1LSIA

Lsiii (nmr, 23 structures)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
RECYLNPHDTQTCPSGQEICYVKSWCNAWCSSRGKVLEFGCAATCPSVNTGTEIKCCSADKCNTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of LSIII, a long neurotoxin from the venom of Laticauda semifasciata.
pubmed doi rcsb
molecule tags Neurotoxin
molecule keywords LSIII
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1995-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1lsiA00
1B41B 1TGXA 2H64B 1FF4A 2MUOA 2CTXA 1IDHA 1S4YA 2CDXA 1QM7A 4BIKB 3BT2U 1FSSB 1NORA 4OM5A 1CXNA 2MFAA 1ERAA 1QKEA 2QJ9C 1LXHA 4HQPF 1HOYA 2QC1A 1MR6A 2CRTA 2MJ0A 2HLRA 2CRSA 2ERAA 3QB4B 2GOOB 1KBAA 1G6MA 1KBSA 1CDTA 2LA1A 2PJYB 5DZ5A 3NDSA 1IDGA 4UY2C 1L4WA 1H0JA 3HH7A 2CCXA 1TFSA 2VLWA 1REWC 1JGKA 2H64C 1DRSA 5IMTD 1F94A 1LXGA 2PJYC 1FRAA 3EVSC 2MUPA 3NEQA 3VTSA 1V6PA 1XT3A 2H62C 2X8BB 4FAOC 1IDLA 2I9BE 1YWHA 1CDSA 1CXOA 2UWRA 2L03A 1MAHF 5EBXA 6EBXA 1NTNA 3BT1U 1NEAA 1CCQA 1CB9A 2MHYA 1ZADA 1PLOA 4IYEA 1FFJA 1FASA 1ABTA 2NBTA 2QJAC 1NYUA 1NXBA 2JVEA 1UG4A 1F8UB 1IDIA 1QKDA 1CVOA 1KFHA 1RGJA 2H5FA 2H7ZB 3PLCA 3U73U 1KBTA 4LFTA 4EY8B 1W6BA 1TXBA 1HAJA 2LCRA 1I02A 3U74U 2HLQA 5DU1A 1CODA 1CREA 1KTZB 1BTEA 1JBDA 1BXPA 2MJYA 1CDRA 1FSCA 1LSIA 2MJ4A 3FEVA 1IJCA 1ERGA 1JE9A 2QJBC 3ERAA 4RUDA 3KFDE 5DO6A 1CDQA 4FAOE 3KFDI 2H7ZA 1IK8A 2K3GA 4XJJA 1CRFA 1IKCA 1HC9B 2BHIA 2ABXA 2H8UA 1LJZA 2OFSA 3NH7A 1KXIA 2GOOC 1M9ZA 2JQPA 1CTXA 4P7UA 1HC9A 2H62D 1LX5B 2FD6U 4AEAA 1ES7B 1RL5A 1KL8A 3LAQU 4ZQYA 1CHVS 1ONJA 1COEA 4DO8A 1NTXA 2N99A 2BTXA 1KC4A 1IQ9A 1KS6A 2UX2A 1VB0A 4OM4A 4BDTB 3EBXA 1HAAA 5IMYC 2J8BA 2L5SA 1KU6B 1NYSA 4QTIU 1TXAA
chains in the Genus database with same CATH superfamily
1B41B 1TGXA 2H64B 1FF4A 2MUOA 2CTXA 1IDHA 1S4YA 2CDXA 1QM7A 4BIKB 3BT2U 1FSSB 1NORA 4OM5A 4KSNA 1CXNA 2MFAA 1ERAA 1QKEA 2QJ9C 1LXHA 4HQPF 1HOYA 2QC1A 1MR6A 2CRTA 2MJ0A 2HLRA 2CRSA 2ERAA 3QB4B 2GOOB 1KBAA 1G6MA 1KBSA 1CDTA 2LA1A 2PJYB 5DZ5A 3NDSA 1IDGA 4UY2C 1L4WA 1H0JA 3HH7A 2CCXA 1TFSA 2VLWA 1REWC 1JGKA 2H64C 1DRSA 5IMTD 1F94A 1LXGA 2PJYC 1FRAA 3EVSC 2MUPA 3NEQA 3VTSA 1V6PA 1XT3A 2H62C 2X8BB 4FAOC 1IDLA 2I9BE 1YWHA 1CDSA 1CXOA 2UWRA 2L03A 1MAHF 5EBXA 6EBXA 1NTNA 3BT1U 1NEAA 1CCQA 1CB9A 2MHYA 1ZADA 1PLOA 4IYEA 1FFJA 1FASA 1ABTA 2NBTA 2QJAC 1NYUA 1NXBA 2JVEA 1UG4A 1F8UB 1IDIA 1QKDA 1CVOA 1KFHA 1RGJA 2H5FA 2H7ZB 3PLCA 3U73U 1KBTA 4LFTA 4EY8B 1W6BA 1TXBA 1HAJA 2LCRA 1I02A 3U74U 2HLQA 5DU1A 1CODA 1CREA 1KTZB 1BTEA 1JBDA 1BXPA 2MJYA 1CDRA 1FSCA 1LSIA 2MJ4A 3FEVA 1IJCA 1ERGA 1JE9A 2QJBC 3ERAA 4RUDA 3KFDE 5DO6A 1CDQA 4FAOE 3KFDI 2H7ZA 1IK8A 2K3GA 4XJJA 1CRFA 1IKCA 1HC9B 2BHIA 2ABXA 2H8UA 1LJZA 2OFSA 3NH7A 1KXIA 2GOOC 1M9ZA 2JQPA 1CTXA 4P7UA 1HC9A 2H62D 1LX5B 2FD6U 4AEAA 1ES7B 1RL5A 1KL8A 3LAQU 4ZQYA 1CHVS 1ONJA 1COEA 4DO8A 1NTXA 2N99A 2BTXA 1KC4A 1IQ9A 1KS6A 2UX2A 1VB0A 4OM4A 4BDTB 3EBXA 1HAAA 5IMYC 2J8BA 2L5SA 1KU6B 1NYSA 4QTIU 1TXAA
chains in the Genus database with same CATH topology
1B41B 1TGXA 2H64B 1FF4A 2MUOA 2CTXA 1IDHA 1S4YA 2CDXA 1QM7A 4BIKB 3BT2U 1FSSB 1NORA 4OM5A 4KSNA 1CXNA 2MFAA 1ERAA 1QKEA 2QJ9C 1LXHA 4HQPF 1HOYA 2QC1A 1MR6A 2CRTA 2MJ0A 2HLRA 2CRSA 2ERAA 3QB4B 2GOOB 1KBAA 1G6MA 1KBSA 1CDTA 2LA1A 2PJYB 5DZ5A 3NDSA 1IDGA 4UY2C 1L4WA 1H0JA 3HH7A 2CCXA 1TFSA 2VLWA 1REWC 1JGKA 2H64C 1DRSA 5IMTD 1F94A 1LXGA 2PJYC 1FRAA 3EVSC 2MUPA 3NEQA 3VTSA 1V6PA 1XT3A 2H62C 2X8BB 4FAOC 1IDLA 2I9BE 1YWHA 1CDSA 1CXOA 2UWRA 2L03A 1MAHF 5EBXA 6EBXA 1NTNA 3BT1U 1NEAA 1CCQA 1CB9A 2MHYA 1ZADA 1PLOA 4IYEA 1FFJA 1FASA 1ABTA 2NBTA 2QJAC 1NYUA 1NXBA 2JVEA 1UG4A 1F8UB 1IDIA 1QKDA 1CVOA 1KFHA 1RGJA 2H5FA 2H7ZB 3PLCA 3U73U 1KBTA 4LFTA 4EY8B 1W6BA 1TXBA 1HAJA 2LCRA 1I02A 3U74U 2HLQA 5DU1A 1CODA 1CREA 1KTZB 1BTEA 1JBDA 1BXPA 2MJYA 1CDRA 1FSCA 1LSIA 2MJ4A 3FEVA 1IJCA 1ERGA 1JE9A 2QJBC 3ERAA 4RUDA 3KFDE 5DO6A 1CDQA 4FAOE 3KFDI 2H7ZA 1IK8A 2K3GA 4XJJA 1CRFA 1IKCA 1HC9B 2BHIA 2ABXA 2H8UA 1LJZA 2OFSA 3NH7A 1KXIA 2GOOC 1M9ZA 2JQPA 1CTXA 4P7UA 1HC9A 2H62D 1LX5B 2FD6U 4AEAA 1ES7B 1RL5A 1KL8A 3LAQU 4ZQYA 1CHVS 1ONJA 1COEA 4DO8A 1NTXA 2N99A 2BTXA 1KC4A 1IQ9A 1KS6A 2UX2A 1VB0A 4OM4A 4BDTB 3EBXA 1HAAA 5IMYC 2J8BA 2L5SA 1KU6B 1NYSA 4QTIU 1TXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B41 B;  1TGX A;  2H64 B;  1FF4 A;  2MUO A;  2CTX A;  1IDH A;  1S4Y A;  2CDX A;  1QM7 A;  4BIK B;  3BT2 U;  1FSS B;  1NOR A;  4OM5 A;  1CXN A;  2MFA A;  1ERA A;  1QKE A;  2QJ9 C;  1LXH A;  4HQP F;  1HOY A;  2QC1 A;  1MR6 A;  2CRT A;  2MJ0 A;  2HLR A;  2CRS A;  2ERA A;  3QB4 B;  2GOO B;  1KBA A;  1G6M A;  1KBS A;  1CDT A;  2LA1 A;  2PJY B;  5DZ5 A;  3NDS A;  1IDG A;  4UY2 C;  1L4W A;  1H0J A;  3HH7 A;  2CCX A;  1TFS A;  2VLW A;  1REW C;  1JGK A;  2H64 C;  1DRS A;  5IMT D;  1F94 A;  1LXG A;  2PJY C;  1FRA A;  3EVS C;  2MUP A;  3NEQ A;  3VTS A;  1V6P A;  1XT3 A;  2H62 C;  2X8B B;  4FAO C;  1IDL A;  2I9B E;  1YWH A;  1CDS A;  1CXO A;  2UWR A;  2L03 A;  1MAH F;  5EBX A;  6EBX A;  1NTN A;  3BT1 U;  1NEA A;  1CCQ A;  1CB9 A;  2MHY A;  1ZAD A;  1PLO A;  4IYE A;  1FFJ A;  1FAS A;  1ABT A;  2NBT A;  2QJA C;  1NYU A;  1NXB A;  2JVE A;  1UG4 A;  1F8U B;  1IDI A;  1QKD A;  1CVO A;  1KFH A;  1RGJ A;  2H5F A;  2H7Z B;  3PLC A;  3U73 U;  1KBT A;  4LFT A;  4EY8 B;  1W6B A;  1TXB A;  1HAJ A;  2LCR A;  1I02 A;  3U74 U;  2HLQ A;  5DU1 A;  1COD A;  1CRE A;  1KTZ B;  1BTE A;  1JBD A;  1BXP A;  2MJY A;  1CDR A;  1FSC A;  1LSI A;  2MJ4 A;  3FEV A;  1IJC A;  1ERG A;  1JE9 A;  2QJB C;  3ERA A;  4RUD A;  3KFD E;  5DO6 A;  1CDQ A;  4FAO E;  3KFD I;  2H7Z A;  1IK8 A;  2K3G A;  4XJJ A;  1CRF A;  1IKC A;  1HC9 B;  2BHI A;  2ABX A;  2H8U A;  1LJZ A;  2OFS A;  3NH7 A;  1KXI A;  2GOO C;  1M9Z A;  2JQP A;  1CTX A;  4P7U A;  1HC9 A;  2H62 D;  1LX5 B;  2FD6 U;  4AEA A;  1ES7 B;  1RL5 A;  1KL8 A;  3LAQ U;  4ZQY A;  1CHV S;  1ONJ A;  1COE A;  4DO8 A;  1NTX A;  2N99 A;  2BTX A;  1KC4 A;  1IQ9 A;  1KS6 A;  2UX2 A;  1VB0 A;  4OM4 A;  4BDT B;  3EBX A;  1HAA A;  5IMY C;  2J8B A;  2L5S A;  1KU6 B;  1NYS A;  4QTI U;  1TXA A; 
#chains in the Genus database with same CATH topology
 1B41 B;  1TGX A;  2H64 B;  1FF4 A;  2MUO A;  2CTX A;  1IDH A;  1S4Y A;  2CDX A;  1QM7 A;  4BIK B;  3BT2 U;  1FSS B;  1NOR A;  4OM5 A;  4KSN A;  1CXN A;  2MFA A;  1ERA A;  1QKE A;  2QJ9 C;  1LXH A;  4HQP F;  1HOY A;  2QC1 A;  1MR6 A;  2CRT A;  2MJ0 A;  2HLR A;  2CRS A;  2ERA A;  3QB4 B;  2GOO B;  1KBA A;  1G6M A;  1KBS A;  1CDT A;  2LA1 A;  2PJY B;  5DZ5 A;  3NDS A;  1IDG A;  4UY2 C;  1L4W A;  1H0J A;  3HH7 A;  2CCX A;  1TFS A;  2VLW A;  1REW C;  1JGK A;  2H64 C;  1DRS A;  5IMT D;  1F94 A;  1LXG A;  2PJY C;  1FRA A;  3EVS C;  2MUP A;  3NEQ A;  3VTS A;  1V6P A;  1XT3 A;  2H62 C;  2X8B B;  4FAO C;  1IDL A;  2I9B E;  1YWH A;  1CDS A;  1CXO A;  2UWR A;  2L03 A;  1MAH F;  5EBX A;  6EBX A;  1NTN A;  3BT1 U;  1NEA A;  1CCQ A;  1CB9 A;  2MHY A;  1ZAD A;  1PLO A;  4IYE A;  1FFJ A;  1FAS A;  1ABT A;  2NBT A;  2QJA C;  1NYU A;  1NXB A;  2JVE A;  1UG4 A;  1F8U B;  1IDI A;  1QKD A;  1CVO A;  1KFH A;  1RGJ A;  2H5F A;  2H7Z B;  3PLC A;  3U73 U;  1KBT A;  4LFT A;  4EY8 B;  1W6B A;  1TXB A;  1HAJ A;  2LCR A;  1I02 A;  3U74 U;  2HLQ A;  5DU1 A;  1COD A;  1CRE A;  1KTZ B;  1BTE A;  1JBD A;  1BXP A;  2MJY A;  1CDR A;  1FSC A;  1LSI A;  2MJ4 A;  3FEV A;  1IJC A;  1ERG A;  1JE9 A;  2QJB C;  3ERA A;  4RUD A;  3KFD E;  5DO6 A;  1CDQ A;  4FAO E;  3KFD I;  2H7Z A;  1IK8 A;  2K3G A;  4XJJ A;  1CRF A;  1IKC A;  1HC9 B;  2BHI A;  2ABX A;  2H8U A;  1LJZ A;  2OFS A;  3NH7 A;  1KXI A;  2GOO C;  1M9Z A;  2JQP A;  1CTX A;  4P7U A;  1HC9 A;  2H62 D;  1LX5 B;  2FD6 U;  4AEA A;  1ES7 B;  1RL5 A;  1KL8 A;  3LAQ U;  4ZQY A;  1CHV S;  1ONJ A;  1COE A;  4DO8 A;  1NTX A;  2N99 A;  2BTX A;  1KC4 A;  1IQ9 A;  1KS6 A;  2UX2 A;  1VB0 A;  4OM4 A;  4BDT B;  3EBX A;  1HAA A;  5IMY C;  2J8B A;  2L5S A;  1KU6 B;  1NYS A;  4QTI U;  1TXA A; 
#chains in the Genus database with same CATH homology
 1B41 B;  1TGX A;  2H64 B;  1FF4 A;  2MUO A;  2CTX A;  1IDH A;  1S4Y A;  2CDX A;  1QM7 A;  4BIK B;  3BT2 U;  1FSS B;  1NOR A;  4OM5 A;  4KSN A;  1CXN A;  2MFA A;  1ERA A;  1QKE A;  2QJ9 C;  1LXH A;  4HQP F;  1HOY A;  2QC1 A;  1MR6 A;  2CRT A;  2MJ0 A;  2HLR A;  2CRS A;  2ERA A;  3QB4 B;  2GOO B;  1KBA A;  1G6M A;  1KBS A;  1CDT A;  2LA1 A;  2PJY B;  5DZ5 A;  3NDS A;  1IDG A;  4UY2 C;  1L4W A;  1H0J A;  3HH7 A;  2CCX A;  1TFS A;  2VLW A;  1REW C;  1JGK A;  2H64 C;  1DRS A;  5IMT D;  1F94 A;  1LXG A;  2PJY C;  1FRA A;  3EVS C;  2MUP A;  3NEQ A;  3VTS A;  1V6P A;  1XT3 A;  2H62 C;  2X8B B;  4FAO C;  1IDL A;  2I9B E;  1YWH A;  1CDS A;  1CXO A;  2UWR A;  2L03 A;  1MAH F;  5EBX A;  6EBX A;  1NTN A;  3BT1 U;  1NEA A;  1CCQ A;  1CB9 A;  2MHY A;  1ZAD A;  1PLO A;  4IYE A;  1FFJ A;  1FAS A;  1ABT A;  2NBT A;  2QJA C;  1NYU A;  1NXB A;  2JVE A;  1UG4 A;  1F8U B;  1IDI A;  1QKD A;  1CVO A;  1KFH A;  1RGJ A;  2H5F A;  2H7Z B;  3PLC A;  3U73 U;  1KBT A;  4LFT A;  4EY8 B;  1W6B A;  1TXB A;  1HAJ A;  2LCR A;  1I02 A;  3U74 U;  2HLQ A;  5DU1 A;  1COD A;  1CRE A;  1KTZ B;  1BTE A;  1JBD A;  1BXP A;  2MJY A;  1CDR A;  1FSC A;  1LSI A;  2MJ4 A;  3FEV A;  1IJC A;  1ERG A;  1JE9 A;  2QJB C;  3ERA A;  4RUD A;  3KFD E;  5DO6 A;  1CDQ A;  4FAO E;  3KFD I;  2H7Z A;  1IK8 A;  2K3G A;  4XJJ A;  1CRF A;  1IKC A;  1HC9 B;  2BHI A;  2ABX A;  2H8U A;  1LJZ A;  2OFS A;  3NH7 A;  1KXI A;  2GOO C;  1M9Z A;  2JQP A;  1CTX A;  4P7U A;  1HC9 A;  2H62 D;  1LX5 B;  2FD6 U;  4AEA A;  1ES7 B;  1RL5 A;  1KL8 A;  3LAQ U;  4ZQY A;  1CHV S;  1ONJ A;  1COE A;  4DO8 A;  1NTX A;  2N99 A;  2BTX A;  1KC4 A;  1IQ9 A;  1KS6 A;  2UX2 A;  1VB0 A;  4OM4 A;  4BDT B;  3EBX A;  1HAA A;  5IMY C;  2J8B A;  2L5S A;  1KU6 B;  1NYS A;  4QTI U;  1TXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...