1LRJA

Crystal structure of e. coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrjA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrjA01
3BMOA 3E5RA 4J4TA 4Q3EA 4E2XA 1W8DA 1TEHA 2D1YA 4TZTA 4CM7A 1R6DA 1UDCA 4EJ0A 5H83A 5EQFA 2Q3EA 4XQGA 1J6UA 3WLEA 2BH9A 2NVWA 3PGXA 3ZWAA 1CETA 3R3JA 1LDBA 1ONNA 3PRJA 2WWRA 1FF9A 1DIHA 4ALIA 5IN4A 3ZU2A 3SBOA 1B8VA 2QRKA 4IDFA 3F47A 3PPIA 4CMEC 2C54A 3ZDFA 1ZNQO 1GADO 4I9HA 2NQTA 2B35A 2O48X 4B7XA 3DZFA 1H6BA 4MKRA 5CP8A 3WS7A 2ZYGA 1DOHA 3JYLA 2EJWA 1EFKA 1H5QA 1ISHA 1HRDA 5DCYA 3KUXA 3CH6A 4UAGA 5B4UA 2PK3A 3NYWA 5BNIA 2VTEA 3ZHXA 5DZSA 1PSDA 5JAQA 4ESOA 2X9GA 5KIAA 1L1FA 4XR9A 1R15A 4M55A 4XDYA 4CMEA 3AJRA 3QA9A 3D1LA 1OC2A 1Y81A 3BMNA 3K96A 2P4HX 2QW8A 4CM5A 1AN9A 2WDZA 2AE2A 3TL2A 3I9LA 4DWVA 4RVDA 1EQUA 2AHRA 2X9VA 4I9NA 4MPDA 2I3AA 1DIRA 3NJ8A 3NAQA 1ZJZA 3WQQA 3DAPA 1I2ZA 1AUPA 3RSHA 1A9YA 4IIVA 3BAZA 4EJ6A 1Q2XA 4YVFA 2EW8A 1JTVA 4BS9A 2VNAA 3AOEC 2O3JA 5I7EA 1C0KA 1O8CA 4FFMA 1HDRA 1QYDA 2AEFA 4BGIA 4M54A 4IPTA 2P2SA 4XQ9A 5THKA 4LMRA 2GF2A 1UZLA 3QQPA 4R1UA 1XDWA 1Z6ZA 4OJNA 3GFGA 4RF5A 1MG0A 4DYDA 1LDMA 2J5QA 2YZ7A 3KO8A 4NK4A 1FDWA 4PVDA 4PGFA 1EVYA 3JQ9C 3ZZNA 4KP7A 1O95A 3FNGA 2Y1OA 1GU7A 1PL8A 5FFFA 4NU6A 4OIMA 4RPJA 3DXFA 4NBTA 4JBHA 1GUFA 1R0LA 3OQ6A 4CMIA 3AW9A 5CEEA 3AOEA 3JCZA 3W6UA 2YQ5A 1G0NA 4BO4A 1GCUA 1KYQA 3ENKA 3FWZA 3OJ0A 5TC4A 1IPEA 3F4LA 4CM1A 1JKFA 5GZ3A 4FBGA 2R2GA 2OGUA 3HB5X 3DAFA 2GDZA 4R9RA 1ULUA 1N9GA 3ULKA 4L4SA 2Y1GA 3GUYA 3T4EA 2YHIB 2VZ8A 5COBA 1SB8A 4JNKA 1T2FA 3JQ9A 1ZJYA 4R4JA 2WD7B 4UEOA 5GY7A 1A27A 3GVIA 3V2GA 5C37A 3TZCA 4DLBA 3Q9NA 4DPKA 3WTCA 1KIFA 1WMAA 2A92A 5L4SA 1P1JA 3FWNA 4GBJA 1T2CA 3WQSB 1JAXA 3ZU3A 3G1TA 3CZMA 1X7HA 4GKBA 4O6VA 1VL0A 2G5CA 4D41A 4EI2A 2NVBA 2ZTLA 4W4TA 4AJJA 2GN9A 3RASA 3JQGA 2IYPA 2DUUA 3FF4A 3W4IA 3K73O 5DN9A 4B4WA 1DBVO 5L95A 1BDMA 2VWPA 1HWYA 2V7PA 4J49A 4HXYA 3L9XA 4RVFA 4AG3A 5L7WA 3LK7A 4N18A 4G5HA 1RWBA 4BQRA 1YL5A 2OHXA 4D44A 4BNMA 4D3FA 4CMHA 2EG9A 5A06A 3UOGA 3SJ7A 2Y1EA 1BSVA 3L6OO 5KVVA 3M2PA 3GY0A 1EDZA 5EL0A 4RZIA 2NUAA 4W7HA 4EUHA 1QP8A 3KXDA 3IC5A 3QIVA 4BNYA 1E6UA 5DBIA 3E8XA 3G49A 1N1EA 2EXXA 2Q4EA 3T4XA 3WFIA 4BO6A 2RHRA 3O8QB 5I7VA 3GDFA 5JCJA 3VH4A 2HU2A 3WBBA 2ZYDA 1Q7CA 5KVQA 1LQUA 1I32A 2FRDA 3D3EA 3ANMA 3DTYA 1ADFA 2VUTA 4TVOA 2AE1A 5JLAA 1BVUA 3AY7A 5TX7A 3HN2A 4ZN6A 1ARZA 3KSDO 1PJ4A 1WZIA 1I01A 3GVPA 1IULA 4GX0A 1PGOA 3FR7A 2GCGA 1DIBA 3P2OA 5TJ9A 2I65A 1PWXA 4NPCA 1LDGA 4F46A 3PGJA 3W6ZA 4PG7A 3RUHA 4DQVA 1C3VA 3U49A 1DC5A 5G0WA 5JE8A 3JQAB 1V0JA 1GPDG 1P9LA 2EIHA 2EW2A 4EZBA 4RVUA 2CUKA 5L45A 1GL3A 1BXGB 1DFIA 2GZ2A 2X58A 2NU7A 4XZ3A 3GK3A 1C1DB 1IE3A 5IN5A 3GEMA 4EUFA 4JLWA 1H93A 1HF3A 4H16A 1XQ1A 2Q1TA 1LDNA 1D8AA 2HCTA 4F3YA 5DCWA 4XJSA 3AU8A 4RPKA 3RUIA 1OZAA 1ZCJA 1DLJA 2QZ9A 1T1RA 2WYVA 3GR6A 3EUWA 5TRTA 2DU8A 4R51A 4RPHA 3WSWA 2PV7A 2DQ4A 1ORRA 2D59A 4ZA2A 5F21A 3PQFA 3WGOA 1VL8A 3K8ZA 3KYBA 4Z9YA 3ZV4A 3ZWMA 4B3HA 5ILOA 4QSMA 4FFLA 4O0LA 2PD4A 4BKOA 1BXZA 3RUCA 3ETGA 2YHIA 4FD3A 1CIVA 2C5EA 2D5CA 3VTFA 1PJ3A 1ZXLA 4IUYA 1GUZA 1FMCA 3WFJA 4TRNA 2WD7A 1HYHA 2ILTA 1AGNA 5IFLA 1NYTA 1ID1A 4YEDA 4Z0PA 1KEVA 1P3DA 1E7QA 1HTBA 1U8FO 1WPQA 1UH5A 4JJIA 4JBIA 4E2YA 2DPGA 2GZ1A 1QG6A 3ON5A 3GT0A 3Q2IA 2F00A 2ET6A 2CF6A 2UAGA 3OQ1A 4IIUA 1I30A 5AOVA 2OZPA 4JK3A 2Z1MA 4RF2A 1GYPA 1PJ2A 2NM0A 1YJQA 4MP8A 5CG1A 4K26A 3PWSA 4BNZA 8LDHA 3GAZA 3MWDB 1QV6A 1P1FA 4BB6A 1EQ2A 2HMSA 2X7HA 4ALKA 4KUHA 1M75A 5AXDA 2C7VA 3DMTC 3E9QA 3OEWA 1E0DA 4UUMA 1NPDA 5B4VA 4B4UA 3PWKA 4CLEA 3L9WA 3TDKA 4Y6RA 1PL7A 1CEQA 2CSUA 2Q50A 4OSOA 5EMHA 1IUKA 2CD9A 4KTVE 1DFGA 4JJGA 1NTOA 5EESA 3NX4A 3VPHA 2VOEA 4MINA 3WNVA 1IPFA 4NMHA 1RM4A 4WNCA 1P1IA 1Z7EA 1DRUA 1DJNA 3EY4A 3JQ7B 3GF4A 3O8QA 2UDPA 1ZO8A 3DMTA 3ZWWA 1Z73A 2OOSA 4J7CA 5JW6A 5L53A 4Z9FA 4R5HA 1UZMA 2EEZA 4GKVA 3AUAA 4BNFA 1P33A 2Y99A 5JAIA 3P19A 3I52A 4H15A 4IJUA 2O3QA 2BLLA 2Q1SA 3T7EA 3DAGA 5CHEA 4GAEA 4WLFA 3R1IA 3JQ8B 3HDJA 1AHIA 1VKOA 4IDAA 3WBFA 4B3IA 3LT0A 1N2SA 4PLYA 4LVUA 4DA9A 4J3FA 2JFHA 1QYCA 3VPFA 4RDHA 1W0CA 1MX3A 2PTGA 1UAYA 2NU9A 2D5AA 1EVIA 3WB9A 4BL5A 2A4KA 3JQAA 4HUJA 3RBXA 2W2LA 5A04A 4L8VA 1GEEA 3GG2A 1WVGA 1VL6A 3GNTA 1BXGA 3OIGA 5JDCC 2VN8A 3QJ5A 4E6PA 1LRLA 4R54A 3JYOA 3ZNNA 1C1DA 5LDHA 5LC1A 1LI4A 2AG8A 2E6UX 4U7WA 3SXPA 2Z95A 4XJTA 4RQUA 4A7PA 2JHFA 3MWEB 3KOUA 2HK7A 5ITVA 3GDGA 2JCXA 3CIFA 2X4GA 4NK5A 5IZ4A 5JFOA 1ZK3A 1PL6A 2D0IA 2EERA 2ZB8A 3ENNA 2AQHA 3D0OA 5ENVA 5JDCA 2HMUA 1NX6A 3HDQA 3ONFA 3OETA 1Z74A 2C29D 2Y0CA 3GAFA 3CZRA 1YGYA 1DHTA 4RDIA 1QLHA 2P9CA 3EK2A 3LF2A 1R0KA 3NTOA 2B5WA 1CQJA 5THQA 4UVDA 1BDBA 2OP0A 3M1AA 4PRLA 4ND4A 1U1IA 2EWMA 4ALJA 1RKXA 2Y1FA 1YH3A 4LISA 2NLOA 4NJOA 5BNFA 3LQFA 3N58A 3R0IA 4WCFB 2VQ3A 4RF3A 4QFDA 1G0OA 3UUWA 5IXYA 1N7GA 3RC2A 3WYCA 4YT8A 4O59O 2E82A 1GV0A 3K5PA 2UYYA 1KS9A 3EDMA 4XDZA 1MP0A 1JN0A 4CJXA 3JQDA 4INAA 1LC0A 2XAAA 2HK8A 1YO6A 2DLDA 5L9AA 1XEAA 1PGQA 1MG5A 4UVGA 1GCOA 2EP5A 3IUSA 1XKQA 4FPXA 3VHRA 4M1QA 3UXYA 3VPXA 4TKMA 5L7TA 4YT4A 2C2YA 1NR7A 2GD1O 2IDZA 1VKNA 4KZPA 1VM6A 2JFGA 2QYSA 5I9LA 2Q1WA 1OFGA 1C0LA 4LVCA 1P31A 1SBYA 1DC6A 4MP6A 2FOIA 4PG4A 1ZK2A 2BFOA 1JWBB 2D2IA 3AK4A 4TKLA 4XYLA 5T8KC 5GMOA 3NTRA 5L4LA 2DBVO 4MVJM 3RJ5A 2CF5A 3GN2A 1V3VA 4GX5A 3WMWA 4CMBA 3E82A 1X1EA 2B0JA 3JQ7A 1ZBQA 2EV9A 3HHPA 1W4ZA 3PIIA 4OXYA 2O3UA 1TB4A 5ER6A 3BYZA 2HAEA 3U4CA 5KJ6A 1OMOA 3AUUA 2YYYA 4J9VA 1B2LA 3AUTA 2GLXA 4A0SA 5T8KA 2E4AA 2A9FA 3G1UA 4Z6KA 2YDYA 3JQ8A 4PLWA 2VOJA 1R4NA 3D4OA 4IZIA 3WGGA 4B4OA 5DBGA 4DPLA 4WNIA 4IJKA 1QKIA 2RCYA 2WSBA 2HRZA 2EJVA 3RFVA 4ILKA 4LSMA 4AFNA 4Q3CA 5C7IO 1NP3A 3ONDA 1GYQA 3SX2A 5AYVA 2Q4BA 3NDJA 3CINA 4DMMA 4QT0A 2YW9A 4CLRB 4AJHA 3R3SA 1EFLA 4P22A 2HMWA 3JD2A 3UCEA 3E6AA 2FSVA 4YAKA 4DVJA 1LA2A 1MC4A 2AG5A 3SC4A 4ZQEA 5U9CA 3FBTA 3K2BA 4QECA 3AU9A 4IQ0A 1YBMA 1F8GA 2ZCUA 1B26A 1GFSA 4LW8A 1E77A 3I6QA 1LRJA 3B70A 4HNHA 4JP2A 1HXHA 1X15A 2Q45A 1AE1A 1C1XB 2UUPA 2ZYAA 3P7MA 4D0RA 2X1HA 3CEAA 3GVHA 2HKIA 1UP6A 3LU1A 4CV1A 1H6AA 3H9JA 3X2FA 1XCBA 2X0JA 5A9SB 5TQVA 3ITKA 2C2XA 1I2CA 3NGLA 4RCVA 1N5DA 3N74A 4TQGA 1V3TA 1K6JA 3PJFA 3WNQA 1PZGA 4BKRA 3PJDA 3PYXA 1HDXA 4CMAA 5DP1A 1QYXA 3IDSA 4YCAA 2Q1UA 1HZJA 3H9GA 1O9BA 1R4MB 4YA6A 3ZH2A 3E18A 3JQEA 2PY6A 2ZB7A 5HS6A 1ML3A 4R3WA 2YUTA 4URFA 3C1AA 1GUYA 1V3UA 3MOIA 5JBIA 2VWHA 4BNXA 4E2ZA 1H6CA 4YB8A 1LU9A 4PN3A 1E7SA 1IHYA 3MOGA 4R69A 3GLQA 3PJGA 1GZ6A 3UCXA 4BNTA 4XYBA 2FHSA 1U28A 3IMFA 1ONOA 3FI9A 2X0NA 5G0VA 5G2OA 4NHEA 1K3TA 2V6FA 1XGKA 4BQPA 4D46A 1YONA 4CV3A 1UXIA 3B1JA 4QEDA 2BRUA 1N8KA 4AICA 1V8BA 4IM7A 2P91A 4N5NA 1BMDA 4YQZA 3KZVA 3OA0A 1TT7A 4F6LA 2JD0A 1O89A 3PYLA 4R1NA 4GLOA 5FI5A 4YWJA 3RUDA 4GGPA 1CDOA 5CPBA 2GZ3A 2ZTVA 3CSDA 1H9AA 4E2WA 3AOGA 3ZWBA 4BV8A 3KBOA 4EBFA 3BIOA 2JFFA 4Z0TA 2I99A 3D5TA 3E48A 4TWRA 3ROQA 3NRCA 4NBRA 3KYCB 3FR8A 3OH8A 1SNYA 2C07A 4MIEA 1JWAB 2PZJA 3PK0A 3GMSA 1E3EA 1P1KA 1G6KA 3SJUA 3A4VA 1MXHA 2IZ1A 3LLVA 1HZZA 2B37A 1NHWA 8ADHA 1M6WA 3F6YA 4LRTB 1GV1A 1M67A 1RM0A 4R1TA 1GEGA 1HYEA 3UICA 3STHA 2O2YA 4LRSB 5TT1A 3OIDA 3WICA 4NZ9A 1PR3A 3AM4A 4MIOA 3V1UA 1AHHA 4CM3A 1EUCA 2ZJ0A 1RJWA 2DTEA 3GEGA 3HE3A 4G65A 4KWIA 1W6UA 3I9KA 4GMGA 3HFGA 4JQCA 2NTVA 3EAGA 4CLRA 3L0DA 4QO8A 3QSGA 4NFHA 1PS0A 5GZ1A 2ZTMA 3C1OA 2NACA 3E03A 1DRVA 3G3EA 1YOVB 2YJZA 5IXSA 3LZ6A 4Y67A 2Y68A 5F1OA 5JO9A 4CODB 2EGGA 1A4IA 1GZ4A 2RHCA 4ZU3A 5EJ2A 2FPGA 1PQWA 1Q0HA 1IZ0A 1M6HA 3EVTA 1E7RA 4XEHA 2H9IA 4NR0A 1IB6A 4WASA 4ND5A 3Q2KA 2YHUA 3RC1A 4BNHA 1NQAO 1C1XA 1ULSA 2XF8A 5IDWA 1KOLA 4M49A 4DIBA 1EK6A 5JY1A 3H2SA 3CXRA 3FN4A 1NWCA 2CVZA 4XWYA 4JCOA 2CVOA 5H82A 4CR8A 5A9SA 3U9LA 4I5FA 3PI7A 1LEHA 4YR9A 4PIVA 1PX0A 5KVSA 4YAGA 1ADCA 2GN4A 4N7RA 3I4CA 4M87A 2FPPA 1YDWA 2ZCVA 2YV3A 4ND3A 4CV2A 2QRJA 4CMJA 1EEHA 4QQRA 2QIOA 3AM5A 1HE5A 4N54A 3EMKA 4FOSA 3RFTA 3KETA 1PJCA 2B83A 3H5NA 1R4MA 4BNUA 3EW7A 3FRJA 2HSDA 2VZ9A 1OI7A 1NNUA 2C59A 4DUPA 4DQXA 4JP3A 4FSHA 4XIJA 1ZEMA 1PZHA 4YTEA 3NT4A 2A35A 4E33A 2FSSA 4DXHA 3ZV5A 3HB4X 6LDHA 1U3UA 4RGBA 3GMDA 4PLTA 3ZGYA 2CMDA 4TROA 4DRYA 1NR1A 5L4NA 3H2ZA 4XA8A 2HJRA 1C14A 1ISFA 4P4LA 3QE3A 3IP1A 2VHYA 3OJOA 3PHIA 2IEBA 1I3KA 3QVWA 1F06A 1QORA 1KEWA 1HSOA 1DC3A 3FD8A 2VWQA 1DFHA 1YQGA 3RBVA 4WLUA 2LDBA 3AY3A 4WEOA 4YYZA 4PLZA 3ZW8A 4B4VA 2CVQA 1E92A 1LUAA 2J5KA 1TXGA 3JQBC 4H7PA 4W7IA 5HWSA 5JYEA 4Q3BA 2Y66A 3WWYA 1FK8A 3IKVA 4CQMD 3N7UA 3K30A 4CR6A 4CUKA 1BGVA 2CY0A 4CM8B 3LF1A 1GD1O 4EEXA 5L40A 3G17A 1X1TA 3KYCA 1TVEA 2W90A 1DB3A 2G1UA 2NV6A 3IJRA 3KSUA 3NKLA 1GZ3A 1KVSA 1W73A 4MVJF 4D45A 4UUNA 4RVSA 3ZHZA 3KLPX 2VYND 4XGKA 3JQBA 4CM9D 1U2GA 4BO8A 4XX0A 3I4FA 4BVAA 3D4NA 1DXYA 1WP4A 5MDHA 2O7SA 2AMFA 2O50A 3FHLA 4II2A 3DC2A 1J4AA 4U8GA 4BO5A 1NQTA 4KOAA 1S7CA 3GZNA 3ADPA 3KB6A 3U4DA 2PH5A 4K9DA 1NPYA 4WOJA 4GVXA 1N1GA 4DMLA 3E9MA 3H6KA 1ONPA 3S1LA 2BHLA 1LLCA 4A5OA 1V9LA 4E0BA 3ZV6A 1YB4A 5DULA 1U2DA 3ZV3A 4HX5A 5TGDA 1ZK1A 1HSZA 3WGZA 1DO8A 2W98A 4WEQA 3TFOA 1Z75A 3LVFO 2BGMA 2RAFA 3PQDA 3L4SO 1YOVA 1MA0A 1F14A 4A03A 2BFMA 3K31A 3LT1A 3IL2A 3MJSA 3WJ7A 2GYYA 2BELA 2NNLD 2V6BA 3PZRA 1K6IA 1QV7A 2X22A 4GX2A 3B1KA 3ZHBA 4R1SA 3INRA 3WGQA 2Y93A 2BI8A 5ICSA 1EBUA 4TMFA 4MKXA 5JYDA 1E5LA 3P5SA 4L9RA 3D4PA 3DZGA 4EEZA 5A5EA 3KV3O 2P5UA 4E3ZA 1P1HA 4HP8A 1VI2A 3PFWO 3QWFA 3M2TA 4RLHA 5CFZA 1ADGA 4BNVA 4ZICA 2Q46A 1UDBA 3HNPA 4OL9A 3TZQA 1NBOA 4FDAA 1TLTA 1P1RA 5FWNA 4DBVO 2DBZA 3DBLA 3CUKA 2DBQA 4E31A 5ICMA 3WOHA 3FTPA 1I5RA 3RD5A 3B1FA 3NDIA 3NT2A 3OIFA 4QTZA 3JSAA 1YDEA 3PJEA 4LCEA 2J3HA 3DOCA 2JCYA 3DTTA 5DBFA 3H9EO 5HM8A 1PEDA 4EW6A 3RUEA 4IDCA 4AJOA 4BO1A 3WLFA 4JIGA 3GHHA 1IHXA 1EK5A 3TSCA 4FFOA 3DONA 2H1SA 1PJBA 1HT0A 2CDCA 3JTMA 3QP9A 3WXBA 1N7HA 1Y1PA 3MJ4A 5ITWA 4W6ZA 1B15A 5KWEA 5DCUA 5CDUA 3ZU4A 4UEKA 3PP8A 4PLGA 1WXDA 5AQ1A 1JU9A 2JCVA 1OOEA 4ZD6A 1WLYA 1GTMA 3BHMA 4JBGA 4BNIA 1DSSG 3OMLA 2YDXA 3OJEA 5U1PA 5A4DA 1JKJA 1PJQA 5F3RA 5KJ1A 3DBVO 4OQZA 3DFUA 4CMKA 2NADA 1A5ZA 3V2HA 1VJ0A 1O6ZA 4B3JA 4TVBA 1ZMOA 1HE2A 3RU9A 4RLSA 1YKFA 3L6EA 3GNQA 3ZCXA 1E7YA 1WWKA 3D64A 3EZLA 4RPGA 5BSEA 3GOHA 4ZQBA 3BZUA 1HEUA 4I1IA 4I08A 1IL0A 4N5MA 4CM8A 5KOIA 5KVCA 2BMAA 1PGPA 4FFPA 1ZIDA 4HY3A 4CMCA 3ADOA 2ZQYA 4WUVA 1E3SA 4L75A 1E1MA 4CLOB 3Q3CA 1LXCA 3DZBA 1ENPA 3QVXA 3S2GA 2Z5LA 2X0RA 2ZK7A 4PZEA 1CJCA 3ZNQA 5B4TA 4OOEA 2IODA 1VSVA 1I24A 4AJLA 5ADHA 4DC0A 1V35A 4MVJD 5I7SA 3V8BA 4E5MA 3TF5A 3JD4A 3PYMA 4XQEA 4BV9A 1O94A 4E4YA 4YPOA 3QWHA 5CAEA 3PWZA 2GSDA 3ETEA 4UVEA 4DIFA 1CF2O 4JN6B 5ES3A 3DDNA 1LX6A 4NBVA 1T24A 2LDXA 3RQSA 3QV1A 3WGYA 1I3MA 4MVJG 5CDGA 2PZLA 1R4NB 4HFJA 1T2EA 3FCOA 3UKOA 3JD0A 4QXMA 4WK6A 4WLVA 4DGSA 2J6IA 4EYEA 3WTBA 5KJCA 2PR2A 3GPIA 2OUIA 3CE6A 5JPIA 3ZHYA 1HDZA 3AI2A 4CLHA 3ZNOA 3AI3A 3VPGA 1E6WA 1KEPA 4IINA 1NQ5A 4XR4A 4BGEA 1VC2A 3U5TA 1UAGA 1E7MA 1I8TA 4KDFA 4TRRA 2CFCA 3GG9A 2PNFA 1E5QA 3COSA 4HWKA 4LN1A 3V1YA 5BSFA 1WW8A 3I1JA 1ENZA 2B69A 2RH4A 4XB1A 4W99A 3GRPA 5BR7A 5ILGA 4I5GA 4IDBA 3PVZA 4IBOA 3I3OA 3VH3A 2DFVA 4OKNA 2O2SA 5IAAA 2GRAA 3F46A 3UVEA 1H6DA 1U3TA 5KNLA 1HE3A 5K6AC 4PG8A 3JYPA 2ZJ1A 1ZSVA 3U09A 4UULA 4GWKA 4PLPA 2NVUB 1JLLA 3S2IA 3GGPA 3C7CB 5IDQA 4BO9A 1YJ8A 3BA1A 1I10A 2Q2WA 4UVIA 4D43A 3ZI0A 3GDOA 2RBEA 3FNEA 2QZZA 5BT9A 3MCVA 4NIMA 2WMDA 3NGXA 2E48A 3GFBA 4DBZA 1E1KA 4CL8A 1UXKA 4U6QA 3RCBA 2W8ZA 5F5NA 4Y98A 3IUPA 1B3BA 5DF1A 5K6AA 1U9JA 1PZEA 3RU7A 2B36A 4BUCA 1PS8A 2OBNA 4FFNA 3WMXA 2EKPA 4WGGA 1M2WA 2JHGA 4TZKA 3TJRA 1VJTA 1DIGA 4K6FA 3U0BA 5IG2A 4LMPA 5FF9A 3C85A 1I3NA 2WYUA 3ZN2A 2HUNA 1LTHR 2VNSA 4D3SA 1GAEO 3BMCA 4NDNE 1XIVA 2H5LA 4Y6PA 2FMUA 2WM3A 4UUOA 4YAJA 2V6MA 1EVZA 4RJTA 2IXAA 2CDBA 1UJMA 2IZZA 2FY8A 1KVQA 4YAIA 4PG6A 1F12A 2RH8A 4ZQGA 2HMVA 3AWDA 4GSLA 1NWHA 4FGSA 4TSKA 3QHAA 1D4FA 1M66A 3MJCA 3ANLA 4L0QA 2EHDA 1A4UA 4NU5A 1MXFA 4X54A 1YQXA 1HLDA 1K89A 3HFSA 4CLOA 3KEQA 3GNSA 2HMTA 3PIDA 3W8EA 3CMMA 2NTNA 4MVJP 3WX0A 2PFGA 2O4CA 3I23A 3HUDA 4HNGA 1B8PA 1DDOA 3IIEA 1ZZEA 4NBUA 4DQUA 4BNJA 5KCZA 1PS9A 4RZHA 1NM5A 1O0SA 3ICCA 2VRCD 4BKQA 1C0PA 3ROKA 3LC2O 1R16A 4DLAA 1GQQA 1JAYA 3IS3A 3OFSA 1OAAA 4CLDA 1JVSA 3IJPA 1XHLA 1YL7A 4NFSA 5DOZA 2Y1CA 3A14A 4ZQHA 2WE8A 3BHJA 3A06A 1PZFA 2P9GA 1RM3A 2G17A 3ZWNA 5LCXA 2O4UX 3LC1O 1KBZA 4H3VA 1YL6A 3O4RA 1XU9A 3Q1LA 3ZWOA 4HFNA 3TOXA 1CWUA 1DJQA 2G76A 1RM5A 5G4LA 2PKQP 4F45A 3DFZA 1XLTA 1Z45A 3CKYA 5C5IA 1DRWA 1FXSA 1PWZA 2JD2A 3OEYA 5COAA 1GQ2A 4IXWA 3Q11A 2Y67A 1EE2A 1NVTA 3ZWVA 4XYMA 5A5FA 3LSYA 4MIYA 4RF4A 2PZMA 5COQA 4WLNA 2IXBA 1R12A 4KMSA 4O1MA 5AXAA 4N5LA 2ZB4A 4ALNA 4P8RA 1T4BA 3VOSA 4G81A 1I0ZA 2CDAA 3BTOA 5C7OO 3HDYA 1KY5A 2O3RA 1XELA 5T57A 5IF3A 4PLVA 1I2BA 4MVJI 5CDYA 2EKQA 5G0SA 3VTZA 3ST7A 1PQPA 4XYEA 3WYEA 4CR7A 4OMUA 4PLHA 3I9JA 5JO0A 4PZCA 1E1LA 3QVTA 5I9MA 3VKVA 2PGLA 3JYQA 2Q49A 4NFYA 3JQCA 1LJ8A 5EPOA 2NVUA 1H2BA 2JL1A 1ENOA 1P45A 2VCYA 2P4QA 1NQOA 1ZSYA 4HADA 2PH3A 5JCJD 5L51A 1KVRA 1E3WB 1SO8A 4ZQFA 3FNHA 3JD1A 3K2EA 3U4IA 4PVCA 4M89A 4UUPA 1UUFA 3WR5A 1K6XA 4J91A 4E5KA 4YT2A 1BXKA 1RYEA 5B1YA 2W2KA 2GR9A 1KETA 2WYWA 1Q7GA 4E5NA 3ITDA 2C0CA 4Z9XA 5A02A 1YXMA 3OBBA 1AXEA 4GMFA 3OA2A 2JAHA 4P4GA 3UH1A 4YJGA 3I9OA 4JX8A 1SZJG 2VWGA 5I8WA 4BNNA 2PKRA 3WGHA 4ONEA 5K9ZA 4PFJA 4UEJA 2VT2A 4II3A 1E3LA 5DP2A 4S1VA 2BF7A 1ZXBA 3KTDA 3E1KA 3VVBA 1BVRA 4AJKA 3D7LA 1ISIA 3NTQA 4LSWA 3WGTA 1QYWA 2X8LA 4FC7A 5A03A 1T26A 4FW8A 4DREA 2JD1A 1D7OA 2X9NA 4Y8VA 5FYDA 1JW9B 5TSDA 1E6EA 3UCFA 2X5OA 4FOOA 3KHUA 3FPCA 3PLNA 5F1PA 1MLDA 3H7AA 4FCCA 2B4QA 3FNFA 5CEFA 3LT4A 4Z3KA 5K0ZA 3ROMA 4QO7A 4ZHSA 4AVYA 2Y05A 4YXFA 4R3NA 1WMBA 1A9ZA 2W4QA 4CMGA 3OM9A 1QLJA 3TPCA 3A1NA 4RVGA 1A7KA 4FGWA 3U62A 1X0VA 2UUOA 2D8AA 2FP4A 4IDDA 5B12A 1XU7A 2PD6A 3BTVA 4FIZA 4R9SA 4BGUA 5C7LO 3CTMA 2WJPA 4CM6A 1DHRA 5B37A 1HKUA 1DPGA 4WKGA 4YACA 4ALLA 4YRAA 1XYGA 4IJWA 1DLIA 4QX6A 3NT5A 4EITA 4YJHB 3PDJA 3DOJA 3PHGA 3L77A 4ZGWA 3TRIA 3HJAA 1BTOA 3I5MA 1IOLA 2O3TA 3UAGA 4B7CA 1ZK0A 4BKPA 1I33A 3VH2A 1GDHA 1T2AA 4FB5A 3H65A 3VZQA 1H9BA 3PTZA 1ISJA 4RL6A 1I3LA 3EZYA 3K92A 1TA4A 4AJPA 1LSJA 2VUSA 2VT3A 3GZNB 2J3KA 4PLFA 2IRWA 4RPLA 4ROSA 4W9NC 4JROA 3EHEA 4YQYA 3DHNA 4BO7A 1KVTA 2D4AA 2XXBA 2DTDA 3RFXA 2HRBA 1K5HA 3K6JA 2JJYA 1PJLA 3AUSA 3ZWYA 1U4OA 1TI7A 5I8ZA 4RVHA 4O63O 1DIAA 2R6JA 4E5PA 1Z82A 5JMPA 1Q7BA 3SLKA 4XD2A 2GNAA 1MV8A 4R01A 5I9NA 4BOYA 4E30A 4C4OA 5F5LA 7MDHA 5I7FA 2YFHA 1GPJA 3PHJA 4OHUA 1VRWA 3WIEA 3ZNPA 1UXGA 4W9NA 2HDHA 4Q3AA 1LBEA 3UW3A 5A9RA 1VSUA 1MUUA 1DAOA 1EMDA 1NFFA 3IP3A 1R37A 3GZ4A 4BHTA 4TRJA 3TN7A 3WQRA 3F5QA 1LDEA 3TNLA 1Q0QA 5CDTA 3MJTA 3GRKA 1WDMA 3W8DA 2IE0A 5DDIP 2IEDA 2BFAA 4Q39A 1WAMA 5IDXA 2DUWA 2Q99A 4XQCA 1T25A 1SEVA 3GVXA 2HK9A 2NWQA 5U4QA 3F4BA 4RO0A 4M86A 1SAYA 3JYNA 3W4JA 1X7GA 3OF2A 2VHZA 2TMDA 4DPMA 1E3WA 4KDEA 4G2NA 1EUZA 4K28A 4BMNA 5JS6A 4Y9DA 3C7DB 3OQBA 1UP4A 1HDGO 3D3WB 3DBLB 4GPD1 5TJHA 4KUGA 1T4DA 3W1VA 3QWAA 1HDYA 3F5SA 5TT0A 4A26A 2D3TA 3F1KA 4ND2A 4B79A 3GEDA 3HG7A 1QXSA 4J1TA 2AEMA 3IOYA 1JQBA 3VDQA 1SMKA 3PFFA 5JMWA 1PR9A 2OORA 2PLAA 4ITUA 3AM3A 3RUFA 3GN1A 1OC4A 4YRBA 3C3XA 2JAPA 4BO2A 3QVSA 1JKIA 2BGKA 2R00C 3JQAD 5HRUA 1XG5A 2W2LD 3W8FA 1CQIA 3DL2A 4WE3A 4A73A 3H9QA 5TLSA 2I3GA 1EDOA 1NXQA 4YJFB 4E21A 1Y6JA 2VYVD 4E13A 5EN4A 1B0AA 3H5AA 4PG5A 3V5NA 2VRCA 3QY9A 4LK3A 1EZ4A 1ZMTA 4L74A 4W82A 1IY8A 3HDHA 3ORFA 3BTUA 3OJLA 1MFPA 2AW5A 2PZKA 3P2YA 1U5CA 3QWIA 5JDIC 1GQYA 4B8WA 1NVMB 1XWFA 2R00A 2HO5A 3BHIA 1J0XO 5TIIA 4BB5A 4IS2A 1R66A 3UGKA 3CPSA 3HSKA 4J7XA 4OYRA 3ZWXA 4B7UA 2DAPA 1P77A 4GWGA 3GGGA 2JKVA 1Y8RB 1MFZA 3O38A 3PHLA 2ZQZA 1X7DA 3ZWCA 2BFPA 4JJFA 1VPDA 3QW2A 2V6GA 3PEFA 3RAJA 3NV9A 3RVDA 3TZHA 4YT5A 5HA5A 3VKUA 3QWBA 3DB2A 4OH1A 5JDIA 1U7HA 3BMQB 4HV4A 3PXXA 3QLJA 4MVJH 4Z3DA 3V1TC 4YJHA 4A27A 3ASUA 1HDCA 1B3RA 4IY1A 2J5RA 2AQIA 1D1SA 4OSPA 5EINA 2FR8A 3OSUA 3WGIA 2WEKA 3I9NA 1S6YA 2VUUA 3O9ZA 3ETDA 1QYVA 4YDRA 1EVJA 1TT5B 1ZW1A 1KY4A 1C0IA 4YRDA 2QX7A 5JC1A 2P5YA 4FJ0A 2BI7A 1BRMA 2P68A 1WZEA 1ZUD1 4O5OA 2PD3A 4NBWA 1CRWG 2H6EA 3FSRA 3JQ6A 3TFQA 4R5MA 4U5QA 3F3SA 4NNJA 2J3JA 1Y9AA 1EE9A 4FN4A 3RWBA 2I5PO 4YAEA 3VPSA 2BGLA 3LLSA 5G0UA 2C7GA 1ZVMA 3F1LA 1JVBA 2A94A 4CPDA 1QR6A 4IGEA 2E49A 3IQDB 5MGBA 1PTJA 5BSHA 4GGOA 4Y6SA 7ADHA 1RYDA 3GC6A 2GN8A 2GUGA 1KC1A 3H3JA 4RORA 5EERA 4P4NA 3TL3A 1B16A 4ALMA 2PWZA 1LLUA 4P38A 2X5JO 3HADA 3T7CA 1Y5RA 2B5VA 2GO1A 2OBYA 1NFRA 3PDUA 3CMCO 3MEQA 3NEPX 4BNLA 4U6SA 1BW9B 4BNGA 1YS4A 1NAHA 5LDGA 4JGBA 2FZWA 4WOKA 2J8ZA 3DZKA 1VE9A 4D79A 4EGFA 1ZFNA 3OHSX 5FEUA 4J0EA 3AFMA 4BGVA 1CERA 1MB4A 1LDYA 3DBRB 3D3WA 1J49A 1YB5A 4R68A 3A28A 3KM0A 3PLRA 5ER9A 1NASA 1LC3A 3H9UA 4I9UA 3W4KA 2AQ8A 4J7UA 3HZZA 3JD3A 4CV0A 3TQHA 4QFCA 2I9PA 2WTBA 4AJIA 1FDUA 2OXIA 2B4RO 5A1TA 2I76A 4LGVA 1NPTO 2YV1A 1LSOA 1LSUA 3U3XA 3EVNA 4I5DA 1JA9A 1U4SA 4ND1A 4PLCA 4IMPA 4OM8A 2VTDA 3SVTA 2HJSA 4YJFA 3I9MA 1XR3A 2TMGA 2F1KA 4GL4A 3RBZA 1B7GO 4R16A 4Q3DA 1SOWA 4IQ8A 4QUKA 4CLXA 4CQMB 4EDFA 2DC1A 1ISMA 4XKJA 4CQLB 2QYTA 3DZJA 2FR0A 2CZCA 4FJ1A 1YB1A 4D3DA 2PGDA 1KVUA 5G0TA 4PCVA 2Q2VA 4XIYA 2EKLA 3DMYA 1IZ9A 1I36A 1KEUA 3KYDB 2Q2QA 3BMCB 1DEHA 1ZKMA 2C82A 4A10A 4WCDA 2GN6A 9LDTA 4WLOA 2CNBA 4J4BA 1P44A 4YJDA 1T1SA 3RUAA 1P74A 5HBRA 1YE3A 4XRGA 1LSSA 3WIDA 1L7EA 1Y8RA 4CUZA 4HFMA 4BMSA 1JDJA 3L07A 3MTGA 5G4KB 1BWSA 3UHAA 3ANNA 3VZPA 2QG4A 3TZ6A 3ZU5A 3RC9A 4XCVA 4J90A 3LDHA 4DTIA 5DOVA 2IZ0A 3BMQA 1GYRA 4IZHA 3UFXA 4AJEA 4J0FA 1RPNA 3DHEA 5IDYA 3M6IA 5CG2A 5JCXA 3EYWA 3RKUA 1U3VA 1XQ6A 4GVLA 5T67A 4ZVVA 3S2EA 4OAQA 1SB9A 4ZRMA 4D0SA 1TT5A 1O5IA 4NG5A 1E1NA 1VJ1A 3LC7O 4I5EA 5KKAA 4DL9A 4FJ2A 3S55A 2E37A 3DBHB 2PA3A 3E5MA 3O03A 3KVOA 1DAPA 1SC6A 2AEJA 5A3JA 1HL3A 4BNKA 5TNXA 1ISGA 1LRKA 3DHYA 3ZW9A 1YBVA 2FZEA 1WDLA 1OBFO 4WPGA 1HETA 3RJ9A 4MKZA 1E3IA 3MZ0A 4AJ4A 2X5KO 1LLQA 4MOWA 5IJZA 1P0CA 2GASA 3L4BC 4Q9NA 4D42A 2FWMX 2ZIZA 3GGOA 4L4RA 3UN1A 9LDBA 1A72A 5BQFA 4MJLA 5JXWA 3GVCA 4BNWA 2G82A 4PZDA 2UVDA 5JSFA 2XPCA 1PIWA 1YVEI 4IJVA 3JQFC 2PKQO 1V6AA 2H63A 3VH1A 2QQ5A 1F17A 3LYLA 2RIRA 4EUEA 4J9UE 1BW9A 1YQDA 3LT2A 4IGFA 1WNTA 5CPFA 3U4HA 2SCUA 2DT5A 3MJEA 5DT9A 4HBGA 3L4BA 4K1LA 5JC8A 2ZTUA 1SOVA 1M76A 4RQTA 1A71A 3DBRA 1UZNA 4Q3NA 1HE4A 4AL4A 1XA0A 4Z0HO 4IQGA 4FQ8A 4KQXA 3JQFA 3UF0A 1HYGA 4GQAA 4CL3A 4OOFA 5KKCA 3DZHA 2VYVA 4FC6A 2O7QA 2POQX 5AXBA 5J23A 1AXGA 2NTJA 3M1LA 2OO5A 1Z7BA 2DTXA 1Y8QB 1BHSA 2NU6A 3EGOA 5AXCA 1Y5MA 4CM4B 4HFRA 2I6TA 4IXTA 1Q0LA 5A9TA 3VVCA 2NQ8A 5CEJA 5JY6A 3DEYX 5AVOA 3H8VA 2AA3A 3AFNA 2W2KB 5ENDA 2GGSA 5T6BA 4CQMA 1H2HA 4OGWA 4CQLA 1K2WA 2OL4A 4NQZA 5L7YA 3SC6A 4KQWA 1F0YA 1R0SA 2Z1NA 1U5AA 1X13A 1P0FA 3KEOA 1VLLA 5JAMA 4YJGB 4B8ZA 4ID9A 3G79A 4S3MA 3C24A 3VC7A 1PU2A 4NJMB 2PGJA 3KYDA 4LCJA 1QRRA 4HKTA 3WJAA 3ROPA 2VYNA 3AY6A 4CM9A 4BMVA 4GI2A 2X23A 1LNQA 5T5QA 3WDSA 4XRRA 4DC1A 4RV9A 4FR5A 1U3WA 4CUJA 3RROA 1NVGA 1LLDA 1PGJA 4J1SA 3TZKA 3DWFA 5IZCC 3MJVA 4WLEA 4YBZA 5G4KA 3HQ4O 3H3FA 2C20A 5BNTA 3WWZA 1F8FA 4OO3A 1Y9EA 4U0JA 2Y1DA 4EJMA 3B20A 1YWGO 2DFDA 2ZKLA 1H94A 3H4VA 3MTJA 1ZH8A 4J4HA 1L7DA 4BO0A 2VHVA 5FI3A 2EP7A 4OXNA 3ZWPA 2AQKA 3R6DA 4I8XA 2O3SA 3NDRA 2EF1A 5A3VA 3BXXA 4OQYA 4ZRNA 4TRMA 1EBFA 1NAIA 2G0TA 3GH3A 3GHYA 4NH4A 4J6FA 4BO3A 2OFPA 4AJNA 5IZCA 3A9WA 4OXKA 3B6ZA 2QRLA 1YRLA 3RI3A 1QMGA 3DBHA 3PQEA 2NU8A 3E9NA 3L6DA 3Q0EA 4JXKA 3VZRA 4F6CA 3Q6IA 2VHXA 1X14A 2XXJA 3BMOB 1ZSNA 1PGNA 3OJFA 4GSKA 1GY8A 1FJHA 2BKAA 4L73A 3DOOA 1J5PA 4GX1A 4J2HA 2ZATA 1FDVA 3NUGA 1UR5A 1UP7A 3X2EA 2WD8A 3AI1A 4XGNA 1BG6A 4A2CA 2FR1A 5GZ6A 1KC3A 6ADHA 5HTOA 4UREA 3G0OA 5F1KA 4J1QA 4J1NA 3INTA 1B8UA 1H0KA 1U8XX 3HN7A 2I66A 1N92A 5T64A 1ENYA 5BSGA 4J16A 2YY7A 5H81A 3S8MA 1SEPA 2P9EA 3KSZO 4L4XA 1UDAA 1PQUA 4XGIA 4E12A 1DC4A 2WE7A 3GQVA 2IYOA 5L3ZA 3DO5A 1NHGA 3ICPA 3K9QO 4MDHA 3VDRA 3F9IA 4MO2A 2XOXA 4OKIA 1XSEA 4XYGA 3ASVA 3KLMX 4PRKA 3WSVA 3RC7A 3FTNA 2X86A 2X6TA 3GUCA 3WG9A 3KRTA 1GR0A 3TWOA 3O26A 3VZSA 3OECA 1U7TA 3H5RA 3PZBA 3SLGA 2YFQA 1A7AA 1T2DA 3NJ4A 3BMNB 4KWHA 1EUDA 2FN7A 1Y8QA 4UVHA 4MVJE 3RKRA 1WDKA 2FPIA 5KJFA 4D7AA 4ZJUA 1E3JA 1D1TA 3ONEA 4IDGA 3WYBA 4NI5A 4CM4A 1HDOA 1PJTA 4J43A 2UV8A 2DKNA 4E32A 4BKUA 4FS3A 2ZB3A 3QRWA 1UXJA 4FFRA 4AJ2A 4DIOA 3INGA 4U0KA 1HLPA 4WCFC 1UXHA 5TF4A 4BIIA 4KTTE 2QHXA 4GLLA 3I83A 3ABIA 3GPDG 1LQTA 1ZEJA 2Y0EA 4K6CA 3C8MA 3OICA 2EGHA 1ZK4A 1KERA 3IAHA 2VHWA 3FPLA 5JAZA 2VZ0A 4IDEA 2YQ4A 4IS3A 1NFQA 3V2UA 4DLLA 2V65A 4NJMA 5C3MA 4C7JA 1SCUA 4MP3A 2AXQA 3SEFA 4L76A 1ADBA 2DBRA 2OP1A 5JNLA 4WCFA 5KTKA 5TS3A 1YBAA 3BTSA 4WECA 1E7WA 4R41A 4AJ1A 3DZIA 4DYVA 1QSGA 4E5YA 4CMIB 5HS4A 5EIOA 2X0IA 5DNAA 2BD0A 2J3IA 4MVJA 3EC7A 3D5QA 4J2OA 3VAZA 4GH5A 2GPTA 3C1TA 3C7AA 3JV7A 5KJEA 1N9GB 1X0XA 3HWRA 2Y0DA 1PJSA 3RIHA 1SPXA 1Y7TA 3OP4A 5EQDA 2DVMA 2HLPA 1CYDA 1MC5A 3DR3A 1Q1NA 3QVOA 2NSDA 3I6IA 3TOZA 2C5AA 5A05A 3FBGA 4M8SA 3Q9UA 1B14A 1FDTA 1IYZA 4KUEA 3GA0A 4IMRA 4XB2A 1FDSA 2YV2A 2OMEA 1D3AA 4WJZA 4C7KA 2DM6A 2O23A 2I67A 2B4TO 2HQ1A 5CDSA 1MGOA 3DQPA 3IKTA 3JQGB 3PHHA 2VRBA 2GERA 1G1AA 3S2FA 2DPHA 1K0UA
chains in the Genus database with same CATH superfamily
2RB5A 1UKCA 2HV8A 3E5RA 2QI9C 3KAJA 3PE6A 4TZTA 3M1YA 2MR5A 3LQ2A 4FW9A 3MFYA 4I1OA 1ESZA 4L4ZA 3IUEA 3W04A 4YRTA 1FLDA 1OQAA 4M9ZA 4CKCA 2BH9A 2NVWA 2O1XA 3C3AA 2I4IA 4BRSA 5EIXA 2H3HA 2R8RA 3PGXA 4IKOA 4LMAA 4F1WA 3R3JA 4WXPA 1TCUA 3ZEAA 4OQDA 1VKHA 5FUMA 4IDUB 4MV4A 4ALIA 5ED4A 3ZU2A 3L1HA 3SBOA 4P7BA 2WKPA 1G5PA 1KDTA 2XBMA 1B8VA 3U6BA 1JEQA 4KFCA 5JWOA 2F43B 2GHRA 1M1YE 3DT6A 5FKJA 2ZUTA 3KOMA 1TVCA 3F7NA 1GADO 4I9HA 4N65A 5ALHA 2JFVA 1L5WA 4B7XA 2YJTD 4TT8A 2OFFA 4IHJA 4MKRA 3WIBA 3ZBTA 1F4VA 1PJRA 2C8LA 3I3SR 3IMCA 5CP8A 2RC6A 5A0FA 1ODKA 4I3FA 4IV0A 2BTQA 1AC5A 3G89A 4BEVA 5BUCA 1DX9A 3U1VA 1JJBA 1H5QA 1ISHA 1DBQA 1U7WA 1H3EA 1EBBA 5AHOA 2OB2A 2PK3A 1YZLA 2VTEA 1R4ZA 3II6X 3CG0A 2NPOA 3OAAD 1PSDA 1JHQA 1QGAA 5JZBA 1FCJA 2IH2A 3VUEA 5HKKA 4RA6B 3OCYA 3AJRA 5F73A 5IT4A 1OC2A 4UQOA 4U2CA 2QW8A 5CLQA 4DUZB 1AN9A 2WIAA 4X97A 1VFNA 2Z3VA 2AE2A 4L3VA 4NARA 3TL2A 4UHJA 4LGYA 2P3SA 4IH4A 1IOWA 4QBHA 3E7DA 3NLLA 4DWVA 5HM6A 3CNOA 3LOUA 4Z2YA 2WNHA 3ESXA 4RAQA 4FONA 5FBQB 5IU6A 2D6FA 5IVDA 3NGMA 2I3AA 1DIRA 3OQPA 4HH4A 2OYCA 1AUPA 3RSHA 2MIIA 3FJYA 1HDIA 3PFNA 3PQCA 5IMBA 2HGSA 3VYTB 1U80A 1KGSA 4FX5A 2B1RA 3I92A 4EJ6A 3BFXA 2EW8A 2X2FA 3NS7A 4HTFB 5A2GA 2IVZA 1MO5A 4BVJA 4BS9A 1L4EA 4I4TA 1C4OA 5KYXB 2ZW9A 3O3CA 3H83A 2IIVA 3OMXA 3P5BA 1EM6A 3THYB 3GBPA 3WLHA 3A1UA 1O8CA 1XD8A 1L8QA 1N5JA 2YN0A 1CQZA 3ANTA 3M3HA 5CH8A 3DOEA 3EXIB 4PAOA 2X6RA 5DE3A 1H0HA 5THKA 2BC9A 4YRMA 1BKSB 1UZLA 1XDWA 3USES 2YZ7A 3KO8A 3AHFA 4PGFA 1EVYA 3TQSA 3UMYA 5IC5A 5LD2C 1O95A 1SCJA 2JK0A 3FNGA 4NATA 4YCSA 3OU2A 4OIMA 2QKYA 1XI2A 2ZANA 3WIVA 2Y6UA 3OQ6A 3UHPA 4CMIA 3AW9A 1XP8A 3HKEB 2V98A 4FIDA 3W6UA 5CEEA 2PWYA 5AFSA 3BFVA 2KLBA 1I6MA 3VYUB 1JKFA 3P52A 4FBGA 1FNBA 1P6QA 2R2GA 1FFSA 2EX1A 4HDMA 1UCFA 1OPRA 2VC2B 1JSZA 3FPBA 4Q7MB 3ZQ6A 1NE7A 3ZCTA 4N5DA 1RJ9B 2XMDA 1DKPA 4IUCS 2YVKA 3OBIA 3P2IA 4UBOA 1C7RA 3SM9A 5JROA 4XOUA 4NH0A 4YO7A 3RT7A 3B1WA 4EVRA 1T2FA 3EE6A 2AMJA 3JQ9A 3L92A 1ZJYA 2PVPA 3O2QB 4K6HA 5GY7A 3GVIA 4MRSA 1H2AS 1VXRA 3V2GA 3FCEA 1Z6YA 2GAJA 5CVTA 3WTCA 2A92A 1TCAA 4DMGA 1P1JA 4JLDA 3M34A 2GCOB 3CLUD 1L4MA 2JEOA 2YYSA 3ETNA 4P53A 1E0SA 3N9IA 2OCXA 2QVCA 3G1TA 3CZMA 3WVNA 3E9ZA 2PQMA 3IQWA 3T3GA 4CIAA 2G5CA 4IEFB 2ZVQX 4HUTA 1SC1A 1L4UA 3N59A 2PAAA 5DHQA 1ONBA 2XYRA 4V38A 2JW5A 5IANA 3JQGA 1YB6A 4I3GA 3QUSA 2AB0A 4B3MB 5DN9A 5IEJA 1U2GC 1RHMA 2E7ZA 4H7KA 3SFVA 4ZPJA 3E3MA 5L95A 1BDMA 2VWPA 2WFZA 4W5WA 3WK4A 2V7PA 3NTXA 4J49A 4JWTA 3N6VA 4KX5A 4D96A 2Y9PB 4A2WA 2GJSA 4RVFA 3F7TA 4EG0A 5L7WA 2CFSA 3I62A 2VTKA 3WFZA 4X61A 3OU6A 5DM1A 4ZMRA 2X3YA 4BQRA 3NYRA 2WWTA 2OHXA 3MGKA 3ETLA 3RM3A 1B74A 2CFIA 2Y1XA 4GE0A 4D44A 4DY6A 1LWNA 5HKAA 5GM1A 3VR3A 3IUYA 5K4GA 3SJ7A 3L6OO 5HDQA 1Z2OX 3M2PA 4JP8A 3GY0A 3JASA 1EDZA 2H9AA 2PQ0A 1ZH4A 2NUAA 3UK6A 3A6KA 3VHXA 4D5EA 4D9CA 1KEEB 2AN3A 3NP9A 4HRXA 4X66B 1XK7A 1YZGA 3A1SA 5A2QA 4DQDA 2E6KA 3T4XA 2RHRA 4G97A 1IN6A 5JCJA 5KAPA 5E1BA 4E6EA 1Y3CE 4KE8A 2G67A 4Z9AA 1Q7CA 3HKBB 2FEOA 3I72A 5LBIA 2R8ZA 2IV7A 5KVQA 4N9QA 4P5EA 2PO5A 2FRDA 4W5HA 3D3EA 3ANMA 3DTYA 4DAOA 2JLUA 3LGAA 3TM4A 1KI2A 2BJWA 1KZYC 2A7QA 2O6LA 3MN1A 2Q9BA 2AE1A 5JLAA 1BVUA 2M32A 2ZXFA 3AY7A 4OHWA 3VU9A 4EDHA 5AO9A 1PJ4A 4MR7B 1I01A 2XUHA 3OZBA 1IULA 3SYNA 2O5CA 1VIYA 4GLBA 2GCGA 1KHHA 1RXYA 1E9BA 2I65A 1V48A 2WHQA 4LS3A 1PWXA 3T06B 4F5DA 4QLAA 1HGXA 3PGJA 5AHWA 2NU9B 3IVMA 1MQ9A 1BGWA 5CB8A 1BCRA 1C3VA 4HQOA 3U49A 3ZUPA 1QHGA 2V59A 2G77B 3GFPA 3H97A 3JQAB 1N5LA 1JKMA 1V0JA 2Q6IA 3K9HA 4HQRA 5IHXA 4RVUA 1OXSC 3P9KA 1NATA 5DHAA 5IM5A 5AOBA 3B38A 4BWVA 2C57A 1SOUA 1RI1A 4WHMA 4XZ3A 2FB9A 3D4IA 4DCTA 2J9ZB 5BN5A 4I1SA 2X3FA 3GK3A 1IE3A 2FW7A 5IN5A 1UOEA 3VM6A 2G08A 1CUEA 4JXJA 2RHTA 3WHIA 1H93A 2Q9AA 1EXNA 1NW4A 1NYLA 1VLHA 2AFIB 1LDNA 1D8AA 2FI1A 2HCTA 2HIGA 3OQJA 5T7BA 3UJCA 3H5LA 4REOA 4H1WA 4U3JB 4RPKA 4Y0VA 3DDUA 2PT6A 3W1EA 1P2VA 4ZT3A 4FHFA 4KAAA 2QZ9A 5E95A 1RD4A 4ZO8A 2A2ZA 4YAUA 3X43A 2DU8A 1GGVA 1TU3A 2PH7A 2Q5OA 4R51A 1Z8HA 4QRDA 4R8MA 1MEEA 1QDEA 3TL6A 4ZANA 3ZS9A 4AYTA 4F85A 4G0VA 4LRXA 3R2JA 5F21A 4XLZA 4Z9YA 3PR3A 2ORWA 3UOAB 1W5SA 5CA1A 1WUTA 1RABA 2WQ6A 3ZWMA 3LQQA 1XKLA 1Z5GA 2EOAA 1Q21A 3C5VA 3PE4A 4MKHA 5EJIA 4ZARA 3RIYA 5DI9A 1VBKA 4O0LA 3T1NA 1J21A 4AN0A 3OQIA 1CY2A 4V0SA 2IW3A 2PD4A 2ZRLA 3JYHA 1W0KA 3PNLA 1UDXA 4YV7A 1G9SA 1W48A 2C61A 3CGGA 4YNBA 4PCLA 2H1FA 2H54A 4ZVQA 4PM4A 5CB4F 3KU1A 2VHJA 4B48A 2JH8A 2WF8A 3VTFA 3WFJA 2G8LA 4LXTA 4ZVPA 1A9SA 2OZLB 3V8RA 4MB2A 6CHYA 1Z5NA 1HLGA 1AGNA 4HVCA 3CU5A 1BS1A 3ZGXA 1I4LD 4YPFA 1K7SN 3UM9A 4D8UA 1HTBA 3L1VA 1WPQA 1YRHA 3EEIA 1PBTA 1OKKA 2EP8A 4JBIA 5KAMA 4BKMA 4D9GA 3PF8A 4CEHB 3DE6X 3FCUB 2FQQA 1NXTA 5DGCA 3O2JA 1VJCA 1N2IA 1TEXA 5ELMA 5IVIA 1KIMA 2ET6A 2DZDA 4IGKA 1I30A 1O4VA 2D1TA 3CPJB 3FWYA 3IAM6 5AOVA 5KI6A 3N2GB 4UM7A 3UA4A 2FUG6 4LJ7A 1U65A 3GCXA 4YRKA 3SYTA 1AG9A 3MTQA 1AF7A 4P3YA 3AVXA 4D9JA 3KWFA 3ZGVA 2YS7A 4K26A 1QQTA 4MS4B 1VMAA 4MS3A 5LB2A 4F2DA 4DA8A 3IQEA 2R96A 2AD5A 1PZXA 2EFCB 4QFBA 5EXPA 2HMSA 1OXMA 2FPXA 1SCAA 2R60A 4CFYA 1XXLA 5AM2A 2C7VA 2N47A 3DMTC 3OEWA 4UUMA 3ROGA 4X62B 2WPNA 3E35A 3PWKA 3L9WA 4BWYA 1Y1TA 3M4XA 2JATA 3ZZ1A 1LVUA 4A8JC 5JQWA 4W5RA 2CSUA 2Q50A 4RFLA 4OATA 4C22A 2AWOA 3VPCA 3VGPA 1KMNA 3VKFA 4FFDA 1L1QA 4RCZA 1OFIA 3VOAA 4JZYA 3RK1A 4DADA 4KSBA 2VA9A 4RJLA 1RM4A 3STVA 2DQZA 2JBAB 1DJNA 1T5IA 2AFIE 2GZMA 2WFLA 5FI0B 1N0VC 1ZO8A 4BLOA 4OXQA 5I47A 1FDIA 2OOSA 1EINA 3O7WA 3ZWWA 5JW6A 1L8XA 1XCOA 3RUPA 5KQMA 2PBFA 2EEZA 4GKVA 3C45A 2HA7A 1IY9A 1P33A 1X2BA 2ATXA 2G04A 2N42A 3AWIA 1H4VB 5HG0A 1RPZA 4FFSA 2P1RA 4H15A 4IJUA 2BMJA 2XKAA 3U81A 4DR6B 3EGXA 5B55A 5BORA 4EELA 3CZPA 3NIWA 4FBMA 4RPCA 1T3GA 1WVMA 4NFLA 4R0MA 4ZHQF 5K8CA 2O59A 4YDQA 1VG9B 1HK7A 3JAKB 4BMYA 1ESEA 1II8A 4RDHA 1CY6A 1UPBA 1RYHA 2PTGA 2D5AA 4QVKA 5I7HA 1YRYE 4OGLA 3GRUA 2W58A 3OOWA 3PUVA 4M4SA 2QD2A 4AD8A 2Z3ZA 1LS1A 3OPYB 3OCWA 3QV2A 3GG2A 2SICE 5AK0A 1PYGA 3GNTA 1DDGA 2HCBA 5CXQA 3QJ5A 1FSZA 3FUTA 3D8SA 2K4MA 4LJSA 3EEYA 2GZRA 1B0PA 3JYOA 4OU5A 3WL5A 3X1JA 4ESEA 1BX3A 2V3CC 4D82A 3W90A 5LC1A 1JNXX 4OPMA 1FP7A 5J1SB 4U7WA 1Q11A 2QJOA 4CE6A 1AZLA 5K0NA 5KVAA 1ODFA 4XFJA 2RDMA 4RQUA 3R0VA 5KX5B 2VTVA 3MINA 1QQBA 1LPPA 4ZYXA 5DWVA 4C3ZA 5B58T 3ZKAA 3KOUA 2HK7A 1X38A 3GJYA 3VNRA 4ENPA 4N8DA 1CULC 5CFNA 3AC0A 5I3ZA 1HM5A 3IR5A 3W2HA 1UBOS 1BHJA 3ENNA 1C30B 1V6CA 1ZGJA 4G5XA 4K6OA 5ENVA 4ER5A 4EKYA 3HCCA 2AF4C 3AVYA 4WKOA 1TAUA 1ECGA 5SZHB 2SHKA 3T4PA 3DEIA 4XVQA 2C29D 2VPWA 5DLQC 5BVHB 4F9GA 3CZRA 1ZVJA 3IEVA 4RDIA 1D4ZA 1J8VA 1QLHA 2B99A 1CUZA 1YAHA 1E5DA 1L7XA 3EDQA 1R0KA 3F6PA 2FPUA 1CQJA 2BFFA 3VO1A 2BE7A 2FX3A 2W22A 4M0EA 4KN5A 4JBXA 3FOFC 1U1IA 4RK4A 4BU1A 2G0AA 1EKXA 3K0FA 1MGPA 1SXQA 3D8TA 1RKXA 4FINA 5ITZB 1YH3A 3OMWA 4LISA 5FA6A 4G4SO 5DVZA 2ZUWA 1CQWA 3R5SA 1EDDA 4KK3A 3AW8A 1COWD 5FI1B 1E0AA 1KDOA 1G0OA 1Z17A 3N8NA 2JZNA 4G5YA 3F2IA 5D6NA 1U8UA 2C42A 3WYCA 5JAHA 3KB2A 4AKHA 2GXQA 4C2TA 2UYYA 3HNRA 1BQ3A 1IQUA 3S0JA 1UT8A 4BGPA 4OM7A 4IDQA 5FL3A 1UF9A 1AA6A 4XWOA 4QQKA 4ZT5A 5FO0A 2ODPA 1E89A 1XJWA 3JY6A 4KO1S 3U6KA 5FOTA 1MPXA 3N5CA 1W36C 3KZMA 3RC3A 1XZPA 2C2MA 1U7XA 4JB2A 1XEAA 1C7EA 1U6IA 4EG5A 1ZZGA 3P8ZA 3IUSA 4HDQB 2FPKA 3U17A 1N2CB 5SYNA 3VHRA 2F3PA 3ANYB 4M1QA 5BW5A 821PA 1VJDA 2OCIA 3R6TA 3K8QA 4EY5A 5L7TA 1ZISA 4YT4A 2HWXA 2IDZA 4WY5A 3DCNA 4B4KA 2E89A 1F9AA 4IIYA 3RU3A 1NVFA 3CFYA 1ZD2P 2V0CA 3QEMA 3S8YA 3N6RA 1IWOA 3N2YA 1WA5A 1DC6A 1Y8CA 4Q9LA 3COZA 3KJGA 4U02A 5EI5A 3GJXC 1TM2A 1YCDA 3CB4A 4HAUA 1LS6A 1UPFA 3EVBA 4ETIA 1VSBA 2NYVA 5T8KC 3KPJA 5KPJA 3EZ9A 1K98A 2CWDA 3CNQS 1D0SA 3KTFA 1PFVA 5SY9A 6YASA 3WLPA 5T4FA 5EWJB 3PRHA 3WMWA 4Y2QA 3UKJA 1MCZA 3HGTA 3JQ7A 4IVRA 5TEVA 3VMFA 1BVYF 3PX3A 3FZYA 3WL8A 1PF7E 2EV9A 3QH4A 3L8MA 1M6YA 1L3BA 1JEAA 3BMXA 3K71B 3KQSA 4BQNA 1W4ZA 5BUSA 1N77A 3S1SA 4NABA 1EP3B 1M2VA 2O3UA 2ZLBA 1V9CA 2ECOA 1PG0A 3ANSA 3C0KA 3BYZA 4HRYA 4MW0A 3TLAA 3T1TA 1B76A 1KQNA 2ZPTX 1II9A 2ZSAA 2J85A 5ARBA 4NHOA 1KZ6A 4Z6KA 4PLWA 1QU2A 4LF8B 2YIJA 3D4OA 2FSVC 3I05A 2Q2OA 4IZIA 5C80A 3G2MA 3I61A 3FKSA 2NXJA 1C29B 4JEIA 3VR2D 3QBTA 2RCYA 3DEKA 4A3SA 4CU2A 1JWLA 2OO7A 5H5JA 3GPLA 2DR0A 3MUNA 4ILKA 4LSMA 5JZSA 1R6TA 2H2IA 3K70D 2Q5IA 4RKWA 3TQIA 2QP3A 2A30A 1EUCB 1M0WA 4YRFA 1KDVA 2HYIC 2Q4BA 3L5KA 4GBMA 3NDJA 2QSZA 3CINA 2Z4SA 2YW9A 1PTKA 4UTXA 1T34A 2NZVG 1DKLA 3M6FA 5KNDA 3CLHA 1UBNA 2DUJA 3GROA 4D9EA 3S5JA 4P2BA 3BWVA 4RJ2A 1RRCA 3QSYA 2ETXA 3ZHOA 1P2DA 4M2LA 1C2TA 1E2NA 3SS8A 2LIPA 4GF5A 5FV4A 4AECA 4X7BA 3MWEA 4E1AA 4QGAA 3SD7A 3U13A 4MPJA 3AU9A 4QECA 1PKXA 4IQ0A 4E70A 3BG5A 4N0DA 3C8ZA 3UUFA 3T95A 2XGMA 4KFRA 4PSAA 3B70A 3MERA 1N2CE 4Y9TA 9GPBA 5LQUA 4JLAA 1HXHA 2Q45A 3O0DA 1TC2A 4D4HA 1WP9A 2UUPA 3M6MD 4M7OA 4XJVA 1NT4A 3SIRA 4D0RA 2ZUSA 3AEQB 3CEAA 4V3BA 1GGEA 4F3RA 1G4UR 4O4IF 1UP6A 4FYXA 4HDNA 4CV1A 1H6AA 4BMZA 3LX6A 1DE0A 4H18A 1G5FA 3KVRA 4PXSA 3QM1A 1E9CA 4JFRA 4NCKA 4RKYA 4RCVA 4UASA 4UDOA 1N5DA 5CXSA 3RIGA 2FWJA 4HPWA 4L2IA 4BEWA 2FZKA 2R7LA 2P78A 4F8EA 3I6YA 2C7PA 3M4NA 2GVDC 3RS8A 1TQDA 1JI0A 2J08A 4YJ3A 4YRPA 3SK0A 4A0FA 3F3KA 5H4HA 2Q1UA 3UJ9A 1HZJA 1IUNA 2BGIA 1H5UA 1UC8A 1Q0SA 3CN9A 4XAQA 1FXWA 1VHDA 3ZGZA 3BRCA 2IQ5A 3SXUB 4YA6A 3BF8A 2P69A 3DMFA 3JQEA 2UYOA 5E7IA 5AW7A 1NURA 2MJLA 2W6IA 5HS6A 2YUTA 3KJNA 3BVPA 3W3AA 3MOIA 1DJPA 3OM1A 4BNXA 1P0IA 1U0NA 4MW4A 2APJA 2HR1A 4X60A 3UWMA 4KH1A 4A82A 4I46A 3SLRA 1XCMA 2WG0A 4EFDA 1IHYA 3MOGA 4H31A 4R69A 3GLQA 5J5VA 2OQVA 1GZ6A 2BFCA 2H00A 3UCXA 2FHSA 3IMFA 5G0VA 3MRVA 2X0NA 3VTKA 3OTQA 5DYNA 1K3TA 2FCAA 2ZUBA 3R9IA 4B0PA 1YTUA 2Q3CA 3L8DA 3O75A 4GMDA 3GLGB 5AJTA 3ZZMA 1AS2A 2ZAMA 2JJ2D 1KXZA 2IYAA 4AICA 3LY8A 2FMFA 2C7OA 1BMDA 5EE9A 3KT6A 1RS0A 3SJAA 3LD9A 5HQ3B 3OA0A 1ZHOA 2O8BA 5LBTA 1O89A 1G8YA 1USIA 4R1NA 4NX2A 4GLOA 3G7SA 3V9AA 2DHQA 1ZGAA 4YRRA 2QV0A 3F3YA 1J0BA 3S40A 3TSWA 1LBHA 2TRSB 2DETA 1WPRA 1R3DA 5B3JC 1K2VN 1M1XB 3I6BA 4JWKA 2Y6VA 5BOVA 4YUAA 5JS7A 4Q1AA 2BLNA 3AOGA 1BS2A 3ZWBA 4E2WA 4ZV4A 3C6XA 4TSFA 2XQVA 1V8OA 3L7CA 4BV8A 1DV2A 3QLUC 2JFFA 5CDHA 3DVSX 2XJ9A 3D0QA 4WA8A 1R88A 2C4VA 2I99A 2Z2KA 1SVSA 3H11B 4XGRA 4F0JA 1XZMA 3KV1A 2PFKA 1YJ5A 2OC9A 5JCZA 2G07A 1U9ZA 2AWNA 2JFUA 4NBRA 4ZPXA 5C8YA 4B3CA 1GNVA 2GBLC 3TLJA 1RZVA 5FBVB 1SNYA 2PGNA 1P1BA 2R8OA 1NBEA 4MIEA 2J9FA 4AP9A 3WJ1A 3AG6A 1ZD3A 3SC3A 1JWAB 2WYIA 3KCQA 1M8KA 1EZZA 3BWMA 3PK0A 1X86B 1FQKA 1FP1D 1P1KA 1P4SA 2B0CA 1G6KA 1S2GA 2EARA 2OBFA 3NANA 3SJUA 4CKEB 2QMQA 4XX0B 3QXJA 4MO9A 4EPVA 1HZZA 1I7LA 2VVTA 1JEEA 1ODJA 3H18A 4FILA 1LY1A 1M67A 5F7XA 3CW9A 1RWXA 4QPDA 4TSRA 1HYEA 5EUBA 5G3YA 2XJ4A 2JK1A 1P2SA 3VFDA 5BNZA 2W70A 3CISA 4LRSB 5IJ0A 1IBSA 2EEPA 5LB4A 4O3FA 3WICA 5BN3A 1DBIA 1JIXA 3V1UA 1P4GA 2WSYB 3GEGA 1RJWA 3HE3A 4US1R 4JOCA 1C7ZA 4G65A 3U4MA 4GMGA 4MS1A 2JAUA 1KDPA 2MSKA 4FHCA 4GYJA 4TTJA 3QSGA 3ZE7A 4O2AF 4Z54A 4NFHA 1PS0A 3EFBA 1M10A 2D5BA 3LCVB 2YJZA 3ZY5A 3LZ6A 3CNBA 5JO9A 5HUJA 4ARSA 4LV8B 1E32A 1A9TA 1AKWA 4HLDA 4XEHA 3UHOA 1A04A 4I81A 2QTZA 3O1IC 1ADYA 2GD6A 1ZL2A 4FR2A 2P6OA 3DB1A 3NMUF 3F8TA 2AI2A 3OCZA 4KIUA 3BDIA 5LA6F 1Z8FA 2CLOB 4RD6A 4WASA 2IYFA 2YHUA 3HDVA 3NWBA 3RC1A 4K81B 4TYPA 5EVJA 4UMDA 2I54A 4NCIA 2FOLA 4JQYA 2G1KA 1AHPA 4KBYA 3GLGE 1KOLA 4M49A 5K3FA 1EK6A 4N3GA 3M9LA 3PUHA 3WLNA 4DSNA 2ZR8A 3SHWA 2BDEA 4Y1EA 4HN4B 1JKXA 5A9SA 4DLPA 5JTUA 4Q7QA 1E4YA 3KUKA 4LNUA 4DJTA 2CUTA 1WCWA 1DKQA 3LO5A 1ADCA 3EVFA 4YAGA 2PUVA 2INGX 3E2PA 3N39C 3ND7A 1XA3A 1K1EA 4F4UA 4F3TA 2FPPA 1U7PA 5HKOA 3PQ2A 2YV3A 1H2RS 1YR9A 4IIGA 4ND3A 2QRJA 4W6QA 3EIUA 3ESRA 3GP5A 3RIXA 4AW9A 4JSTA 4B74A 4CN8A 2QBYB 1GXSA 4N54A 3RFTA 2I8CA 4UTOA 4OLHA 1OFUX 1T29A 2PHZA 1R4MA 5AHKA 3AJAA 4QTYA 1UQTA 1L5NA 4WJLA 1FDRA 1GRQA 1M8GA 2A1IA 4PHFA 4JP3A 4UZSA 1PZHA 1N2EA 4YTEA 4YREA 4E33A 2VRWA 1RXWA 2Z2ZA 4Q7KA 2QY6A 2DPXA 3TR5A 3OZUA 4RTPA 5K20A 13PKA 5IM4F 1ZGBA 1U3UA 1VPEA 2J7KA 2C3PA 3GMDA 4RGBA 3ZGYA 2ODTX 4E14A 3EXEB 1E1CB 1MW8X 1ZRMA 1V39A 4PZ9A 3GPCA 3T5BA 4UAJA 1ISFA 3EQZA 3OWHA 2YNMA 2PT5A 1IWPB 3ZK8A 1XTSA 4K7JA 1P80A 2I33A 1I0IA 1WHSA 1ZAKA 1SY7A 2Z57A 3IXLA 2RHBA 1BN7A 2F3SA 4EHBA 2XMGA 3ET5A 1IXKA 1V47A 2H59A 3I0MA 1F06A 1XMOB 3HZHA 4LZAA 1P2UA 2QX4A 1MQAA 3QXGA 3FD8A 4IV5A 4KV9A 5K3SA 1IUPA 2VWQA 2RGRA 1TYCA 2ANBA 1VE3A 3JR7A 3HABA 2XNKA 4WLUA 5LYJB 3OC0A 4YYZA 1JHMA 4B4VA 1XFAA 4J07A 4DCMA 3P2EA 1E92A 3UGQA 4PINA 5GJVC 5KNBH 1ZJJA 1JFRA 1F2UA 2P79A 2RGUA 5B3KA 3DDSA 4S12A 1XLUA 2NUTA 4D0NA 5DU2A 4EGJA 1A9QA 2FK7A 4JL6A 5KU1A 1RCUA 1X1AA 4LE2A 1RKVA 3WL7A 3BSWA 1KFJB 2YIMA 1UOOA 4CKWA 3NBXX 3WGNA 4A6DA 2P2LA 5L40A 1VL2A 1OJ7A 3S2UA 3CEHA 3NYQA 1YNOA 2G1UA 3TK1A 4RTNA 4AMBA 4FLFA 4UUNA 4C0QC 4RVSA 2HJVA 2IBSA 1EK2A 1UPXA 3AT1A 3Q5GA 5EHGA 5F98A 1U2DC 3PFBA 3ZGNA 4AUKA 3LLCA 1U2GA 3EN0A 1LJLA 5EJMA 1C3JA 1Z56C 3D4NA 1DXYA 4Y1RB 3D31A 5MDHA 4NCAA 4LZLA 1O6CA 4C2UA 3QHQA 1ZM9A 4B34A 1J4AA 4BFVA 3O21A 4MITA 5DNUA 1NQTA 3TTSA 1R5BA 4KOAA 3EZ7A 3GZNA 3ENVA 2I2AA 2QJTA 2W2NA 2YXBA 5D7NA 3STTA 1NPYA 4L8YA 5HZKA 1E2IA 4GVXA 1YR3A 2XA2A 3KX2A 1Y1LA 3E9MA 3S1LA 1ILEA 4Z7NB 2HLHA 4FFWA 4KI0A 1GPH1 3EVZA 1UBFA 4KQFA 4GECA 1W59A 2PVCA 5HCIA 5K0LA 2IBTA 2Q5QA 2FLVA 3L0OA 3FYUC 5DULA 2C1XA 1ZK1A 1HSZA 3AVOA 4PFQA 5GAJA 2W98A 3KE9A 3L84A 2E0IA 1KFKB 3EA5A 2BGMA 3U7QA 1ZDMA 1CQPA 3VR5D 4QGFA 2WT9A 3H04A 3DOHA 3GJ8A 3K31A 1XZQA 5I9TA 3NHPA 3V4RA 3V55A 3WJ7A 1ZVQA 4K0RA 1ODCA 3PZRA 4J94A 4G5OA 1K6IA 1RAIA 2UYGA 4PZUA 5JQGF 3B1KA 4C3UA 1VJRA 1A5BB 2AJBA 3ZHVA 5EJEA 1VLVA 2BI8A 2IDMA 1NKSA 4BC0A 5ICSA 1JT9A 4KMMA 1OWOA 4TMFA 5BYKA 1HUQA 5JYDA 4L4YA 3EDOA 3GAAA 2FGKA 2ZJ2A 3DKVA 3DZGA 3H87A 3HR4A 4QJIA 4EEZA 5A5EA 4XGQA 4P35A 1MW9X 3A6ZA 3VPDA 3JAWA 4E3ZA 1P1HA 4WY2A 3W5CA 1Y82A 3QWFA 3PFWO 4UFNA 4R2HA 1PD1A 3IDZA 1GNRA 1Z6PA 2CE7A 3K9CA 3QE2A 2OV1A 4WIAA 2W6QA 3EWAA 3FCAA 3GDHA 5DIZA 2BY4A 4OGFA 1UDBA 4DJFC 1Y34E 2JIOA 2I6FA 2N1MA 2QI9F 3HNPA 4FDAA 4FNMA 3KKNA 3P0IA 4HQFA 4PQYA 1ZRHA 4RLQA 4TTQA 1J20A 4S1WA 3CUKA 2DBQA 5B64A 4E31A 5LP6B 4C0LA 4LDZA 2ZI6A 3UG6A 3FTPA 3ACDA 3RD5A 3DA8A 4QATA 4AZVA 5BV7A 1X9GA 2QZSA 1KO8A 1TU4A 2LR0A 3PSAA 2JCYA 4O4LF 2O1SA 3TR6A 1V7ZA 3H9EO 2CUNA 1P7CA 1PEDA 2WIDA 3LDAA 1J33A 2O0HA 4IDCA 5LMUB 1VFPA 4BO1A 4EB8A 5A4IS 2P9JA 4C0SA 1PK8A 1ZL0A 1EK5A 3ABOB 3TSCA 4FFOA 4CI0B 4HLCA 3DONA 2H1SA 1PJBA 4IDPA 4NBLA 3RANA 3IE0A 4DEXA 4WMLA 1N7HA 2BR4A 1Y1PA 1OU0A 4B46A 5IFKA 1G5TA 2GZDA 3CUEF 4R2WA 5CDUA 1Y9ZA 1NW3A 3S99A 2VIIA 3ZU4A 1TK2A 1ODIA 4PLGA 1W5AA 2O8NA 1GGJA 2FPRA 2DWUA 1JU9A 2W11A 5AQ1A 3I9V1 3T3DA 1OOEA 3FYHA 5GVRA 2XSZA 3QBVA 3T7KA 2VK2A 4EHKA 1GTMA 5LKRA 3A37A 4KO8A 4ZQCB 3BHMA 3WIOA 1BIFA 1FY2A 5HIAA 4FFBB 5HR5A 1T6ZA 3TJZA 1PW5A 3OJEA 3B9BA 4RU1A 2W6OA 2NTYC 5A4DA 1T9HA 1JKJA 3EX7C 5JXIA 5IH3A 4M1YA 4M1SA 2R6FA 1NVKA 2B30A 3PNYA 4OQZA 3U5TA 3PNKA 3RFFA 5KMGA 2F4VB 2C5LA 4JLPA 1J90A 2QAGB 4O33A 3WADA 1OBOA 1FBTA 4B3JA 3FMGA 5DHPA 1YR7A 1US8A 3K0BA 3LI2A 3NONA 3O8RA 3FUVA 2I2WA 2PZBA 1YKFA 5GIOE 5G1PA 3AHCA 3GNQA 3H2JA 3SS7X 3D64A 3EZLA 3IHKA 3GOHA 2VNIA 4EHDA 1G64A 4YPVA 5KOIA 3L1JA 1UC9A 3HU2A 4MR8B 4FFPA 4HY3A 1ZIDA 3I2KA 3NC4A 5IC6A 4RHCA 1NSYA 2DWOA 3VU3A 2FWIA 4HMPA 1CHNA 1E3SA 4L75A 2PKWA 4CLOB 3Q3CA 2PGXA 4D8WA 2QR5A 1VE5A 3DZBA 5FWXA 1W2HA 1WBJB 2VSOA 4HZUB 4D74A 5GTDA 5BR1A 4ML3A 3EIFA 2X0RA 2ZK7A 1HQCA 1GAXA 2HJ9A 4EX6A 1ZWLA 3JQQA 2AC4A 2GJKA 2YS6A 4ZC8A 4AWAA 4N6OA 3VMMA 3WGMA 2F8TA 4HLUA 4R9VA 4C7MA 4DC0A 3GWGA 3ZJ5A 3DOUA 5ADHA 2MOKA 4BLRA 1CUBA 4E5MA 3JD4A 3OKFA 3O4IA 4XQEA 4KXMA 2BT4A 4BV9A 1DWOA 1Q1GA 2X0FA 1I3CA 4E4YA 1RI3A 4YPOA 5AVYA 1Z5PA 2Y1KA 3HV0A 1CF2O 5ES3A 3WYGA 2CJWB 2LBPA 3DDNA 3B6MA 4G84A 4TVSA 3DYIA 4CDMA 4J1GA 3X1ZA 2R6R1 2LDXA 1CZKA 1TPZA 3WGYA 3WYDA 4KAJA 3SNKA 3HA3A 1F3LA 3IE1A 1VCMA 3SQNA 2JFQA 5C18A 2PZLA 5JRJA 4J0DA 2IVFA 1EPUA 4A4DA 1KIAA 3FCOA 3UKOA 4EM6A 2O8DA 1CU1A 4H3HB 3DR5A 3RJTA 2REOA 1XDGA 2ZS9A 2K6GA 1RAEA 3GLVA 2BM8A 3MB5A 6REQB 3WTBA 1EFUA 5KJCA 1LBTA 2PR2A 2JLZA 1CJMA 3CE6A 4FMCB 3ZHYA 2O8CA 3AFIA 1IJEA 3VPGA 4XR4A 1H2YA 2Y27A 2Z9BA 4NCXA 5BWLA 2IX3A 1QQAA 3D1JA 1E7MA 1D0IA 1P61B 1Z16A 2CL5A 4KDFA 4TRRA 2HFKA 4Z1MD 3PVCA 1E5QA 1QCDA 3RTGA 3CLUC 2C4NA 3OFNA 2YYAA 4C6TB 4LN1A 1WW8A 4K05A 3BK7A 1Y4ZA 2Z8YM 5LMZA 2WLSA 4QQFA 3DLIA 3A2NA 3GRPA 4E4TA 3JALA 4I5GA 1I6KA 4IDBA 3V8PA 4HNAB 2RE8A 4JC5A 2UZ3A 4IH9A 2FDRA 5DX8A 1AXRA 2JIPA 1S01A 5ALXA 1XZ8A 2GRAA 3KB8A 3P2JA 5JZ9A 2HT1A 3UVEA 1XN4A 3WV5A 3OM8A 1H6DA 2D3WA 1U3TA 3N3AC 3RADC 2VEOA 1J7KA 1HE3A 2YH2A 4AX8A 1Z35A 4PG8A 5JH7A 2NZXA 1ESMA 3JYPA 1ZSVA 4M9UA 1D09A 4U63A 4G3XA 4GWKA 4MVWA 4HPXB 5IDVA 3S2IA 3D2LA 2Z1DA 3TTXA 4ERNA 1Y9JA 4OLFA 4E5UA 4BO9A 1YJ8A 3BA1A 1I10A 2OR3A 4UVIA 2CXQA 4C4RA 4KC0A 5FBWB 4BZQA 1I9GA 3IKJA 1T4CB 3NRJA 3TYXA 3FNEA 3IT2A 5BNWA 2WTAA 1N6HA 1K8YB 4JT8A 5GJBA 1MB3A 1UXKA 3GFTA 1KRWA 5KYYA 5KU7A 3ZD8A 1AX9A 5K3EA 2DULA 3F6EX 1HOTA 4R0VA 3WBJA 3GLFB 2UUCB 3A4YA 4MV0A 3RU7A 4UTPA 1PS8A 2FLKA 4L50A 1U1FA 2Q3HA 4WGGA 4DCUA 1G20B 1Q74A 2HHAA 2JHGA 3X1KA 4TZKA 3TJRA 1FYWA 4EPXA 1GR1A 2J3LA 2DHCA 3WBKA 2G83A 1Z68A 5E9WA 4C0BA 1VHWA 1EGHA 3O82A 4R1LA 2JFPA 1KEKA 3ZU6A 1HG0A 2IYTA 1F6DA 1GAEO 121PA 4NDNE 1XIVA 2H5LA 3KZOA 2WF9A 3LHFA 1E98A 5IT9A 4LPKA 4HWOA 1QGZA 1KPGA 1XP5A 1WD7A 1OXVA 4YAJA 4A6EA 4EY3A 1JEYA 4K5QA 4RJTA 2IXAA 2IZZA 1E2GA 1D7AA 1LVGA 3SYLA 5IS2A 4YAIA 1NM5C 5DXJA 2OXFA 2RH8A 5J40A 2PUFA 2CV1A 4F04A 2CNLA 1DJOA 3QHAA 1KFBB 1QIHA 3QFCA 1TUGA 2FAXA 3VOBA 1S2MA 4LEIA 4UUBA 5AKEA 3LX4A 4N7JA 4BE4A 3Q40A 1J9ZA 2IF2A 3UTCA 3CN7A 2GAFA 3QYJA 4JT9A 1HLDA 2WMOB 1OYWA 3PIDA 2V58A 1D07A 2PT9A 4ZOLA 1C3OA 3O4GA 2ZYWX 5A5VA 2O4CA 3I23A 5F35A 3LW8A 1TE2A 1Y3IA 3VR5A 4DQUA 2XCSB 1Z22A 3AKEA 5KCZA 2ICAA 4LZZA 2WG2A 3DFKA 5K3OA 4Y0AA 2VXBA 3QU7A 1CUXA 1FRVA 5CVUA 5JTTA 1ZNYA 2P35A 4FZJA 3ROKA 1R16A 1D1QA 1JAYA 2OENG 5CW2A 4TZ0A 1IHPA 3BQMB 1A2OA 1OAAA 4WADA 4CLDA 1Z6AA 3IKLA 1H8EA 1YR2A 4CEIA 1XHLA 3WAGA 2AKEA 1NMSA 1YL7A 2H7VA 2Q07A 3RC8A 3L05A 1H0SA 1KO5A 1BZYA 4D4LA 1YCHA 1JP7A 1L5OA 2RGAA 2WE8A 1W85A 3EDRA 3NP7A 3A06A 1MIHA 1R6UA 1Q3KA 1VI6A 5ICFA 2O4UX 1RRMA 5HIJA 3PNPA 3TCKA 3LC1O 1K8XB 1MF7A 1VYUA 1DVRA 2AC2A 5CH5A 1WOYA 5A0TA 3I5UA 2QU7A 4YRSA 2G76A 4ZK6A 1YF3A 3O4FA 5B3LA 5D85A 3NTVA 2IPMA 1G5QA 2FF7A 1A1SA 1ZICA 3P4XA 4QULA 1OTXA 2QE7A 3PQ7A 3WZ2A 5LSAA 2AN4A 1FXSA 1F5NA 2JD2A 2OPBA 5COAA 1NE2A 1CP2A 5KOJB 4ME6A 1EE2A 3CLRD 2HU8A 1HLFA 5DK6A 5AM0A 5A5FA 2MYTA 3GRRA 1JHPA 2BISA 1CRQA 2QD1A 1O97D 1Z5OA 2OGSA 3D7KA 3LCUA 4HGOA 4MIYA 4H35A 4NBKA 4OHXA 5ED0A 3GLFE 1HQYE 4O1MA 3SEZA 1FOEB 5AXAA 4DGQA 4IO0A 2ZSHA 5TPZD 1G20E 1L5MA 2X8AA 3W2TA 4G81A 1KY3A 1I0ZA 2CDAA 3ETHA 3HYCA 4ZXPA 5C7OO 3HDYA 3CKKA 3ODPA 3PBKA 4JOSA 4TKVB 3ZQJA 1W29A 1USVA 1XELA 5D3QA 4PLVA 1OZFA 3EPLA 3O73A 3C7TA 1U8EA 1I2BA 5DTRA 3ZTYA 3PR1A 4BYMA 1R6XA 4CF4A 5G0SA 3TLEA 3B5IA 2XKKA 1JDTA 1KWGA 1J07A 2QVZX 4OMUA 1FZQA 2O06A 3GXBA 4XSVA 3G7NA 3O4VA 2VPZA 4X00A 2WV7A 2VA8A 5I9MA 4F11A 4EYSA 5HFNA 2AR7A 3FNIA 2JFZA 4NFYA 1W0JD 1LJ8A 1U11A 2C97A 2H85A 5EPOA 4BY9E 3A27A 3DD1A 1ENOA 2IP1A 2VCYA 2P4QA 3HB1A 3W34A 4HADA 1MMFB 5CB4B 5G40A 3SC2B 3OQOA 4RKRA 3ED5A 2VK8A 3FIUA 1E3WB 1NSFA 2MSLA 4AAYA 5K0CA 4PZPA 3ZW7A 1W19A 4OX9B 4O0MA 3TGPA 1ND5A 3U4IA 1ULAA 3IULA 3BXOA 1AKQA 1OUMA 4M89A 4UUPA 5LWQA 4AC9A 1K6XA 4E5KA 5LP1A 3TSOA 3TCNA 1R8SA