1LRJA

Crystal structure of e. coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrjA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrjA01
2HJSA 4B4VA 1HL3A 1YJQA 4J7XA 4Q9NA 5T67A 2DBZA 4WLVA 1YS4A 3U49A 1LNQA 9LDTA 5TJ9A 3TPCA 1VRWA 5CG1A 1PGOA 1DRUA 1EUDA 2DQ4A 3OJFA 2GYYA 1MUUA 3O8QB 1KVQA 4DBZA 3DR3A 3U3XA 2FZEA 4BGUA 2W2LD 1OC2A 2O3UA 2VHYA 1MG5A 2VT2A 2WYWA 3H4VA 3IAHA 3TL2A 1ZJYA 2CSUA 2PR2A 5HRUA 2VYND 1WPQA 4HFMA 3SLKA 3ANMA 1Y81A 3ZWAA 3UCXA 3ZW8A 5L95A 3JSAA 3T4XA 3K2BA 2R2GA 1UP6A 1YONA 4JP2A 5I7SA 4BNLA 3KXDA 3VDRA 4EW6A 3RUFA 3E6AA 3H2ZA 1GADO 1SEPA 3DONA 3F6YA 4TZKA 1Z82A 1AXEA 3GGPA 1Y8RA 1M67A 4NG5A 1LBEA 4PLYA 4IBOA 1GCOA 1CDOA 4FPXA 2AE2A 1E7QA 2FHSA 4M55A 1P1FA 1ISMA 3B1FA 2V6MA 2WYVA 2Z95A 4QFCA 1DBVO 4MKZA 5F5NA 3LLSA 6LDHA 4CM1A 3EHEA 4N54A 3PJGA 1LEHA 3ADOA 4IMPA 3V8BA 3BYZA 4YRBA 2PY6A 4AL4A 1E6UA 3Q11A 1KY4A 2YJZA 1OAAA 4NFYA 4QO8A 6ADHA 4D46A 4BO1A 3QP9A 5A4DA 3PLRA 1QYXA 4PCVA 2DFVA 2X0RA 4R9RA 2GZ2A 4Q3NA 4MVJE 5G0UA 4NIMA 1KS9A 4OM8A 2FR0A 1Z7BA 3AI3A 1FDWA 4MP3A 4QUKA 2WJPA 4EUHA 1I0ZA 1LDMA 4WCFA 5KTKA 1P74A 2Y1GA 2O3QA 3HE3A 2VYVA 4JNKA 2EV9A 3OJEA 4PIVA 2WEKA 4BO0A 1RM0A 4Z0HO 1LSSA 3HDHA 4O6VA 3Q2IA 3F1LA 3AM3A 2UAGA 2Y1CA 3DTTA 1E1KA 4R1TA 3RASA 3BMOB 1DJNA 2FWMX 4EUEA 1GDHA 3ONFA 3S2IA 4N7RA 1GZ6A 5KVCA 3PEFA 3VZPA 1D7OA 4IMRA 4FW8A 4CMCA 1T4DA 1WVGA 2YFQA 4DGSA 5JLAA 3NTQA 4MVJM 4D3DA 3M1LA 4FFRA 5DOZA 4W9NA 1FK8A 4QFDA 5U4QA 4ALMA 3RUDA 4PLHA 4WASA 3KRTA 4YAKA 1DSSG 3AM5A 1MB4A 1E0DA 2H6EA 3FTNA 1UXJA 3SXPA 4F6LA 3AOEA 5C37A 1KVUA 2B35A 2Z5LA 3HDYA 3G1UA 4J1SA 1YBAA 2VQ3A 4PZDA 4XA8A 3SEFA 4EGFA 3AK4A 2V65A 3SC4A 3ZV4A 5TQVA 4PRKA 1O0SA 1R16A 1NAHA 1T2DA 2EHDA 1ORRA 5EN4A 4BNHA 5FI3A 2B4RO 4XRGA 5HS4A 1ZSNA 1GFSA 3LK7A 5EPOA 1PJ3A 4GVXA 1V6AA 3OMLA 3VC7A 4IUYA 2WSBA 3W4IA 3R3JA 3DAFA 3MWEB 3ZU4A 4RLHA 4S3MA 2NVUB 4X54A 2Q50A 4L8VA 2RHRA 1T1SA 3GVCA 1EK6A 4Q3EA 3AI1A 1FDSA 4II2A 1HSOA 4K6CA 1B14A 3LC7O 2W2KB 2GRAA 2QQ5A 2VNAA 2JCYA 1HZJA 3QVXA 3JD2A 4OGWA 2G76A 2VUSA 3E03A 4FOOA 4HKTA 1VE9A 4ND3A 2PGLA 2EKPA 4BNIA 1AGNA 4GBJA 1HDXA 5L7YA 2BLLA 3JQDA 2C7VA 2GN4A 4HY3A 3JQBC 4C4OA 4WECA 1KBZA 1HE2A 2VWHA 2HLPA 3E9QA 4BMVA 2ZB8A 3O8QA 4JJIA 1AHHA 5KVVA 3F9IA 1PIWA 4II3A 1EE9A 2YDYA 1H6BA 2ZQZA 4BNUA 4CV0A 3S55A 1W0CA 1L7EA 2NNLD 1QRRA 2Q4BA 3VZRA 5BQFA 4NH4A 4J1TA 4G81A 2OZPA 4MP6A 4JN6B 3NT5A 4I08A 1V35A 2DLDA 3H9EO 4E0BA 3U09A 3FSRA 1ID1A 4AJEA 2F00A 3E82A 3IQDB 4WLOA 3GAZA 4CLXA 2DU8A 3RBXA 2HMVA 5JCJD 4TVOA 3WYEA 1MC4A 1PJLA 1ULUA 4YXFA 3TQHA 3U5TA 2X0IA 2HAEA 2J5KA 2HRZA 2YZ7A 3L6OO 4OOFA 4J43A 2IYOA 1LJ8A 4DIBA 4CL3A 2B0JA 2NU7A 1N7HA 4A7PA 5K6AA 4CQMA 3MEQA 4DPMA 2CD9A 3SVTA 4A73A 1N2SA 4XZ3A 2RH8A 4OJNA 4DVJA 4ND2A 3COSA 4U7WA 3RC2A 3JYOA 4TRRA 2NVBA 3UFXA 3WS7A 5T57A 4MOWA 1PL6A 2NQTA 3UCFA 4AJ4A 1KEPA 1XQ6A 3ONEA 5KIAA 3H5AA 4P22A 3GNQA 1FJHA 3EAGA 2Q99A 3TL3A 4B4OA 1BW9A 4B8ZA 2JAHA 4GSKA 4ONEA 2HK8A 3UXYA 4E3ZA 1YXMA 3GY0A 3GGGA 4UUNA 3F4LA 4NQZA 5G0SA 2GZ3A 3UN1A 1T2EA 3VZQA 4BO3A 1G0NA 2OFPA 1X14A 2CDAA 4I9UA 4DIFA 3KEOA 3WMXA 3B1KA 1IPFA 2O50A 2OORA 4JIGA 1PGNA 4HP8A 3QY9A 4RJTA 3QSGA 3BMOA 1U8XX 4J3FA 4K26A 1ADCA 2GN9A 3I4FA 4DQUA 4LSWA 1P1IA 4NJMA 4E2WA 3JQGB 5KWEA 2NTNA 1VL0A 3FR8A 5LDGA 3DOJA 3VTZA 2VHXA 2ZJ0A 4B7UA 4CMIA 4J7UA 2G1UA 4ILKA 5F1KA 1JAYA 1HZZA 2PA3A 3FI9A 4CODB 2P9GA 1QLJA 4YT5A 5C7IO 5IXSA 4OXYA 3BHJA 4WE3A 2OOSA 5IDWA 4R1UA 2OHXA 3PXXA 1Q1NA 4F3YA 4DYVA 5EERA 4ITUA 3TFOA 4EEZA 2Q1SA 3NX4A 2IYPA 1EQUA 5JY6A 1CERA 3W4KA 1UP4A 4CLRA 1K6JA 2PH3A 2HMTA 2E37A 3H9JA 5CP8A 1G6KA 4FBGA 4M87A 2BD0A 4G2NA 2O3JA 4BNTA 4JJGA 1J0XO 1H93A 3WBFA 3ICPA 3UAGA 4FCCA 1Y5RA 3KM0A 2X5OA 3ASUA 1XIVA 1N7GA 1SCUA 3EMKA 3WTCA 2VOEA 4YAEA 1Y5MA 1CJCA 4YAJA 4R4JA 4R51A 3ZV6A 4J16A 1I3MA 2O4CA 4Q3BA 4I5EA 4Z3KA 4M89A 1P31A 1KIFA 1BTOA 2H5LA 4J1QA 1U8FO 2O3RA 3KV3O 1IHXA 3MJ4A 4EZBA 1EQ2A 1N9GB 1PWZA 3DBRA 2H1SA 4FSHA 4MVJA 4BNYA 1PX0A 3VH2A 4FDAA 1I32A 1VM6A 1E5LA 2AQ8A 4JBGA 3KSUA 4CPDA 3I9MA 4EUFA 2C5EA 5I9MA 4JK3A 3TN7A 3KYBA 5LDHA 3B20A 3QHAA 1Q7BA 1GEEA 1B16A 5L3ZA 3E5MA 3VPHA 5A3JA 4ZJUA 3DFUA 3SJ7A 5I7FA 1SZJG 3UHAA 3ADPA 3Q9NA 1WDMA 1ZSYA 5BSFA 4XDYA 4RCVA 3PHJA 4P4LA 5I7EA 1O5IA 4HADA 4OKIA 4RV9A 1U28A 2R00A 4WLNA 4D41A 3WFIA 1NM5A 3GC6A 1LC0A 2JCVA 1AXGA 5L45A 1NQ5A 2QZZA 1JKJA 2AEFA 3L77A 4NU6A 4PG7A 1EEHA 4FS3A 4PVCA 2CVQA 2VRCD 2NACA 4CMAA 3I83A 1MLDA 4TQGA 3H7AA 4ZQFA 1JVSA 2W4QA 3HDQA 4NBTA 4Z3DA 4HWKA 5DCWA 2B4TO 4UVDA 5TNXA 4HNGA 3WLEA 2AQHA 3UICA 5JAMA 4AJNA 4PZEA 2CF5A 5ICMA 4I1IA 2WE8A 5EL0A 2ILTA 1HDYA 3L4BC 1UAYA 4CMEC 3DBLA 4CLOA 3AM4A 4YT4A 1FMCA 3EK2A 3PYLA 5BSEA 1ZZEA 2CDBA 1K0UA 2ZYGA 3WGZA 1KYQA 4K6FA 2O2SA 2Q1UA 4P8RA 4BO2A 2GN8A 4PN3A 4E13A 2JD2A 1JDJA 3DBHB 5KKCA 2C07A 5JBIA 1DAOA 3QV1A 2Q3EA 1UZLA 1QYVA 1B3BA 1G1AA 2JL1A 2Q4EA 4Y6SA 4GGPA 3KUXA 4ND5A 1IPEA 1WMBA 3GZ4A 4J4HA 3MWDB 3DC2A 1VL8A 3GZNB 2DPHA 3PFWO 1MFZA 4UULA 2VWGA 1Q7GA 1XKQA 3RROA 3RUIA 4TROA 1O89A 1YWGO 1LLCA 1NVMB 1LDYA 1M66A 5TT0A 2AQIA 4PLPA 5KKAA 1SPXA 3ZWNA 4A0SA 3ZWPA 4P4NA 1U9JA 1NHGA 3PQDA 5A04A 3PHIA 5KVSA 2FR8A 1PJ2A 2I99A 3IIEA 4XIYA 4BL5A 5KOIA 3PJEA 2Q1TA 5I9NA 2DBQA 3JQGA 5IAAA 4PG6A 1XGKA 1QP8A 4A03A 3D3EA 3QLJA 3F3SA 3JQFC 4R01A 2JKVA 3WBBA 2HMUA 4BQRA 2FSVA 5L4LA 1UDAA 1BXGA 2HUNA 4TZTA 4IZHA 3WIEA 1ENZA 1YO6A 5JMPA 2JCXA 1A72A 3WWZA 2ZB3A 4ALLA 2FR1A 1B8PA 2HMWA 4DC0A 2FPIA 3H3JA 2IE0A 4LRTB 4NDNE 4QSMA 1GCUA 2QRKA 4GKVA 4O59O 4UAGA 5TC4A 2CZCA 3DMYA 3CUKA 3DDNA 1HYHA 4O0LA 3T7CA 1K3TA 2Z1MA 2P9CA 1LRJA 3NTRA 1T25A 2QYTA 3I9NA 1HLPA 1M6HA 1M6WA 4PFJA 5ENVA 3R6DA 3I9LA 1F17A 2Y0CA 4BNJA 3DAPA 1UH5A 3SJUA 1R0SA 4E2YA 3AUAA 4YDRA 4YTEA 5EQDA 4GGOA 2P5UA 2P5YA 4N5LA 3CMMA 2OBNA 1WZEA 1BWSA 5MGBA 1NNUA 5DBFA 1GR0A 2P2SA 1UZNA 4KWIA 2PV7A 4W82A 4BB5A 1TEHA 2E49A 3ICCA 3Q1LA 5IZCC 4HX5A 4EI2A 4UVHA 4M86A 4CR7A 1ENOA 4OH1A 5TGDA 4DL9A 5A5FA 4BO5A 3OJ0A 4R3NA 5DT9A 2DFDA 4BNZA 3GDOA 3ZDFA 2BELA 4PG5A 2PH5A 2OO5A 3JQAD 3NGXA 1LC3A 1PZEA 1YL6A 3CMCO 4NFSA 1EDZA 4G65A 2J8ZA 4KUEA 1QYCA 5L7WA 2ZB7A 1HKUA 1C0LA 4U0JA 4CMHA 3GRPA 2X1HA 1NPYA 2CF6A 5IG2A 3GVPA 4LVCA 3AWDA 4JCOA 5HM8A 4DQVA 3FWNA 3ZWCA 1UUFA 1XEAA 2DC1A 2ZJ1A 3EGOA 1KY5A 2J3KA 4BV9A 1BXZA 1XDWA 3O4RA 3N74A 4INAA 3WG9A 1GAEO 1P1KA 2C2YA 2I66A 4BNNA 3S2GA 5BSHA 1WDLA 5A1TA 1PTJA 3FNHA 4FC7A 4QX6A 1E7RA 2DTDA 4YRAA 1MG0A 1GL3A 3OJOA 4EEXA 1DOHA 1E5QA 1VKOA 3GEGA 3A28A 3TOXA 1P9LA 3C7AA 3C1TA 4XJSA 3PYMA 5A02A 2HK7A 1HDCA 2DAPA 4LGVA 2I3GA 3JD4A 5G2OA 3K9QO 2WD8A 4CM8B 1ISFA 1BVRA 5LCXA 1O94A 3PDJA 1B26A 3EVTA 4B3JA 2UVDA 1BMDA 4M1QA 3NV9A 4RL6A 2PZMA 4BNKA 4RF5A 2H63A 1SMKA 3DTYA 3RUEA 5JDIC 1EBUA 2V6GA 3QVTA 4IDAA 1X7GA 1E92A 5F21A 3EY4A 2ZCVA 1F12A 3DZHA 1UXKA 4GKBA 3D7LA 2FRDA 2PNFA 1YB1A 3HHPA 4YQYA 4CM4A 1H2HA 4P38A 1TT5B 1U3TA 3P2YA 3E5RA 5ER6A 5MDHA 2RCYA 2UUOA 2XOXA 1DC6A 2ZYDA 3KYDA 4RZIA 1C0PA 3E1KA 5ENDA 4IJWA 1LX6A 4F6CA 2YW9A 3H9GA 2VYVD 3C85A 4DUPA 3FBTA 3EZLA 4L4RA 3IJPA 4RQTA 2GCGA 4WK6A 3BA1A 3PDUA 2BGKA 5AQ1A 3BTUA 4G5HA 3ZWBA 2X23A 4J4BA 5CG2A 1WLYA 3IKTA 1CWUA 3ANNA 2PKRA 2XAAA 2R6JA 1NFFA 2O23A 4W6ZA 3GN1A 3GGOA 4BQPA 1E1NA 5K0ZA 3G17A 3IDSA 4BOYA 4FGWA 4OXNA 1DIRA 1XA0A 3OP4A 1HF3A 2I76A 4DBVO 3KHUA 3R3SA 3MJEA 4CLEA 4YT8A 3ZH2A 5JE8A 1YBVA 3SLGA 3KEQA 4K28A 5EMHA 3DZBA 2QYSA 3VOSA 1NQTA 4J9UE 3B6ZA 3M2PA 4EJ6A 2P4QA 3LDHA 4OQZA 2C20A 3RJ5A 1I5RA 1RYDA 1GUYA 4L0QA 2PKQP 4P4GA 1JA9A 4AFNA 1SB8A 2NWQA 1CYDA 1P3DA 5T8KC 3RC1A 3Q9UA 5JPIA 4JJFA 4B3HA 3VKVA 3CINA 1T2AA 1UXIA 1A5ZA 2NVWA 3O03A 5JSFA 3EDMA 2VTDA 4KQXA 2E48A 3F5SA 3PRJA 4CUKA 4FD3A 3VPFA 2NU6A 1YGYA 2VWPA 4DRYA 4S1VA 3ST7A 2VT3A 2X7HA 3LF2A 1LU9A 3KBOA 4NBRA 1Q7CA 1RM5A 4M49A 4DPLA 1VC2A 3AUUA 3FPLA 1Y8QA 3MCVA 1ML3A 1FF9A 3B1JA 1RM4A 2X0JA 4R5MA 4WLFA 2WWRA 3HG7A 1E3SA 2EG9A 5BR7A 2HO5A 1ISGA 3ZCXA 4E5YA 4YJHA 1Z73A 5THKA 5B1YA 5TF4A 4J1NA 3ASVA 1GYRA 2OMEA 4K9DA 4D44A 2P9EA 4UVIA 1JTVA 1BDBA 2YFHA 3QRWA 2AW5A 5TJHA 4WPGA 3AFMA 4XCVA 3NGLA 3DOOA 1LSOA 2EXXA 3FCOA 3JCZA 4O1MA 4QT0A 3RIHA 3PJDA 3ROQA 2IXAA 1ISHA 4HFNA 4J2OA 1EFLA 3H2SA 1OOEA 4AJOA 1BG6A 3WSWA 4N5NA 3UF0A 4YJDA 1IL0A 4EJMA 4RVSA 2BFOA 2F1KA 2ZCUA 1MA0A 1TA4A 5H82A 2AE1A 1IZ9A 2YHIB 4WNIA 1DLIA 3HFSA 4IINA 1UXGA 3VAZA 1NX6A 4MVJI 1YH3A 3PIIA 3ZHYA 1E6EA 5DCYA 3VH4A 2H9IA 5A5EA 3K31A 1CQJA 1FDUA 3ETDA 3MOIA 4XIJA 3RUCA 2VYNA 4ESOA 1W8DA 2PWZA 3IP3A 3RWBA 4FFNA 4DXHA 2IZ1A 3AY7A 3GUCA 3KYCA 5JCXA 4DIOA 1HDOA 4GQAA 4GWGA 3KLPX 4XGIA 3WMWA 4TSKA 1FXSA 2UYYA 3G79A 3FRJA 4IY1A 4N18A 4WEOA 1X15A 4KDFA 3RVDA 3ZWMA 3R1IA 3I1JA 3CEAA 3JTMA 3W8FA 1X7HA 2I5PO 4AVYA 3D4OA 3OJLA 1P1HA 1DC4A 1HYEA 3CKYA 3JYPA 1UZMA 4CQMD 1YOVA 2GSDA 2FSSA 4I8XA 4ZICA 4PLVA 1WP4A 3H6KA 4LISA 3W8EA 3KETA 5I8WA 1I3NA 5AXAA 4R9SA 5B4UA 2Q46A 3GK3A 1BGVA 1KOLA 2VN8A 2P4HX 1GYPA 3ZV5A 4CMKA 3WGHA 3WQQA 1TT5A 2CFCA 2LDXA 4AG3A 2WE7A 4AJKA 4DMMA 4R16A 3PWSA 3G1TA 4JP3A 2QG4A 4IGFA 5DBIA 4CR8A 4RPGA 1EVZA 3TNLA 1ZK4A 4KUGA 4OMUA 1SEVA 3FTPA 4RLSA 3VVBA 5HA5A 4JROA 5COQA 4U0KA 1NASA 1P1JA 4LN1A 4MJLA 1AN9A 2Q49A 4OSPA 4W99A 4AICA 2Q1WA 2NADA 2O48X 2G0TA 5COBA 4A10A 4GL4A 3CZRA 5I7VA 1EFKA 1ZK2A 2HKIA 4RVUA 5TIIA 3QJ5A 1B0AA 5KJFA 4FJ0A 4CLDA 4KTVE 2Q2VA 3FHLA 5DULA 4XKJA 2HMSA 2OBYA 5ADHA 3GNSA 5EINA 4EDFA 4XYMA 4NBUA 2X0NA 1DFIA 1C1XB 2VHWA 1OZAA 2G82A 3ZHXA 5CDYA 1DJQA 4YJGB 2DM6A 5ER9A 4JLWA 3INGA 2ET6A 2A9FA 2OXIA 1ZCJA 3HQ4O 1DEHA 3D5TA 3HDJA 4GWKA 4FJ2A 8LDHA 3ZWXA 1P44A 3I52A 3GT0A 1DO8A 1HTBA 3RFVA 3WSVA 1O95A 4PRLA 5JO9A 1ZXBA 1JAXA 4YR9A 3DXFA 1PJQA 2FN7A 4BUCA 2EKQA 4R5HA 3OBBA 5F1OA 3NYWA 4WCFC 4FJ1A 3GLQA 3D0OA 3V2UA 1A7AA 1MP0A 3QA9A 4BGIA 2PD3A 3U9LA 3ZHBA 4E5MA 4L4XA 2D3TA 3BAZA 3AU8A 1XYGA 2PGDA 3TZQA 4H7PA 3ZNQA 5JC1A 1MX3A 1SB9A 2HRBA 3H5RA 1NXQA 4XRRA 3ZU2A 3BTOA 4YB8A 3MJSA 3FNFA 2BRUA 2DPGA 1UAGA 2EP7A 3V2GA 1SBYA 4CL8A 2P91A 2B69A 3HFGA 1PGPA 1K6IA 4FFOA 3OF2A 4D0SA 1N1GA 3LZ6A 4W9NC 5FYDA 2OUIA 3RFXA 4B3IA 2GD1O 2DKNA 4KP7A 1EUZA 1C1DB 2IEDA 1H2BA 3AOEC 4WKGA 3RUAA 2XXJA 4MIYA 5AOVA 1XELA 1L7DA 1H6AA 2YHIA 1O6ZA 3UOGA 3HSKA 1JWBB 5JAIA 4UVGA 5CHEA 5BNFA 2B4QA 1ADBA 2OL4A 2PTGA 2IRWA 3PLNA 5DOVA 1A7KA 4Y6RA 2OP0A 4Z9FA 2GASA 1GD1O 3AOGA 2VRBA 3RI3A 4J4TA 3HADA 5TS3A 2TMGA 1MFPA 1XR3A 1IOLA 2ZTLA 1RKXA 2VHZA 4TVBA 4GX2A 2X58A 3CH6A 1A4IA 4ROSA 2X8LA 4E4YA 4RVGA 2AQKA 5BNTA 3LT0A 2OGUA 2FMUA 5KNLA 2UV8A 4HFJA 4ID9A 1U3VA 5DNAA 3DL2A 1XU9A 1PS0A 4RPJA 1W73A 4LMRA 4IDDA 2NVUA 4XB2A 5JDCA 2V6FA 3MJTA 3QVSA 2D2IA 1NHWA 3CE6A 4BGEA 5CDTA 1WXDA 4NMHA 1BSVA 2QRJA 2VZ0A 1P0CA 2B37A 1P1RA 4BKRA 3PYXA 2W2KA 3BTVA 4DLAA 3S2FA 1KETA 1F8FA 3HJAA 4NNJA 4BKQA 2NU8A 4XYLA 2X9VA 4BMNA 5IN4A 4IIVA 4R54A 1IB6A 5FI5A 3T4EA 1NTOA 4CM3A 4XEHA 4B79A 1ZVMA 1CEQA 4ZD6A 5G0WA 2W90A 4YAIA 1E1LA 2IZ0A 3HB4X 2VWQA 4MO2A 4YQZA 4DLBA 2OP1A 1H6CA 1HETA 5HTOA 4AJJA 1V0JA 1TXGA 1X0VA 3Q3CA 1LLUA 3ZN2A 2I6TA 5G4LA 4HXYA 1EZ4A 4JQCA 3UCEA 1YB5A 1YQGA 1HRDA 3EZYA 3PJFA 3HZZA 1F14A 3GVIA 3AU9A 1E7WA 1Z74A 4LW8A 4CMJA 3D4PA 3GH3A 3GNTA 4U6SA 3INTA 4KTTE 1U5CA 3L07A 4CMGA 4W7HA 2PGJA 1DIAA 3JQ9A 1R4NB 2FZWA 2I65A 2I67A 4NBWA 5FF9A 1C1XA 1Q0LA 3TSCA 3JV7A 1D1TA 1DIHA 4WLEA 1ZEMA 5TLSA 4WOKA 4NZ9A 4DWVA 5K6AC 1VPDA 2YV1A 3JQ8B 4R3WA 1LDBA 3LLVA 4AJ1A 3QWIA 2E6UX 4IS2A 3DOCA 4BHTA 2FP4A 3QWAA 1DHRA 5H81A 4ZQGA 1V3TA 2GERA 1RJWA 1E7MA 3FF4A 4J0EA 3ZI0A 3WWYA 1RPNA 1XLTA 2J6IA 2JD0A 2X5JO 3D4NA 5JC8A 1LI4A 3OIDA 1YDEA 2BFMA 1KVRA 5ITVA 2BKAA 1CIVA 4C7KA 2NM0A 3IJRA 1DRVA 2EF1A 4NBVA 4CM9A 2JFFA 1CETA 3DZJA 4U8GA 3RU9A 3ZNPA 2ZIZA 4YAGA 1M75A 4K1LA 4E31A 4YACA 1ADFA 3E48A 4RPLA 3ZWVA 2O4UX 3WGOA 4I5FA 3C7CB 4W7IA 2D0IA 3D64A 3WGIA 2E4AA 2Y1EA 1BXKA 1ZW1A 5DN9A 4E5PA 2PZJA 1MC5A 5DZSA 1N1EA 3ZNNA 5L4SA 1DFHA 3JQ7B 3NTOA 1ULSA 1QV6A 2DBRA 3RBVA 5IDYA 3FWZA 2GR9A 1XCBA 2HK9A 2D5CA 2NV6A 2WD7B 5TX7A 3MJCA 3U4CA 3PZBA 3JQAB 3K6JA 3RKUA 4DYDA 1CF2O 1U3UA 1VJ1A 4OL9A 3BZUA 3ONDA 5KJ6A 1C1DA 1PSDA 2XPCA 4IDEA 1K6XA 2RAFA 1H0KA 3GR6A 5AXDA 3DMTA 3JYQA 3K5PA 4GMGA 5ICSA 4B7CA 4MKRA 4QEDA 2RHCA 3FBGA 1Z7EA 5U9CA 2Q45A 4J90A 4J91A 1E7YA 4J9VA 4M8SA 1DRWA 4TRNA 4W4TA 5F1PA 3RCBA 2GDZA 3OIFA 4Y8VA 4UEJA 5A03A 2VRCA 1B7GO 3PWZA 2AMFA 3KOUA 1YRLA 1A9YA 5T6BA 3C3XA 1HEUA 3OHSX 4R68A 3TF5A 1T2FA 4MP8A 4FB5A 2CDCA 2CVOA 3DEYX 4J0FA 3UKOA 3PK0A 1GEGA 3G0OA 3VTFA 4RF3A 3W8DA 3BMNB 4FFLA 1R66A 1I2CA 3W4JA 2JD1A 4BNFA 1I24A 2Y68A 5CEJA 4BO4A 3A4VA 2EERA 4H15A 1ZK0A 4IJKA 3D3WB 5JO0A 1DHTA 3HN2A 4ZQHA 1VLLA 3NT4A 1X1EA 3PIDA 1HWYA 1LXCA 1Y8RB 2C29D 2YQ4A 1WMAA 1E3EA 1E7SA 1PS9A 3JQEA 4XGNA 1OFGA 1LSJA 1VSUA 1V9LA 4GX5A 3E9NA 3A06A 1R0KA 1P45A 3ITKA 2UUPA 5I8ZA 4E33A 1AE1A 2X22A 1GQQA 1E77A 1H9AA 3F5QA 2HQ1A 3VPXA 4BNVA 3CIFA 2O2YA 3KVOA 4A26A 3IP1A 3OSUA 1N9GA 1HYGA 4FN4A 2BGLA 3KSZO 4UEOA 1U2DA 3OH8A 4YBZA 1X0XA 1Y1PA 5ILGA 1N8KA 5G4KB 4Z9YA 1R0LA 4GH5A 2R00C 4QQRA 4Y9DA 3BHMA 5AYVA 2O3TA 4GX0A 4FR5A 3AI2A 3AW9A 3F1KA 2HSDA 5IDQA 1QMGA 5IJZA 1BVUA 2GUGA 3D5QA 3L4SO 3DB2A 3L9XA 3OIGA 4WCFB 4BVAA 2C59A 4MIEA 4XJTA 3WDSA 5CPFA 3AY6A 4D3FA 3C7DB 1VSVA 4EYEA 1B3RA 1TLTA 5C7OO 1HT0A 1P77A 4BKUA 5BSGA 3IUSA 4E32A 1Z6ZA 1DXYA 1KVSA 3JD3A 4RDHA 3WGQA 1YB4A 5T5QA 1J49A 1ZMOA 3FR7A 3U4DA 2EIHA 3U4HA 2VUUA 2JFGA 1PQUA 3OQ1A 5HBRA 1R4NA 1Y7TA 4PLWA 5GZ3A 1I3LA 2Y66A 3K2EA 4IDCA 1GQ2A 1HDGO 1Q0HA 3NJ4A 3TZHA 4DTIA 4RVHA 2Y05A 3QW2A 3WR5A 1OMOA 3I6QA 4XYEA 3M1AA 1P0FA 1V3VA 1D1SA 3WLFA 4RZHA 3RKRA 1VJ0A 1F0YA 4XB1A 4ZQBA 1GZ3A 3JD0A 3TZ6A 4ALNA 1XU7A 3QWHA 3RJ9A 4WJZA 4IDBA 3DBHA 3V2HA 4BV8A 1JKFA 4B4UA 3RQSA 3NDIA 1HE5A 1SO8A 5EIOA 3JYNA 3TRIA 3HN7A 3MTGA 3KTDA 4TRJA 3ENNA 3ORFA 1GQYA 2Y1FA 2D8AA 3QWBA 5U1PA 1T26A 1MXFA 1K89A 3C8MA 4R41A 3IUPA 7ADHA 5J23A 1DDOA 3GAFA 2YDXA 2AEMA 3M6IA 3QWFA 3RSHA 4LSMA 3GZNA 4EBFA 5L51A 2C5AA 1HDZA 4PLZA 3ETGA 3G49A 1YDWA 4BGVA 3I5MA 3ZV3A 4ALIA 4CUZA 3HNPA 3ROMA 3JQ7A 3WNVA 5B4TA 1E3LA 5JS6A 3F46A 4H3VA 3GEDA 3GMSA 1T4BA 3FD8A 4MDHA 3GDGA 4I9NA 4UUPA 5L4NA 4AJLA 3GHHA 1HLDA 4I5GA 1QR6A 2EP5A 4JGBA 3L6DA 3OETA 3BXXA 1N92A 2CY0A 4IM7A 4RDIA 1GTMA 1EK5A 3I23A 4I5DA 3I4CA 2PK3A 4YJFB 1ONNA 2BHLA 5AXCA 2PD6A 1RYEA 2D5AA 1M2WA 1ZIDA 1NBOA 2DTEA 1WWKA 1ZSVA 3RBZA 4GLLA 2EKLA 5CDSA 2IDZA 1EE2A 1UP7A 4CV3A 5BT9A 3STHA 4DREA 3JQBA 3INRA 5L40A 2J3IA 2ZTUA 4KZPA 4DC1A 1JN0A 1OC4A 3UGKA 1BDMA 4B4WA 5JFOA 2VNSA 1FDVA 1I01A 3NKLA 3BMNA 3PQFA 1E6WA 1QORA 4F45A 4NPCA 3SBOA 2EJWA 1NQOA 4LCEA 3KO8A 1I36A 3D3WA 3HWRA 2YV3A 2NUAA 2EJVA 3IS3A 3PFFA 1ZH8A 4IQ0A 4MVJP 2G5CA 1GY8A 4A27A 5JAZA 2YHUA 5CEEA 1BRMA 1NAIA 4Q3DA 3VZSA 1SOVA 1KERA 1LDGA 1IULA 4YWJA 2NTJA 4CQMB 4CQLB 3MOGA 1QG6A 4AJPA 1B15A 2RIRA 1PJ4A 3JYLA 4GAEA 1EBFA 4RVDA 1B8VA 1WNTA 2IODA 3F47A 5G4KA 2X5KO 4XGKA 3CXRA 3OQ6A 4MPDA 2VUTA 4OIMA 5A06A 1J6UA 3DHEA 5IXYA 3ZWOA 4BO9A 3WJAA 1BW9B 4NHEA 2HU2A 3AJRA 1H94A 3Q0EA 3ZWWA 5HWSA 4U6QA 3NRCA 3TZCA 3TZKA 1C0KA 3PHGA 3QVOA 4A5OA 5L7TA 3PHLA 1RM3A 2O7SA 4DA9A 1PJBA 4RGBA 3RD5A 4YCAA 2BGMA 1XG5A 1NFRA 1F8GA 4RQUA 4ZVVA 3K8ZA 1EUCA 1YE3A 1T2CA 2AXQA 3LU1A 4WOJA 5JYEA 2GLXA 3I9KA 4D79A 1Y9EA 3AUSA 3PZRA 4IIUA 2W2LA 3DFZA 4PGFA 4NJMB 4D3SA 1LLQA 2PZKA 5EJ2A 1XWFA 1GUZA 4CMIB 4B7XA 4F46A 5A3VA 3WJ7A 4E2ZA 1NVGA 3PVZA 4PLTA 2QX7A 1O9BA 1NQAO 1E3JA 3EUWA 1DPGA 1PZFA 3TDKA 2BI8A 5ES3A 2Z1NA 4BO8A 2EGHA 1PJSA 5DP1A 4CM8A 2CMDA 2Y93A 2FOIA 3EC7A 5IFLA 3RC7A 1NWHA 2JJYA 2C0CA 1SOWA 1IY8A 2DUUA 4L9RA 1U2GA 5F5LA 3DZIA 3JQCA 4CLRB 3GHYA 3ROPA 4TRMA 4PZCA 2DBVO 1ZBQA 3GVHA 4DQXA 3E18A 3R0IA 4A2CA 2WDZA 8ADHA 1F06A 3LC2O 4D42A 1ONPA 1LDNA 1QKIA 3H8VA 3I9JA 4HFRA 1HXHA 2WTBA 1C3VA 4U5QA 1QLHA 1ZNQO 3P19A 2C54A 4E12A 1B2LA 3K92A 4UEKA 2WM3A 3VPSA 4MINA 3VVCA 1ZEJA 4Y6PA 3OFSA 2ZTVA 4J6FA 2IEBA 5I9LA 3NAQA 3PQEA 3DBRB 1PU2A 4KMSA 2I9PA 1GUFA 4BKOA 1VKNA 3RU7A 4RO0A 5JMWA 3P5SA 1DIGA 4YEDA 1LUAA 3WGTA 2D1YA 3GEMA 4TKMA 3D1LA 4QO7A 4L73A 4BO6A 3OECA 4UUMA 2AHRA 2EGGA 3QIVA 1XHLA 3GF4A 4ZRNA 3RFTA 3GQVA 1UJMA 2O7QA 4YJFA 1WW8A 1OI7A 4R1SA 1ZMTA 3SX2A 5JW6A 3PP8A 1YKFA 1R15A 1D3AA 4D43A 1N5DA 2V6BA 4RVFA 4TKLA 5FWNA 4CV2A 2PZLA 3A9WA 4WGGA 4CMBA 2LDBA 3OM9A 2A92A 3S2EA 4GVLA 1B8UA 3VH3A 5IF3A 2WMDA 4EITA 1HDRA 3C1AA 3C1OA 4LMPA 3WYBA 4FFPA 5GY7A 1NWCA 4XQ9A 4E30A 4CUJA 1Z75A 1HE3A 1S6YA 2VZ9A 1PZGA 2Y1OA 4FOSA 3WTBA 3M2TA 2BFAA 4Y67A 3GG2A 4CV1A 4L4SA 1C0IA 4QTZA 4RORA 2BMAA 2JHGA 4DPKA 4NI5A 4BNGA 1O8CA 3DBLB 4CLOB 3NUGA 3WB9A 2FPPA 4C7JA 1IZ0A 4Q3CA 2B5WA 4HUJA 1T24A 2X86A 2VCYA 3A14A 3E8XA 4N5MA 4OQYA 5KVQA 5LC1A 3UH1A 5KJ1A 1KC3A 4BMSA 4XQCA 4ND1A 3GFGA 2B36A 3L4BA 3GFBA 3WNQA 4CMEA 3JD1A 4JX8A 4L75A 4XR9A 3GVXA 4ALJA 4CQLA 4XR4A 4MVJD 5A9SB 1NYTA 2Y99A 4XQGA 5JAQA 3VH1A 3O26A 3GOHA 1X7DA 5B4VA 1I8TA 4YVFA 4LRSB 4YYZA 2C2XA 4OKNA 2GF2A 3W6UA 2I3AA 1ISIA 1DC5A 1GZ4A 1YQXA 1EVIA 2PKQO 3DHNA 1D4FA 2IZZA 4JBHA 3ON5A 5DCUA 3BMQB 4CM7A 5JY1A 3EW7A 2HJRA 1H6DA 1HE4A 2X4GA 3MJVA 2DTXA 4FFMA 3WGYA 2Y1DA 2JAPA 1UDBA 4LK3A 3VKUA 2ZB4A 3LSYA 1DIBA 2GNAA 2AG8A 1U7HA 2GGSA 2O3SA 1R4MB 2QW8A 3LYLA 1V8BA 4CJXA 4OAQA 2AEJA 4NR0A 1PL7A 2GN6A 4KUHA 3UUWA 1V3UA 2J3HA 2VTEA 2DVMA 4IJUA 2GZ1A 5B37A 2EWMA 4ZU3A 3V1UA 4FQ8A 1PQWA 3WX0A 3BTSA 4OSOA 4BNMA 1LQUA 2POQX 4IQGA 3G3EA 2A94A 3L0DA 3HUDA 1I30A 4MVJF 3RC9A 3TOZA 1E3WB 3ULKA 2A35A 1BXGB 2C82A 1U5AA 4PLCA 1GPDG 3PHHA 2CVZA 1MV8A 3GMDA 4R69A 3H9UA 3NDRA 4FIZA 4MIOA 4XX0A 4M54A 1ZKMA 3JQFA 2A4KA 2AA3A 1H5QA 3L6EA 1U4OA 1MGOA 1KEWA 1U4SA 3IC5A 5JCJA 4Z6KA 1JVBA 2NQ8A 4NU5A 1I2ZA 4XQEA 5K9ZA 2UDPA 3PI7A 4ZQEA 1A4UA 1X1TA 4HNHA 2BF7A 1GYQA 2ZKLA 1GPJA 2XXBA 4PG4A 5AVOA 3ZZNA 1SC6A 4J49A 4CM9D 4HBGA 4PVDA 1PZHA 1QV7A 4CR6A 4JBIA 4OO3A 5L53A 3QQPA 4XDZA 1G0OA 4D0RA 3WQSB 1PJCA 2NTVA 3PTZA 3ZHZA 3MZ0A 2PFGA 3SC6A 4ALKA 5CDUA 1ONOA 1Z45A 1C14A 5CEFA 2QHXA 5CAEA 4PLGA 3OA2A 2RBEA 1HSZA 3GDFA 1UR5A 2B5VA 3WIDA 3ROKA 5ILOA 1ISJA 3QVWA 4YRDA 2JFHA 2NU9A 3AUTA 2GPTA 1GU7A 3H65A 5FEUA 2YYYA 3NDJA 4D7AA 1GV1A 5COAA 1R37A 1E3IA 2BH9A 5DF1A 3L9WA 3WXBA 4OXKA 1AUPA 3X2EA 4UVEA 4AJHA 1Y6JA 4DMLA 3KSDO 1J5PA 4NFHA 4PLFA 3P7MA 3UW3A 5GMOA 5TRTA 5IZCA 2Q2WA 1YL5A 3T7EA 3LVFO 4FC6A 2D4AA 5THQA 4Y98A 3OEWA 1ENPA 1K5HA 2QIOA 1EVYA 1XQ1A 2TMDA 3CSDA 3FN4A 3TFQA 2BI7A 3WQRA 3H3FA 3RUHA 2VHVA 3U4IA 3DHYA 5EQFA 3KB6A 1KC1A 4E21A 2HCTA 4YJGA 4AJ2A 3FPCA 3ABIA 5G0VA 3OEYA 4RPKA 5CFZA 5CPBA 1QXSA 1JQBA 3O38A 3OA0A 3VPGA 1D8AA 3DO5A 3MTJA 3A1NA 1EVJA 1AHIA 3ZU3A 3K96A 5T64A 4BS9A 1T1RA 3U62A 1CRWG 1Q0QA 1Y9AA 4LCJA 4ZGWA 7MDHA 4FGSA 3PGXA 1EDOA 2IXBA 1TB4A 3U0BA 3NT2A 1ZXLA 2QZ9A 3AY3A 3NEPX 3Q6IA 3X2FA 1PGQA 4LVUA 2ZK7A 3LC1O 3BMCB 3NJ8A 2YQ5A 4IXWA 4YT2A 1NPTO 2BFPA 5AXBA 1UDCA 1QYWA 2Y0DA 3PPIA 3K30A 4Z0PA 5C5IA 1ENYA 1LQTA 1TVEA 3EYWA 1A71A 4CLHA 3N7UA 3HB5X 1VJTA 5A9SA 5KCZA 4H16A 1PGJA 4AJIA 1I33A 1QYDA 2JHFA 4UUOA 5ITWA 1NR7A 4JXKA 5F3RA 4ZHSA 3LT2A 3GN2A 3N58A 5TT1A 4CM4B 5CDGA 4E5KA 1PJTA 5JDIA 5GZ1A 3BMQA 3KYDB 4NK5A 4R1NA 1GV0A 2Q2QA 1IUKA 5C7LO 4Q39A 3W1VA 4KDEA 1TI7A 3CPSA 2GO1A 2ZTMA 3JQ6A 4GPD1 3LT4A 1R4MA 1OBFO 5JXWA 3VDQA 4RPHA 3BHIA 5B12A 2HDHA 3OQBA 1IE3A 1BHSA 1LRLA 2YY7A 4TMFA 4BIIA 4YPOA 1J4AA 2AG5A 3ETEA 3RAJA 4J2HA 5EESA 3TJRA 3TWOA 5IZ4A 1ZUD1 4OHUA 1NFQA 4YA6A 2D59A 2VOJA 5C3MA 3PGJA 1LSUA 2NSDA 5DDIP 4GMFA 3Q2KA 4ND4A 4OYRA 1U1IA 3WYCA 4IDFA 4J7CA 3S1LA 3W6ZA 1DAPA 1E3WA 1H9BA 2J3JA 3DQPA 5JDCC 3ITDA 3VHRA 4WUVA 4IQ8A 4Z0TA 1R12A 4OOEA 1I10A 2QRLA 2PLAA 4WNCA 3IOYA 2X9GA 4CM5A 5GZ6A 1E1MA 4DLLA 5A9TA 2C7GA 4IJVA 4XYBA 2DT5A 2B83A 2ZQYA 4ZA2A 3S8MA 1PR9A 3K73O 4MKXA 1EMDA 3DBVO 3O9ZA 4WCDA 4Z9XA 1KVTA 3DZFA 5IDXA 1S7CA 2EW2A 3LT1A 3PWKA 2FPGA 3GRKA 4BO7A 5IN5A 2X6TA 3KZVA 4BNXA 1ARZA 1PWXA 2PD4A 1K2WA 1LRKA 3GA0A 3AFNA 4QXMA 4E6PA 5T8KA 4I9HA 3LF1A 1JLLA 1KEUA 2J5QA 2DUWA 4KOAA 2NLOA 1YL7A 2Y0EA 1I2BA 4E2XA 1LTHR 1ZK3A 4IDGA 4WEQA 3B70A 2FY8A 1U7TA 3DAGA 1Y8QB 1L1FA 2EEZA 4CM6A 4L74A 4IZIA 1Q2XA 5A05A 1YBMA 3IL2A 5BNIA 2W8ZA 3BIOA 4WLUA 5KJCA 2X9NA 2CUKA 2E82A 4GSLA 1ZFNA 3JQ9C 4NJOA 4NK4A 4YJHB 1IHYA 4MVJG 3I6IA 2RH4A 3WICA 3QE3A 1ZO8A 3ZU5A 3CZMA 4KQWA 1CQIA 1WZIA 1R6DA 3OICA 2YV2A 1DC3A 1NPDA 3H9QA 2SCUA 4QECA 4GI2A 1DB3A 3DZGA 4URFA 5KJEA 1DFGA 1NVTA 1LA2A 1VI2A 1YJ8A 2J5RA 2YUTA 2G17A 5TSDA 1A9ZA 1UXHA 3I3OA 3GPDG 5G0TA 4E5NA 1WAMA 1LLDA 3V1YA 1NR1A 5L9AA 2V7PA 1PEDA 3UVEA 9LDBA 1A27A 4PG8A 3JQ8A 1MXHA 4IS3A 1RWBA 2WYUA 1YQDA 3GUYA 4B8WA 3V1TC 3DWFA 4L76A 4MVJH 3E9MA 3WFJA 1PQPA 4RF2A 4UREA 1IYZA 2ZYAA 3WOHA 3ENKA 4RF4A 1ADGA 1X13A 5A9RA 2CNBA 1JU9A 1XSEA 1ZK1A 3KLMX 4XYGA 3V5NA 3KYCB 3DZKA 4ZN6A 1I3KA 1ZJZA 1W6UA 1M76A 1PL8A 2W98A 4O5OA 5DP2A 2Y67A 1FDTA 1PR3A 1SNYA 5H83A 3BMCA 1DLJA 1JWAB 1SAYA 5JNLA 5JYDA 3EVNA 1NP3A 3I9OA 3ANLA 4IPTA 5HS6A 2XF8A 2EW8A 1JKIA 1LDEA 3IMFA 4BNWA 1YOVB 3GPIA 2VZ8A 1WDKA 1U3WA 1YVEI 3P2OA 4BKPA 2P68A 3FNGA 3GG9A 4EJ0A 1JW9B 3C24A 3IKVA 4IGEA 3WGGA 4D45A 2ZATA 4GLOA 4HV4A 1KEVA 1PS8A 3FNEA 4XWYA 1TT7A 4ZRMA 3LQFA 4Q3AA 1W4ZA 2WD7A 3DMTC 5FFFA 4GX1A 4O63O 3ZW9A 3H5NA 3JQAA 4IXTA 4XD2A 3ZNOA 1VL6A 1QSGA 5DBGA 4TWRA 3ZGYA 3F4BA 4KWHA 3ZWYA 3CTMA 4BB6A 1P33A
chains in the Genus database with same CATH superfamily
4IDQA 3DTVB 9LDTA 3OM1A 4QOSA 5J58A 5HDBB 3O8DA 2EKZA 3TPCA 3UJ7A 1DJMA 4WIAA 2X5NA 3P4UA 2JGKA 3ZUPA 2VJKA 2DECA 4MWBA 3I8XA 3O8QB 5EI5A 3ANXA 3QBTA 4CFSA 2OA0A 1Q12A 2GM9A 2QORA 3DR5A 2ZKIA 2PUFA 1GFIA 3WK8A 1OBCA 2J0UB 3HKCA 4HN4B 3QEMB 1OC2A 1QK5A 3SIWA 5LZ9A 3TKLA 3THOA 1AIPA 4FFSA 1FLDA 4RS3A 3FB4A 2CSUA 3TL2A 2PR2A 2IXDA 4PAOA 5HRUA 2A84A 5M7EA 3LQKA 1ODLA 3R8FA 2PLRA 1F7VA 2O59A 3GLTA 3CF4G 3HU2A 3JSAA 3T4XA 4M9XA 2R2GA 3VDXA 1YONA 4EG5A 4I3HA 1Q0SA 1L7AA 3KXDA 4O4HB 3SXUA 3KQOA 4EW6A 3H2ZA 3VV2A 1YU9A 1SEPA 3F6YA 1MX1A 4GPZA 3RU2A 2DH6A 5CT8A 1REQA 3ED5A 2FMFA 1Y8RA 5EXXA 1OXBB 1MH1A 821PA 4RMGA 4FEEA 1HT1E 4DE5A 1AQNA 4A9AA 4ID3A 1BJTA 5HQTA 1CDOA 1U2DC 2FW1A 1EUQA 5MN6A 1ISMA 4U9IS 4HVLA 4QFCA 3GNLA 2IH2A 4OGFA 5AUPB 4CETA 2BHSA 4ND7A 1K5GA 3SM3A 4UXHA 4BV3A 1EXVA 1YR2A 3NALA 1E6UA 2VJLA 1JQLB 3Q11A 1KY4A 5J4VA 4H0CA 2QTMA 1PDOA 2J0VA 4QELA 5AVUA 2HM7A 1I51A 4Q1FA 3UFXB 1LFAA 5KYYA 2QRMA 5BPFA 2PLNA 4OXQA 5H59A 3I9V6 1PJZA 1JZQA 1AMOA 1ST3A 4ZYXA 4NIMA 4C4SA 1W2GA 2WJAA 3QVKA 3W79A 4P7KA 5LR6A 1JQEA 1H2FA 2WJ4A 5AUOB 2N75A 4KJZA 4K3VA 3IB3A 5KTKA 1NR5A 1P74A 3SVZA 2AZTA 2J46A 2NO4A 1BD4A 1UT5A 2O3QA 2XE6A 4QQNA 5L3QB 3HE3A 4JNKA 3I9FA 4CDMA 4IIHA 2K2QB 4I1SA 2WEKA 3ZHSA 4O0MA 1RM0A 3W1EA 4Q9DA 1UJ2A 1VMKA 3F1LA 4N49A 4BLPA 1Y1LA 2EC5A 5F23A 2UAGA 4LVNA 4NMLA 1E1KA 2C5LA 4RM3A 3AL3A 1W88A 3BREA 3RYCA 3MT7A 2IT1A 2KI5A 3QE9Y 5ISMA 1GDHA 3MW8A 3U0VA 4U7DA 4M37A 1QGUA 3USZA 5HZKA 3R20A 4TQAA 4LF8B 1N2ZA 1D7OA 4FW8A 3N8DA 2R6FA 1ZCZA 1Q22A 2Q21A 3EASA 4MVJM 5JLAA 3U19A 3P4YA 2IEZA 2ERCA 2H29A 4PS1A 3BERA 4D3DA 2CBGA 3AVWA 1N5RA 1OX5A 7MHTA 2IHTA 2I22A 1O94C 4NAHA 2AJCA 3SF0A 4F4FA 2XI4A 1DZ3A 4JJ7A 1EI9A 4QFDA 2BFCA 3DV0A 4UUAA 2JGAA 4PLHA 4L8GA 4B3CA 1ZOLA 3IUYA 2JGJA 5FOUA 1GLVA 2J3MA 4KO4S 4DIDA 4UHEA 5HFAA 4EPXA 5CFPA 1RRVA 2AOVA 1E0DA 1A50B 1CULC 2H6EA 2W6ID 2Y9MB 4FYHA 4PYOA 5D8DA 4F6LA 1AK9A 3EH2A 4YV7A 3DSRA 1LB1B 2W2OA 1TYBE 2DFKB 1VZ2A 3CLVA 4D98A 2RBKA 5C37A 4GPTA 1L8AA 4UBJA 1ZD3A 4HL6A 1P0QA 2BTQA 2VQ3A 3QOFA 4PZDA 2JIQA 4JBWA 1KGSA 3EYAA 4XA8A 4XWGA 3UK7A 2XCLA 3L05A 1H23A 3TW4A 4IIJA 5TQVA 1O0SA 1ZVKA 1GKIA 1K3UB 3P2KA 4YHBA 5FTWA 1T2DA 4J0JA 4URVR 3R6GA 4BNHA 2YVUA 5FI3A 1E4OA 4DNOA 3NM6B 2P2GA 5TQJA 4URHA 4X66B 2H4FA 3REGA 1YHYA 4WSOA 1GZ7A 1YQTA 1ZD5A 2YVAA 3S1AA 3ZGLA 3BB3A 3VNQA 1ZSNA 5B1IA 1M6YA 2V98A 2AJ8A 1V6AA 3DAYA 2PRYA 1VKHA 3T8YA 1SCUB 2GM4A 4MR8B 1G7TA 3C3AA 5KWIA 2QTFA 2I6UA 1MQ8B 3DAFA 2Z9BA 1I2MA 3MWEB 3OCUA 4FZRA 2YJNA 5AT1A 3BL6A 3RE1A 4ZJZA 4X54A 2E1RA 4L8VA 1SBTA 1SBCA 2ANBA 2RBGA 2RHRA 3NOQA 4M21A 5DX0A 3NWEA 5TDHA 1T1SA 4YUZA 4CEHA 1JHQA 1MX9A 3AI1A 4Z8XA 4II2A 3WZMA 1IZ7A 3D8UA 4OQXA 2KW5A 3NTXA 3OLQA 3AXSA 3DFFA 2PXAA 1Z22A 4MI1A 1VIVA 1HZJA 4UM5A 3QVXA 1QKKA 3ZY5A 2HT1A 3A27A 3G0DA 2VUSA 3KT0A 4HKTA 1Z4JA 1LV8A 1W93A 3EXFB 2PGLA 2EKPA 5FTKA 4B73A 1AGNA 3KB8A 2P2CA 4W63A 4GZLA 4Q21A 4DV4B 5L7YA 4C07A 1X2BA 4UHBA 3U3XA 2BLLA 1SOAA 4ZP1A 2GN4A 4R31A 3QE0A 5HRCA 1P6UA 2IEIA 3JQBC 1AD2A 2QI9C 3L7JA 4KQ9A 1KSJA 1UKEA 3PCXA 3E9QA 4BMVA 4DAOA 4AYXA 1DO2A 3GEPA 3KR1A 4NULA 3QF7A 2R85A 4GYYA 4JJIA 4WZBA 1ZKDA 2QL6A 5IRCD 4IEIA 2V58A 4KLCA 4D9JA 5JWRA 1Z34A 2OQVA 2B7LA 4ZCQA 2NO6A 3VSAA 1XLUA 2ERXA 1EE9A 4UCWA 1OILA 5IFKA 2PUWA 3B7GA 1VIYA 3EF1A 3TD9A 1WB5A 5AW9A 2YHSA 4QFBA 4EF6A 4M98A 3DOEA 4XX1A 2XTMA 2AN1A 5EJ8A 1N2OA 4XVUA 3HPQA 2Q4BA 3CG4A 1X1SA 2YWDA 1OVMA 4G81A 4J1TA 4ZZ0A 1P9NA 3NT5A 4RSHA 4ZOAA 1ID1A 4WLOA 4UQLA 2ZBEA 2BDTA 3H1AA 4FFBA 4QBGB 3CNHA 3I34X 4OM7A 1XYVA 4U1RA 4XDHA 3PUJA 2FJ0A 1PZNA 3AEZA 1F2TA 1PJLA 4E51A 1ZVQA 2HAEA 1T3LA 2HRZA 4OOFA 4O4LB 2O14A 5DVZA 4RM2A 3IUJA 3LUHA 2IYOA 4QGHA 1TMOA 2GN2A 2C8JA 3L8MA 3A58B 1AO3A 1N7HA 3HFRA 4A7PA 2J3DA 2VIIA 3SVTA 3EOZA 3QGMA 1LX7A 1KFEB 4LHXA 1N2SA 1V25A 3G8BA 4DVJA 4WJKB 3COSA 4XFDA 2L19A 1DX9A 2CCJA 3AHJA 4X7BA 2CHEA 3GZJA 4KV7A 1HR0B 5EUMA 3QEBZ 4PM4A 3DMHA 3SN6A 3ER6A 3TIGA 5AK4A 2W6ZA 1DG3A 4RHTA 1FJHA 3NKFA 4B4OA 1FP4A 1GPWB 2CYBA 4P5PA 1JIVA 4G1CA 2JAHA 3AF1A 1Z4OA 2DKFA 1HE1C 1Y3DE 3L8YA 5TEVA 4E3ZA 4ESEA 1QHIA 3GY0A 3PPWA 2PUEA 1A0OA 3BRWD 1GNRA 1NN0A 4NQZA 4UUNA 5G0SA 2IKQA 1CXZA 3GP3A 4KFSA 1OAKA 1UWKA 1G0NA 2VG8A 2Z3VA 2OFPA 4I4TA 3G2NA 2W22A 4PHHA 2CDAA 5IUKC 1GNPA 1DDGA 1I1QB 1YIOA 3PDWA 5BYBA 1TC1A 4RTMA 1NT4A 5EJ9A 1T29A 3OIUA 1SUFA 5JOQA 3N75A 1X1DA 3EGXA 4M9SA 1PGNA 1D4OA 4C2TA 1OLSA 3RB8A 3ZWDA 1EDBA 1NW4A 1PKEA 3RTBA 3BMOA 3BZWA 2IYTA 2I8AA 4N3NA 4D80A 4J3FA 4K26A 3PGA1 4CHGA 4DA7A 1ADCA 1JIXA 3E35A 4GXRA 2AK3A 2O2CA 2O5CA 5BSRA 5LN1A 4OK6A 4F6RB 2NTNA 4DR6B 4RJKA 4GEGA 4B7UA 1EHYA 2ZJBA 1RI1A 1B42A 1JHDA 4BMZA 1GT6A 1T6NA 4GRIA 5B53A 4DXAA 2A9KA 2NO5A 4NOMA 5F1KA 4FB4A 3A6PC 1CEYA 2PX6A 1J9EA 4MUYA 2H57A 2H31A 3DZDA 1U31A 1QZ3A 4RQAA 3UXHA 4YT5A 5C7IO 1TOAA 1XTSA 3W2TA 3FYTA 3VKGA 5EHNA 4GMHA 4PX9A 4R1UA 2QUHA 4H77A 1Q1NA 5DX8A 1CBUA 3F74A 2PO7A 1J2JA 1V9SA 3MFYA 2QDXA 2GBGA 4P3PA 4QHSA 5EERA 2PKWA 4CFYA 5AKJA 1Q1EA 3NX4A 2WIKA 2R65A 3FPSA 2O0LA 4LOHA 4I8IA 3EZ9A 4CLRA 1K6JA 4AY5A 3P2MA 5CP8A 5I7WA 1X8JA 4EPVA 1U98A 4WINA 4M87A 2WB2A 2O8CA 5LD2B 2GKSA 4G2NA 2BR3A 2VHCA 3N2NA 1R8QA 3MWYW 4K86A 1Z4QA 4I0WB 5KAMA 1ORVA 3T0IA 2XOEA 3KM0A 1XIVA 1YE8A 1N7GA 4LX0A 4N7MA 5IVIA 1OTHA 2PSDA 3QI2A 4GU5A 2WNSA 2VJOA 4YAEA 3UG6A 3DXXA 4OFZA 1BVHA 4QGBA 4E1AA 2P3SA 4S04A 3A6DA 3KZKA 3OKCA 1ODKA 3AEKA 4WOCA 1O6GA 3BIWA 4TTIA 1Z08A 5JNTA 1S2GA 3OURA 3AVYA 4ENVA 3BWMA 4MROA 4BQEA 3MJ4A 2L17A 1VRVA 1R27A 2NXCA 4M0KA 3SY8A 4EZBA 8GPBA 2ODEA 3DBRA 2F4VB 1R5JA 1PX0A 4YUVA 1VM6A 3FMIA 1KAQA 3LP6A 4FKZA 4LQ4A 1F9AA 1UIRA 1Z6XA 2D1QA 5I9MA 4JK3A 3TN7A 1RLIA 3T5DA 5K05A 3O6VA 2OHGA 5ALYA 3VNBA 3DXYA 2AG1A 4OLHA 2D7DA 4CKBB 3QHAA 4FDVA 4XW2A 3HWWA 2V3CC 1B16A 1FU7A 2O8FB 3DFUA 3CLRC 1SZJG 4GR9A 3UHAA 4YMUA 1WDMA 1SUWA 1ZSYA 2I62A 1XZEA 4RCVA 4XDYA 3S4YA 3SFTA 3ZOZA 1VECA 4HADA 3WYAA 5M2QA 2R8OA 3FUCA 5BQ3A 1T5BA 3GT3A 5AJUA 3WFIA 5KYNA 4A8TA 3P9PA 3PEYA 1NQ5A 5K7SA 1KXZA 1SD2A 2AR0A 4EHFA 3QTLA 3DO8A 1BFKA 3ROGA 3SX0A 1YHZA 4PG7A 4RTOA 2VRCD 4CMAA 3LPDA 2ZWOA 1MLDA 3I83A 4GKAA 4U9UA 4ZQFA 3OQNA 2OCDA 5D86A 3KG2A 4L85A 1VLVA 4HXEB 2C9CA 3GB9A 4I55A 5TNXA 1T5LA 3AETB 3WLEA 2YWCA 2J5XA 4JXJA 1OASA 4RNDB 4X1YA 5JAMA 1G5FA 2BBWA 1THTA 4PZEA 2EZUA 1PNRA 2B6NA 3NHUA 2FOLA 5ICMA 4OJTA 1XEWX 2RONA 2ZR9A 3W77A 2ILTA 2UYQA 4K9NA 2RHBA 2O6LA 1UAYA 4CMEC 2DH5A 1C8KA 2F1OA 3DBLA 5CR9A 4S12A 4P7BA 3AIMA 3RC3A 2G6BA 5HP4A 1QIJA 2B1GA 2H48A 3QUSA 3W5BA 3T3HA 3EEBA 4ZCMA 1U8CB 3WGZA 5JNWA 1MVOA 1YULA 2G67A 1E64A 4NZPA 1TK2A 1A4RA 2Q1UA 3LH5A 2Y2UA 4XSGA 4PN3A 3CSSA 2VJCA 1ZI9A 2JD2A 1JDJA 4FYYA 4NENB 4ES6A 3HJHA 3QV1A 3KFXA 1UBKS 3NTLA 5KPDA 1UZLA 2VH5R 4RLQA 3UJCA 4KRFA 3GDHA 4R3UC 1G1AA 2EJCA 1NXWA 1W87A 2IZ7A 2O8NA 4U7FA 1UMDB 4GGPA 3I28A 3DW3X 3PENA 1J0AA 2I4RA 2IE8A 3CWCA 3N2LA 4K9PA 2NOAA 2MSWA 1UJNA 2KWIA 4KKVA 1ZBDA 2FXIA 4KO2S 4BX8A 5KU1A 5H3HA 1VL8A 2VSOA 3NEJA 3B78A 4N47A 3K6KA 2DPHA 3CONA 1K6EA 2BEUB 1Q7GA 5DXJA 2A7XA 3DVAA 2D5LA 1UFVA 3E0QA 3WKCA 1V5WA 3P52A 2IYYA 1YWGO 4JD5A 4LK2A 2DPMA 5IBRA 1NVMB 3TIVA 4YAOA 2ZG6A 5TT0A 4BZZA 2WZDA 4BGPA 3W1WA 3FVRA 1WEHA 3FKSA 3WYNA 1SPXA 4BN5A 3ZWNA 3JR3A 3K0HA 4LG1A 3RO7A 2O6HA 2V96A 3HU5A 1KZ7B 5A04A 1UPBA 5DGHA 1M72A 2HZBA 5HKKD 4LJRA 1TGYA 2FR8A 2I99A 1DAHA 2WDPA 3A2NA 4OX9B 3VISA 4DM7A 2CLDX 4Z1MA 3CF4A 4C4ZA 1T5OA 5HIIA 5I9NA 4GFDA 1W29A 1PI3A 2H2WA 2J9RA 1TIPA 1VB3A 2ZRLA 3CIOA 2M9MA 2WJVA 3JQFC 3QU5A 2YVQA 2C4NA 1CZLA 4AKHA 5LXTF 1CUBA 4HH0A 5E38A 3TM4A 2VHTA 3IEIA 4JOSA 1G3IA 2BR5A 2HUNA 5L4LA 2C4HA 1P7CA 4IZHA 4U5XA 4BDTA 5KTNA 3VJRA 1HX7A 1M9NA 4IMJB 1DJOA 4YBRA 1GUBA 1KAMA 4MULA 1T9DA 4NNOA 4HZGA 2DEUA 1AUOA 1T2VA 2R1VB 3KT3A 3OCWA 4A23A 4ALLA 1RWOA 1DUSA 2EP8A 2JGDB 4BEBA 3OMWA 4TLAA 2FPIA 4YV1A 4JL6A 1RI2A 2OO7A 2XVYA 3H3JA 3OUTA 2IE0A 3ET4A 4XGQA 4XUDA 2HCRA 4FGJA 4I50A 2IH5A 1JBQA 1JFVA 3AUYA 2CZCA 3DMYA 3CUKA 1YZKA 7AT1A 4JR2A 4IR7A 1CUAA 2Z1MA 2P9CA 4MKHA 5B1DA 4OHWA 2RK4A 3K9GA 1XPRA 2CXQA 2WUVA 4NPHA 3W2FA 2HCJB 2BLNA 2XGMA 3L1HA 1VGQA 3TXAA 5JD4A 1N3BA 2IL1A 3QX8A 1FP2A 1NI4B 1WBBA 4PGAA 1TQ6A 3MGAA 4BNJA 1JV2B 3KV1A 2F17A 3AW8A 4NXNB 3B2QA 3UXMA 1V5IA 3V8RA 4Z9AA 2WWFA 3CMMA 4PZUA 4XE5A 3WRVA 5DBFA 2GFQA 1FUYB 4I1UA 3CR8A 4HQKA 3SSNA 1UZNA 1FBTA 5FBRB 4OQPA 3SZOA 2ZSDA 1TEHA 2E49A 3Q1LA 4C0JA 1JHMA 5IZCC 4G0NA 3PNKA 1EFVB 4U2GA 1AZWA 3NIBA 4M86A 4MWTA 5LA6F 1ENOA 1UK6A 4MRRA 4OH1A 5TGDA 2D1SA 4BU1A 4BO5A 4TN5A 1G6HA 3HUUA 4DL9A 2DFDA 1V8OA 1M2GA 4C2AA 1JLRA 2ZT7A 4KDRA 3JQAD 2RKWA 3Q3IA 4INPA 5KQPA 1QYCA 2PZFA 5L7WA 1NW3A 2ATVA 2XUOA 1T0PA 3KB2A 2FKNA 3KPJA 3W3AA 4U0JA 3L0ZA 4XLTA 4DJ5X 5EMKA 3R6TA 5IG2A 4LVCA 3LA8A 4OUDB 1IONA 1CY4A 2EBFX 4YCCA 4Y7CA 5ITSA 1FVXA 3T1NA 3BQMB 3ZWCA 1B6GA 5KTSA 3VI4B 1X8KA 1RXEA 1H2XA 3RARA 2VEDA 1XJ0A 2IYVA 4DNXA 1WDWB 5EIXA 2ZVJA 3IR7A 3U31A 3UC9A 3RTDA 1KY5A 2XCOA 5KTRA 1M0EA 3GBSA 3BH0A 1BXZA 3SJCA 4KCGA 3NAZA 5FWXB 3I12A 2C8KA 3D8HA 4WK0B 4INAA 4BTLA 4EQ6A 1O2DA 2IHJA 3JWGA 1V47A 3NUQA 4QNRA 1QJ4A 4D4KA 3L93A 2X0KA 3S2GA 3G2LA 2XYHA 1HE8B 3V00A 1Z8HA 4XGRA 3FNHA 1YJXA 4YRAA 1MG0A 1GL3A 3PB3A 1E5QA 3C8UA 3GEGA 1PBNA 1QQ5A 4E5VA 4B83A 4JELA 3WHKA 1P9LA 2KJQA 3FTDA 3ISJA 5KCMA 2Q07A 2P0YA 2E5LB 4KO8A 4N12A 3ZI7A 1BVYF 2AGVA 1QCDA 3UJPA 4PPYA 2POCA 2Q2OA 5FOTA 1E1CB 5HR5A 4G8DA 1SQSA 3I0ZA 1XZNA 5G2OA 3K9QO 4CM8B 3CVOA 5LCXA 3PDJA 1B26A 3EVTA 1DQRA 4EUNA 1M74A 4FMPA 4M1QA 3TD2A 3NV9A 4RL6A 5AD1A 3L7BA 3ESDA 3DF7A 4QRIA 1KO7A 1SMKA 3WLPA 4Q1VA 1JXQA 1XZKA 2V6GA 3QVTA 1QQ7A 5F21A 2ZCVA 4KL8S 1P2FA 1SGWA 1XZHA 4WKBA 1V6CA 2PNFA 4AQ7A 4YQYA 4UBNA 4CM4A 5K3OA 2GYWA 2JGLA 1SXGA 4JJAA 3Q3EA 1E60A 3MWLA 5ER6A 2QI9F 4YP7A 1V7CA 2NP6A 1KKLA 4C0AC 1V7QA 2UUOA 2ZYDA 4MKGA 3KYDA 4RZIA 1C0PA 3E1KA 1LPBB 5LZ7A 2BDUA 1Z2CA 4F6CA 3K9BA 3D1VA 3EH1A 3H9GA 3TQTA 3H05A 4AX4A 1NXXA 3EZLA 5LP6B 1GUAA 1NURA 2Y0BA 2BGKA 3OPMA 3DKPA 3STYA 4G5HA 5G1OA 1U5BB 2RGNA 2VSYA 1QS0B 2Z5FA 3B2NA 2WP0A 1CWUA 1MHPA 1WV1A 3R9IA 2MDTA 4RE6A 5DNWA 1IRXA 3NWPA 4KHPB 3LUJA 1KYZA 4PO8A 2VPWA 2ENWA 3G17A 4BOYA 1MO6A 2QN7A 1KOFA 2WC1A 4OXNA 3ZXIA 2ZFUA 4MDEA 2JBHA 1XA0A 2H2HA 2OAP1 2OLJA 3RAGA 1L4FA 2D0PB 3V8MA 4DBVO 2XUHA 3ESAA 4G4SO 4RK4A 4IHJA 4ZZ1A 1A5AB 1DWQA 4HS4A 1GGEA 2NZUG 3SLGA 2YN2A 5TV2A 1Z5ZA 1KU0A 3T9BA 1O6FA 3A6LA 3O84A 2WSLA 3A3OA 2QTZA 3VOSA 3NOXA 4BTVA 1NQTA 5CJ2A 1SIUA 4EATA 3OX4A 4YLGA 5JZ9A 2XQJA 1NE7A 5E4YA 1SZPA 4X5OA 4RV5A 1I5RA 4L0QA 4IFEA 4X44A 3OFNA 2V7QA 4AROA 4D9IA 4DMHA 3E61A 1QIFA 1JA9A 3U13A 5IKEA 1SB8A 2O2EA 3L7KA 4MV7A 3R6WA 4RAOA 5F5NA 2J5BA 3K09C 1O97D 2WYIA 3T3GA 2PPVA 2CDRA 2ZBRA 4X20A 5LMNB 2XCUA 4MEBA 3WIBA 1SU6A 1OY1A 2C57A 2JGFA 1W5TA 3VVLA 4B3HA 1Y5LA 1A5ZA 3FG9A 4YN3A 5KQLA 5JSFA 5J59A 3EDMA 4F7WA 5EYPA 4HT3B 3PRJA 1U2QA 4MRVA 3GGSA 5I7HA 3DL7A 4PHTA 2V6IA 4PICA 2G63A 4RHUA 3QU9A 4PR3A 4S1VA 1RU3A 1D2RA 2D3WA 1C3OB 3BUSA 3IUBA 3AY0A 1BGXT 4UC0A 2VT3A 1IB0A 3L6RA 1QG4A 3LF2A 4H1TA 5LQJA 2CVFA 1RM5A 1N4DA 3H2YA 4XXHA 4M49A 4EABA 3TOCA 1Y8QA 2ZIGA 3MCVA 1ML3A 3BCRA 5FUYA 3HG7A 1DKOA 5ALHA 5BR7A 5KC9A 2HO5A 1VE7A 4YI3A 3AJ9A 2IOFA 3ZCXA 3E5HA 4E5YA 1NOKA 4Y2JA 1YCDA 2H8GA 4U2DA 4HS9A 1DUIA 1GYRA 1RAFA 4JMPA 1OBOA 4K9DA 4FZVA 3N0XA 1AGRA 4UVIA 3FPHA 3PNBA 1IBKB 3QRWA 3IQXA 1U6JA 5DH9A 5TPWB 5F9FA 1QRUA 2JLQA 1XA3A 1LSOA 2R48A 1BGWA 1NNI1 4JH0A 3RIHA 2EGUA 2PX4A 5KVAA 1PT5A 2COUA 1NF2A 2J7PA 1MTZA 2P2ZA 3PJDA 5JI2E 3ETHA 4KR3A 1ISHA 3THYA 1EFLA 4M0LA 4L9WA 2ATCA 1T1GA 4TXLA 2BUAA 4UQPA 3UF0A 1U0OC 4J0CA 1NV9A 4YJDA 3NHYA 2GCIA 4EJMA 4YRGA 4RVSA 5HQ3B 2WNHA 4RGQA 1ZUNA 1P7VA 1WCV1 1JEAA 3D5EA 4RJJA 4U9HS 1K7SN 4X9XA 5IJ0A 2PUAA 3VPAA 2Q8NA 4TMKA 1W5AA 3IHLA 2GBIA 4HVAA 4QGAA 3VAZA 5LSAA 3SJAA 2IKSA 3GJ4A 3C39A 3ZHYA 1E6EA 5DCYA 3VH4A 5F35A 1WXEA 4Q34A 2EDCA 5A71A 3IPYA 3K31A 4MVCA 4X0EA 5HTKA 4C0XA 4I6EA 2HTFA 3AH8A 4XIFA 1KEEA 5C51B 3BFKA 1FP1D 1Z83A 1K5PA 1ZRSA 4XI9A 5K0LA 4PWZA 3CTPA 1PL0A 1ZUHA 4MRPA 3ETJA 3TAUA 4DXHA 3KYCA 4MQMA 1O54A 2IP4A 4KN6A 2GCOA 1JRLA 4IIBA 4TTVA 1F0KA 3P9SA 3FLMA 3EGDB 4LMBA 4JC5A 4CTKA 1H05A 3KAQA 2NPIA 5HIMA 1VHWA 3I1JA 3CEAA 3W8FA 5JS7A 2WR8A 2I5PO 3ZS9A 1D7AA 2CXTA 3CKYA 3OM8A 4WK4B 3K53A 1TQ8A 2FSSA 3R4CA 4ZO6A 3W2IA 3IDFA 5LBIA 4AUNA 3PX7A 1IBSA 3H6KA 1M7BA 2R1UA 3TEMA 5I8WA 5BN5A 4LDRA 2OV6A 3KJIA 3R7BA 5GQSA 3GCWA 3WE7A 3WRXA 4DYDA 4ZYWA 1Z38A 5I45A 1JH9A 3THXA 2CNKA 2VN8A 2P4HX 4RDXA 4AU1A 2DFTA 4LF4B 1THMA 1TT5A 4RK6A 3S6JA 3FOZA 1X3SA 3IP8A 1V4BA 4PO1A 4AJKA 2DQKA 4DMMA 2YYAA 3WA7A 4Z3OA 4BQNA 1LI5A 4F04A 2QG4A 4IGFA 2P5TB 5IMBA 1M2VB 4B31A 4DR7B 4QEKA 1Y37A 3TNLA 3CVUA 4CEIB 4ZOLA 3B12A 1Z0IA 5K3FA 3T7KA 1TQ2A 4RLSA 5IH3A 3R2JA 3PXGA 3DTVA 1PHPA 3RSSA 2V54A 1NASA 3W5HA 3A6FA 1N2IA 1WB6A 1AN9A 2Q49A 3CRVA 4OSPA 1XZDA 3ZR4B 3C5CA 5H68A 2BOVA 2VHUA 1J1IA 4FFWA 3M9WA 2O48X 1J00A 2G0TA 2YWJA 3IBYA 1E6CA 2O20A 3K8OE 3CX8A 3NXSA 3HSSA 3CZRA 2J0UA 1EFKA 2EBHX 1S1CA 3QJ5A 3H2HA 4PPNA 1MU0A 3V4RA 1DAGA 3FWKA 4FJ0A 3REQA 3ZH9B 4F4HA 1AKNA 2QZPA 4FDMA 4XKJA 2HMSA 2OBYA 5K0NA 5ADHA 1ZMBA 2CB9A 3GNSA 4Q48A 5EINA 4EJFA 1Q7RA 2DP4E 2GESA 1TCCA 1DFIA 2WU4A 3V8QA 3W6PA 4ASUA 2AC2A 1IHDA 4A0GA 3ZHXA 1OZAA 2SHKA 1DBRA 1GCAA 4UTPA 5FQNA 1Z12A 3AP3A 5JQWA 1AQLA 3A1TA 1WX1A 3INGA 4ACBA 2ET6A 2QJWA 4HPXB 1SHLA 2OXIA 3TIXB 5IWCA 3UPTA 4TTTS 1WXXA 3HQ4O 2JIOA 3HDJA 1YCFA 5BWNA 4GG1A 1VCMA 2I87A 8LDHA 1JIUA 2FP4B 3AEXA 2ZJ3A 5BW4A 5JXJA 3HR7A 3GZTB 1FE8A 1IATA 4N4AA 1DO8A 1J8YF 2DPXA 1L7XA 2HADA 4I4TF 1HTBA 3RFVA 1PJAA 1L4HA 1O95A 4B9EA 1TZMA 1C4KA 1BROA 1JAXA 4R1QA 5UKDA 4YR9A 1AF4A 5JSHA 3SWWA 4BUCA 5K99A 1ZIYA 1S5PA 2RAPA 3GI1A 4FJ1A 3D0OA 1V5EA 1DZIA 4G9EA 1MNQA 3M5PA 3R3WA 1Q1ZA 4D9KA 2PUCA 4ZZIA 2OBBA 5K6AA 2Z2IA 1OI4A 3I2YX 3N2IA 1OTXA 4L4XA 4AY6A 3N53A 2D1FA 5FLEX 1UFOA 6NULA 4ISCA 4AN1A 2B5OA 1IM8A 4ZEOA 3UJ9A 2FSFA 2XECA 1OH6A 3L6CA 3TZQA 4MWZA 3GLFE 3EW9A 3HB9A 3BILA 2B1JA 5JC1A 3IDZA 4DQDA 3H5RA 4KB5A 4NDZA 1MAHA 3FNQA 3LC0A 3VR3A 5L3QA 2I29A 1KNXA 3MJSA 1VMEA 2Q6OA 3IRUA 3AERA 2EP7A 2DX7A 2JVJA 1U90A 1NRWA 3VX4A 3F2IA 1K6IA 4FFOA 2EX0A 2QSUA 3OF2A 1N1GA 2Q6KA 3LZ6A 4ZAFA 3ROEA 3TECE 4W9NC 3A26A 2W42A 1QWOA 2OUIA 1FQOA 2FEWB 3DDUA 1HMPA 2GD1O 4D74A 5ES4B 1GPBA 4BXOA 1IJFA 1P2SA 1QU2A 4DOMA 1Z16A 4AKGA 3HJRA 2LRHA 1CUHA 1X7ZB 3V32A 1GNQA 3IPLA 2V8BA 2P1DA 3HO6A 2A86A 3D7KA 3LNCA 1B1AA 3U37A 4RKEA 1L7DA 1H6AA 2FUEA 4PGHA 5JAIA 1I6KA 1E9RA 2KLHA 4KLZA 2Z6QA 4OQFA 3H87A 1DTWB 2XYGA 2VSXA 5BNFA 4WKPA 2AZMA 1XMPA 3W04A 4LRWA 4PTYA 4L4YA 1JR3D 2OL4A 2PTGA 1W85B 2IRWA 3PLNA 1A7KA 4G86A 4JU8A 5DOVA 5JS2A 2QUKA 3F6EX 3FTCA 4AP9A 1A2BA 4AN0A 4EG6A 1SCNE 2GASA 1GD1O 2KS6A 3QXCA 1Z2EA 1ESEA 3RR2A 4MW4A 1V4VA 2TMGA 1M0SA 1DKLA 5LUBA 4US2R 4NABA 1CUJA 1MFPA 4IHQA 5JH7B 4IOMA 3PITA 3V33A 3WDKA 4GX2A 1U4NA 1Z0KA 2WK1A 2XW6A 3TNYA 1JE0A 2X8LA 2FZ5A 1SVNA 2AQKA 2QMZA 4JSRA 1SHJA 2JVIA 1QIGA 1T8YA 3I5AA 2WPDD 1CJSA 4IWNA 3WNCA 4D8TA 3B6MA 5BNTA 1DARA 1CS4C 2OGUA 2VUIB 1AGXA 2WPNA 4MITA 2Q4TA 4ID9A 1QTQA 1EDEA 4R84A 2CE7A 3DL2A 3FDJA 3MWEA 4IDDA 5AI9A 2FFQA 3H0EA 4Q93A 4OHVA 4DXDA 4FI3F 3IBCA 2FNAA 2LCFA 4O08A 4AS1A 3SFVA 4EX6A 3RREA 3R6LA 4TMWA 1P1RA 3PF8A 1DBWA 2B0CA 4FNGA 4YJ2F 2QR2A 3JAMA 2X8WA 1VJGA 3F8SA 4XB6B 3BTVA 5K4AA 4EUKA 1WKVA 4Q15A 3S2FA 3ZGNA 4ZK6A 2QAGC 2NU8A 3ZIAD 2X9VA 3PQ7A 5IN4A 4J1GA 4IIVA 1GZUA 5ELMA 3FFAA 3ONVA 1C8LA 3TPZA 1PWHA 3I72A 2REBA 1KFCB 1M33A 3FNIA 4CM3A 4DLRA 1XVVA 1R9NA 1QH0A 1ZVMA 3KKZA 4GW3A 4P2GA 2HYDA 4HEA6 4I55F 2PSSA 4DM4A 3RS8A 4MO2A 2IZ0A 3RSZA 3NHAA 3VNRA 3PFBA 1IWOA 3M6WA 2WSIA 2XQFA 2WKPA 3TTUA 4Z7QB 5HTOA 1K66A 4AJJA 1B6TA 2BGJA 1OGYA 3DBIA 1WPRA 3CPEA 1M2OB 3M5WA 2I6TA 5G4LA 1KO5A 3JWIA 4HXYA 4EYOA 4DDTA 4ZT7A 1C3EA 4RIHA 4ZEXA 2HMYB 4TYNA 1HA3A 2JI8A 1EDDA 3LLCA 2WOJA 4MPRA 3O1IC 4LOLA 3R7DA 3TB4A 2Z04A 2BEJA 3S5UA 2PQ2A 1XKLA 3GVIA 4V24A 1UZUA 1QPZA 4BTEA 4MV3A 4IUCS 1J8VA 3FM9A 3V1NA 4YXWA 2GBLA 4GMKA 4HQFA 1ZUWA 1U5CA 5FNZA 5JSZB 1GSIA 4HK4A 4W5QA 3EJWA 1R4NB 3O5AA 3PC8C 5F78A 3AT1A 3UAVA 4KZKA 2HBYA 1XMVA 3TSCA 3FH0A 5KYUB 2Q6VA 1I9GA 1M8FA 2JATA 5LDDC 3H11B 3ND6A 4G63A 3PSAA 3BXEA 1Q0ZA 4HWSA 4RHFA 5EZQA 3P9KA 1X1CA 2YV1A 5KOHA 3AVUA 1T8PA 4C0SA 1H5UA 2FETA 1ZOIA 4HN2A 3D8TA 4HDCA 4HLUA 4BHTA 3SQXA 4TLEA 4O4LA 3B1ZA 3PQCA 4L2IA 2CXOA 2GERA 1RJWA 3DHVA 4R6WA 4J0EA 4CMBA 2ID7A 1F4LA 1XLTA 2X5JO 3D4NA 5LQDA 5LU9A 5JC8A 1LI4A 4CIXA 1Q92A 2Z8ZA 2BJVA 1XC7A 2BFMA 1G16A 1W9HA 2FWAA 1JMVA 2DY1A 4OB7A 1PWYE 1GPMA 2ZROA 3EWIA 3E8SA 5A1JA 1W5BA 4TV8F 4CCWA 4YDSA 3K0SA 3K1JA 1DRVA 2C7OA 1NXTA 1MDBA 2WAYA 1LPAB 4CKYA 4K1LA 5DKFA 4YACA 5BRJA 3H2GA 5EEHA 4TQUS 3ZWVA 3TW0A 4HLQB 4TKZA 1NJ2A 3WGOA 4RD3A 5JJBA 2OPHA 1SVWA 3WGIA 4OXRA 5FQOA 5FLXA 5F3WB 1R5OA 3DXZA 1G60A 3EPLA 3D7RA 3A0RB 4L3VA 4YRFA 1RWKA 3ZNNA 3UPUA 1XKTA 2EFJA 1SXPA 3OJCA 4Y2TA 2YIDA 3OZBA 4U4AA 3SG0A 3VX3A 4DR2B 5JISA 3FWZA 2HK9A 2J0SA 1JQ3A 7REQB 4R0NA 1SY7A 2WD7B 3IDAA 2ZT8A 3QENA 2HSZA 3E2IA 1XRMA 3EGCA 3L0BA 2R5NA 3M1IA 3MJCA 1L5SA 3JQAB 3VMMA 1J9ZA 2XMRA 3B9BA 1R3UA 3K6JA 3RKUA 4G8BA 4F6RA 3AVVA 4HNAB 4K88A 1F48A 5KJ6A 1C1DA 1K9SA 4QE3A 1VPTA 3NJRA 2XPCA 2Z1DA 5JCZA 2LE0A 4WERA 5EQTA 4H7JA 3DT8A 4BMPB 2C7QA 2VCEA 4X41A 2VXOA 2CL0X 3B1XA 5BV1A 2Q45A 3HXOA 4J91A 4XOUA 1E7YA 1VFNA 3CVWA 1GPH1 2AT1A 4J9VA 5IAJA 3WISA 3ACCA 5L3SA 3HCAA 2QRNA 2ZB2A 4G5OA 4TRNA 1WXQA 4RZSA 4W4TA 2A88A 3VRHA 5I7UA 3OIFA 4ZTZB 4MI9A 1RWVA 3ABRB 1PG2A 1QX4A 2AMFA 3GGDA 3KOUA 3M3PA 3RHZA 1TVKA 3HL4A 5T6BA 3ZCTA 3IO3A 1T2FA 2LKCA 4FB5A 3DEYX 2JBWA 4UBMA 3UKOA 4F06A 4OHKA 2OFOA 1G8PA 2ADMA 2HPAA 1TUEA 1R66A 1J0CA 721PA 4V03A 4BNFA 3QVGB 2Z30A 5CEJA 4Z86A 4BO4A 8MHTA 2WAOA 4LY3A 3KKKA 1I3OA 1F8YA 4JQYA 4JT9A 1DHTA 2WJIA 3NT4A 4M83A 1X1EA 3ZBQA 3IE2A 2NUAB 4B2PA 5HCIA 3C5VA 2LZ0A 3DT9A 1M2EA 1KI1A 2QNRA 1XD2B 1QR2A 2YQ4A 3C6MA 1E3EA 1E7SA 2B2XA 3JQEA 3MYRA 4FCTA 1LSJA 4XGNA 4EB3A 2N1MA 2C5FA 5JALA 2P35A 5B1EA 3A06A 2FV8A 2QAJA 3A1VA 4FGZA 5DTRA 5JTUA 2BBSA 1JMYA 2I4NA 1AE1A 3MIZA 2YFKA 1E77A 4NE7A 4R1OA 2HQ1A 3GEBA 1GKYA 3KVOA 4JUBA 3TM5A 4CTNA 4X94A 2MINB 3F67A 1N2EA 1KH2A 4HDRB 1W44A 2BL4A 5IBPA 4E2FA 3ZYZA 2ODQA 2VF8A 4QXQA 3AR9A 4U7GA 1P4AA 3IPAA 2QP9X 2A0YA 1PYDA 3VOBA 1YVRA 2EG5A 4LKRA 2MU1A 4E88A 4EA9A 1ZN2A 3TINA 1CUGA 2WU0A 4M1SA 4XD7A 4GX0A 5SY9A 2BZ0A 1NLZA 1XDGA 2O8FA 3F1KA 4N41A 2HSDA 5IDQA 2AB0A 1QMGA 2Z3ZA 3KPWA 4OAOA 1SCBA 5CH5A 3D5QA 3L9XA 3DB2A 5TGTA 3IAS1 4BVAA 3ENVA 2C59A 4KXVA 4MIEA 4XJTA 3WDSA 4D3FA 1QH9A 1Y8CA 5AHKA 2VF5X 1UWVA 2QU8A 3KLNA 4KFTA 3W2EA 2ZIVB 4E09A 4JQSA 2RGCA 3WLSA 5C7OO 4NZNA 3NC4A 1XDUA 3D2CA 3DEIA 3IUSA 4E32A 3ISTA 3EQ2A 4ZEWA 1QZTA 1KVSA 3TVYA 3UWDA 1O96B 3WGQA 4NZYA 3KSAC 1CV2A 2BHRA 1J49A 1JEOA 1B1CA 1RMTA 2W6CX 3GUVA 1FNSA 5DB4A 2DERA 3FFTA 4GRDA 3VKHA 2VUUA 2ZSAA 5FLYA 1WXFA 4WZBE 1NNLA 4YCLA 2P1ZA 3OQ1A 1YQQA 2XUDA 1GIAA 4LJAA 5GZ3A 1I3LA 3WHPA 5DHRA 4BVBA 4AUKA 3QOWA 3K2EA 2VF4X 1XAHA 1E4YA 1T9KA 3Q6MA 1HDGO 1Z5VA 4GMDA 5AW6A 4R98A 1DC7A 2R7KA 2C42A 1IMJA 1X19A 2H1HA 3A04A 5LKRA 5IAOA 1PDWA 3QW2A 3WR5A 4C6TA 3ZCQA 4Q01A 1IHPA 3M1AA 1NV8A 2CXPA 4F2GA 4QDXA 2ZAIA 5AIBA 4G0ZA 2ZJ2A 4RZHA 2PA0A 1E63A 2PMDA 1F0YA 4LXUA 4ZQBA 2NAFA 1GZ3A 2ODPA 4EG7A 4ALNA 2QK4A 1VCNA 3DHWC 3S44A 1ZR4A 3H42B 4NENA 3IMKA 3STTA 4HNVA 3R8CA 3VU1A 2V74B 4KYVA 3MTGA 4QPPA 3KTDA 4TRJA 5CLFA