1LSJA

Crystal structure of the e110q mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVQNLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the E110Q Mutant of L-3-Hydroxyacyl-CoA Dehydrogenase in Complex with NAD
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1lsjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lsjA01
1EVJA 4GVLA 4NQZA 3VTFA 2ZJ1A 3VZPA 5L95A 1KVRA 1LLQA 4IDGA 1WPQA 1E1KA 1ZK3A 1TI7A 2B4QA 2CSUA 4F6LA 2JJYA 1JA9A 3JYPA 1UP6A 3JQAA 3U4CA 1I33A 1PR3A 3WMXA 3BMQB 5KTKA 2O7SA 4YBZA 1H9BA 1KETA 3I9MA 3BYZA 4JIGA 3BMCB 3EK2A 3F46A 3HFSA 3GOHA 4BV8A 1QORA 2YHIA 5A1TA 1U7TA 1WXDA 3OSUA 1HZJA 3C1AA 1E6EA 3O9ZA 5BSHA 2ZYAA 4G5HA 5JW6A 5A9SB 2ZQYA 3HFGA 3H65A 4L74A 4KUGA 5DP1A 3ZHZA 1PZGA 3QWBA 4II2A 4ZQHA 4MP6A 3A1NA 4KOAA 2B0JA 5TF4A 4IIVA 4B8WA 4URFA 4M89A 4H16A 3ROPA 3T4EA 5GMOA 1EMDA 4K1LA 1KVTA 2CY0A 2G82A 1ZO8A 5CP8A 4HADA 4GMGA 4YWJA 1HLDA 3VPGA 4XR4A 1DIRA 4AJ2A 1L7EA 1P45A 1DIGA 5LCXA 3K96A 1B3BA 1R0KA 4S3MA 3RJ9A 2PK3A 5FI5A 1Y8RA 1SAYA 4HUJA 3IJRA 2P5YA 2GN6A 3LSYA 1P9LA 2OP1A 3OP4A 1GZ3A 3GDFA 3KRTA 2UUPA 4OSOA 1ZKMA 3H8VA 1MXFA 1A9YA 2W4QA 3K9QO 3LVFO 1KS9A 3F4LA 4YTEA 4DYVA 1M6HA 4ZRNA 1V3TA 2NUAA 3ENKA 4PZCA 2Q46A 1YVEI 5TLSA 5FI3A 5I7FA 1XG5A 1GZ4A 1BMDA 1U2GA 3W8EA 4E21A 4HXYA 2YQ4A 2A94A 4F46A 4CLRB 3AY6A 4CL3A 2C7VA 4WEQA 4WGGA 1IZ9A 1ULUA 2X5JO 1JKFA 3Q1LA 1NPDA 4FFLA 1BXZA 1B2LA 3ULKA 3A28A 5G4LA 3DL2A 3DBVO 1ZMOA 1G0OA 1VL8A 3KYCB 3H3JA 3C3XA 2YJZA 3A9WA 1NVGA 2PZJA 1SEPA 1JTVA 2EIHA 3KV3O 4RGBA 2W2LA 5TSDA 3VKVA 4YT8A 4AJOA 4CLOA 3ITKA 5CEJA 1RPNA 1EQ2A 4ONEA 1EUCA 1PR9A 5A9RA 3DEYX 4WK6A 1V0JA 3WFJA 3GRKA 3TJRA 1QR6A 3WB9A 1DFGA 2C82A 1PS9A 4KP7A 3ZU5A 2X0RA 3DBRA 4J7CA 4E5PA 4XGIA 3GDOA 1QV7A 3QQPA 1YWGO 1Q1NA 1MC4A 8ADHA 4Z6KA 1KC3A 3MJ4A 5H81A 2OP0A 4DRYA 1ZEJA 1C1DB 5I8WA 1VSVA 3GZNB 3ZWAA 2GZ1A 2AG5A 3JQFC 4IDEA 1P31A 4I08A 4BNTA 3HB5X 2C54A 3O4RA 1NNUA 4Y67A 1XA0A 3W8FA 3GEMA 1LC0A 4PLFA 2XAAA 1IHXA 2Y67A 4OQYA 5CG1A 2EW8A 3GFGA 2P5UA 3TL2A 4B4OA 2AG8A 2H9IA 2AXQA 3DBLA 3FWZA 4BO6A 1UP4A 4J4TA 3PI7A 1FMCA 3ZI0A 1QSGA 3JQBC 2DVMA 1RM0A 1LI4A 4YAGA 5CDGA 4LRTB 3V2UA 3W8DA 3ZWYA 3DAGA 4MKXA 1A9ZA 1I2BA 3WNVA 4KQXA 4BOYA 3ZNOA 3PJEA 1ZCJA 3HDQA 5TX7A 2DM6A 2EHDA 2DPGA 5FFFA 4WCFB 4EZBA 3ONEA 4RVFA 4WLNA 4OXKA 2V65A 4C7KA 5AVOA 2ZJ0A 4JLWA 1KOLA 1WZIA 5FF9A 4TVBA 5KNLA 4CQMB 4QX6A 4BNHA 4BO0A 1ZJZA 5A5EA 2W98A 3I9JA 4MVJE 4YJGB 1YO6A 1DIBA 1SNYA 2CZCA 4J2HA 1AN9A 2CVQA 3NRCA 1Y1PA 4FQ8A 4J0FA 4CMIA 4OKIA 3I9KA 4P22A 3GN1A 4NFHA 2HJSA 1B15A 4CV2A 4IPTA 3UCEA 3WGHA 4K26A 1Y8QB 2Z5LA 1MG0A 1HETA 4R51A 1XQ1A 4DXHA 2C59A 2A35A 1E3SA 3HN7A 3AI3A 3E48A 4XJTA 5BSGA 5IF3A 2EKPA 2WEKA 3L4SO 4NJOA 4PGFA 3GN2A 1DIAA 2AEJA 4R69A 4W9NC 1P1KA 3EUWA 1VL0A 5HBRA 1NWHA 4XQ9A 4EUEA 4M54A 4HX5A 1Y9EA 2GN9A 4BB5A 3FN4A 1FJHA 4J1QA 3AUTA 3T4XA 4J9UE 1DDOA 1BHSA 2Y1DA 1YONA 2EEZA 1N2SA 5JDIC 2GN8A 2RHRA 4OOEA 4DREA 2CD9A 3PHLA 1RYDA 4UEOA 1X7HA 3B1KA 3DR3A 4O6VA 3PGJA 3WSVA 4WLFA 1IHYA 4BMVA 1K2WA 1X1EA 4RF3A 3QVWA 4I5EA 4ALJA 2O2SA 3F6YA 3OQ1A 4PG5A 1HL3A 5IDYA 3D4PA 4KTTE 3ST7A 4YJHA 7ADHA 2POQX 4PLWA 5F21A 2VWGA 5MDHA 3QWIA 1B7GO 3WX0A 3NT2A 5T67A 5C5IA 4ZVVA 1YBMA 4DQXA 4U0JA 3N7UA 4LCJA 4Q3AA 3FSRA 4UUMA 3ITDA 4Q3EA 5H82A 1T4BA 3AOEA 4GX0A 5JAQA 1AHHA 4GSKA 5T57A 4CMGA 2DUWA 2FRDA 1F14A 4GX5A 4K9DA 3WIDA 5KJCA 1ADBA 3AW9A 2ZB4A 4FOOA 1A7AA 1W4ZA 4CL8A 4WLVA 1IB6A 4B7CA 1EBFA 3H5AA 4R5HA 3GA0A 2VHWA 3DFZA 4OM8A 2HU2A 3R1IA 3R0IA 3ANMA 3K73O 4Z9YA 4B4WA 1NM5A 5TIIA 2PKRA 4BNXA 2I6TA 3D64A 2NSDA 4LSMA 4YJGA 1BG6A 2BHLA 3QE3A 4IDDA 1S7CA 1SBYA 3OHSX 3MWDB 1GYQA 2Y99A 2DFDA 2OORA 1GR0A 4Z9FA 5A03A 3RUFA 4P4GA 1VJ1A 1E77A 2WD7A 1Q2XA 2XOXA 2IE0A 3TOXA 1LBEA 4JN6B 4MVJF 4A73A 2W8ZA 1T2AA 1U28A 3ANLA 3D1LA 3P2YA 4HFRA 4I5DA 2P9GA 4WEOA 4A10A 3PZRA 2Y68A 2CFCA 2PWZA 2C07A 5A3JA 1BVUA 3ZH2A 3QWHA 4IDBA 3ZDFA 1TT7A 3OH8A 4TRNA 2YFQA 4D3SA 4YPOA 2JHGA 3LZ6A 2OL4A 4P4LA 5JAZA 3F5QA 3A06A 2YHIB 4CQMA 3CH6A 4MDHA 2FHSA 3I6IA 4N7RA 3F1KA 1MA0A 2I66A 1YKFA 3FPLA 1A7KA 3SBOA 2NLOA 4R9SA 4W7HA 4MVJM 4LN1A 1GCUA 5AXCA 3GRPA 2FOIA 1K6IA 5EERA 3O38A 4PLHA 4WECA 3SLKA 5B1YA 4OXNA 1HDGO 1Z82A 1GUYA 4WCFC 1DLJA 3HJAA 3ZWXA 1KVUA 4XX0A 4A27A 3JQ9A 4M86A 4FGWA 3E5MA 1NQTA 3GVCA 4E5NA 2IEDA 5A5FA 2WM3A 2B36A 4TKMA 1Z7BA 5JFOA 1E1LA 1UXHA 5CHEA 1E92A 4JQCA 4ZGWA 1GQYA 4OYRA 2X9VA 2EJWA 3ZWVA 4CLRA 4J7XA 3MOGA 2FZEA 2ZB7A 4W6ZA 2Y1OA 4GH5A 1XWFA 3W1VA 1WAMA 5EL0A 3IKTA 4BGEA 2PZKA 1ZSNA 2H5LA 1PJQA 1UDAA 3DHNA 1U7HA 1VM6A 2PZLA 3IS3A 4PZDA 2EP7A 1R6DA 3QJ5A 4OOFA 4BL5A 1X7DA 2H6EA 3D3WB 1V6AA 1YS4A 4A0SA 5CEFA 1V3VA 5LC1A 2OO5A 4E3ZA 1RM5A 1O0SA 4XYLA 3VH1A 2EWMA 4BIIA 1UZLA 4AJNA 3PGXA 4EUHA 2OXIA 1QYVA 1YH3A 3NT4A 3WGTA 4BO9A 4TSKA 4JGBA 1HZZA 1KBZA 2DTDA 1KEUA 1JN0A 1RM3A 4E31A 1EUZA 2B4RO 3NEPX 3QW2A 7MDHA 3CPSA 1E7RA 2HLPA 3UXYA 3NJ4A 1NHGA 2HMSA 3NX4A 4BNJA 3M1AA 1JVSA 4Z0HO 3UVEA 2YZ7A 4JBIA 3FI9A 1UXJA 4A03A 2WYUA 2OMEA 1OFGA 2FZWA 3H5NA 4QT0A 3CUKA 3IDSA 5B37A 1IYZA 5B4VA 4GAEA 2QW8A 2P9CA 4CV0A 2DU8A 4EDFA 4DMLA 4DLAA 4E5MA 3I6QA 1H6AA 4YA6A 3LYLA 1A27A 1ZK4A 3QHAA 3DDNA 3IIEA 3P2OA 4YVFA 1YDEA 5L3ZA 3TPCA 1OC4A 2EKQA 5HA5A 1SB9A 4CM5A 4IZHA 5TT0A 5I7VA 2VHYA 3WYEA 4GLOA 3QA9A 1A71A 2JAHA 1PJSA 3NT5A 3C8MA 1E1NA 3HHPA 3RKRA 1UXIA 2IEBA 4LCEA 2A9FA 4XQCA 1B26A 2ZYDA 3GNSA 4YXFA 4L8VA 3F9IA 1UDBA 1D3AA 2PGJA 5F1OA 4HNGA 2B83A 4HP8A 4PG8A 2W2KB 4MP3A 4MVJP 2X6TA 3E1KA 2O48X 3RU7A 1GYRA 3WYCA 3LK7A 2DKNA 4BNIA 1W73A 3E6AA 3UAGA 2DC1A 4BKOA 2EKLA 4UVDA 3Q9NA 5CG2A 4ND4A 1HSOA 5HS4A 1Z7EA 9LDTA 1JKJA 3F47A 1K0UA 4ZHSA 4RF2A 4CMCA 3ICPA 4CM9D 3KXDA 1GQQA 2P2SA 4XRGA 2HRZA 2NADA 3HDJA 1PZHA 4Z9XA 3NYWA 3RI3A 1MFPA 2V7PA 4UVIA 4CLEA 3OJFA 1NR7A 3ZV5A 5JCXA 1MC5A 3T7CA 3IUSA 1FDWA 4OH1A 3FTNA 3TF5A 4JJIA 3H9JA 3CSDA 1AXGA 1HKUA 2IZ0A 1ZFNA 3RFXA 1EEHA 2VHXA 4BNVA 1ZBQA 1EE9A 3BTOA 3ROMA 3PK0A 4A2CA 5G0WA 1YGYA 2QIOA 3I3OA 1LQUA 5JC1A 1PWXA 4MO2A 2BELA 4R01A 4R41A 3PFWO 4CM9A 4H7PA 1EK6A 3SJUA 3NGXA 3CIFA 3WGYA 1E7WA 4Y9DA 2D3TA 4D3FA 1DAPA 4A5OA 3RC2A 5F1PA 2YW9A 4ND3A 1GTMA 2BH9A 3OA2A 1FDSA 4A26A 3MJTA 4IQGA 4F45A 3EC7A 3GT0A 4JP3A 3DZBA 4JX8A 2D5AA 4W4TA 2I3GA 3OETA 3O8QB 3Q2IA 2X7HA 3VC7A 2QG4A 3FWNA 2VNSA 4G2NA 1F8FA 4XEHA 2HK7A 3GFBA 4YJHB 2BD0A 3E9NA 3TRIA 3DHYA 3I4CA 4JROA 1EDOA 1M6WA 1KY5A 1NQAO 3RJ5A 2HK8A 3ZHBA 4L4RA 1FXSA 4DWVA 4RV9A 3KZVA 2VYND 1SOVA 4DIBA 2QYSA 1PGOA 4R3WA 3EYWA 5CFZA 2AW5A 1W0CA 3JD3A 1XR3A 2E37A 5T6BA 1LC3A 3G79A 5TGDA 2PD6A 4EUFA 3LQFA 4ZICA 6LDHA 3D0OA 5I9LA 2EW2A 4AG3A 4CM7A 5BSFA 2R2GA 4PLYA 5L4SA 1ADCA 3JYOA 3HDHA 1WDMA 2O4CA 3ZN2A 3S2FA 5K6AA 1E7SA 1VC2A 5DOZA 3TZQA 2C20A 1I2ZA 1E5LA 3CZRA 3K8ZA 5A9SA 3IC5A 3MTGA 1E7QA 2X86A 3JQCA 4YQZA 4JBGA 1N1EA 5CDYA 5ILGA 1NVTA 1JDJA 1D4FA 1YQDA 3IOYA 3Q6IA 3HSKA 3TQHA 5AQ1A 1X13A 5C7IO 1L1FA 4FCCA 3F1LA 2FSVA 4JBHA 5HWSA 1P3DA 3IKVA 5EN4A 2ZKLA 2EGGA 4ZJUA 5K9ZA 3JQ8B 2OUIA 1DJQA 1T1SA 1AGNA 2DFVA 4IXTA 4BGIA 3G1TA 3W6ZA 1CDOA 1DRVA 5ENDA 3RC1A 4YT4A 3PHJA 5IDWA 3TFOA 2YDYA 4BQRA 4PIVA 1DBVO 3PXXA 1ZK2A 1QYDA 1PTJA 2C2XA 3D7LA 3HQ4O 1Z6ZA 3GF4A 2PH3A 1LRJA 2JD1A 1PS8A 1BW9A 3G0OA 2VT3A 1C3VA 3OIDA 4LSWA 4FFNA 3FCOA 3LC7O 4PVDA 4IMPA 2A92A 1PZEA 3TOZA 1B3RA 4J0EA 1NFRA 3EVNA 2UVDA 3WQQA 3ZNQA 2QZZA 4IS3A 2J3KA 1KIFA 1UZNA 1R4MA 4D46A 3EAGA 1YQGA 4EEXA 1LNQA 3PIIA 4XR9A 3S2GA 1UXKA 3O8QA 3GK3A 4IS2A 4BUCA 1LDNA 4YT2A 3NJ8A 3SXPA 1AXEA 4YAKA 3OJEA 3WFIA 4I1IA 1GFSA 1HDCA 2EV9A 3RC7A 1XLTA 2YV1A 4TQGA 3GG2A 5K6AC 4HV4A 5KOIA 1NAIA 3QY9A 4UVGA 2QQ5A 3DMTA 3X2EA 3KSDO 2VRBA 2XXBA 4I5FA 4WUVA 1ONPA 3HWRA 4FPXA 5DNAA 1T24A 3BIOA 5KVQA 1VI2A 4QUKA 1QMGA 2PTGA 2Q45A 1ZW1A 4FGSA 4EW6A 2Q4EA 2Q2VA 4B7UA 5ADHA 5B4TA 3NDJA 2EJVA 4OSPA 4EEZA 4MVJG 2VOJA 1EQUA 3V2GA 3B1FA 3ADOA 3WGIA 2EGHA 3INTA 1VSUA 2GERA 2JCXA 3HB4X 5F3RA 4R4JA 3EGOA 2AQKA 3N58A 4LK3A 1Q0LA 3KVOA 2B5WA 3RUDA 5ICMA 4J49A 3FNHA 4LMRA 4W9NA 4AJKA 4BGUA 3QIVA 1LSOA 3LC1O 4JP2A 4CQMD 2D2IA 4NK4A 4RVGA 4Y8VA 2AEMA 2NQTA 3GHHA 4MP8A 2E4AA 1Q7CA 4XKJA 5DT9A 2VZ8A 3RQSA 3C24A 4PCVA 1C1XA 3VOSA 4CM3A 4GGPA 4MIOA 3ONDA 5U4QA 2UUOA 9LDBA 6ADHA 5DCWA 4RVDA 1FDUA 1LQTA 4MOWA 5H83A 1EZ4A 1NTOA 1GQ2A 2GLXA 3QVXA 3NTQA 4YYZA 1R66A 4G65A 1PGQA 4JCOA 2ZQZA 3OA0A 3I9NA 2YQ5A 1SC6A 1LDMA 2TMDA 4ZA2A 1CWUA 4GSLA 1GUZA 3FF4A 4Q3BA 2RIRA 3L6EA 5EQFA 3UGKA 5KVCA 1YL7A 2V6GA 2C2YA 4YRAA 2GUGA 4QO8A 3PJGA 3ICCA 4AFNA 1LA2A 5T5QA 3WLFA 4K6FA 1NX6A 1PSDA 1VL6A 1U4SA 2JHFA 3L0DA 4PLPA 4FR5A 5CEEA 4NBTA 3K6JA 2FN7A 1PZFA 5L9AA 4DGSA 4CM4A 3VH4A 1YXMA 4MVJH 5L51A 4PRKA 3P5SA 3CMMA 2PKQP 3RFTA 4NBVA 1EK5A 4BNKA 2GASA 3EDMA 3TZHA 4WOKA 5A9TA 4CMAA 1GL3A 2PR2A 4OXYA 1MUUA 2NU9A 2CDCA 2Y1GA 4Y6SA 3DZGA 4XGNA 4IUYA 1R16A 4CMKA 1AHIA 3JQ6A 4DIFA 4D41A 5TJHA 2WE8A 2O7QA 3TZCA 1N8KA 4XGKA 2Q1WA 3ZHXA 1IL0A 1YJ8A 1R4MB 1X1TA 2PFGA 2O3SA 1X15A 4DYDA 3IP3A 2X0JA 3VPFA 2YFHA 3L6OO 5KWEA 4YT5A 3ZU3A 2NWQA 2ZB8A 5DN9A 1IE3A 1QYCA 3AK4A 2GCGA 3KOUA 5JLAA 1MXHA 1NR1A 1JAXA 2NVUB 2PV7A 2G1UA 4RPHA 5L40A 1PL7A 2IZZA 1PGPA 1T26A 5L4LA 1GZ6A 1K3TA 2NQ8A 2UAGA 2WDZA 3SLGA 5JYDA 3PWSA 5TS3A 1C0LA 1ZH8A 2AQIA 4XIJA 4CR8A 3AI1A 1C0PA 1NPYA 2WE7A 3MJCA 1QLHA 3MCVA 2G5CA 3QSGA 2G17A 2AA3A 3DOCA 3FNGA 1O6ZA 3ADPA 2DPHA 3OJ0A 4NU5A 5KIAA 5GZ3A 2Q99A 3WXBA 2UDPA 3PJFA 5G2OA 3R3JA 4XYBA 3GMSA 3M2PA 1T2FA 1R37A 1IOLA 3HUDA 1QKIA 3GVXA 2P4QA 4FFOA 2Y0DA 3FHLA 5U1PA 4F3YA 5IZCC 1I8TA 1RKXA 4LVUA 3AWDA 5EPOA 1P33A 1UH5A 1IY8A 3WOHA 4GI2A 3AOEC 1X14A 2HJRA 3BHMA 4FIZA 5ITVA 4P4NA 1VJ0A 5JO0A 3GNTA 3GPDG 1TEHA 3MJVA 4NBRA 1BGVA 1D1TA 1LRKA 3DC2A 3WLEA 4B4UA 2NM0A 3OM9A 2ZIZA 3DBLB 3DQPA 4TKLA 5JPIA 3GZNA 3UCXA 4CJXA 3EW7A 3JQAD 3GVHA 2PD3A 3LT1A 1X7GA 4TZTA 4P38A 4J16A 4MJLA 4GKVA 1GUFA 2JL1A 4CUJA 3G3EA 4U7WA 4UEKA 4UVHA 3WQRA 4DTIA 3TDKA 1E3JA 5EINA 1KVQA 4OMUA 5JCJA 4BQPA 3RIHA 2UYYA 2XPCA 3ETGA 3AI2A 5AXDA 4CLHA 5I9MA 2IRWA 3FRJA 3UKOA 4BKQA 1DHRA 3L9WA 3ZWCA 3E82A 1HE4A 1PJLA 1LLUA 2D4AA 3GPIA 3OEYA 1M76A 2XF8A 3C1TA 5ES3A 4BNNA 4XRRA 3C7CB 3O26A 4RZHA 1I2CA 4Q3NA 4E2YA 4UREA 4ZD6A 1YL6A 3PVZA 1Y8QA 4BKPA 1GAEO 1Z74A 4CMJA 2HO5A 2E6UX 1XYGA 1BVRA 4RDIA 4BGVA 3FR8A 4KUHA 2J3HA 3KETA 4ND2A 5F5NA 2HRBA 2QHXA 2JKVA 2IYPA 2VN8A 1ZVMA 4S1VA 3KYDA 3U9LA 2NTVA 1KY4A 1R12A 1BRMA 1JKIA 4RF4A 1QYWA 1J4AA 3E9QA 3L4BA 3NAQA 3ZWBA 4QFDA 4K6CA 2W90A 4QTZA 1P1FA 1ZK1A 3KYBA 3LF1A 4M8SA 3HNPA 1P1IA 5EMHA 2YUTA 3EZLA 2WSBA 4GLLA 4INAA 1A4IA 1LDYA 5A3VA 3JD1A 3JV7A 3RU9A 3GAFA 4IZIA 1KEPA 4BMSA 5TC4A 2BMAA 3V2HA 1ML3A 1O8CA 3QRWA 4D45A 3LF2A 4MPDA 1LDGA 2C5AA 4CLDA 1MP0A 1PGNA 4IJUA 3IJPA 2BFPA 2ZTMA 2DQ4A 5IJZA 4KWHA 1M66A 1H94A 1UZMA 1YDWA 1DLIA 3MZ0A 2Y05A 3OJOA 3PTZA 1LTHR 4GPD1 1MGOA 2PGLA 3WDSA 2V6FA 3G17A 1LLCA 2BRUA 2AQHA 4M87A 4QEDA 3WGQA 3BMCA 4DC0A 2XXJA 1DEHA 4GL4A 3W6UA 1LDEA 2BGKA 2G0TA 1YOVB 3WJ7A 3JSAA 2H63A 4TRRA 4IGFA 3RVDA 4D3DA 4NZ9A 3ENNA 1N7HA 4JNKA 1EBUA 1S6YA 5DCUA 5AXBA 4C4OA 3ZWNA 4ALNA 3B70A 1I3KA 1T4DA 1AUPA 1LSUA 5FEUA 1WZEA 1K5HA 4O63O 2B5VA 3ZV3A 2R00C 2X9GA 3ANNA 3DBHA 1N9GA 1ISHA 2VWQA 4WASA 2O3UA 1OZAA 1XHLA 3WBBA 2VWPA 1MB4A 4OHUA 4RJTA 1PQPA 2GYYA 4E32A 2Y1EA 5C7LO 3BMNB 2Q1SA 2ZTVA 1N7GA 4GKBA 4DLBA 3U3XA 3ETEA 2CUKA 2E82A 2HUNA 2I67A 2FPIA 1LX6A 1ZJYA 2WMDA 4L76A 2GZ3A 5IN5A 3NUGA 2NACA 3D3EA 3C1OA 3UICA 4GX1A 2GPTA 1HXHA 3DO5A 1DPGA 2Q50A 3JQBA 3GLQA 4FFMA 3RD5A 5J23A 4ND5A 4TRMA 5EESA 3PJDA 1GEEA 1OOEA 1OAAA 4OKNA 2BFMA 3RUCA 1MLDA 1T1RA 3VDRA 1PS0A 4CM4B 4K28A 2O3QA 3K92A 4CM1A 4UAGA 3LLSA 5G4KA 3ROQA 3EY4A 4WJZA 3KBOA 5L7TA 2Y93A 3VTZA 3JD0A 2NVWA 2BGMA 2P91A 4N5NA 4YRDA 1UP7A 2DT5A 3KSZO 3RROA 2ZTUA 1DC4A 3DOOA 3JTMA 2NV6A 3CZMA 1HE5A 1GV0A 3PHHA 4CMIB 4BO7A 3IL2A 1XELA 4IIUA 1H2HA 1YE3A 4YB8A 4NG5A 4D7AA 5GY7A 1ENOA 1DC6A 1E7MA 4UUPA 1VKNA 2NU6A 2I99A 4J3FA 4NJMB 4CPDA 4MVJD 3CE6A 3GMDA 4E5KA 2EXXA 1Q0QA 2D0IA 3MJSA 3RUHA 2PY6A 4XDYA 4PG7A 1BXGA 2JCVA 5AYVA 2LDBA 2DAPA 3ETDA 1C0KA 4WNIA 1BSVA 1E3WA 4NIMA 3JQDA 2DBRA 5IDXA 1G1AA 4OQZA 4Q3DA 1NAHA 4BV9A 1YB4A 1H0KA 5CDSA 2X5KO 4FJ2A 5IG2A 3R3SA 4QXMA 2V6BA 2YHUA 5F5LA 2ZK7A 3COSA 2Y0EA 3NV9A 1ISIA 1WVGA 3AUUA 4L0QA 4M1QA 5C7OO 2P4HX 2YDXA 1HF3A 3JYQA 4N5MA 1IULA 1M2WA 1KERA 1UDCA 3BHJA 3D5QA 3GGGA 4HFJA 3L4BC 3D3WA 2RH8A 3VVBA 2Z1NA 1ISFA 1D7OA 3V1TC 1NBOA 1ADFA 3DHEA 4C7JA 1H5QA 1ZXLA 1PL8A 2DTXA 3QWAA 1K89A 5ER6A 1EFLA 4BO1A 2OZPA 3HE3A 3NDIA 1HDZA 1FDTA 2B35A 4DUPA 3EVTA 4IXWA 4R1NA 2HDHA 3WIEA 3JYNA 2PH5A 3WYBA 4ND1A 4TWRA 2JAPA 3H7AA 4FC7A 4U5QA 1UUFA 1FF9A 1J6UA 3K5PA 3HZZA 3R6DA 3ZNPA 1IZ0A 4FB5A 4XDZA 3AUAA 1P77A 4E4YA 5TRTA 2J6IA 4HBGA 1IUKA 3WGOA 1V9LA 1GDHA 4Q9NA 1Q7BA 2DBQA 3EHEA 3QWFA 2CDBA 4EJ0A 1ENZA 4J90A 2Y66A 3BMNA 1R4NA 2DTEA 5COBA 3STHA 2J3IA 1DXYA 2G76A 1NQOA 4RVHA 1DC5A 5BNFA 3O03A 4CQLA 4DVJA 1E6UA 5A02A 3ROKA 4CODB 2Q1TA 3M6IA 5G0UA 5JNLA 3BTVA 2OBNA 2VOEA 3IAHA 3BXXA 1ID1A 4IJKA 3KEOA 2AQ8A 3WJAA 1ORRA 4Y6RA 1E5QA 3JCZA 2LDXA 4IINA 5JY6A 2VTEA 2PD4A 1JQBA 4LISA 1JVBA 3D4NA 2IYOA 3JQGB 4I9HA 3UF0A 1P0FA 2GD1O 5TJ9A 5L53A 1L7DA 2FPPA 5U9CA 1E7YA 4JK3A 1HLPA 4FD3A 2C29D 3GEDA 1ZIDA 4M49A 4CM6A 3OEWA 4OL9A 3K2EA 4E12A 3SJ7A 3PIDA 2HQ1A 2QRKA 2WYVA 2NU8A 5C37A 3EZYA 5DOVA 2VUUA 3KYDB 4JJGA 1DFIA 3QVOA 3PHIA 3NTOA 1CRWG 1SEVA 4DPMA 2DBZA 1CEQA 4FDAA 1WLYA 5JMPA 1FK8A 2QYTA 2WWRA 3WQSB 3ZNNA 3PYMA 1BXKA 1LJ8A 3INRA 1QLJA 3WWYA 3GGPA 3PYXA 5JXWA 2B4TO 3QVTA 2Z95A 1T25A 1OC2A 4XWYA 2H1SA 2BKAA 3AU8A 2ZCUA 5C3MA 1K6XA 3JYLA 1QYXA 1B16A 1ARZA 4CMEA 4E5YA 2WTBA 5ICSA 2R6JA 2E49A 4RCVA 4CM8B 3SC4A 1DRWA 2IXAA 2HMVA 2O3JA 2X4GA 2ZB3A 4FJ0A 4I5GA 4OJNA 3U0BA 1CERA 1H6BA 4YAEA 5BT9A 1X0VA 4DLLA 3LC2O 3B1JA 3LU1A 1M75A 2GNAA 1LUAA 4J1SA 3SVTA 1UAGA 2PZMA 4TVOA 2O3RA 4N18A 4KQWA 4NHEA 4NNJA 2GSDA 1Y5RA 2Y1CA 2RAFA 2UV8A 2VUTA 3VZSA 1NYTA 3G1UA 4I8XA 3B20A 2FSSA 4J2OA 3MJEA 4PLCA 1O95A 4R68A 2O4UX 4TRJA 2NNLD 3U09A 3IQDB 3I4FA 1O89A 4ZN6A 4YEDA 2NVUA 4LRSB 1UJMA 4XQEA 3UUWA 3AM5A 1NFFA 3U62A 4NH4A 2AE2A 4ALMA 2X22A 3AJRA 1ISMA 1H2BA 1I5RA 2EG9A 3CKYA 1GPDG 3DWFA 3IMFA 4AJHA 3GR6A 3P7MA 5GZ6A 5KJEA 3M1LA 5I8ZA 5JE8A 4IQ8A 3PZBA 1E3LA 4M55A 1HEUA 4KWIA 3RKUA 1U9JA 1U3TA 1HYEA 1Y5MA 2JFHA 2CF6A 3U4IA 4WOJA 4DBZA 3L9XA 4P8RA 3DZFA 5CDUA 1RM4A 4GBJA 2WYWA 1NWCA 2ZTLA 5COAA 4UULA 3HADA 1YB1A 3DBHB 4NFYA 2GDZA 2J8ZA 2I5PO 1U2DA 3LT0A 4B3IA 4YR9A 4KUEA 3PHGA 4Z3DA 3CXRA 4Q39A 1ULSA 2DBVO 4CUZA 1VKOA 3JQ8A 4XQGA 1E3EA 3AFMA 3VKUA 2W2KA 1OBFO 1UR5A 1XGKA 1F8GA 3QP9A 4YJFA 3VVCA 4BVAA 1Q7GA 5HRUA 3CTMA 1PU2A 1X0XA 1YBVA 1R0SA 3S55A 3WWZA 1N92A 1NFQA 3SX2A 3F5SA 4TZKA 1I10A 1A5ZA 1LDBA 3JQ9C 3DAPA 2W2LD 5FWNA 2X9NA 2PGDA 4L4XA 4RQUA 4YACA 2OFPA 4R3NA 4D0RA 1B0AA 3UW3A 4WLEA 1PWZA 3Q11A 3PLNA 4O0LA 1E3IA 3W4IA 2PLAA 3B6ZA 4J1TA 1H93A 1NP3A 2B69A 1GV1A 1PJTA 5AXAA 5ILOA 1CQIA 2P9EA 4QECA 4XJSA 4PFJA 1B8UA 3IP1A 4ZQFA 2JFFA 3X2FA 4CR7A 3ZWPA 1J0XO 4B7XA 4CM8A 2JD0A 3VZRA 1BTOA 3UCFA 1T2DA 1ONOA 2CNBA 2C5EA 3AY3A 1XU9A 3BA1A 3MEQA 4H3VA 3FBGA 4D79A 1PQWA 1HYGA 2CF5A 1TT5B 4L4SA 1RJWA 4BMNA 1JW9B 1EVYA 4O5OA 3AU9A 3RBXA 3RAJA 3WTCA 2VYVD 4B8ZA 3KYCA 1VE9A 4HWKA 3ZGYA 3RUIA 5BR7A 3PDUA 4J6FA 1U3WA 3KEQA 4IM7A 1ZK0A 2QX7A 1IPFA 2DUUA 1ZSVA 2QZ9A 2A4KA 4YRBA 2B37A 1PX0A 1EVZA 1QP8A 4E30A 4U0KA 1P44A 1TB4A 5JAIA 3H2ZA 4G81A 3U4DA 3K2BA 4RPLA 1XIVA 4JJFA 5JBIA 1Q0HA 2VRCA 4W99A 3PRJA 4UUNA 4N5LA 4Z0PA 4E6PA 3H9EO 1GY8A 1PEDA 4OAQA 3PEFA 2Q1UA 4X54A 3ORFA 4HFMA 4R1SA 4II3A 1N1GA 3GG9A 3TSCA 3DMTC 1W6UA 2GGSA 4ZQBA 3I9LA 1F12A 1OI7A 3OJLA 3DZJA 4Q3CA 3CEAA 1DIHA 2EP5A 1I3LA 4CLXA 1C1XB 5DP2A 4RPJA 5BQFA 4LW8A 1P1JA 3BMOA 5EJ2A 1UXGA 2BGLA 1EE2A 4N54A 5IN4A 2VCYA 4D44A 2SCUA 1PJBA 1HDYA 2D8AA 2WJPA 4EGFA 5FYDA 4L75A 4YAJA 4CQLB 3L6DA 1PJCA 5JO9A 4HFNA 5L7YA 3G49A 1LSJA 4KDEA 2Q2WA 1MFZA 1WDKA 1DHTA 4E0BA 4DBVO 4IGEA 2FR0A 1DSSG 4W7IA 5G0VA 4AJ4A 1HRDA 3DFUA 3L77A 3BTSA 1CYDA 4L9RA 4GWGA 2PA3A 3DZHA 5K0ZA 1FDVA 2VHVA 1SOWA 2NU7A 3KB6A 2HCTA 3PQEA 4CMHA 1NHWA 3I83A 4YCAA 3CINA 3H9GA 4EJ6A 1JWBB 4WLOA 1QXSA 1I3NA 3M2TA 1Y6JA 5G0TA 1ZXBA 3PFFA 1SZJG 3H9UA 3DTTA 1K6JA 1J5PA 4NR0A 4DMMA 1HSZA 3RASA 2FY8A 3HN2A 1IPEA 2HK9A 1DC3A 1DAOA 3OECA 4ROSA 2O2YA 1ZMTA 1YOVA 4XD2A 4PVCA 2TMGA 4CV3A 2I76A 3OICA 4AICA 1U8XX 3OIGA 1LRLA 2IXBA 2OOSA 4WNCA 3EMKA 4E2WA 4H15A 4UUOA 1W8DA 3WG9A 4ALKA 3H9QA 4DPLA 3BTUA 4ZRMA 5JY1A 4IDAA 5EQDA 5DCYA 1GPJA 2I9PA 4XB2A 3VPHA 1D1SA 2GR9A 2AEFA 3BHIA 5TNXA 3U4HA 4A7PA 3TN7A 3L07A 5JDCA 1WMAA 4R54A 4DA9A 5IZCA 3AM4A 5I9NA 1E1MA 4EBFA 3ZU4A 3DMYA 2VHZA 5T8KA 1CIVA 3KSUA 1GD1O 1YL5A 4IJWA 2JCYA 5DBGA 5F1KA 5TT1A 3ZU2A 3RUAA 4BNMA 1I01A 3DOJA 1HE2A 4Y98A 3ZWMA 2C7GA 4D43A 4ALIA 1EVIA 1XSEA 3DXFA 2ZCVA 1Z75A 1ZNQO 2C0CA 1QRRA 2HSDA 4RVSA 4AJPA 1U8FO 4UVEA 3RBZA 1LEHA 1WNTA 2R00A 4ITUA 3ABIA 4EJMA 3QV1A 4AL4A 4FSHA 1JU9A 1DJNA 5BNTA 2ILTA 2D1YA 1JAYA 1U4OA 1V8BA 3VHRA 3S2IA 4O59O 3PQDA 4FOSA 2GN4A 3JQAB 4RF5A 1HTBA 1Y81A 2HMWA 3RWBA 3GDGA 1CETA 4NI5A 4DL9A 3PP8A 2FMUA 3ZWOA 3ZWWA 1EDZA 3D4OA 3WR5A 4O1MA 5TQVA 1R4NB 5KKAA 2J3JA 3ON5A 1HDRA 3A14A 4BNLA 1YRLA 1V3UA 3S2EA 3PWZA 3JD4A 4R5MA 2HMUA 1VPDA 4YAIA 5JSFA 3PYLA 2VYVA 4EITA 4GGOA 1I24A 4J1NA 5CDTA 1ISGA 4OO3A 1RWBA 4FBGA 3E9MA 1JLLA 4IDCA 3V1YA 3OF2A 2X23A 4AJEA 3TFQA 1YJQA 3RBVA 3LDHA 1BWSA 3GZ4A 4Y6PA 3RSHA 1E0DA 2NTJA 4QO7A 4BO3A 3CMCO 2OHXA 5B12A 5KJ1A 4UEJA 1EFKA 4RLHA 4IJVA 1I32A 4WCFA 3WTBA 1NASA 4KZPA 3GC6A 4J9VA 4MKRA 5KJFA 4AJ1A 3E18A 2I65A 1QG6A 5A06A 3ZW8A 4BNYA 2IDZA 2WD7B 4MIEA 5THKA 4XYGA 4NBUA 5CPBA 2IZ1A 3VPSA 1KEWA 2X1HA 3IUPA 4BHTA 4E33A 4BS9A 4CV1A 3I23A 4J4BA 4L73A 3PDJA 3Q2KA 4BO8A 4MKZA 3FBTA 4R16A 1MG5A 2YYYA 1XEAA 1LXCA 3GQVA 5DBFA 1P1RA 4J7UA 4F6CA 1U3VA 2NTNA 2OGUA 2NVBA 3F3SA 4PLGA 4U8GA 4YJFB 4LVCA 5IDQA 4CMEC 3P19A 1GCOA 3VAZA 3VH3A 4DIOA 4MINA 2JFGA 3ZZNA 4WPGA 3PLRA 4D0SA 3MTJA 4YDRA 2F00A 1SB8A 5JCJD 2P68A 3DAFA 3GHYA 1D8AA 3DBRB 5JC8A 2YY7A 3Q3CA 1Y7TA 3OIFA 1PIWA 5AOVA 2VQ3A 3GVIA 1JWAB 4XA8A 3ZV6A 4HKTA 3W4KA 3NKLA 1GYPA 2E48A 4BNWA 3WS7A 3KLMX 2CVZA 5ITWA 3UN1A 3KM0A 1E6WA 3VPXA 2VWHA 4BNUA 3WNQA 5L45A 4HNHA 5JAMA 1UAYA 2HMTA 3U49A 2X8LA 3SC6A 4DPKA 4XIYA 1I0ZA 5I7SA 3DONA 4FN4A 4GVXA 5JMWA 1XQ6A 1Z73A 3JQ7B 5L7WA 2CVOA 1P0CA 4IMRA 3RCBA 5HS6A 3VDQA 1VLLA 4LGVA 1MX3A 2HKIA 3ONFA 5DF1A 1ZZEA 3AM3A 4AJIA 3UH1A 2FP4A 2VYNA 1NPTO 4YQYA 3DZIA 5IXYA 1KC1A 2O23A 2VNAA 1B8VA 5B4UA 4ZQEA 1CJCA 2DLDA 2BFAA 4NPCA 3S1LA 1RYEA 1VJTA 2F1KA 3MWEB 1H9AA 2J5QA 2FR8A 1EUDA 3OQ6A 4BB6A 2V6MA 3BMOB 4BNGA 4ZQGA 2JD2A 3Q0EA 4WE3A 1TVEA 5CPFA 3ZHYA 2BI7A 4XCVA 4GWKA 2GO1A 1HDOA 2IODA 5MGBA 3PQFA 4BO2A 5BNIA 3KTDA 4IBOA 5THQA 4DQUA 4B79A 4XYEA 5A04A 5JYEA 4R1TA 2J5KA 1PL6A 4RO0A 3DTYA 1O5IA 2PNFA 2ZATA 2VZ0A 3E03A 2RBEA 3KO8A 4BNFA 8LDHA 2Q49A 4Z0TA 3WBFA 3FD8A 3HG7A 3AOGA 4YJDA 1HWYA 4RPKA 4WLUA 1XU7A 4RDHA 2ZYGA 1U1IA 1I3MA 3SEFA 1C14A 2D59A 3JD2A 1XDWA 2VRCD 2O3TA 4LMPA 4AVYA 3DB2A 2O50A 2RCYA 5CAEA 2ET6A 3E8XA 5DULA 1ENPA 1B8PA 3W4JA 5I7EA 1NQ5A 3H4VA 3LLVA 5DBIA 1DB3A 1E3WB 2HAEA 3H2SA 4ALLA 2Y0CA 4NJMA 1OMOA 1R15A 1P1HA 1QV6A 1Z45A 4KTVE 3KUXA 3K30A 1Y8RB 4QQRA 3ZV4A 4PZEA 3PWKA 5T64A 3GH3A 2RHCA 3VZQA 3V1UA 3GNQA 3WICA 1HE3A 3BZUA 3NTRA 4RPGA 2GF2A 5A4DA 4GQAA 3ZW9A 3GY0A 3ASUA 3D5TA 3F4BA 1H6CA 1T2CA 5KCZA 3KLPX 5JDIA 5KJ6A 1SMKA 2RH4A 2QRJA 3GAZA 3HDYA 4EI2A 1YQXA 2CMDA 1I30A 4PLVA 5DDIP 2PKQO 5LDHA 4PG4A 3UFXA 2D5CA 1ZEMA 5LDGA 3H6KA 1PJ2A 1T2EA 2Q3EA 1MV8A 1WW8A 4CMBA 1U3UA 4BKRA 4E13A 3NGLA 4FW8A 1H6DA 5IAAA 4DQVA 3FR7A 3JQFA 3WMWA 5KKCA 1CF2O 1A72A 5HM8A 4NDNE 3A4VA 4OGWA 1DO8A 4DC1A 1NVMB 1F06A 1AE1A 1C1DA 3QVSA 4U6QA 4NFSA 1C0IA 3TZ6A 1PJ4A 3KHUA 4RL6A 3C7DB 2AE1A 3BAZA 3C85A 5EIOA 1M67A 3JQ7A 1ENYA 2AMFA 4NMHA 5KVVA 3GEGA 2YV3A 1TXGA 1KVSA 3N74A 2X58A 3E5RA 4KMSA 4ZU3A 2I3AA 1P74A 1GU7A 5L4NA 4PLZA 4CUKA 3ASVA 4R9RA 2X5OA 1N9GB 5ENVA 4RZIA 1F17A 1PQUA 1F0YA 4E2ZA 1SO8A 4RQTA 2BF7A 4PRLA 3T7EA 4BO5A 5HTOA 4Z3KA 1ZSYA 4IDFA 3H5RA 2GRAA 2YV2A 4BNZA 2WD8A 2VT2A 4W82A 1BDBA 3GUYA 2AHRA 3CTVA 4OIMA 3FTPA 4U6SA 3FNFA 3LT4A 4GX2A 5IXSA 3U5TA 1A4UA 2EF1A 3GGOA 4J91A 1TA4A 4ID9A 1DRUA 1ONNA 3NDRA 2X0NA 4XZ3A 3JQGA 3TNLA 4E2XA 4PLTA 4PN3A 4IY1A 3VH2A 3PPIA 1G0NA 3ZCXA 3RFVA 1BDMA 1G6KA 4J43A 1WWKA 4TMFA 1XKQA 1LU9A 1HDXA 3GUCA 3UOGA 1NXQA 4XYMA 3MOIA 3OMLA 4RLSA 1O9BA 1TLTA 1ZUD1 4D42A 5G4KB 1WP4A 4NU6A 1B14A 2Q4BA 4B3JA 3RUEA 3OFSA 2FPGA 2BFOA 3FNEA 3Q9UA 2Q2QA 2FWMX 1CQJA 4MVJI 4BO4A 1GADO 2J5RA 4XB1A 2OBYA 5DZSA 4QSMA 1SCUA 1V35A 3AUSA 4B4VA 2BI8A 3I1JA 4NK5A 2VTDA 1R0LA 3I5MA 3WGZA 1U5CA 2EERA 3DZKA 4TROA 1PJ3A 4FFPA 4ESOA 2Z1MA 3JQEA 3TL3A 4I9UA 5BSEA 5G0SA 4EYEA 3AY7A 4KDFA 4J4HA 4BKUA 1BW9B 1O94A 1U5AA 4FFRA 1WDLA 2BLLA 1I36A 5ER9A 3I9OA 4PG6A 1KYQA 4R1UA 2X0IA 1YBAA 4B3HA 1WMBA 3I52A 4CR6A 4RORA 3OQBA 5GZ1A 4IQ0A 2Y1FA 4MVJA 5KVSA 1LLDA 1HT0A 1TT5A 3V5NA 2VUSA 4QFCA 3RC9A 1ISJA 3S8MA 1HYHA 2VZ9A 4WCDA 4FS3A 4NBWA 3K31A 3GVPA 4FC6A 3V8BA 2CDAA 3BMQA 5IFLA 4GMFA 5JS6A 3OBBA 1DFHA 1KEVA 4AJJA 5IZ4A 4JXKA 4I9NA 5T8KC 2QRLA 1N5DA 3WGGA 1BXGB 5JDCC 1VRWA 4MIYA 1PGJA 3TWOA 4HY3A 3QLJA 1GEGA 2GZ2A 5COQA 4FJ1A 3TZKA 3LT2A 4CLOB 4AJLA 1XCBA 1YB5A 4WKGA 1DOHA 5A05A 1ADGA 1J49A 1Y9AA 3C7AA 3UHAA 3H3FA 3INGA 3WSWA 3AFNA 1LSSA 2FR1A 4RVUA 4ILKA 1SPXA 3FPCA
chains in the Genus database with same CATH superfamily
2XF2A 1EVJA 3AXSA 3JRWA 4QGBA 3SKYA 1CP2A 4F4DA 1J1ZA 1Z7GA 3VTFA 5CBPA 3MRVA 2XB4A 3MWEA 1LLQA 5IJ0A 3O74A 1G21E 4IDGA 2ZWIA 1GQSA 1QGOA 3EA0A 4GP9A 3ZZTA 3JYPA 4MA4A 2OBLA 1BYUA 3E7PA 5AJUA 3U3MA 2IF0A 3W6NA 1W85A 3C5VA 1JSXA 2R97A 1SIWA 3D8NA 1PR3A 1Z33A 4FYMA 3WMXA 1YDGA 5KTKA 2DWUA 2H1CA 1Q57A 1H9BA 2O7SA 3I9MA 4YBZA 5JSHA 4JIGA 3FJ1A 4GYJA 2VNKA 3HH8A 5ABPA 4H0CA 2C2HA 2JGLA 5G3ZA 1WB5A 3OLYA 2IS2A 4IKOA 2KLHA 1M9NA 2A8YA 3OSUA 1E9SA 3QX7A 5LOVB 2C1ZA 1RP7A 3WRYC 3C1AA 1JU3A 5THXA 1FNNA 4IUBS 5JW6A 3O9ZA 3EVEA 4C08A 3EVCA 4KXMA 3GCZA 4KUGA 3H7IA 1OTYA 5KNBD 3QWBA 1ZHOA 3HWSA 1T34A 3FPAA 1TIPA 4YUAA 2B0JA 5L3QB 4J3NA 5HQ3B 3NVKI 1J07A 2KSQA 4M89A 4URFA 1Q44A 2VH1A 3DTNA 3PCXA 4MW6A 5ALDA 4OHZA 3ELBA 4H0FA 6NULA 1U0GA 3C87A 5EJ9A 1NLYA 2NU7B 1MAHA 4ZVQA 1Q1EA 1ZO8A 5CP8A 5KWSA 1GM5A 3TTYA 5B5SA 2XVXA 4HADA 1U90A 2ZSKA 5DM70 1GILA 5JJKA 1P73A 5EE5B 3UBMA 1FUIA 3VPGA 2EFEB 3GLIE 2ZOSA 1DRJA 2AN9A 3G2NA 3N05A 5LCXA 4MCHA 4DSOA 2VP3A 2R3SA 1B3BA 1JHDA 1JG7A 2R66A 4S3MA 3OWXA 4HQLA 4LJ6A 5DHRA 1S9DA 5FI5A 2OYRA 1SAYA 1EX9A 3G0BA 5TVKA 2BE9A 2P5YA 3CLTD 1J99A 2JGFA 3AHFA 1MMFB 2VPPA 3OP4A 4JXXA 3DPUA 3DKIA 4RHXA 3EH1A 2QL5A 1RAIA 4L5CA 5C53B 3F4KA 1ZKMA 2DHEA 2HWKA 5AVYA 1I80A 3NVAA 1JFSA 4DUYB 2NMVA 3MMZA 1MXFA 1A9YA 2W4QA 4MRMB 4RK5A 5CLIA 3F4LA 3PUZA 4US2R 5K0CA 2FEPA 3MW8A 5CFMA 5HGXA 4Q18A 2XDQA 4WERA 2C7BA 3RK0A 4TWIA 1YVEI 2H1RA 4CKEB 1NOIA 3L05A 2W2MA 1XG5A 1A7UA 2B8NA 3FHOA 5I7FA 3DVAA 2BYTA 3ZE9A 5KYVA 3R7SA 1A9TA 1SC3A 3UAOA 5HXAA 2H7XA 1U8TA 4WK2B 3TQCA 5BW4A 1YUNA 1N6OA 3ZJVA 5JLJA 3FUCA 2V5VA 4F46A 2PPVA 3F3YA 2ZXUA 4CL3A 2UVPB 2C7VA 5I51A 3IKLA 4CL2A 4DKJA 1NN1A 2X5JO 2HBYA 1NPDA 1G17A 3UJ7A 4L85A 1E1CA 5ADUS 5FTJA 4I4IA 5IANA 3LDGA 3A28A 2CL6X 1PNQA 5G4LA 2V0NA 2X5XA 3CEJA 3ZY2A 3E7FA 1G0OA 3O2SB 4UHFA 5D51S 1VL8A 3WLOA 3MHPA 5AW7A 1NVGA 4XDHA 4GM1A 1GAJA 3ZXUB 1SEPA 2O0JA 2EIHA 3KV3O 4RGBA 3NWJA 5CTAA 1G2QA 4P53A 1AJEA 3EPKA 3OE7A 4CLOA 4HEHA 2JANA 1YAHA 3ITKA 1JL3A 1GTVA 1O7JA 1RPNA 2V5AA 1URPA 2BMJA 1PR9A 4ONEA 1L7MA 2A0KA 3LW7A 4HLNA 4WK6A 1DZIA 4NE2A 1V0JA 2O1XA 3F97A 3TTUA 1TMYA 3BL8A 3M83A 1PS9A 4KP7A 1HNZB 2WP8J 1RZUA 3PDHA 5F3DA 2C9BA 2O2JA 3QQPA 1WZNA 1YWGO 2AN1A 2XE7A 3ZCRA 4HF7A 4F7WA 4OG2A 3QVVA 8ADHA 1JFVA 4LY3A 2OB1A 1KC3A 3HDGA 4KV9A 2OP0A 2QY9A 5KYXA 1P7YA 4X92A 2QX9A 3R6LA 3VC2A 5IBCA 1E2BA 2AG5A 4IDEA 3UWKA 4R0MA 3QEMB 5GWXA 1BDIA 2AYZA 4LZOA 2O8BB 3N5CA 3GEMA 2G7MC 1QX3A 1WSDA 2HTEA 3LXXA 2AD5A 2I9KA 1IHXA 2VPXA 3CW8X 1GLVA 3ESBA 3RO7A 4B4OA 4PY2A 4IVQA 2AXQA 2NQ2C 2Q5FA 3FWZA 3L7YA 3DXYA 4KX5A 1DAHA 1UP4A 1CF9A 2WRZA 3NHJA 1TC1A 4OQQA 1FMCA 4KE7A 4KO8A 3RYIB 1U94A 1W52X 3OZBA 3Q0IA 4O4LF 5BW5A 1EP1B 1PFUA 1RM0A 3DWEX 4MICA 1LI4A 3R6TA 4LRTB 4N8EA 4MKGA 3V2UA 1JHVA 4YAUA 4NESA 1QB7A 3ZWYA 1BD4A 4MAMA 3VGPA 1A9ZA 3AUJB 1E4OA 3JY6A 1WCIB 4JC0A 2E21A 4Y2UA 5E7IA 4BOYA 4E94A 3GFOA 3ZNOA 4KR6A 1UEJA 2IU4A 3UAYA 3E1SA 1HTWA 2DPGA 1RQNA 2PMWB 4Z99A 4WLNA 4EKNB 2QD1A 5ISMA 4OXKA 4Y2YA 5GONB 3EWAA 3UWOA 5AMXA 1VGRA 2RHHA 2CUTA 2JFWA 3HVUA 1KOLA 3M1IA 1EK2A 3BXFA 4M8LA 3UJAA 2RI1A 2QL6A 4QNNA 4QX6A 4BNHA 4BO0A 5A5EA 5H59A 5B2FA 3A4MA 4PIPA 1YO6A 5GINE 4JWTA 3ZKWA 2EFDB 2J3DA 4KMRA 4AIRA 4FQ8A 4M8IA 4J0FA 3MOSA 3I9KA 3N0WA 2JRLA 3KPJA 1F8YA 1KO4A 1HLFA 2Z6AA 4IPTA 3IYLW 2ZBVA 5P8WA 4UMDA 4K26A 3P9PA 1MH1A 2IP2A 5HKAA 6PFKA 3CZPA 4ENPA 2Q3MA 2C59A 4DLTA 4XJTA 1HNXB 1G291 3KDAA 3WV4A 4MDYA 4WXPA 4LYHA 1Y3FE 2EKPA 3BE6A 2C58A 1OTHA 4NJOA 4G0YA 4HGYA 5FWXA 4R69A 3GJ0A 5I7RA 5IT5A 5ICFA 3KOZA 3T1HB 4D9IA 1NWHA 4Y6OA 2WG2A 1MKYA 5CVVA 1G66A 2NGRA 4HZIA 1BKDR 5FD8A 4BMYA 3QPBA 5HX7A 3KWMA 3ZDCA 5LFAA 1JPNA 1TUIA 3HYLA 3T3PB 3RS5A 4B48A 2XE6A 6ABPA 2QZJA 5AHWA 3WZLA 4GR4A 4JYAB 2RHRA 2VSXA 1EDDA 2CD9A 3HBFA 4N3AA 3M7IA 3MUOA 4WD3A 3HI6A 3L7JA 2NU8B 4TXMA 3PGJA 5KNCA 1GKYA 1YOBA 1IHYA 5C4GB 1K2WA 1WUKS 3HY4A 4E4RA 2GM5A 1VPTA 4ALJA 4IFEA 5JAOA 2AWOA 3F6YA 1TM2A 2FMHA 1X7XA 1TAQA 4OLAA 1FXUA 5CM2Z 1CDEA 1Y48E 1ZJ4A 4GIBA 2POQX 3HB0A 3I0NA 1EAYA 1SXHA 2ZJAA 4P6VF 4C6SA 4DLYA 5LXTB 2HRCA 5AHXA 3NT2A 2WF5A 3GH1A 5C5IA 1U63A 1KP3A 4XWOA 1YBMA 4R8KA 1KMHB 4BP3A 4DQXA 5F9MA 1LFDB 1K97A 4X6LA 3U7GA 4IVNA 1ZDMA 4GR9A 1WW2A 5H82A 1T4BA 2QX4A 2ZTHA 4CTMA 1YACA 3G2IA 3PNMA 4GSKA 5ALHA 5JAQA 4ZEWA 5I9NA 4M37A 5A5GA 4K9DA 3WIDA 3DCIA 1WL8A 1BH2A 1YB6A 2WIBA 2XKJE 2BFDA 2ZB4A 2TMYA 3LBYA 4FOOA 5TXGA 1FFWA 1W4ZA 2GTPA 3RYHB 4ACBA 2CJWB 5AJTA 5C8VA 1KMMA 4CL8A 3UTCA 4IUDS 1EBFA 4CEJA 1AKEA 5BN4A 1YR8A 2P62A 1WPXA 3KV1A 3THOA 2JFQA 1SUEA 4Z9YA 1H22A 1GGMA 4N4AA 1PT6A 2QTVB 4N49A 2PKRA 1ZVQA 4PAGA 4AECA 5C9ZA 3P9QA 4OQ4A 2X8WA 5IJ0B 1L5HB 2PCLA 4JLDA 2Q21A 2IEZA 1P72A 4M1SA 4RHFA 3BRQA 3OHSX 3KR0A 3HUFA 4LRQA 1FSPA 2FPRA 2WWTA 3ZQKA 3LWDA 4Z9FA 4P4GA 1NJ1A 1VJ1A 1JT2A 2GJSA 2WD7A 1Q2XA 2WNHA 4HMPA 4DLKA 2FK7A 4F93B 1FSSA 2GPBA 4MVJF 2PVSA 4JS0A 3C3YA 2W8ZA 1T2AA 3DEIA 3P2YA 2GN2A 4I5DA 4NMXB 4NTZA 3CHYA 4ZKDA 3G2OA 1VQ1A 2BTQB 2OLJA 3ZH2A 4GVPA 4EARA 3YASA 1AK2A 4DR4B 4JY7A 4D3SA 1Y98A 3NBYC 2OL4A 1QK4A 1B41A 2VQSA 5BSRA 2BFFA 2OV8A 3F5QA 3U3OA 1VKZA 2CLKB 5FFNA 4C0WA 2YHIB 1KZYC 3CWQA 3CH6A 3DE3X 4M7PA 3M6WA 1QV9A 4E07A 4DMUB 3IO5A 1RWNA 1MA0A 3EB9A 3BWVA 4PANA 1NKTA 4PPNA 4HR7A 3FPLA 4C20A 2B94A 4H18A 1A7KA 1AM4D 4IYRA 4CI9A 1OA1A 4EHAA 3FDIA 1XJQA 4MVJM 1SBCA 2C3OA 3FCSB 4QJ5A 5AXCA 5CRIA 4UE6A 1QO0D 4K81B 3SLKA 5B1YA 4OXNA 1HDGO 4HSEA 4ZOEA 5DB4A 2BJVA 2IPXA 1KVUA 3ELDA 1FP4A 3PE4A 4MJ7A 1UF9A 4UUQA 3UA4A 2H57A 2CUNA 2HYDA 4ZO9A 3WK7A 1SUPA 2VPZA 3SZMA 3AR2A 5BVGA 3NCHA 4PWYA 3OFVA 1B23P 2HZBA 3R0JA 1DJLA 2XHEA 1E5XA 4HJXA 2G9VA 3D0RA 3V1LA 1PKEA 5KI6A 3DD1A 4S05A 5JFOA 3S40A 3D3KA 4KLAA 4P31A 2G9QA 4JQCA 2RKWA 4D02A 1C3OB 5AUPB 1NG9A 1Z6GA 2EQAA 2I4MA 4X8OA 1CCWA 2DFLA 1SHTX 3QYPA 1NR5A 5KDLA 5IEBA 1Z28A 4RIEA 3PFKA 2JNWA 1XWFA 1F2DA 3B1XA 4DZZA 2B4KA 4O4HB 4QIHA 3VSEA 2J9ZB 1E98A 1QIJA 4GKKB 2QORA 3IKTA 4BGEA 1SCQA 1DBIA 1V1JA 1ZSNA 1KJ9A 4YI5A 4URXR 2EP7A 4DFDA 2JK0A 3HB9A 1CR4A 3WVNA 1X7DA 5CLHA 2R6HA 3D3WB 1JEAA 1OE0A 2NP7A 3AVYA 2GRUA 1ULHA 3IKJA 2FXIA 4Y2SA 3I42A 4E3ZA 4YRSA 3U4QB 1QHXA 2IPOA 2ODQA 3ZJUA 1CVIA 5UKDA 4B7AA 4EUHA 4UQPA 2ZRCA 5SZKB 1CLEA 1U7ZA 2WYHA 4JHLA 2CFSA 2ZGVA 1I2DA 1Q22A 2I3DA 5E0KB 2W6QA 3QW2A 4E31A 2NPIA 2E1RA 4EHHA 2AX4A 3M6MD 7MDHA 4MS3A 1TPYA 1UQRA 1AUVA 2V74B 3G8YA 3IAM6 5KX5B 3I1FA 3UXYA 1WY7A 4BNJA 1PG0A 3M1AA 3UVEA 3T5MA 2IEGA 3VI3B 4C30A 2HSWA 1GITA 2MDTA 1U0LA 1UXJA 1USKA 3FI9A 2J5BA 4A03A 2OMEA 2P90A 1TVKA 3T1YB 4CTOA 2RI6A 3LVQE 3CUKA 3TRFA 2XYPA 3KEGA 2WV7A 2R84A 2ODBA 1QVWA 5FBHA 1XHFA 3NONA 1GDTA 3ZGZA 3CLRD 2QW8A 1UOPA 4CV0A 3OZTA 4EDFA 2C4UA 1LS6A 1UT6A 3T3DA 4U3JB 3I6QA 4YA6A 5JECA 1SCDA 1KOJA 1SA0A 1FRQA 1TCBA 1TF5A 1WCWA 4NX2A 3PIRA 3VZDA 1ZK4A 2CC2A 2HNKA 4YVFA 1SUFA 3G02A 3TPCA 4JI4B 3DPSA 1OC4A 2R1ZA 3NNNA 5A7GA 2NTEA 4TL6A 1ZA1A 2VHYA 5TMEA 5F52A 5BRNA 3QA9A 1A71A 1D7AA 3NT5A 3BPSA 2ZYTX 3HACA 3RKRA 1O08A 4UU7A 1JRLA 3WIBA 3SQOA 2FMKA 2ZYDA 2C77A 1MB2A 3AKEA 3EFHA 2QWXA 4IXMA 2VXYA 4XE5A 3B1VA 3L43A 4HNGA 5J2TF 4PG8A 2B78A 4DCGA 4MVJP 4QUGA 3ZY6A 5EC8A 2NXWA 3ZVNA 2REXB 3BJZA 3LK7A 2DLCX 5SZJA 2IOFA 4KQMA 2R87A 2PX6A 5EOVA 5G3YA 4BKOA 5KYYB 1Q1AA 1SOAA 1WZUA 2YJGA 2GH1A 4UVDA 1I7NA 5HTKA 5HS4A 4IHJF 1Z7EA 2JIOA 4OY3A 4ZK2A 1V2GA 9LDTA 5K2MA 5KYWB 5LP6A 3EZNA 3O75A 3EQZA 5EZYF 3HGTA 1WXFA 3RDPA 1RHMA 2BEUB 1K0UA 3L0OA 4EVSA 1GHTA 1Q0ZA 3NPAA 3ICPA 3KXDA 4LDPA 2XCLA 4QATA 1QQTA 3DUFA 1DEOA 2EL7A 2B92A 2HRZA 2NADA 3A9VA 4HK4A 3NYWA 5I6DA 1NBMA 2CUZA 3PEYA 2NW6A 2BMVA 2FPLA 3T06B 3OJFA 3W3ZB 3W3AA 1QDUA 4A8HA 2X1LA 1FFAA 3ZBPA 4Z3OA 1FDWA 5AVTA 4TXJA 5LWQA 4OH1A 3ZEAA 2DT8A 3TF5A 2BEJA 5FOXA 1ST2A 4UNNA 1AXGA 1V9SA 2JGAA 3K4PA 2AR9A 2XNSA 2CLFB 3RFXA 2AXNA 5HOQA 3KTOA 2O2HA 3O82A 1ZBQA 5LQCA 1AQUA 3A3PA 1EE9A 3ROMA 4NYJQ 1ECBA 4BAGA 1QAMA 3I3OA 3OHMA 5G0WA 1TKRA 1SHUX 2BELA 4IH1A 4ZI7A 1QK5A 2GXSA 4ARCA 4CDMA 3CLKA 2Q1YA 3UMMA 1QGUB 2IP1A 4R7ZA 3SG0A 1E7WA 2VAXA 3ZPXA 4A5OA 3RC2A 4RTOA 1PZNA 2OXCA 3FYDA 2V6JA 1SR8A 2AC2A 1YFKA 3Q3VA 2YW9A 4K6GA 4OGKA 4Q9LA 4RA6B 4A8JB 4DJFC 1O97D 4F2HA 2CNNA 3OG9A 4IQGA 1WD5A 2II6A 4B4DA 3EC7A 4JX8A 2QM0A 4F8JA 5SYAA 2D5AA 2VAMA 4BECA 4EFDA 2G9RA 3QKRB 3ZE7A 2YMQA 2NX2A 3Q2IA 4MQMA 1Z68A 4BPBA 2HPHA 4E51A 2VNSA 5JQGA 1D5WA 2YWRA 1F8FA 1FU4A 1SA0B 1L4FA 3IV6A 2HK7A 3D7SA 2O7NA 4QUEA 1F60A 5GONF 3ZXIA 4HS9A 1E1QD 3DHYA 3IQGX 1ORHA 4V3BA 2BFWA 5JHGB 3MC1A 4MV7A 521PA 1M6WA 2OD9A 2G72A 1KQOA 1F20A 2BZSA 4ZT3A 5B1HA 3ZHBA 4DWVA 1HFWA 2EJBA 1VRVA 3GUUA 3MSCA 2AJBA 1OXSC 2A6PA 3BAFA 4FNGA 3EFOB 4JWKA 2Z2XA 4RIHA 3UHPA 4P5PA 3KUKA 1LD3A 3C6BA 4MXDA 4RE5A 4MQ6A 1KDYA 1JG1A 4TMYA 1U7PA 4LDZA 1XQXA 2ZDGA 1E79A 4HNTA 5BSUA 1XR3A 1O8BA 3QG1A 1XO1A 1YKSA 3H5OA 2VIIA 5TGZA 5BW8A 5A0FA 1GPH1 4ZICA 5D5QA 3N39C 3WK6A 3K9FC 2EW2A 3CGGA 2AJDA 1F8UA 1XZDA 1M1YE 4FKMA 4WK4B 4AG3A 2IYEA 1PUJA 5L4SA 3HDHA 3AONB 3WY9A 2BGGA 3QLUA 5KWJA 2FPGB 1E18A 2QMEA 2G1PA 4D5EA 3BCUA 3EDYA 3VC3A 5EI5A 5HMLA 2RGBA 4OHBA 1J0CA 1R8SA 4B85A 1FVFA 5CYOA 2D7JA 4F92B 3HM2A 4F6RA 1E7QA 2G08A 4YH1A 3EXG2 2FP4B 4H4CA 3JQCA 5F33A 4BFWA 4JI2B 4YV7A 5AVXA 2PYIA 4JBGA 2N75A 3OO1A 4JITA 2UUAB 1WF6A 1JDJA 1D4FA 3DDZX 1D2CA 4DR6B 1RQGA 3HSKA 3VX4A 2HUPA 3VZBA 4HL6A 3TQHA 5AQ1A 4NFLA 4QBKA 1TTPB 2AR7A 2FWPA 4DDTA 3GYBA 2FUNB 1P3DA 2GM9A 2D3WA 1R6UA 1GNTA 3IKVA 3WLAA 3O83A 3EIHA 2AVNA 3NZEA 1Z12A 4D81A 4TMXA 4BNDA 1XC7A 1M8PA 1RWMA 2EGGA 5AOBA 4DAOA 3K70C 1AGNA 4IXTA 2J0VA 1C8KA 3E5HA 2F3RA 3NKFA 3R40A 2BKEA 1UFVA 1JI0A 1DRVA 4FEYA 4FVTA 1KE2A 3H11B 4WT7A 1I7PA 1Y80A 1S8OA 4IZ6A 5KYUA 2ZJ5A 3BX1A 3PXXA 4BMZA 4DSZA 3OESA 1D4OA 2QZPA 3D7LA 2OQ2A 3W2GA 1JE1A 3GF4A 4ENTA 1JQEA 4JOCA 4A6EA 4PBRA 2PH3A 4HB3A 3UV6A 1V37A 1LRJA 2Y9MB 4HDKB 1OLXB 5E2BA 5KNDA 3GD5A 2CYCA 1BW9A 3OAAD 4NMLA 2VT3A 3AESA 2F48A 4ZQIA 4FFNA 3RR2A 2HH9A 5AM2A 2ZTSA 1ZGCA 2ZBQA 3EEFA 1RC0A 2ZRHA 3F7OA 1JXMA 4LF8B 1NFRA 1J56A 4QQNA 3K9LA 4DTCA 3KJXA 4FDTA 4Q19A 2WINI 3CJRA 3R24A 4K2HA 1LNQA 3IPLA 3S2GA 4UM9B 4IRMA 2CHVA 3GK3A 5IKXA 4HRXA 2QR5A 3BVPA 4QU8A 3RM3A 4YT2A 4F2DA 4R0VA 5DISB 3M3DA 5K3DA 4KPFC 3GD7A 3OZFA 1I4LD 3B1YA 1F9AA 1TU0A 3ZV7A 4EPWA 3RC7A 5A02A 3H0KA 1XLTA 4D8WA 2H06A 4ESVA 4ER6A 3HNRA 3ZDQA 4TQGA 5KOJA 1RXEA 2V7EA 4K9KA 1SVUA 1MR3F 2COKA 3QY9A 5K0FA 2VQFB 3DMTA 3UPTA 3X2EA 3P9NA 3ZVMA 1TIBA 4I5FA 4TSRA 1G41A 5DRTA 4NU0A 2KB0A 1NXSA 1WIWA 1MX5A 1MH9A 1S01A 3CLTC 1RCUA 3L0ZA 4D8UA 3BIOA 5E9QA 3T15A 3ESCA 5LZ9A 1I7SB 2NPFA 1Y3HA 3OLWA 3KAJA 2PL3A 2GHQA 4EW6A 1BX0A 1W25A 4HRVA 4I0WB 1XEWY 1ELOA 2ST1A 5L3RA 5ADHA 3H1TA 2EJVA 1IZ8A 2FI1A 1GJRA 3ILYA 4TKVB 5MN4A 1IFXA 1FQKA 3K8OE 4MVJG 1G8PA 4F8EA 4BY9E 1V5GA 2C4VA 3STUA 4HNAA 1WY5A 3B3JA 4AP6A 4YMVA 3L0YA 3NBKA 1SVNA 4KO4S 4MV8A 4DQDA 5AVVA 1G38A 4UTZA 3EGOA 2AQKA 3WLJA 4LK3A 1Q0LA 3KVOA 5BUQA 1FMLA 5BSWA 1OI2A 1V6CA 2EARA 2QE7D 4JEHA 3VNSA 1MJFA 2JEYA 3T6KA 1YI8A 1UJ5A 3WHIA 3SE0A 2D2IA 3AHCA 1YZFA 3DVRX 3HJGA 5BSKA 1Q14A 2E4AA 1O0BA 2JAOA 4J2TA 5DT9A 2RONA 5MFPA 1COZA 3IQFA 1D4AA 4MIOA 2HIMA 3ONDA 2BM8A 2Q2OA 1QFMA 5DCWA 1N5LA 3W5CA 1FDUA 3NGMA 4DIDA 4FE3A 2Q5CA 1UKYA 3N76A 4MOWA 1NTOA 2GLXA 4LOJA 4ZU1X 2Z5VA 3QVXA 3NTQA 3WBJA 1R66A 4GYWA 4DILA 3OQJA 5HF5A 4C4YA 3OX2A 5ERYA 3OA0A 3I9NA 5M5BA 4LOAA 4TS9A 2JH3A 1FNDA 2QUZA 4BN0A 1GUZA 3O8OA 4Q3BA 3VR1A 1SHLA 3A4YA 7YASA 4TYNA 1RAFA 5FTWA 1M5RA 2ID7A 5KVCA 1YL7A 5BR8B 2JBAA 1UPTA 2WSMA 5JANA 3WLMA 1RLUA 4WGFA 3L1JA 2QP9X 4B3FX 2A84A 2V3WA 5T5QA 1V5WA 1BEUB 3JS5A 1NZDA 2JHFA 2FQQA 4NBTA 2X2PA 5L9AA 2FE4A 2AUNA 5KC9A 3P5SA 3CMMA 4EGQA 2XWQA 4XI9A 2PKQP 5BMVB 3UEOA 4I1YA 3LXMA 4TLCA 3RFTA 3RAFC 3WISA 1I6LA 4IV5A 1I51A 1E96A 4BNKA 4F86A 4HNRA 1FW6A 5EWMB 4QPZA 3LCRA 5C8YA 4Y1FA 2I6SA 1BCRB 2AIRA 2ZIWB 2J85A 4KFUA 3RLFA 4CIVA 5LQUA 2NU9A 3M6VA 1FXWF 5KOHB 3AV3A 4FDMA 1IU9A 1IVYA 3HXKA 1E20A 1V8OA 4K40A 4CMKA 1XA4A 2ECKA 1WQ4A 2ATCA 3FYCA 1D1QA 1ONSA 1AHIA 4DIFA 5C51B 4LBVA 1U8EA 3TO5A 3W04A 3W5UA 2WE8A 3FYTA 4F1JA 4HT3B 3EJ6A 3JVEA 3L2OB 1H5NA 3ZCSA 1YJ8A 1R4MB 3OZWA 2L42A 5FA6A 3HJUA 1EGAA 3VPFA 5E9JA 3EMDA 3G5TA 4NBLA 3T0IA 2ZB8A 4JI6B 5D3MB 1QYCA 3AK4A 3SZ3A 2FAXA 1REQA 2FG6C 2BM9A 4OGLA 1NR1A 3NHPA 1SVMA 2BEKA 3C0KA 2BC9A 3R0QA 4J6EA 1SBIA 4G9EA 4RCZA 2VBGA 4M36A 2IW1A 4LOHA 5L40A 4KI7A 1K88A 1PGPA 1TCAA 5HMMA 5L4LA 3W5DA 2NQ8A 1DCTA 2WDZA 5IH7A 2LVBA 4QQFA 4XIJA 3OURA 2KYRA 1B73A 2I6QA 4X20B 3BDIA 4JX9A 1O6FA 1F0PA 1QLHA 2AMLA 3IIMA 2ZUVA 2AA3A 2ZAGA 3FNGA 1O6ZA 4E6EA 2DPHA 2JARA 4RKFA 4EI9A 1W93A 5GZ3A 1SBQA 4OB7A 1DCKA 2JI8A 1ZD1A 1RP1A 3MS4A 1IPHA 1IQPA 1EGMB 2Q99A 3CONA 3I6BA 4HYTA 4UCWA 4UMEA 2IELA 4M9SA 4QZVA 2D2VA 2I1VB 4HXFB 3VGJA 4WQMA 1SOMA 3C48A 1IOLA 2GJAA 3HUDA 4HZGA 4JYMA 4U2DA 4AF8A 1CUWA 4NCHA 3GVXA 4BX8A 3RSSA 1BXRA 4FFOA 1Q1ZA 2NZYA 5CFQA 2Y0DA 1DXHA 4LNUA 1G7RA 4LSGA 3ACDA 4F3YA 4K7JA 3GWZA 5IZCC 1I8TA 3GP5A 4K05A 2P11A 3AWDA 3K72B 1P33A 2J31A 1GKKA 3ZVKA 1TU4A 1XTIA 5E2IA 1OH8A 1C8VB 3LPAA 5ECWA 2Z3ZA 3EEBA 4XJXA 3T7JA 2KBFA 4P4NA 1VJ0A 3T3HA 5HUQA 5C8YF 5JO0A 4XVCA 3CPJB 5DW3A 2I4LA 3GNTA 3GPDG 4D98A 1KEEA 1TEHA 4QGAA 3IUMA 4KIUA 3CURA 4NBRA 1D1TA 1LRKA 1XROA 3DC2A 1JSRA 5EIEA 4NXNB 2O59A 3T1QA 4LKOA 2IHYA 3UCXA 4FQ7A 4CJXA 3MXTA 1Q16A 3R9WA 3HA5A 2HA7A 3HYRA 2FRXA 4HPXB 4TZTA 4P38A 2HX1A 3ZCPA 4RJIA 3VYTB 1Y82A 2W6JD 2D1TA 3GI1A 3SBEA 4PQGA 2JL1A 3T0GA 4CUJA 3G3EA 2SICE 4CIXA 4DDKA 1H0HA 5JFTA 4HAUA 3UXHA 3K0KA 5EINA 4EA9A 5J2UA 4Y2XA 2GEDA 1KVQA 4HNUA 1QIDA 5JCJA 1WO8A 1IB0A 1IDOA 2JI7A 3U26A 3WWCA 3WYDA 3CZAA 3KG2A 4CLHA 4KGXA 2HO4A 1KBQA 4QVIA 4EB8A 5FI0B 1L5OA 1QQ5A 3OCCA 3W5VA 1O57A 1DMSA 4DCJA 3E82A 2I03A 1LLUA 4ZYWA 1V4NA 1CNFA 1RAHA 1T8SA 3GPIA 4HQNA 2YJNA 4KFTA 4W8OA 1E59A 5IKOA 4BX9A 3WRYA 4BNNA 3MT0A 3LCCA 5LZ4A 2XHZA 1JXOA 2OCLA 4TQUS 4O4IB 5BV0A 4MRAA 1GKUB 2IP4A 4D9JA 4EJ2A 3HFJA 2B21A 2IL1A 2QRVB 4PZ0A 2X8JA 1Z74A 4JBLA 2Z4RA 4JA2A 4BGVA 1BVRA 4PTYA 4NJEA 3FR8A 2KE5A 3G7NA 4JB0A 4PSAA 4D4KA 2WJWA 4WMLA 3E53A 2MYPA 3SYLA 2ERYA 5B7PA 1Z0AA 3U9LA 1H8EA 4OLJA 5KREA 3JALB 1XPUA 2GETA 1JYEA 1JKIA 4BDTA 3BFJA 2FX2A 2KPOA 3E9QA 3WMRA 3ZWBA 1AIPA 1NE7A 4K6CA 2P6NA 1RJ9A 3LF1A 1P1IA 2WSIA 2YUTA 2XTMA 4QJ4A 5HF9A 1GNQA 3HKEA 2WSBA 1L4LA 4GLLA 1IMOA 4INAA 5FEMA 3I39X 3BIFA 4KYVA 3AP3A 4Z2AA 3BK2A 1O5OA 4YDSA 4ZJPA 4BZXA 4GOMD 4F96A 2ZI5A 2BH2A 4D82A 1O8CA 2A3RA 2EJCA 2YUIA 3D2BA 2IEIA 3EXAA 3LO5A 4LDAA 4NLLA 4FFVA 4B43A 5LM3A 4JEMA 4IJUA 2OO3A 4B76A 3IJPA 2YXEA 1VBMA 2BFPA 3KR2A 2DKOA 3TQRA 2DQ4A 1N57A 4C0XA 3DDWA 5IJZA 1M66A 1HPLA 2RB4A 3TZEA 3W05A 4BLUA 2R79A 5GAJA 4TTSA 1XJ0A 4BLPA 5I9IA 4BJ3A 1Y8CA 4Q00A 3TNJA 1BFUA 1LTHR 4L3WA 5IJXA 1T1IA 3KKOA 1MGOA 4R31A 5D86A 5CB0A 3MGCA 3A2KA 3G17A 3HU5A 3RC8A 1NSYA 2J9XB 3U4AA 1N5JA 4ICIA 4NEGA 4RW0A 4DC0A 4GL4A 3W6UA 2G0TA 4G0VA 1BD3A 3OE4A 2BJHA 1Q17A 2Q4DA 2ZRLA 2XD4A 1W96A 1P39A 1WXGA 3CEHA 5JRZA 3ENNA 4R40A 4QXRA 3BRWD 3TI7A 1S6YA 4R2IA 4XYLA 1JKMA 3ELWA 4ALNA 1KTVA 2IH2A 3SR3A 1K6MA 3FFXA 1EP3B 2ISCA 4M0KA 3PC2A 4W5JA 5GADl 5FEUA 2FUEA 1PSWA 4K87A 4NV0A 1QFSA 2Z08A 1D4ZA 2B5VA 4O63O 4HN9A 5HPYB 1NMEA 4C06A 3ANNA 3NJRA 3TFWA 3D6TB 2PUEA 1U2RA 1ABEA 3L8EA 3SYRA 4D3XA 3NV7A 4WASA 3PQ8A 2B6HA 1T0IA 2A9VA 1C7JA 2XGOA 3I0ZA 1SBHA 2CCGA 3DP7A 5DNCA 2NV0A 1PQPA 4MHTA 4GKBA 5LZ7A 1XK6A 2H00A 2YFYA 3ZCQA 2RDMA 2I67A 4TTTS 4KQCA 3P2MA 3V8PA 4AKEA 3L01A 2WMDA 3OBIA 3E58A 5IN5A 4EZEA 1QGDA 1QYRA 2ZCJA 2NACA 2X42A 3BJEA 3G68A 2EQ5A 2X1VA 3C1OA 5JVDF 4GBMA 4QYIA 1R00A 1NYLA 3AR6A 4PNPA 4BP8A 2PIAA 2ZUBA 3OT1B 3Q3GE 4XM1A 1E2EA 2H1VA 3WLTA 1QRAA 2RHMA 2H4FA 1A77A 3K9HA 4RQBA 2ZUEA 5MF6A 2P2CA 5J23A 5F7OA 5EESA 2XQFA 3PJDA 5EUQB 3EMBA 3RARA 1OOEA 3MRXA 4KYUA 3K0FA 2HRQA 3T34A 3G2LA 5KYGA 2UYHA 1U1EA 5KO2A 1PR6A 2PU5A 3EBPA 2GJ8A 2BZ0A 2O3QA 3KOWA 3LLSA 3EY4A 4NYJR 3IMKA 3KBOA 3QF7A 5L7TA 2FFAA 3VTZA 3WYAA 5JROA 3U16A 3HJCA 3CF4G 1UP7A 4TM7A 2V1XA 3TSZA 2FZ5A 3EEIA 1L9XA 1Z15A 4BEWA 1KOGA 3DOOA 1SCKA 3I92A 5BMVF 3ADKA 4Q1AA 1C9DB 3CZMA 3HVHA 5TPWB 1EHCA 1DEKA 3D7KA 4EHLA 2F67A 4CMIB 2VKTA 5EY5B 1DQSA 1H2HA 1Z0FA 2W6JA 4EQZA 421PA 1NIPA 4MLCA 4NG5A 2ZJ7A 1UBFA 4L57A 2QUIA 4YY3B 3HFRA 4UUBA 1ENOA 3AHJA 3ELYA 3LWNA 2NZWA 4PC7A 4BVKA 1DC6A 1QAQA 4MWEA 2QN9A 3WMFA 4F3TA 3N86A 4QGFA 3HU1A 1VKNA 5AM0A 1FSFA 2NZUG 2YVQA 3E9RA 4CPDA 1V7ZA 2E85A 3DEZA 4MVJD 3QVJA 2DQKA 1FIUA 5GM1A 1VJ5A 4YCBA 4E5KA 5BUCA 1M2KA 1Q0QA 3RUHA 3ACCA 5JWOA 2N42A 2N1MA 1G3UA 5JZMA 4XDYA 3ZHSA 1BXGA 1XCLA 5AYVA 4S04A 1FDRA 1C0KA 4TN1A 2GAFA 1L1RA 4R2KA 5IRCD 3IQZA 1BSVA 3K0EA 1DJPA 4BKMA 3ZD9A 4NIMA 5T3UA 1G20A 5AVZA 3G8DA 2DBRA 4QJIA 1Z62A 5IDXA 1PNVA 4MV4A 4B6JA 4BEJA 2BFCA 5CDSA 3VR5H 2F9LA 1IN4A 4GMHA 3IILA 4HX2A 4IRUB 5IG2A 2R65A 3RRZA 1NBME 3PQ4A 4RD6A 3NLLA 4NULA 2P2YA 5IYZF 2H17A 3DR5A 1SG9A 4DA7A 4J0KA 2YXNA 4FB4A 5KX5A 4MRPA 4FGJA 1ISIA 4Q4DA 4CDNA 3L4JA 3GRFA 4NOMA 4Q9AA 4TKUB 5F23A 1M2OA 1YULA 1HF3A 4MYTA 5ULLA 3ZLJA 1GLGA 1MOPA 1KERA 3GGGA 4IAOA 3B3GA 3VVBA 2D0OB 2RH8A 4UBJA 5GPBA 1ISFA 1J21A 3V1TC 4LWZA 3Q7PA 1H5QA 1Z5ZA 1J8YF 1ZXLA 2DTXA 1K89A 3OZ7A 4WNAA 5IMBA 5TQ0A 4BVHA 4C5CA 3BT7A 3WWPA 3HE3A 1ZW6A 2QRUA 3UGQA 3NDIA 3OZSA 1AHNA 2ZLBA 1FDTA 3CCBA 1FNBA 1I1OA 2A0FA 5FNVA 4DUPA 4YGYA 4QKQA 4R1NA 5KQPA 2PUJA 2QVCA 3JYNA 5DCLA 1H2XA 5FHQA 5LZ5A 2PX8A 1YRYE 2E0IA 3H7AA 4TWRA 3UFBA 1QU3A 5ENZA 2WZQA 1FF9A 1C9YA 1J6UA 1NN5A 2F3QA 3HZZA 3K5PA 3L1UA 3MGAA 4I3FA 1V4BA 5JYCA 1OKKA 4C7KA 3C6KA 1Z2EA 1FTGA 4U9UA 1NQXA 5AVUA 1J70A 2A9QA 4Q9NA 4QVKA 5BN4B 2RHLA 3EHEA 4DM4A 1SUBA 1RE0A 3I5UA 1IOZA 2WFLB 2P8SA 1R4NA 5GQSA 1H2EA 3STHA 1F6BA 3A05A 1QS0B 4QELA 2G76A 1XTPA 1FTQA 1H1LA 2HWXA 4RVHA 1P81A 3WXMA 4P32A 1OWOA 5I8PA 1RFLA 2QX8A 5J4HA 1KL7A 4QTYA 3M6IA 1EXWA 2H8KA 1IJBA 4F4UA 4YR7A 2YZKA 3NM4A 1ID1A 4DEYA 3ER6A 1N6HA 4KRYA 5ELLA 5LP6B 1TCCA 2VZLA 4UM9D 1SCNE 6REQB 1JEYA 1IEVA 3JQRA 4IVPA 4ECAA 1U2QA 2VTEA 2PD4A 3IEKA 3IQEA 3EXHC 4LISA 2JEOA 2FW8A 4PX9A 3ZC3A 3NASA 3BFXA 1T6NA 1EXNA 1NOKA 2VFAA 2BCJQ 2Y1KA 2ZWVA 3CT6A 2FPPA 3BCRA 1XTUA 4QUJA 3D02A 4W8GA 2XYVA 1HLPA 3RVPA 1FSGA 2C29D 2PMEA 4C4XA 1AQLA 2G40A 4X3OA 3CXUA 1POWA 3KJZA 2NO4A 3OEWA 3W77A 3GFPA 3K2EA 1T36A 4HDSA 3KR1A 5IAOA 1IY2A 3U3RA 2HQ1A 4QXOA 4H1TA 3VJKA 1QTQA 5FBQB 5C37A 1UIRA 2JH8A 3KQWA 2EOAA 1Z08A 3K5WA 1XQWA 3EZYA 3TH5A 3OZRA 3VVMA 4O3FA 2AOWA 3NTVA 3OU6A 4D9NA 1ZX1A 3W78A 1CRWG 3ICVA 1PFGA 1VLVA 2GPSA 2VPIA 5FLYA 5H4HA 2DPLA 2XGJA 1NP6A 1QLWA 3FSGA 3M4NA 4KBGA 2ODNA 4W1SA 2C4TA 3PYMA 1A8HA 5AI9A 4EYQA 2VPQA 2QGFA 3GJZA 1LPNA 5T7BA 1QLJA 5FOSA 4D9BA 2YVKA 4OK5A 3RYIA 1T43A 2JGDB 2Z95A 3NHAA 3EG5A 3AU8A 3DZ8A 1N36B 3H4IA 4LRUA 1K6XA 3BIWA 2IHJA 2JFYA 3GRAA 3JYLA 3ORRA 1QYXA 1B16A 4EPVA 4UQOA 3ND5A 1LBTA 3LTEA 1KWGA 1UPBA 1OREA 1ARZA 1F1BA 2LCQA 5AFSA 1EESA 2K87A 4WFJA 2L18A 3VOAA 1ZITA 2E49A 4RCVA 1WBBA 1WPGA 2ZBRA 3KR9A 2BV3A 3CR7A 3LECA 3JRNA 3ONNA 2QJRA 5TMPA 1ULTA 2O3JA 1SRQA 1TU3A 2AB0A 3U0BA 2PMFA 1Z29A 1CERA 1IK4A 1GGEA 1MRZA 2WHYA 1H6BA 3M70A 3ID6C 2L82A 4QNMA 4S0XA 2VDPB 3O4GA 4YGXB 4YAEA 5FBLB 4H35A 2FXVA 3TCNA 2GHTA 2YMPA 1N2XA 3B1JA 3Q8LA 1QQAA 3NRJA 4OATA 1M75A 2GNAA 1LUAA 2PUTA 3R3VA 3NNDA 1U2PA 4ISBA 4J1SA 3R8XA 5KWIA 6CHYA 3CN7A 2Z2IA 3BH7A 1VP9A 4TVOA 5EJ5A 4TS4A 3UGTA 1XKLA 4ZIRA 1UBCA 4KQWA 5LZ2A 4NNJA 1ZM2A 5AK6A 2QQ0A 4ZAGA 2RAFA