7A 1BMOA 2QQCA 1Y1CA 2P6AC 2WVJA 1NXUA 2JYYA 1TBRR 1TUSA 2NU0I 1PCEA 3KY9A 4JCVE 1SGPI 2JA1A 1V1HA 2QQ0A 3MEKA 3RU0A 4B6DA 1UVFA 1CHOI 5CCMA 1X4SA 2N52A 2KMRA 1NUBA 1P9ZA 1W4RA 2A20A 2B8TA 3FSYA 3TO9A 1M8CA 5FUXA 2GKVA 1BUSA 1OYVI 3UGDA 1XBTA 5J8CA 1IY5A 2JW6A 2KMOA 1CT4I 1MJBA 1SGDI 1K7VA 2E5RA 2KCXA 3OXLA 3OXGA 2N17A 1Y1BA 1XX6A 1YU6C 1SGQI 2N71A 4E1RA 1FYBA 3D00A 1UUCA 3OVOA 3OXFA 3R5AA 1SGRI 1MT1A 3QTLD 1CGJI 1V1IA 1K7TA 1TBNA 1HDLA 1KBEA 2X3TA 4GI3C 1Z7KB 2QQDA 2FNFX 2UZ3A 5EX0A 3OL0A 1DS2I 2QQEA 2LEOA 1PTRA 5JHWC 1CSOI 1TBQR 1WKXA 3BJIA 2JXDA 2KMQA 4UXIA 2OVOA 1LR8A 2L7XA 2SGPI 1FY7A 3FSXA 3VDPA 1X74A 1Y8FA 2W0TA 7WGAA 1OMTA 2SGDI 1ULNA 1AN1I 2V1CC 9WGAA 1TURA 2WGCA 3R5BA 3UEYA 3QWPA 4HGUA 1XA6A 1CGII 2V53A 2Y0MA 3TO6A 1WGCA 1UVGA 2OD1A 1SGEI 2M5XA 1DS3I 2ELIA 3R5CA 2OU2A 1R79A 2WCYA 2X52A 1ULKA 2N1AB 1YTPA 2RIJA 1W3SA 2RC4A 5J8FA 1TIHA 2YQPA 1FARA 2NU4I 1OVOA 3SGBI 2ERWA 5DAEA 3TOBA 2DIPA 4AMLA 3UGIA 2QPOA 1HPTA 2NU2I 1TBOA 2ENNA 2E73A 1R0RI 1S20A 2UVOA 3E59A 4E1PA 1TGSI 2GKRI 5FUWA 4A24A 1FAQA 1Z2IA 3CXLA 1CT0I 3QAHA 1PPFI 2L8EA 1RFHA 4OVOA 1PTQA 2K9HA 1CE3A 5EX3A 1HJAI 2ORWA 2NU3I 2XRCA 2V1CA 3TJQA 1H0ZA 1LR9A 4WP4A 5FUVA 3VE5A 2LUYA 2CWFA 3FC3A 4SGBI 2ODDA 3PDNA 1OMUA 3SGQI 3UGLA 3VDUA 1IW4A 2LB7A 1UHAA 2SGQI 3UFFA 3E2IA 3SEKC 5HQ8A 1KBFA 1P9GA 1M8BA 2CWGA 2OZUA 3R5DA 2DB6A 2JZMA 4FKDA 1SGNI 4DNCA 2J87A 2GKTI
chains in the Genus database with same CATH topology
2ORVA 3UEJA 1SGYI 4L9MA 1CT2I 2B0UC 1IY6A 2CJSC 2SGFI 2GVIA 5CCLA 3HH2C 2NU1I 2YUUA 1N13A 1PJUA 3GOXA 4UXHA 1KMAA 2J9RA 2BUSA 2ENZA 5FUYA 4UXJA 2ARPF 2VRWB 3B4VC 2SGEI 2KMPA 1U5KA 2F3CI 1VDDA 1TOTA 2ROWA 1LR7A 5HI7A 1BMOA 2QQCA 1Y1CA 2P6AC 2WVJA 3KY9A 2JYYA 1TBRR 1TUSA 2NU0I 1PCEA 4JCVE 1KBFA 1SGPI 2JA1A 1V1HA 2QQ0A 3MEKA 3RU0A 4B6DA 1UVFA 1CHOI 5CCMA 1X4SA 2N52A 2KMRA 1NUBA 1W4RA 2A20A 2B8TA 1M8CA 5FUXA 2GKVA 1BUSA 1OYVI 3UGDA 1XBTA 1IY5A 2JW6A 2KMOA 1CT4I 2KCXA 1SGDI 2E5RA 3OXGA 3OXLA 2N17A 1Y1BA 1XX6A 1YU6C 1SGQI 2N71A 4E1RA 1FYBA 3D00A 1UUCA 3OVOA 3OXFA 1SGRI 1MT1A 3QTLD 1CGJI 1V1IA 1TBNA 1HDLA 1KBEA 4GI3C 1Z7KB 2QQDA 2FNFX 2UZ3A 5EX0A 3OL0A 1DS2I 2QQEA 2LEOA 1PTRA 5JHWC 1CSOI 1TBQR 3BJIA 2JXDA 2KMQA 4UXIA 2OVOA 1LR8A 2L7XA 2SGPI 3VDPA 1X74A 1Y8FA 2W0TA 1OMTA 2SGDI 2V1CC 1AN1I 1TURA 3UEYA 3QWPA 4HGUA 1XA6A 1CGII 2V53A 1UVGA 2OD1A 1SGEI 2M5XA 1DS3I 2ELIA 1R79A 2WCYA 2N1AB 1YTPA 1W3SA 1TIHA 2YQPA 1FARA 2NU4I 1OVOA 3SGBI 2ERWA 5DAEA 2DIPA 3UGIA 2QPOA 1HPTA 2NU2I 1TBOA 2ENNA 2E73A 1R0RI 3E59A 4E1PA 1TGSI 2GKRI 5FUWA 4A24A 1FAQA 3CXLA 1CT0I 1PPFI 2L8EA 1RFHA 4OVOA 1PTQA 2K9HA 1CE3A 5EX3A 1HJAI 2ORWA 2NU3I 2XRCA 2V1CA 3TJQA 1H0ZA 1LR9A 5FUVA 3VE5A 2LUYA 3FC3A 4SGBI 2ODDA 3PDNA 1OMUA 3SGQI 3UGLA 3VDUA 1IW4A 2SGQI 3UFFA 3E2IA 3SEKC 5HQ8A 1M8BA 2DB6A 2JZMA 4FKDA 1SGNI 2J87A 2GKTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGY I;  1IY6 A;  1CT2 I;  2B0U C;  2SGF I;  3HH2 C;  2NU1 I;  1N13 A;  1PJU A;  1KMA A;  2BUS A;  2ARP F;  3B4V C;  2SGE I;  2KMP A;  2F3C I;  1LR7 A;  1BMO A;  2QQC A;  1Y1C A;  2P6A C;  2JYY A;  1TBR R;  1TUS A;  2NU0 I;  1PCE A;  1SGP I;  1UVF A;  1CHO I;  2N52 A;  2KMR A;  1NUB A;  1M8C A;  2GKV A;  1BUS A;  1OYV I;  1IY5 A;  2KMO A;  1CT4 I;  2KCX A;  1SGD I;  2N17 A;  1Y1B A;  1FYB A;  1YU6 C;  1SGQ I;  2N71 A;  1UUC A;  3OVO A;  1SGR I;  1MT1 A;  3QTL D;  1CGJ I;  1HDL A;  4GI3 C;  1Z7K B;  2QQD A;  1DS2 I;  2LEO A;  5JHW C;  1CSO I;  1TBQ R;  2JXD A;  2KMQ A;  2OVO A;  1LR8 A;  2SGP I;  1OMT A;  2SGD I;  1AN1 I;  1TUR A;  4HGU A;  1CGI I;  2V53 A;  1UVG A;  1SGE I;  2M5X A;  1DS3 I;  2WCY A;  1YTP A;  1TIH A;  2NU4 I;  1OVO A;  3SGB I;  2ERW A;  5DAE A;  1HPT A;  2NU2 I;  1R0R I;  1TGS I;  2GKR I;  1CT0 I;  1PPF I;  4OVO A;  1CE3 A;  1HJA I;  2XRC A;  2NU3 I;  3TJQ A;  1H0Z A;  1LR9 A;  4SGB I;  1OMU A;  3SGQ I;  1IW4 A;  2SGQ I;  3SEK C;  1M8B A;  2JZM A;  1SGN I;  2GKT I; 
#chains in the Genus database with same CATH topology
 2ORV A;  3UEJ A;  1SGY I;  4L9M A;  1CT2 I;  2B0U C;  1IY6 A;  1ULM A;  2CJS C;  1Q9B A;  2SGF I;  1MJ9 A;  2GVI A;  5CCL A;  1WTJ A;  3HH2 C;  2NU1 I;  2YUU A;  1N13 A;  1PJU A;  3GOX A;  4UXH A;  1KMA A;  3UOE A;  2J9R A;  2CWH A;  5E3P A;  2BUS A;  2ENZ A;  5FUY A;  4UXJ A;  2ARP F;  2VRW B;  3B4V C;  5E3Q A;  2SGE I;  2KMP A;  2PQ8 A;  1HEV A;  1U5K A;  5E3R A;  3TOA A;  2DKV A;  1WGT A;  2F3C I;  1VDD A;  2GIV A;  1MJA A;  4MPI A;  1K7U A;  1TOT A;  1LR7 A;  2ROW A;  3TO7 A;  5HI7 A;  1BMO A;  2QQC A;  1Y1C A;  2P6A C;  2WVJ A;  1NXU A;  2JYY A;  1TBR R;  1TUS A;  2NU0 I;  1PCE A;  3KY9 A;  4JCV E;  1SGP I;  2JA1 A;  1V1H A;  2QQ0 A;  3MEK A;  3RU0 A;  4B6D A;  1UVF A;  1CHO I;  5CCM A;  1X4S A;  2N52 A;  2KMR A;  1NUB A;  1P9Z A;  1W4R A;  2A20 A;  2B8T A;  3FSY A;  3TO9 A;  1M8C A;  5FUX A;  2GKV A;  1BUS A;  1OYV I;  3UGD A;  1XBT A;  5J8C A;  1IY5 A;  2JW6 A;  2KMO A;  1CT4 I;  1MJB A;  1SGD I;  1K7V A;  2E5R A;  2KCX A;  3OXL A;  3OXG A;  2N17 A;  1Y1B A;  1XX6 A;  1YU6 C;  1SGQ I;  2N71 A;  4E1R A;  1FYB A;  3D00 A;  1UUC A;  3OVO A;  3OXF A;  3R5A A;  1SGR I;  1MT1 A;  3QTL D;  1CGJ I;  1V1I A;  1K7T A;  1TBN A;  1HDL A;  1KBE A;  2X3T A;  4GI3 C;  1Z7K B;  2QQD A;  2FNF X;  2UZ3 A;  5EX0 A;  3OL0 A;  1DS2 I;  2QQE A;  2LEO A;  1PTR A;  5JHW C;  1CSO I;  1TBQ R;  1WKX A;  3BJI A;  2JXD A;  2KMQ A;  4UXI A;  2OVO A;  1LR8 A;  2L7X A;  2SGP I;  1FY7 A;  3FSX A;  3VDP A;  1X74 A;  1Y8F A;  2W0T A;  7WGA A;  1OMT A;  2SGD I;  1ULN A;  1AN1 I;  2V1C C;  9WGA A;  1TUR A;  2WGC A;  3R5B A;  3UEY A;  3QWP A;  4HGU A;  1XA6 A;  1CGI I;  2V53 A;  2Y0M A;  3TO6 A;  1WGC A;  1UVG A;  2OD1 A;  1SGE I;  2M5X A;  1DS3 I;  2ELI A;  3R5C A;  2OU2 A;  1R79 A;  2WCY A;  2X52 A;  1ULK A;  2N1A B;  1YTP A;  2RIJ A;  1W3S A;  2RC4 A;  5J8F A;  1TIH A;  2YQP A;  1FAR A;  2NU4 I;  1OVO A;  3SGB I;  2ERW A;  5DAE A;  3TOB A;  2DIP A;  4AML A;  3UGI A;  2QPO A;  1HPT A;  2NU2 I;  1TBO A;  2ENN A;  2E73 A;  1R0R I;  1S20 A;  2UVO A;  3E59 A;  4E1P A;  1TGS I;  2GKR I;  5FUW A;  4A24 A;  1FAQ A;  1Z2I A;  3CXL A;  1CT0 I;  3QAH A;  1PPF I;  2L8E A;  1RFH A;  4OVO A;  1PTQ A;  2K9H A;  1CE3 A;  5EX3 A;  1HJA I;  2ORW A;  2NU3 I;  2XRC A;  2V1C A;  3TJQ A;  1H0Z A;  1LR9 A;  4WP4 A;  5FUV A;  3VE5 A;  2LUY A;  2CWF A;  3FC3 A;  4SGB I;  2ODD A;  3PDN A;  1OMU A;  3SGQ I;  3UGL A;  3VDU A;  1IW4 A;  2LB7 A;  1UHA A;  2SGQ I;  3UFF A;  3E2I A;  3SEK C;  5HQ8 A;  1KBF A;  1P9G A;  1M8B A;  2CWG A;  2OZU A;  3R5D A;  2DB6 A;  2JZM A;  4FKD A;  1SGN I;  4DNC A;  2J87 A;  2GKT I; 
#chains in the Genus database with same CATH homology
 2ORV A;  3UEJ A;  1SGY I;  4L9M A;  1CT2 I;  2B0U C;  1IY6 A;  2CJS C;  2SGF I;  2GVI A;  5CCL A;  3HH2 C;  2NU1 I;  2YUU A;  1N13 A;  1PJU A;  3GOX A;  4UXH A;  1KMA A;  2J9R A;  2BUS A;  2ENZ A;  5FUY A;  4UXJ A;  2ARP F;  2VRW B;  3B4V C;  2SGE I;  2KMP A;  1U5K A;  2F3C I;  1VDD A;  1TOT A;  2ROW A;  1LR7 A;  5HI7 A;  1BMO A;  2QQC A;  1Y1C A;  2P6A C;  2WVJ A;  3KY9 A;  2JYY A;  1TBR R;  1TUS A;  2NU0 I;  1PCE A;  4JCV E;  1KBF A;  1SGP I;  2JA1 A;  1V1H A;  2QQ0 A;  3MEK A;  3RU0 A;  4B6D A;  1UVF A;  1CHO I;  5CCM A;  1X4S A;  2N52 A;  2KMR A;  1NUB A;  1W4R A;  2A20 A;  2B8T A;  1M8C A;  5FUX A;  2GKV A;  1BUS A;  1OYV I;  3UGD A;  1XBT A;  1IY5 A;  2JW6 A;  2KMO A;  1CT4 I;  2KCX A;  1SGD I;  2E5R A;  3OXG A;  3OXL A;  2N17 A;  1Y1B A;  1XX6 A;  1YU6 C;  1SGQ I;  2N71 A;  4E1R A;  1FYB A;  3D00 A;  1UUC A;  3OVO A;  3OXF A;  1SGR I;  1MT1 A;  3QTL D;  1CGJ I;  1V1I A;  1TBN A;  1HDL A;  1KBE A;  4GI3 C;  1Z7K B;  2QQD A;  2FNF X;  2UZ3 A;  5EX0 A;  3OL0 A;  1DS2 I;  2QQE A;  2LEO A;  1PTR A;  5JHW C;  1CSO I;  1TBQ R;  3BJI A;  2JXD A;  2KMQ A;  4UXI A;  2OVO A;  1LR8 A;  2L7X A;  2SGP I;  3VDP A;  1X74 A;  1Y8F A;  2W0T A;  1OMT A;  2SGD I;  2V1C C;  1AN1 I;  1TUR A;  3UEY A;  3QWP A;  4HGU A;  1XA6 A;  1CGI I;  2V53 A;  1UVG A;  2OD1 A;  1SGE I;  2M5X A;  1DS3 I;  2ELI A;  1R79 A;  2WCY A;  2N1A B;  1YTP A;  1W3S A;  1TIH A;  2YQP A;  1FAR A;  2NU4 I;  1OVO A;  3SGB I;  2ERW A;  5DAE A;  2DIP A;  3UGI A;  2QPO A;  1HPT A;  2NU2 I;  1TBO A;  2ENN A;  2E73 A;  1R0R I;  3E59 A;  4E1P A;  1TGS I;  2GKR I;  5FUW A;  4A24 A;  1FAQ A;  3CXL A;  1CT0 I;  1PPF I;  2L8E A;  1RFH A;  4OVO A;  1PTQ A;  2K9H A;  1CE3 A;  5EX3 A;  1HJA I;  2ORW A;  2NU3 I;  2XRC A;  2V1C A;  3TJQ A;  1H0Z A;  1LR9 A;  5FUV A;  3VE5 A;  2LUY A;  3FC3 A;  4SGB I;  2ODD A;  3PDN A;  1OMU A;  3SGQ I;  3UGL A;  3VDU A;  1IW4 A;  2SGQ I;  3UFF A;  3E2I A;  3SEK C;  5HQ8 A;  1M8B A;  2DB6 A;  2JZM A;  4FKD A;  1SGN I;  2J87 A;  2GKT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...