1LSIA

Lsiii (nmr, 23 structures)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
RECYLNPHDTQTCPSGQEICYVKSWCNAWCSSRGKVLEFGCAATCPSVNTGTEIKCCSADKCNTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSIII
publication title Solution structure of LSIII, a long neurotoxin from the venom of Laticauda semifasciata.
pubmed doi rcsb
molecule tags Neurotoxin
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1995-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1lsiA00
3U74U 2MJYA 1LJZA 4FAOE 1CXOA 1FRAA 1CCQA 2GOOC 2CCXA 4XJJA 1FSSB 1LX5B 4UY2C 1RGJA 1NEAA 1KU6B 2N99A 1ERGA 5DU1A 2QJBC 1IQ9A 2MUPA 1L4WA 1ONJA 4IYEA 1IDLA 1HAJA 2ERAA 1LXGA 2HLRA 2CRTA 1F94A 1CDSA 2MJ0A 2FD6U 2BTXA 2H7ZB 2PJYB 4OM5A 2QC1A 4QTIU 1NORA 2CRSA 3VTSA 1IK8A 2VLWA 1CDQA 1TFSA 3BT2U 3NDSA 3U73U 1BXPA 1IDIA 1VB0A 1S4YA 1NYUA 1TXAA 1HAAA 1CB9A 2BHIA 1H0JA 3KFDI 3ERAA 1DRSA 2LCRA 1CDRA 1MR6A 2H7ZA 1TXBA 2HLQA 2MUOA 2UX2A 3FEVA 5IMTD 2GOOB 3NEQA 3NH7A 1QKDA 1NXBA 2QJAC 1KC4A 2H64C 3EVSC 1IDGA 2NBTA 2QJ9C 5IMYC 2L03A 1YWHA 4ZQYA 1CODA 1B41B 1IKCA 1CRFA 1ERAA 1KS6A 2CDXA 1NTNA 1F8UB 1CDTA 3LAQU 2H62D 4OM4A 1KBAA 1UG4A 1KL8A 1FASA 1BTEA 2H64B 1RL5A 2X8BB 1COEA 1JGKA 1TGXA 1HC9B 1QM7A 2L5SA 2H5FA 1KTZB 1CHVS 1W6BA 2MJ4A 2JVEA 1JBDA 1I02A 1KBSA 2OFSA 2MHYA 4HQPF 1XT3A 1PLOA 3KFDE 3EBXA 2K3GA 1QKEA 1FF4A 5DZ5A 4BDTB 2ABXA 4BIKB 1CTXA 2UWRA 1HC9A 1MAHF 1ZADA 5EBXA 1CVOA 1CREA 2H62C 3QB4B 1NTXA 2J8BA 2I9BE 1JE9A 1ES7B 1IJCA 1NYSA 1CXNA 3HH7A 6EBXA 1KFHA 3BT1U 4EY8B 1LSIA 2PJYC 4FAOC 4P7UA 2LA1A 3PLCA 1FFJA 1FSCA 4RUDA 2H8UA 1LXHA 1IDHA 1REWC 2MFAA 1ABTA 1M9ZA 1KBTA 2JQPA 4AEAA 1G6MA 1KXIA 1V6PA 2CTXA 4LFTA 1HOYA 4DO8A 5DO6A
chains in the Genus database with same CATH superfamily
3U74U 2MJYA 1LJZA 4FAOE 1CXOA 1FRAA 1CCQA 2GOOC 2CCXA 4XJJA 1FSSB 1LX5B 4UY2C 1RGJA 1NEAA 1KU6B 2N99A 1ERGA 5DU1A 2QJBC 1IQ9A 2MUPA 1L4WA 1ONJA 4IYEA 1IDLA 1HAJA 2ERAA 1LXGA 2HLRA 2CRTA 1F94A 1CDSA 2MJ0A 2FD6U 2BTXA 2H7ZB 2PJYB 4OM5A 2QC1A 4QTIU 1NORA 2CRSA 3VTSA 1IK8A 2VLWA 1CDQA 1TFSA 3BT2U 3NDSA 3U73U 1BXPA 1IDIA 1VB0A 1S4YA 1NYUA 1TXAA 1HAAA 1CB9A 2BHIA 1H0JA 3KFDI 3ERAA 1DRSA 2LCRA 1CDRA 1MR6A 2H7ZA 1TXBA 2HLQA 2MUOA 2UX2A 3FEVA 5IMTD 2GOOB 3NEQA 3NH7A 1QKDA 1NXBA 2QJAC 1KC4A 2H64C 3EVSC 1IDGA 2NBTA 2QJ9C 5IMYC 2L03A 1YWHA 4ZQYA 1CODA 1B41B 1IKCA 1CRFA 1ERAA 1KS6A 2CDXA 1NTNA 1F8UB 1CDTA 3LAQU 2H62D 4OM4A 1KBAA 1UG4A 1KL8A 1FASA 1BTEA 2H64B 1RL5A 2X8BB 1COEA 1JGKA 1TGXA 1HC9B 1QM7A 2L5SA 2H5FA 1KTZB 1CHVS 1W6BA 2MJ4A 2JVEA 1JBDA 1I02A 1KBSA 2OFSA 2MHYA 4HQPF 1XT3A 1PLOA 3KFDE 3EBXA 2K3GA 1QKEA 1FF4A 5DZ5A 4BDTB 2ABXA 4BIKB 1CTXA 2UWRA 1HC9A 1MAHF 1ZADA 5EBXA 1CVOA 1CREA 2H62C 3QB4B 1NTXA 2J8BA 2I9BE 1JE9A 1ES7B 1IJCA 1NYSA 1CXNA 3HH7A 6EBXA 1KFHA 3BT1U 4EY8B 1LSIA 2PJYC 4FAOC 4P7UA 2LA1A 3PLCA 1FFJA 1FSCA 4RUDA 2H8UA 1LXHA 1IDHA 1REWC 2MFAA 4KSNA 1ABTA 1M9ZA 1KBTA 2JQPA 4AEAA 1G6MA 1KXIA 1V6PA 2CTXA 4LFTA 1HOYA 4DO8A 5DO6A
chains in the Genus database with same CATH topology
3U74U 2MJYA 1LJZA 4FAOE 1CXOA 1FRAA 1CCQA 2GOOC 2CCXA 4XJJA 1FSSB 1LX5B 4UY2C 1RGJA 1NEAA 1KU6B 2N99A 1ERGA 5DU1A 2QJBC 1IQ9A 2MUPA 1L4WA 1ONJA 4IYEA 1IDLA 1HAJA 2ERAA 1LXGA 2HLRA 2CRTA 1F94A 1CDSA 2MJ0A 2FD6U 2BTXA 2H7ZB 2PJYB 4OM5A 2QC1A 4QTIU 1NORA 2CRSA 3VTSA 1IK8A 2VLWA 1CDQA 1TFSA 3BT2U 3NDSA 3U73U 1BXPA 1IDIA 1VB0A 1S4YA 1NYUA 1TXAA 1HAAA 1CB9A 2BHIA 1H0JA 3KFDI 3ERAA 1DRSA 2LCRA 1CDRA 1MR6A 2H7ZA 1TXBA 2HLQA 2MUOA 2UX2A 3FEVA 5IMTD 2GOOB 3NEQA 3NH7A 1QKDA 1NXBA 2QJAC 1KC4A 2H64C 3EVSC 1IDGA 2NBTA 2QJ9C 5IMYC 2L03A 1YWHA 4ZQYA 1CODA 1B41B 1IKCA 1CRFA 1ERAA 1KS6A 2CDXA 1NTNA 1F8UB 1CDTA 3LAQU 2H62D 4OM4A 1KBAA 1UG4A 1KL8A 1FASA 1BTEA 2H64B 1RL5A 2X8BB 1COEA 1JGKA 1TGXA 1HC9B 1QM7A 2L5SA 2H5FA 1KTZB 1CHVS 1W6BA 2MJ4A 2JVEA 1JBDA 1I02A 1KBSA 2OFSA 2MHYA 4HQPF 1XT3A 1PLOA 3KFDE 3EBXA 2K3GA 1QKEA 1FF4A 5DZ5A 4BDTB 2ABXA 4BIKB 1CTXA 2UWRA 1HC9A 1MAHF 1ZADA 5EBXA 1CVOA 1CREA 2H62C 3QB4B 1NTXA 2J8BA 2I9BE 1JE9A 1ES7B 1IJCA 1NYSA 1CXNA 3HH7A 6EBXA 1KFHA 3BT1U 4EY8B 1LSIA 2PJYC 4FAOC 4P7UA 2LA1A 3PLCA 1FFJA 1FSCA 4RUDA 2H8UA 1LXHA 1IDHA 1REWC 2MFAA 4KSNA 1ABTA 1M9ZA 1KBTA 2JQPA 4AEAA 1G6MA 1KXIA 1V6PA 2CTXA 4LFTA 1HOYA 4DO8A 5DO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U74 U;  2MJY A;  1LJZ A;  4FAO E;  1CXO A;  1FRA A;  1CCQ A;  2GOO C;  2CCX A;  4XJJ A;  1FSS B;  1LX5 B;  4UY2 C;  1RGJ A;  1NEA A;  1KU6 B;  2N99 A;  1ERG A;  5DU1 A;  2QJB C;  1IQ9 A;  2MUP A;  1L4W A;  1ONJ A;  4IYE A;  1IDL A;  1HAJ A;  2ERA A;  1LXG A;  2HLR A;  2CRT A;  1F94 A;  1CDS A;  2MJ0 A;  2FD6 U;  2BTX A;  2H7Z B;  2PJY B;  4OM5 A;  2QC1 A;  4QTI U;  1NOR A;  2CRS A;  3VTS A;  1IK8 A;  2VLW A;  1CDQ A;  1TFS A;  3BT2 U;  3NDS A;  3U73 U;  1BXP A;  1IDI A;  1VB0 A;  1S4Y A;  1NYU A;  1TXA A;  1HAA A;  1CB9 A;  2BHI A;  1H0J A;  3KFD I;  3ERA A;  1DRS A;  2LCR A;  1CDR A;  1MR6 A;  2H7Z A;  1TXB A;  2HLQ A;  2MUO A;  2UX2 A;  3FEV A;  5IMT D;  2GOO B;  3NEQ A;  3NH7 A;  1QKD A;  1NXB A;  2QJA C;  1KC4 A;  2H64 C;  3EVS C;  1IDG A;  2NBT A;  2QJ9 C;  5IMY C;  2L03 A;  1YWH A;  4ZQY A;  1COD A;  1B41 B;  1IKC A;  1CRF A;  1ERA A;  1KS6 A;  2CDX A;  1NTN A;  1F8U B;  1CDT A;  3LAQ U;  2H62 D;  4OM4 A;  1KBA A;  1UG4 A;  1KL8 A;  1FAS A;  1BTE A;  2H64 B;  1RL5 A;  2X8B B;  1COE A;  1JGK A;  1TGX A;  1HC9 B;  1QM7 A;  2L5S A;  2H5F A;  1KTZ B;  1CHV S;  1W6B A;  2MJ4 A;  2JVE A;  1JBD A;  1I02 A;  1KBS A;  2OFS A;  2MHY A;  4HQP F;  1XT3 A;  1PLO A;  3KFD E;  3EBX A;  2K3G A;  1QKE A;  1FF4 A;  5DZ5 A;  4BDT B;  2ABX A;  4BIK B;  1CTX A;  2UWR A;  1HC9 A;  1MAH F;  1ZAD A;  5EBX A;  1CVO A;  1CRE A;  2H62 C;  3QB4 B;  1NTX A;  2J8B A;  2I9B E;  1JE9 A;  1ES7 B;  1IJC A;  1NYS A;  1CXN A;  3HH7 A;  6EBX A;  1KFH A;  3BT1 U;  4EY8 B;  1LSI A;  2PJY C;  4FAO C;  4P7U A;  2LA1 A;  3PLC A;  1FFJ A;  1FSC A;  4RUD A;  2H8U A;  1LXH A;  1IDH A;  1REW C;  2MFA A;  1ABT A;  1M9Z A;  1KBT A;  2JQP A;  4AEA A;  1G6M A;  1KXI A;  1V6P A;  2CTX A;  4LFT A;  1HOY A;  4DO8 A;  5DO6 A; 
#chains in the Genus database with same CATH topology
 3U74 U;  2MJY A;  1LJZ A;  4FAO E;  1CXO A;  1FRA A;  1CCQ A;  2GOO C;  2CCX A;  4XJJ A;  1FSS B;  1LX5 B;  4UY2 C;  1RGJ A;  1NEA A;  1KU6 B;  2N99 A;  1ERG A;  5DU1 A;  2QJB C;  1IQ9 A;  2MUP A;  1L4W A;  1ONJ A;  4IYE A;  1IDL A;  1HAJ A;  2ERA A;  1LXG A;  2HLR A;  2CRT A;  1F94 A;  1CDS A;  2MJ0 A;  2FD6 U;  2BTX A;  2H7Z B;  2PJY B;  4OM5 A;  2QC1 A;  4QTI U;  1NOR A;  2CRS A;  3VTS A;  1IK8 A;  2VLW A;  1CDQ A;  1TFS A;  3BT2 U;  3NDS A;  3U73 U;  1BXP A;  1IDI A;  1VB0 A;  1S4Y A;  1NYU A;  1TXA A;  1HAA A;  1CB9 A;  2BHI A;  1H0J A;  3KFD I;  3ERA A;  1DRS A;  2LCR A;  1CDR A;  1MR6 A;  2H7Z A;  1TXB A;  2HLQ A;  2MUO A;  2UX2 A;  3FEV A;  5IMT D;  2GOO B;  3NEQ A;  3NH7 A;  1QKD A;  1NXB A;  2QJA C;  1KC4 A;  2H64 C;  3EVS C;  1IDG A;  2NBT A;  2QJ9 C;  5IMY C;  2L03 A;  1YWH A;  4ZQY A;  1COD A;  1B41 B;  1IKC A;  1CRF A;  1ERA A;  1KS6 A;  2CDX A;  1NTN A;  1F8U B;  1CDT A;  3LAQ U;  2H62 D;  4OM4 A;  1KBA A;  1UG4 A;  1KL8 A;  1FAS A;  1BTE A;  2H64 B;  1RL5 A;  2X8B B;  1COE A;  1JGK A;  1TGX A;  1HC9 B;  1QM7 A;  2L5S A;  2H5F A;  1KTZ B;  1CHV S;  1W6B A;  2MJ4 A;  2JVE A;  1JBD A;  1I02 A;  1KBS A;  2OFS A;  2MHY A;  4HQP F;  1XT3 A;  1PLO A;  3KFD E;  3EBX A;  2K3G A;  1QKE A;  1FF4 A;  5DZ5 A;  4BDT B;  2ABX A;  4BIK B;  1CTX A;  2UWR A;  1HC9 A;  1MAH F;  1ZAD A;  5EBX A;  1CVO A;  1CRE A;  2H62 C;  3QB4 B;  1NTX A;  2J8B A;  2I9B E;  1JE9 A;  1ES7 B;  1IJC A;  1NYS A;  1CXN A;  3HH7 A;  6EBX A;  1KFH A;  3BT1 U;  4EY8 B;  1LSI A;  2PJY C;  4FAO C;  4P7U A;  2LA1 A;  3PLC A;  1FFJ A;  1FSC A;  4RUD A;  2H8U A;  1LXH A;  1IDH A;  1REW C;  2MFA A;  4KSN A;  1ABT A;  1M9Z A;  1KBT A;  2JQP A;  4AEA A;  1G6M A;  1KXI A;  1V6P A;  2CTX A;  4LFT A;  1HOY A;  4DO8 A;  5DO6 A; 
#chains in the Genus database with same CATH homology
 3U74 U;  2MJY A;  1LJZ A;  4FAO E;  1CXO A;  1FRA A;  1CCQ A;  2GOO C;  2CCX A;  4XJJ A;  1FSS B;  1LX5 B;  4UY2 C;  1RGJ A;  1NEA A;  1KU6 B;  2N99 A;  1ERG A;  5DU1 A;  2QJB C;  1IQ9 A;  2MUP A;  1L4W A;  1ONJ A;  4IYE A;  1IDL A;  1HAJ A;  2ERA A;  1LXG A;  2HLR A;  2CRT A;  1F94 A;  1CDS A;  2MJ0 A;  2FD6 U;  2BTX A;  2H7Z B;  2PJY B;  4OM5 A;  2QC1 A;  4QTI U;  1NOR A;  2CRS A;  3VTS A;  1IK8 A;  2VLW A;  1CDQ A;  1TFS A;  3BT2 U;  3NDS A;  3U73 U;  1BXP A;  1IDI A;  1VB0 A;  1S4Y A;  1NYU A;  1TXA A;  1HAA A;  1CB9 A;  2BHI A;  1H0J A;  3KFD I;  3ERA A;  1DRS A;  2LCR A;  1CDR A;  1MR6 A;  2H7Z A;  1TXB A;  2HLQ A;  2MUO A;  2UX2 A;  3FEV A;  5IMT D;  2GOO B;  3NEQ A;  3NH7 A;  1QKD A;  1NXB A;  2QJA C;  1KC4 A;  2H64 C;  3EVS C;  1IDG A;  2NBT A;  2QJ9 C;  5IMY C;  2L03 A;  1YWH A;  4ZQY A;  1COD A;  1B41 B;  1IKC A;  1CRF A;  1ERA A;  1KS6 A;  2CDX A;  1NTN A;  1F8U B;  1CDT A;  3LAQ U;  2H62 D;  4OM4 A;  1KBA A;  1UG4 A;  1KL8 A;  1FAS A;  1BTE A;  2H64 B;  1RL5 A;  2X8B B;  1COE A;  1JGK A;  1TGX A;  1HC9 B;  1QM7 A;  2L5S A;  2H5F A;  1KTZ B;  1CHV S;  1W6B A;  2MJ4 A;  2JVE A;  1JBD A;  1I02 A;  1KBS A;  2OFS A;  2MHY A;  4HQP F;  1XT3 A;  1PLO A;  3KFD E;  3EBX A;  2K3G A;  1QKE A;  1FF4 A;  5DZ5 A;  4BDT B;  2ABX A;  4BIK B;  1CTX A;  2UWR A;  1HC9 A;  1MAH F;  1ZAD A;  5EBX A;  1CVO A;  1CRE A;  2H62 C;  3QB4 B;  1NTX A;  2J8B A;  2I9B E;  1JE9 A;  1ES7 B;  1IJC A;  1NYS A;  1CXN A;  3HH7 A;  6EBX A;  1KFH A;  3BT1 U;  4EY8 B;  1LSI A;  2PJY C;  4FAO C;  4P7U A;  2LA1 A;  3PLC A;  1FFJ A;  1FSC A;  4RUD A;  2H8U A;  1LXH A;  1IDH A;  1REW C;  2MFA A;  4KSN A;  1ABT A;  1M9Z A;  1KBT A;  2JQP A;  4AEA A;  1G6M A;  1KXI A;  1V6P A;  2CTX A;  4LFT A;  1HOY A;  4DO8 A;  5DO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...