1LSSA

Ktn mja218 crystal structure in complex with nad+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
MYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDAGIEDADMYIAVTGKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of regulating transmembrane potassium flux through a ligand-mediated conformational switch.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
molecule keywords Trk system potassium uptake protein trkA homolog
total genus 50
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lssA00
5IN4A 2NVWA 3W4JA 1GL3A 1IYZA 2PZKA 2JAHA 4J0EA 3Q9UA 3GEMA 3JD4A 2IE0A 3MJTA 3VVBA 1T2DA 5ICSA 3MEQA 5FYDA 4WLOA 1HDYA 1UXJA 4BO6A 4YXFA 3D3WB 1S6YA 3VVCA 4NBVA 2VOEA 1PL8A 3D64A 3C1AA 3B1KA 4MPDA 4YJHB 1UZLA 2EV9A 3U49A 3GGGA 1GTMA 3DZGA 1ZSYA 1I36A 5CEEA 5F1KA 4BNJA 1CDOA 2PZLA 3TFOA 3I4CA 3N74A 3A4VA 3PLNA 2WMDA 4JLWA 1U8XX 4BL5A 2FSSA 5THQA 2PTGA 1A71A 2DPGA 4GLOA 1O6ZA 2ZCUA 1YB5A 4CV3A 3HG7A 3ZHXA 3E48A 1QSGA 1A72A 4B3IA 4CLRB 2EKQA 2OBYA 3K30A 5AOVA 4RJTA 4WASA 4AJ4A 2BMAA 4LCEA 1NAIA 3A1NA 1S7CA 4J49A 4KTVE 4J7XA 2QQ5A 2X5OA 1B8VA 2V6BA 2ZK7A 4BMNA 1MFZA 3G1TA 3ONFA 4CQMA 4FGSA 5DBIA 3GLQA 2R6JA 4OMUA 1EQUA 4U0KA 1UZNA 1ADFA 3NV9A 4JJGA 1XKQA 3ZN2A 3CPSA 3DZKA 3ZI0A 4I5FA 5TT0A 2XXJA 3ZU3A 1ML3A 1E6UA 4JBIA 5GMOA 1XEAA 4JQCA 2AQHA 1R16A 2O3RA 3CTMA 3OP4A 4TRRA 5EMHA 1DO8A 4YRAA 4TQGA 4IDEA 1DFGA 4TVBA 3RBXA 1SO8A 2AQ8A 1SCUA 3DMYA 4LSMA 1IE3A 2Q1WA 4DIOA 5A9SB 1YE3A 3DHEA 2ZTLA 3AUAA 1SMKA 3JQGB 3OQ1A 4FJ0A 3ZV3A 2YDYA 3IS3A 4BGIA 4YJGA 4E21A 1C1DB 1DDOA 2I6TA 3EDMA 3F5SA 3RIHA 4IZHA 1R0KA 3WIDA 1SEPA 1GUFA 3GVIA 4PG5A 1GZ3A 5J23A 2E6UX 1HDCA 3ZNNA 3SX2A 2FR8A 2VCYA 5TF4A 1NAHA 4GGPA 1Z75A 4TRNA 3RI3A 2DUWA 3S8MA 4E2WA 2H9IA 3L0DA 3QIVA 1Y9EA 5CG1A 3WBFA 4PIVA 1DEHA 4XIYA 5A4DA 5BQFA 3I3OA 1SOWA 2D3TA 3UCXA 1KS9A 1YVEI 5CFZA 1LI4A 1EDZA 3DBHB 3KYDB 5KJCA 3SVTA 4N18A 2P5UA 1F14A 2XAAA 4Z0HO 2RHCA 4QECA 3FNEA 3JQAA 4Y67A 2Y1FA 2R00C 3AOEA 2JAPA 3WQQA 4K9DA 1E3SA 3F6YA 4UVDA 5BNIA 3OBBA 1R4NB 3RU7A 2FWMX 1F06A 4MP6A 3H5NA 5ES3A 3AUSA 1JTVA 1IPEA 3I52A 4RORA 5A9TA 1BW9B 4EEZA 1G6KA 1YDWA 1V3VA 5F5NA 1P31A 5C7IO 3FF4A 1YOVA 4BO9A 5KJ6A 4F46A 4R01A 4GX2A 5AXDA 1HDXA 4Q3CA 4TKMA 3IUSA 5IDQA 4YAKA 3WG9A 2UV8A 4Q3DA 4ZJUA 1N8KA 3GPDG 2PH3A 3K31A 4CR8A 2YHIB 1M75A 2PGDA 4MP8A 5DP1A 1HYEA 4JROA 3AK4A 1PR3A 4QUKA 3KHUA 4CM9D 1ZK3A 3DAPA 4P38A 1R12A 1U3WA 3GAFA 3KZVA 4GH5A 2Z1NA 4D7AA 2XXBA 1TVEA 1X15A 3JQ9A 4ZN6A 1OI7A 3PYXA 1ZXBA 2OXIA 1A27A 2BGKA 2E48A 4J43A 4CUKA 1PJBA 3DBLB 4IGFA 1R4MB 5IG2A 3WGTA 1EFKA 4DMLA 4IDGA 3BMNA 3LF2A 1NVTA 3WWZA 4BKRA 1GZ6A 3HNPA 3WQSB 4ZHSA 1JAXA 1UXHA 4DYDA 3LVFO 2GNAA 3NT2A 2FPPA 4G81A 4L75A 1T24A 3PDUA 3OEWA 2IEBA 2ZCVA 4HFNA 4IIUA 3FPLA 3GGOA 3ETGA 2B69A 2RH8A 5TT1A 1HT0A 4RLHA 4EZBA 1ISMA 4CMIA 2O2SA 3IJRA 4YT8A 4QT0A 4FIZA 1U2GA 1DPGA 3K73O 4MJLA 4PG7A 1AN9A 2ZYDA 5LCXA 5FEUA 3TPCA 5HWSA 5ICMA 5TC4A 1QYXA 2HK7A 3MZ0A 4MP3A 4ALLA 3U4HA 1C14A 2Z1MA 1LSSA 3JYPA 2OBNA 4IXTA 3PI7A 2DAPA 4OJNA 4Q3NA 4FB5A 4IZIA 3B20A 1EK5A 3WSVA 3H5RA 1JVSA 4M1QA 4J1NA 4CMAA 4CV0A 1NHWA 1GR0A 3FTPA 4PLVA 1LX6A 2VRBA 4YB8A 4NK5A 4NFHA 2OMEA 5TX7A 3H65A 2YDXA 2WYUA 2YQ4A 1LNQA 2HJRA 1PU2A 2PD4A 4ZQBA 3ZWXA 2DPHA 3PDJA 5K6AA 5IN5A 4D46A 2FZWA 3PXXA 4BNFA 2HMVA 3JCZA 3HB4X 4L4RA 1H6CA 1VLLA 4PVCA 2O3QA 2WEKA 4NBRA 1PZHA 4WEQA 2J6IA 4M89A 3UCFA 1ONOA 1QYDA 5F1OA 1YQGA 2PK3A 4NQZA 3RUIA 3RBVA 4J6FA 2NU7A 4R1TA 4D41A 4TSKA 1HXHA 5AQ1A 4AG3A 4DBZA 1GUYA 3AY3A 4XQCA 2IYOA 5G4LA 1QV6A 2X7HA 1Q7BA 3JQFC 4CMEC 4JIGA 2DFDA 3DBVO 3C1OA 5IJZA 5JSFA 3WGIA 4D42A 1AXEA 4PLHA 1AE1A 5JAQA 1WMBA 1QRRA 1E6WA 3F46A 3FTNA 2VHWA 3H9UA 3HQ4O 4RF4A 2GN9A 3GNSA 5A05A 3T7EA 3TRIA 1NQAO 2YHUA 2ZYAA 5L95A 2B4QA 2D1YA 2X0JA 4NH4A 1Q7CA 2OGUA 1M2WA 1L7DA 1ONNA 5L7WA 1C0IA 3S1LA 1XQ1A 4FW8A 3FI9A 5T8KA 3IAHA 3TN7A 3EC7A 2P4HX 3HFGA 1JW9B 2B5VA 3PVZA 3INGA 4TRMA 3U5TA 1HWYA 3HFSA 3DOCA 2YW9A 1HLDA 2JFFA 3AWDA 3JQAD 3WTCA 4DXHA 3UH1A 3ZWWA 1DIGA 4W82A 3NTQA 2VYVD 3W1VA 2VT3A 1LDYA 2VRCA 4UEJA 3TOXA 4OM8A 4NNJA 1K6IA 4P8RA 1GPDG 1GZ4A 4W7HA 1H6DA 1WAMA 2FY8A 3CXRA 3M1AA 3C85A 3RC1A 1P74A 3CZMA 1PWXA 3RFTA 3ZZNA 3B1FA 2EEZA 4FFOA 3ENNA 4BNHA 3GFGA 2J3KA 3V1UA 1EEHA 1HRDA 1ENOA 4HNHA 3WLEA 3OFSA 3ZWNA 4LRSB 4R1NA 3HADA 4CJXA 4NFYA 1X0XA 4ALJA 5HBRA 4XEHA 4U5QA 1UAGA 2C07A 3OH8A 4CM7A 4W7IA 4LMRA 4CM9A 1QP8A 1N9GA 2X0RA 4G65A 3JD0A 3ASVA 1L7EA 1JAYA 1PJCA 1T4DA 1XR3A 3BA1A 3PJDA 1U8FO 2GR9A 4UAGA 4GX0A 9LDBA 1ZZEA 4KUGA 4JNKA 2Q1SA 4BIIA 2EJWA 5ER9A 1MG5A 1I2CA 4FFLA 5I8ZA 1UP6A 2GRAA 4L4XA 1BTOA 3K96A 1QMGA 5DULA 1FDSA 1ZXLA 1WXDA 5T67A 3BMCA 1W73A 3A9WA 4DQXA 1UXGA 2POQX 4E13A 5F1PA 2XF8A 2NWQA 3U4CA 3TZQA 4AJNA 1X7HA 3K2BA 1ZEJA 1VI2A 4H15A 3PHIA 1NQOA 1PGPA 1XSEA 1AHHA 1OC4A 5EERA 5FWNA 1P1KA 4I9NA 1MP0A 4FJ2A 5DBGA 3ZW9A 1XDWA 2YJZA 4CQMD 2B83A 3G79A 3KETA 1KERA 4FBGA 4WJZA 4PG4A 1LLUA 3CE6A 4RZIA 1NTOA 3VKUA 4DIFA 4WLEA 3RJ9A 3DWFA 1I30A 3NTOA 2EKLA 2RH4A 3D0OA 1J5PA 3K92A 4HXYA 3AW9A 4FGWA 1LRKA 1P1HA 2Y67A 1R37A 4D3FA 1YB4A 4CM6A 1MB4A 1NASA 2YFQA 1DAOA 5A1TA 4ND2A 5IDXA 4TZTA 4IJUA 3DAFA 1KIFA 4S3MA 4BKPA 1EUDA 4XR9A 3TNLA 1DC5A 2O3TA 3ZNOA 2Q1UA 3BTVA 1D1SA 2OHXA 1Y8QB 2C82A 2ZB8A 3MJVA 3GAZA 2TMDA 4WCFC 5AXAA 4D79A 4W99A 1X7GA 4D3DA 3F3SA 4NPCA 3ENKA 4R68A 1C0PA 3E9QA 4UEKA 4MVJM 2GGSA 1ISGA 4BO4A 5KJEA 3SLKA 1E1LA 1RKXA 2ZQYA 2CZCA 2WM3A 3TL2A 2G17A 4E6PA 1N2SA 1X1EA 1LBEA 4FPXA 2JD0A 5TIIA 1Z73A 2VNAA 3PWKA 5JCJD 4FQ8A 1TLTA 2GD1O 3O03A 5EQFA 1K5HA 5JMWA 3GC6A 3PGXA 3ETEA 1PJSA 5DT9A 4AJOA 4N5NA 1QYVA 1WMAA 4XZ3A 3Q11A 1NNUA 1NQ5A 3V1YA 4LN1A 1GEEA 1NBOA 2B36A 5FI5A 2Q49A 1AUPA 4GQAA 1PGJA 3A14A 1GEGA 1NVMB 3CUKA 4QO7A 4AJJA 1Y5RA 3VZQA 1TI7A 1CJCA 1ZK4A 3EAGA 3AY7A 3VPGA 2YV1A 3VH4A 4B4VA 3ANNA 1E3IA 2DTXA 4IQGA 3ZHBA 6LDHA 3ZHYA 3PYMA 2QYTA 3GPIA 5EQDA 2CF5A 4GVXA 3B70A 2NTJA 3H9QA 5JCJA 2X9GA 4Q3EA 3QWAA 1UJMA 2CNBA 3RUDA 3OQ6A 1ONPA 4BNIA 4XYBA 3ADPA 4J7UA 3C7CB 1KVQA 5U4QA 1U5CA 3WGGA 2W2KA 3I83A 4A5OA 4D0SA 2Q2WA 5JDCA 1Y9AA 3QVSA 4IJKA 3GUYA 3NYWA 4K1LA 3GN1A 4BGEA 1KC3A 2PY6A 3QJ5A 1HETA 3G3EA 4YTEA 4K26A 2DQ4A 1DC4A 1OOEA 1U7HA 3DZIA 1KVTA 3DBRA 3PQFA 4GSKA 2Q2VA 4UULA 2X58A 1ZK0A 2VHXA 3QVTA 1SC6A 4BNWA 4IDCA 5TQVA 4C4OA 4YRBA 3G17A 2W4QA 2YZ7A 2BFMA 3WJ7A 2UDPA 3OECA 4X54A 4PRKA 2WE8A 4BNVA 1F8GA 4INAA 1ISJA 1BSVA 2FZEA 4A7PA 3PWZA 3U62A 3QVWA 4DYVA 1JU9A 4KDFA 1GPJA 3BXXA 2EXXA 3E8XA 4HADA 2PA3A 5HS4A 4IQ8A 5EN4A 4E33A 4CR7A 5JC8A 1LRJA 4NBUA 4CM8A 2ZKLA 1WZEA 4N5LA 1LDNA 3E9MA 2DTDA 1A4UA 1FDTA 1U3TA 3PQDA 1MXFA 4J4TA 5CPBA 2X8LA 5LC1A 3SC4A 4XRGA 5DDIP 4Q3AA 1HSOA 4YJHA 4R5HA 1BMDA 2JFGA 4U7WA 3D3WA 4DREA 5JDIA 3GDGA 1GUZA 3WOHA 2V6FA 2PH5A 2Y1CA 5BR7A 1TA4A 2O7SA 2Q45A 3TFQA 4CM4A 2JCVA 1ENYA 2NVUB 2GPTA 3KV3O 5TGDA 4PZEA 4PVDA 3MCVA 4Y9DA 5FI3A 4CUJA 1VPDA 3GVCA 2GASA 4B3JA 1H6BA 1T1RA 2JJYA 1EBFA 1N1GA 3LQFA 4MIYA 3ITKA 3DOJA 5BT9A 4R54A 4C7KA 4DL9A 4F6CA 3JD2A 1Y8RA 4KZPA 5B12A 4IMRA 4MDHA 3UUWA 4R3WA 3MJEA 3P2YA 4WKGA 1IOLA 2QW8A 2NQ8A 3DO5A 4EI2A 1MC4A 2Y1EA 4D3SA 5JYDA 2WDZA 3IDSA 2SCUA 5ITVA 1V3UA 3CMCO 2X0NA 4D43A 2AQKA 1NR7A 1U7TA 1B3BA 3DC2A 4PG6A 1PJLA 3WYCA 4BS9A 1WZIA 4O6VA 3E5MA 2BF7A 5K0ZA 1I32A 1I01A 1R66A 3DZBA 4M55A 3I6IA 4BV8A 1E7RA 4XA8A 4TKLA 1PS9A 2X0IA 3QP9A 4AJPA 4MVJH 1BXKA 2VWHA 1MV8A 2CD9A 1YL5A 2J8ZA 4YRDA 3PZRA 1UP7A 4JX8A 4UVIA 2WE7A 5JXWA 3I9MA 3ULKA 3JYQA 2GERA 2GLXA 3CEAA 4L73A 3DDNA 4WCFA 1PQUA 2Q50A 3C3XA 4O5OA 1QXSA 2FN7A 3FNHA 3FSRA 1HYHA 3KTDA 2I3AA 4EW6A 2WTBA 1JQBA 4CL8A 2NTVA 2V65A 4RL6A 4E3ZA 3GN2A 4ND5A 2AW5A 1LLQA 2QIOA 4WK6A 3OF2A 3ROQA 4HWKA 5A9RA 3JQ8A 2RIRA 2HQ1A 2ZATA 4A03A 1P1IA 2B4TO 3TDKA 4BGUA 5L4LA 4AJHA 3RROA 5GZ3A 4W9NA 3H7AA 4PGFA 2Y1OA 4EEXA 3RC7A 5C3MA 5KVSA 3GEDA 3KO8A 1R4NA 4KQWA 4A26A 4JP3A 2HKIA 4CMBA 2PGJA 4BUCA 4D0RA 4YJFB 1YJ8A 4GX1A 4WOKA 4DBVO 1VJ1A 5G0UA 2IODA 3GNTA 3BMOB 1HDGO 1O8CA 3AUTA 3EGOA 3KM0A 3RC2A 4ALNA 1VKNA 5THKA 3LT4A 1K2WA 1W6UA 2D59A 2C7VA 1A4IA 2VT2A 4A27A 1CQIA 2P9EA 4R1SA 3OA0A 2A9FA 1VL0A 5ENDA 4KQXA 3NT5A 2NSDA 3F1LA 3O38A 1SOVA 1UR5A 4Z0TA 3L07A 4BQRA 4B79A 2NU6A 1E92A 4BMVA 3PPIA 3EYWA 4YAGA 1LUAA 1T2FA 4IJWA 4PLYA 2B0JA 3LF1A 1I5RA 5A3VA 3TZKA 2AHRA 4RCVA 1XQ6A 4H7PA 1LQTA 3U0BA 1VSVA 1TT5B 3NX4A 1B14A 3ZNQA 4RO0A 3TQHA 1G0NA 4PLTA 3JYLA 4YT5A 2BELA 4MO2A 2P9CA 1P44A 4GLLA 3I9OA 4I5DA 1WWKA 3LT2A 3RUFA 3P2OA 3W6UA 1A5ZA 1YXMA 3DAGA 2VWGA 4YDRA 4YAJA 4DQUA 3TOZA 3KEOA 5IDWA 5IXSA 2J3JA 4XDZA 1VKOA 3GNQA 4N5MA 2YQ5A 1ZO8A 4O0LA 5DNAA 3MWEB 1UZMA 1I2ZA 1NXQA 4FOSA 4BGVA 3ORFA 4H3VA 5JC1A 5L4SA 4E32A 4RF3A 2AQIA 1E5QA 2IZZA 2JCYA 3GT0A 1RM4A 5A04A 4XWYA 3R0IA 4FD3A 3IUPA 1O94A 1PL6A 3PHHA 4R9SA 3M6IA 4OXYA 1MGOA 3UICA 1I3MA 1DJNA 5U9CA 1Q7GA 3EUWA 4W9NC 4UVHA 1CYDA 5AXCA 5T57A 2VTDA 4DC1A 3JQ9C 3JQBA 1PQWA 3GVPA 4P4GA 3AM5A 4Q9NA 1HKUA 3HN7A 2AEFA 2PZMA 3RC9A 5KVQA 4CMGA 2W90A 3DZJA 4IQ0A 1QR6A 3DFZA 1DOHA 1YL7A 3QWIA 1E1KA 3LC2O 1Q0HA 2EG9A 4KUEA 1LU9A 7ADHA 1F12A 2Q4BA 3LT1A 3MOIA 4IINA 3GK3A 3W8DA 1KEWA 4EUFA 2I76A 4XX0A 4AFNA 3I5MA 4XJTA 2X1HA 1XIVA 2CSUA 2HRBA 4FOOA 4I8XA 1ORRA 1C3VA 4E4YA 4RVGA 3PIDA 4C7JA 4TWRA 3RAJA 3RCBA 4FJ1A 2HMWA 2GZ2A 2YY7A 2CY0A 2VHVA 4KMSA 4BO8A 1CEQA 1NPYA 2C5EA 3FHLA 3ZWAA 1U9JA 4BNMA 1D8AA 1DAPA 3GY0A 2GN4A 3NDRA 4GKBA 3DBHA 5EJ2A 1WDMA 4ZA2A 3ASUA 2PNFA 1MG0A 1YRLA 3DXFA 4R5MA 3TZCA 1D3AA 4EJMA 4NFSA 5CEJA 3TJRA 1PIWA 2V6MA 3B6ZA 3H6KA 4QO8A 2D0IA 2HRZA 3RQSA 4J1QA 2CDBA 2JCXA 4NJOA 4ILKA 3COSA 1ZMOA 4A0SA 2WD7B 5G4KA 4O63O 4CLOB 3ZWMA 4B4WA 2FR0A 1WPQA 2AEJA 3I9LA 5HRUA 3GRPA 1ULSA 4DVJA 1EE2A 2BFOA 2A35A 1LDMA 2X86A 2YHIA 1J0XO 3OA2A 3SBOA 1EUZA 1RM3A 5EIOA 3S2FA 3ZV5A 4CR6A 3L4BC 2DM6A 1ZJYA 1U28A 1YJQA 3DB2A 1DC3A 1IHYA 2HO5A 3Q2IA 3K9QO 1Z6ZA 1ZVMA 3ITDA 2HK8A 1E3EA 4FC6A 4JXKA 3LLVA 2H1SA 1W4ZA 4EUEA 3VZRA 1BXGA 4NJMB 3O26A 3Q3CA 1I8TA 1YOVB 4DPKA 3M2TA 3UKOA 1H2BA 2NQTA 1V9LA 2TMGA 5CDTA 3U9LA 5B1YA 4YT4A 1HDOA 5I7VA 1PX0A 5TSDA 1CERA 2A4KA 2QZ9A 3MJSA 4IDDA 4IIVA 2GZ3A 3ZGYA 2JL1A 2C2XA 4B3HA 1RM5A 2H63A 1M6WA 2I99A 3GDOA 4Z3DA 1BDMA 1CETA 3HWRA 1DFIA 1C0KA 1T26A 3AI1A 1OAAA 4MVJA 1NP3A 3GG2A 1XCBA 2EWMA 1DJQA 4OGWA 1HYGA 2DKNA 3VPXA 4DLLA 3ZV6A 4D44A 3QV1A 2G76A 3DQPA 5DF1A 3RUAA 4IPTA 4WLVA 3OJLA 2NV6A 3VDRA 1SEVA 4ONEA 3UOGA 2BFPA 4IY1A 3NT4A 5KKAA 4GVLA 4UEOA 4BKUA 1TT5A 1JLLA 2YV2A 1IZ9A 2D4AA 4PLCA 2LDBA 1E77A 3ONEA 1WNTA 4O59O 5G2OA 3H5AA 4PLFA 4FCCA 4R1UA 2EGGA 5IF3A 1HDRA 3O4RA 3RUCA 3WLFA 4QTZA 3PJFA 1IY8A 2CVOA 1ISFA 2WD7A 1H0KA 1QYWA 1LDBA 1IPFA 2E49A 2X5JO 3D4OA 4CM5A 3WTBA 3LZ6A 4LGVA 1ADGA 4YYZA 4PLWA 4WLFA 2EW2A 2QZZA 3ANLA 2ET6A 3M2PA 4WE3A 1B15A 4XCVA 1IB6A 3T7CA 3I9KA 4RPKA 1YBAA 5KJFA 3WIEA 5KVCA 3OICA 1IHXA 3T4EA 4GGOA 1WLYA 3IIEA 5JAZA 1QV7A 3L6EA 3JQDA 4CUZA 4FFPA 2CVZA 5JDIC 4RZHA 4R51A 1DIHA 1P1FA 4P22A 3KUXA 5ILOA 4K6FA 4I1IA 1HE3A 4OXKA 1BHSA 1A9ZA 3OJOA 3ZU2A 2O2YA 1Y8RB 4J16A 5MDHA 4CLXA 1EVYA 1CIVA 3I4FA 3NJ8A 4BOYA 2A94A 3KBOA 3AOEC 3EW7A 3E18A 3PGJA 3L4SO 4ND3A 3BZUA 4IGEA 1FDWA 1N7GA 1MUUA 4RVUA 1A9YA 3AFMA 4F45A 4CODB 4CM4B 3Q1LA 2UAGA 4EJ0A 3Q9NA 3OJFA 1V6AA 4LVUA 1QG6A 2VZ9A 1HE5A 2OUIA 2PGLA 4Q3BA 3W8FA 3U09A 3OIDA 1K6XA 5KVVA 3BAZA 1DLJA 3BMQA 1VL6A 2Q46A 4R9RA 2G82A 3HDJA 3PHGA 3R3JA 1GV1A 3C24A 4PZDA 5AXBA 3BMQB 1GYRA 4BO3A 1GCUA 4CM1A 2JD1A 4FFNA 1WVGA 1V8BA 1FDUA 2C5AA 2CVQA 4DPLA 1ARZA 5C5IA 1P45A 3RUEA 3AU9A 2X6TA 1E1NA 4NHEA 3VH2A 4BB6A 5AYVA 1D7OA 1MXHA 4YA6A 2RBEA 4AJEA 5TS3A 5KKCA 4DQVA 4OHUA 5JCXA 3K6JA 3DHNA 3UHAA 3E5RA 4WPGA 3P19A 5ADHA 1Y5MA 4L4SA 4ZGWA 3WGOA 2VTEA 2BD0A 1J4AA 5CDYA 3ZWBA 1N7HA 1YB1A 2ZB4A 4L76A 6ADHA 1HEUA 1NFFA 1SPXA 5CDSA 2OP0A 3BMCB 5KCZA 4J3FA 2WWRA 4OL9A 3DEYX 5H81A 4LW8A 5G0TA 3V8BA 3WMXA 4J9VA 2Y66A 1RM0A 4HKTA 4URFA 3NEPX 1MFPA 4JK3A 4PZCA 2EW8A 5FF9A 3D7LA 4BVAA 3FWZA 3WFJA 3VPFA 3AI2A 4QQRA 5TJ9A 1LEHA 3GMSA 2O7QA 4J4HA 3D4NA 3KSUA 3MTGA 2FPIA 4BV9A 3VTFA 2DBVO 3IC5A 5JY6A 3WX0A 2OFPA 3JYOA 3KOUA 1U3UA 2X5KO 1UH5A 3VDQA 4Y98A 3W6ZA 4E12A 3A06A 4TZKA 3WYBA 4PCVA 3X2FA 4NBWA 4ZQFA 1B8UA 4XJSA 1PL7A 3F5QA 4RPJA 1E7YA 1O9BA 1XU7A 4WNCA 2ZJ0A 1BVRA 2DBRA 3JQGA 4KWIA 3GH3A 5A9SA 3JV7A 3JQCA 5CAEA 1NYTA 3KSDO 1I33A 1MX3A 4IDAA 2VZ8A 1LXCA 1B3RA 2D8AA 4HBGA 4YAIA 4E5YA 2GF2A 3LU1A 4UUPA 4E5NA 1LLDA 3ZWPA 1YH3A 1NPDA 4DRYA 1B8PA 2DC1A 3CMMA 3PYLA 2H6EA 3DMTA 3ICCA 5TJHA 1BG6A 1SB9A 3PHJA 1E3WA 3C8MA 2IEDA 3QVOA 3VC7A 1C1XA 1HTBA 2PV7A 2WJPA 2ZYGA 4RV9A 5H82A 2JHGA 3D1LA 1QLJA 2BI8A 2VYVA 3VZSA 2AG5A 4JN6B 3G49A 4NU6A 4K28A 3UFXA 3W8EA 4AJ1A 1NM5A 2NTNA 3H3FA 4IJVA 1B0AA 1PZFA 3BTUA 4EGFA 2VQ3A 2B37A 4PRLA 4L9RA 2I9PA 4N7RA 3TZ6A 1DB3A 5F21A 1ZK1A 5GY7A 5JE8A 1FXSA 4MVJF 1HDZA 1BXGB 4R69A 4DA9A 5L7TA 3OJ0A 1KEPA 2W2KB 5I7EA 3KVOA 3WGYA 2I67A 4ND1A 3SXPA 5IZCC 2F00A 5JLAA 1U4SA 4DIBA 5CP8A 3PLRA 5I9NA 1JN0A 1O5IA 1V35A 2DBZA 4E31A 3LYLA 1AXGA 1NVGA 2VWPA 3JQFA 2VUSA 1VJTA 4KUHA 2Q3EA 1K89A 1X13A 4HP8A 2HJSA 1KETA 3VKVA 4XGKA 3O8QB 3IKTA 2QHXA 4A10A 4JJFA 1GCOA 4CLEA 4XKJA 1X0VA 1NWHA 2OP1A 4RPGA 2Y0CA 4J91A 2AA3A 3WYEA 4PLPA 1UDBA 1MA0A 1ZKMA 3GHHA 1EMDA 2CFCA 3FR7A 2J5RA 3FNGA 1F17A 2Y05A 2JD2A 2JFHA 4K6CA 1NWCA 1VJ0A 4WGGA 4WOJA 2UUOA 4YCAA 3VPHA 1KOLA 3WMWA 4BNLA 5DOVA 3EK2A 4EJ6A 4OAQA 4EITA 4OQZA 4RVDA 4KOAA 1PJQA 4BO7A 2LDXA 1LJ8A 1T2EA 4PFJA 4XGNA 3V2GA 2IXAA 1HZZA 2E82A 3AJRA 1HL3A 3ST7A 3NGXA 3FBTA 4J1SA 1A7KA 4EYEA 5COQA 3KLMX 1F0YA 1P1RA 3NAQA 5KIAA 5IFLA 1EDOA 3N7UA 4BO0A 5JBIA 2VN8A 2NVUA 4GKVA 4NR0A 5BNFA 1YQDA 4B8WA 5JNLA 3LC7O 2QRKA 1HE4A 3ZW8A 4JCOA 3CZRA 4BO1A 3PP8A 3L4BA 4MIOA 2IXBA 1GQ2A 5F5LA 3DHYA 3GRKA 4B7CA 3FNFA 4RDIA 3OHSX 3WGQA 1LSJA 3VOSA 1GQQA 2FOIA 2O3UA 1NQTA 3U4IA 1ZUD1 4BNNA 1E1MA 3DZFA 1DFHA 3MWDB 4GMGA 1RYDA 5JMPA 1R4MA 3M1LA 5TNXA 4NIMA 4M87A 3GVHA 4UUMA 5L7YA 3F9IA 1DIBA 4QFCA 3D4PA 1Z82A 3V2UA 1Q2XA 2BFAA 3ZV4A 1ZCJA 2JHFA 5T6BA 1VSUA 3OM9A 1PJ4A 2FMUA 2NU9A 3DMTC 1NPTO 4MVJP 3WS7A 5T8KC 2HMUA 4YPOA 3AM4A 4AJKA 4ZQGA 1YO6A 5G0VA 2NACA 2Q2QA 1XWFA 4FSHA 3F4BA 3S2EA 3RSHA 4GPD1 2R00A 3K2EA 1ENPA 3CINA 1PGQA 1OBFO 4KTTE 1Z7BA 4WCDA 3WNQA 2C2YA 4ZQEA 2V7PA 5AVOA 1T4BA 4Z9YA 1CQJA 4I9UA 2E37A 3JQ7B 1IUKA 3JD1A 2Y99A 4J1TA 2I66A 4RVHA 3H3JA 1Y7TA 1BW9A 1YKFA 3UCEA 1VM6A 1DSSG 4F3YA 3INRA 1U3VA 4L74A 2NVBA 5JAIA 3HN2A 5TRTA 4FC7A 2YUTA 3GZNB 5K6AC 3GDFA 5DP2A 3R1IA 1PWZA 3U4DA 3K5PA 4QSMA 2BGLA 1OC2A 1KEUA 4UUOA 5BSFA 4OYRA 2ZTMA 3KYDA 3ZWCA 4CQLB 2EERA 1MC5A 1PZGA 4Z9XA 2P4QA 5JYEA 3PJGA 5L45A 3FR8A 2B5WA 1T2AA 2D2IA 4DLAA 4IDBA 2X9VA 1OFGA 1X1TA 2RCYA 3GZ4A 2HUNA 4LK3A 4LVCA 8ADHA 3IOYA 3ICPA 3KB6A 1HLPA 2C20A 2DU8A 4OIMA 3ZHZA 4F6LA 5A3JA 5CG2A 1W0CA 4AICA 3RASA 3HB5X 3Q0EA 3C7DB 1LC3A 4B4OA 1PJTA 1PJ3A 3GGPA 4EBFA 5BSGA 4IS2A 2VYND 3IJPA 4OSOA 3NRCA 4U8GA 1Y81A 1VE9A 1M6HA 2Y1DA 1XLTA 3JSAA 4TVOA 4MVJG 1KY5A 3AFNA 2EF1A 4YR9A 1GYPA 1I10A 2X23A 1ISHA 1M66A 1ZJZA 3H8VA 1E0DA 4HFJA 3GEGA 3I6QA 3IKVA 5JY1A 1B16A 3GHYA 4R41A 1E7SA 1RJWA 4QX6A 1KY4A 1LSOA 5CDUA 5IZ4A 1K0UA 2DUUA 3GMDA 2I5PO 3ETDA 3A28A 4E5PA 1Q0LA 3F4LA 4E30A 1PS8A 4BMSA 2B4RO 4OKNA 4WECA 1JKIA 4CMKA 4HV4A 2UYYA 5DN9A 5H83A 5C37A 1QORA 2CDAA 3ZU4A 4A73A 3QWBA 2Q99A 5EL0A 3PJEA 1EVZA 2CF6A 1BWSA 4YACA 4U6SA 1R0SA 3KXDA 4OOFA 3NUGA 4D45A 3NGLA 3DTTA 3GFBA 4G2NA 5B4UA 4XYMA 2IRWA 3H2SA 2EP7A 5ENVA 1IULA 2HCTA 3E82A 1NR1A 4ZU3A 1P3DA 2BHLA 1P1JA 2HK9A 1TEHA 4RGBA 1B7GO 2HDHA 1ZEMA 4BHTA 1Q0QA 1T2CA 3ROMA 1GU7A 1I24A 5JW6A 2GZ1A 3V1TC 2I3GA 4M86A 3TZHA 1PGOA 1GD1O 1EQ2A 5COAA 4JGBA 1XG5A 2GYYA 1NFRA 4Q39A 1E7QA 4NI5A 4XGIA 3SJ7A 4XQGA 1O89A 3WNVA 4GAEA 4MOWA 1OMOA 4BQPA 1KVRA 5JPIA 2EHDA 2D5AA 2WYVA 1OZAA 3L6DA 3PK0A 4YT2A 3AU8A 3BHIA 4II3A 4LISA 3QE3A 1ZSVA 2FSVA 3L77A 3ABIA 2D5CA 4DLBA 2OO5A 3EVTA 3RBZA 3EMKA 3FN4A 3ZCXA 1Z74A 1LTHR 1CRWG 1DXYA 4ZICA 3JQEA 3QWFA 3WFIA 3KSZO 5DCUA 1JDJA 2DFVA 4J90A 3V5NA 3HDHA 4XQ9A 5DCWA 3I9NA 2HMSA 4J2HA 1K6JA 4WLUA 5BSEA 3L9XA 4ROSA 3N58A 4QXMA 4KWHA 4ALMA 1C1XB 1GAEO 2NM0A 1YONA 1Y1PA 1YDEA 2EKPA 2I65A 2V6GA 4WEOA 3LT0A 4NDNE 5A06A 4BNTA 5CHEA 4TROA 3VH3A 3HHPA 4H16A 2J5QA 5U1PA 4CLHA 4XB2A 3WBBA 2AE1A 5FFFA 4LMPA 4PLGA 4OOEA 2PD6A 3RUHA 4Z9FA 1DHRA 1DHTA 3F47A 2PKRA 2IYPA 1E7MA 1I0ZA 4IM7A 2QG4A 2PWZA 3WDSA 1Q1NA 3KYCB 4Y8VA 4FFMA 3ZWVA 2NNLD 3DR3A 3F1KA 4YQZA 3WWYA 5CPFA 1X7DA 4I08A 4DTIA 3OEYA 3UAGA 4MKZA 1PGNA 5JO9A 1ZIDA 2EP5A 3BMOA 1L1FA 2DLDA 3R3SA 3ZWYA 4AJIA 4OH1A 4NG5A 3H2ZA 4R3NA 1LDEA 4YJFA 4BNZA 1E5LA 3BHJA 4WUVA 3WB9A 3GZNA 1I3LA 1H9AA 2C0CA 3DBRB 5HA5A 4LCJA 1QKIA 1DIAA 4MVJI 1YQXA 3AUUA 3JQ7A 5L51A 3RU9A 3RFVA 3E03A 1UAYA 3E9NA 3RKUA 1PJ2A 2G0TA 3D5TA 2ZTUA 3R6DA 5B4VA 3GQVA 3JQ8B 1EK6A 3L9WA 4P4LA 2P9GA 3HSKA 3IP1A 3H4VA 4CMHA 1VL8A 2DBQA 3HDYA 3ZDFA 1ADBA 2G5CA 2VHYA 2GN8A 1I3NA 2EJVA 1SB8A 4B7UA 2BH9A 5K9ZA 1H94A 1KC1A 2VNSA 2NLOA 1U2DA 5F3RA 3EVNA 1H5QA 2CUKA 4B4UA 3OIGA 4MKRA 1LA2A 3GA0A 3RWBA 4YWJA 5DZSA 2PD3A 1PEDA 5JAMA 1BDBA 3DONA 3O9ZA 3ONDA 4XQEA 4IS3A 4AL4A 2X22A 2E4AA 1RYEA 3ROKA 1GV0A 1C0LA 2VHZA 4IDFA 4CLOA 2IZ1A 2C7GA 4HUJA 2FR1A 4BNKA 1LRLA 1PTJA 4B7XA 1ULUA 4XIJA 2ZB7A 1ZSNA 3GF4A 3PZBA 4R4JA 3LLSA 2UVDA 2C54A 1UXIA 2BRUA 2GCGA 8LDHA 1JA9A 1U5AA 3BIOA 3PFWO 4CPDA 3VTZA 1V0JA 5EESA 1U1IA 3PQEA 4QEDA 1H2HA 3NDIA 3VHRA 4G5HA 1ISIA 4CM3A 1GDHA 4EDFA 1B26A 1G0OA 4BKQA 1N9GB 2WSBA 3HZZA 2FHSA 3D5QA 4Z0PA 1ZMTA 3DL2A 4AJ2A 4Y6RA 4BNYA 4RVSA 3PHLA 2AMFA 1DRUA 1N92A 3AM3A 2ILTA 1P77A 3UN1A 4BO2A 5C7OO 5ITWA 1B2LA 1BRMA 3QLJA 1O95A 1KEVA 2QX7A 3K8ZA 5GZ6A 4DWVA 4LRTB 1EVIA 4JBGA 2Y68A 4CM8B 5LDHA 4CLRA 2QRLA 5CEFA 2EIHA 4OXNA 4E2YA 1XU9A 4U0JA 3GOHA 4CMEA 1UUFA 1R15A 1LC0A 4CV2A 3O8QA 1P0FA 4I9HA 2NADA 1U4OA 1PQPA 3GG9A 1SNYA 3LK7A 1QLHA 4J0FA 4R16A 2DTEA 5HS6A 5JS6A 3UGKA 4EUHA 3KRTA 3TSCA 7MDHA 2VYNA 1LQUA 3D3EA 4DGSA 2RAFA 1BXZA 4CLDA 1GFSA 2O48X 2WD8A 1T25A 3GVXA 3HDQA 1XHLA 2A92A 3EHEA 5T64A 3ZNPA 1E3JA 3H9EO 4UVEA 4Z6KA 4RVFA 1VRWA 3OQBA 4Z3KA 5G0SA 3MTJA 2DT5A 1UDAA 3FPCA 3SEFA 3KEQA 2J3IA 1R6DA 2XPCA 4RDHA 2O3SA 1ZFNA 4M8SA 3JQBC 2Z5LA 4M49A 2PKQP 2OZPA 3P7MA 1WDLA 4J7CA 2Q1TA 2JKVA 4L0QA 4UVGA 4XYEA 3BTOA 4GWKA 3HJAA 5G0WA 5LDGA 4DMMA 5A03A 1KVUA 1DBVO 2OOSA 4II2A 4BNXA 5IXYA 3PTZA 1E3WB 4P4NA 2NUAA 1E3LA 3DTYA 5I7FA 5BNTA 4GMFA 4S1VA 4JBHA 3KYCA 3JD3A 1AGNA 3QVXA 1ZH8A 3VPSA 2J3HA 4GBJA 3RD5A 5L9AA 1NX6A 4YEDA 2Y0EA 5TLSA 4WLNA 3Q6IA 3AOGA 1XGKA 3HE3A 4HY3A 4IMPA 5MGBA 1IZ0A 4CL3A 1NFQA 1VC2A 3CIFA 4NZ9A 2FPGA 3RJ5A 4NMHA 3S2IA 2Z95A 2J5KA 2R2GA 3C7AA 4BNGA 4XD2A 2VUUA 3IMFA 1C1DA 2YYYA 4N54A 3RVDA 1KBZA 4YJGB 4XB1A 5IDYA 3IQDB 4XR4A 3RFXA 5DBFA 1WP4A 3UXYA 5G4KB 5JFOA 3Q2KA 3PRJA 4MKXA 3TWOA 2O23A 1TXGA 2OL4A 3LSYA 4IBOA 3QA9A 4J4BA 4BO5A 4E5MA 4ZQHA 5ILGA 4BNUA 5EPOA 1X14A 4W4TA 4OQYA 4A2CA 3OJEA 1DLIA 5GZ1A 3GUCA 1QYCA 4MVJE 2Y0DA 1XYGA 1H6AA 4BB5A 4YVFA 2NU8A 2FP4A 1A7AA 4TMFA 1AHIA 1PSDA 1ZNQO 2IDZA 3DZHA 2W2LA 3PIIA 1P33A 1Y8QA 1H9BA 1HF3A 1LLCA 2GUGA 2P5YA 4CQMB 4UUNA 3OSUA 3W4KA 3ANMA 4CV1A 1ZBQA 2AE2A 2O4UX 5IZCA 3U3XA 3BMNB 4IUYA 1EUCA 4CMJA 4I5EA 5KNLA 2ZIZA 3AY6A 1M76A 3AI3A 1P9LA 4ZRNA 1ADCA 1EBUA 2QRJA 4RQUA 2P68A 1RWBA 3C1TA 1GYQA 3LC1O 2UUPA 5COBA 1KVSA 4FFRA 3X2EA 1LSUA 5KWEA 2GO1A 2Y93A 3I23A 3FWNA 4RPHA 1GY8A 2YFHA 5B37A 2X4GA 5CDGA 1FJHA 2PKQO 4RF5A 1E6EA 1DIRA 1JKJA 3QY9A 3QSGA 2DVMA 4WCFB 1N1EA 4E2XA 1ZW1A 3SC6A 3TF5A 1O0SA 1SBYA 4GX5A 4DC0A 4ESOA 4W6ZA 4MINA 1UDCA 4HNGA 2F1KA 5I7SA 1XELA 3OIFA 3QQPA 3VZPA 3W4IA 3QRWA 1PZEA 1T1SA 2GSDA 3BHMA 2BLLA 1FK8A 4LSWA 4Y6PA 1UP4A 4MIEA 4QFDA 4OSPA 4UREA 1W8DA 2W8ZA 1YBMA 1EE9A 2O4CA 3WR5A 4DUPA 1P0CA 1JWAB 3ADOA 3S55A 2IZ0A 4ZRMA 4XRRA 1Z45A 4E5KA 5HM8A 4U6QA 4CMIB 1N5DA 2PR2A 2PFGA 3I9JA 4B8ZA 4BKOA 3IP3A 2ZTVA 4XYLA 3KYBA 5L53A 2X9NA 3STHA 4HFMA 3P5SA 1DRWA 1BGVA 4M54A 4RLSA 3JQAB 3RKRA 3NJ4A 5DCYA 4GWGA 3JQ6A 1I3KA 1GADO 2AG8A 2WYWA 3BYZA 1DRVA 4YBZA 1PR9A 3S2GA 1KYQA 3PEFA 5EINA 2CMDA 3UW3A 3G0OA 3FCOA 1JKFA 4OKIA 3WGHA 2P91A 3CKYA 1I2BA 1UXKA 5B4TA 1Z7EA 3CH6A 1G1AA 3LDHA 3MJ4A 3PWSA 3QHAA 1JVBA 3I1JA 1PS0A 3DBLA 4JJIA 3FD8A 4NBTA 1ZK2A 1NHGA 3H9JA 2ZB3A 1K3TA 3T4XA 4AJLA 3DOOA 3INTA 1V3TA 4Y6SA 3EZLA 5ER6A 5L3ZA 5I8WA 4DPMA 5I9LA 5KOIA 1Y6JA 3JYNA 2GDZA 1HE2A 1JWBB 3B1JA 5T5QA 1EZ4A 3WJAA 2CDCA 2AEMA 2H5LA 4ALIA 4PG8A 3V2HA 4NU5A 4FR5A 4ALKA 4ZD6A 3ZU5A 4I5GA 4WNIA 1F8FA 4YAEA 1MLDA 2P2SA 4CQLA 2EGHA 3ROPA 2C29D 4GI2A 1WW8A 9LDTA 1TT7A 2HAEA 2YV3A 5A5EA 1YGYA 3VH1A 1FMCA 1IL0A 2W2LD 1E7WA 4CMCA 2VZ0A 3MOGA 3KLPX 2B35A 5I9MA 4XDYA 1GQYA 2O50A 3ON5A 4ND4A 3WQRA 3OMLA 2O3JA 4PLZA 4FN4A 3HUDA 1M67A 3L6OO 4ITUA 3TL3A 3EY4A 4YJDA 3SJUA 2QYSA 3BTSA 4AVYA 4KP7A 1XA0A 2Y1GA 3CSDA 5C7LO 3WXBA 4TRJA 3QWHA 4FDAA 2VUTA 4E2ZA 1FF9A 2VOJA 2HLPA 1HZJA 2HSDA 2ZJ1A 3VAZA 2G1UA 1HSZA 2PLAA 2BKAA 3E1KA 4NJMA 1BVUA 3G1UA 1R0LA 1YWGO 3FRJA 5A5FA 4J9UE 3FBGA 3H9GA 1DC6A 5KJ1A 3DFUA 3OETA 1ENZA 2W98A 3ZWOA 3JTMA 5BSHA 1RPNA 3NTRA 1J49A 2HMTA 2VWQA 4HFRA 1LDGA 4L8VA 3WICA 5JO0A 2FRDA 5DOZA 3E6AA 3GR6A 4HX5A 4MVJD 4IXWA 3WGZA 4J2OA 1EFLA 4RQTA 3UF0A 3QW2A 4RPLA 3PFFA 3IL2A 2HU2A 2ZQZA 1SZJG 1J6UA 1YS4A 3UVEA 4PN3A 5IAAA 4JP2A 4XYGA 3NDJA 2AXQA 2VRCD 4NK4A 4YQYA 1SAYA 3SLGA 1CWUA 1TB4A 5JDCC 4ZVVA 1D1TA 4O1MA 2BI7A 3WSWA 1H93A 4FS3A 1YL6A 2BGMA 5KTKA 3EZYA 2Q4EA 1WDKA 3MJCA 4OO3A 1D4FA 2OORA 4RF2A 1FDVA 2RHRA 4ID9A 1CF2O 1ID1A 2PZJA 2C59A 2XOXA 5HTOA 3ZH2A 4GSLA 4KDEA 2GN6A 5A02A 4GL4A 5L40A 3NKLA 4E0BA 1EVJA 1YBVA 5L4NA
chains in the Genus database with same CATH superfamily
4X45A 5IN4A 2AYZA 4GOJA 3VUEA 4JC5A 4Q9LA 1IYZA 5JNTA 4OXQA 2VP3A 2D2XA 4RE5A 1YR9A 2Z9CA 1FZQA 4QYSA 4JEHA 3JD4A 1MOPA 2AD5A 2IE0A 3BFVA 3PQ8A 1GRVA 4UU8A 5CLHA 1FQJA 3VVBA 4KWCA 4AURA 3MEQA 2GPBA 1JH8A 1J1ZA 2P6NA 1UXJA 2GDJA 5FYDA 4DADA 5KYTA 2GEUA 3U7GA 4QYIB 3VVCA 3V7YA 3WMWA 5SZIA 1FYFA 2J0UA 4YJHB 2N42A 1DV2A 3GGGA 4F1WA 1DCFA 1KI4A 4KIWA 2J3MA 2LXNA 1DKLA 1BEEA 1JYSA 3S28A 5DBEX 1ZSYA 1I36A 2QXTA 3I01A 5AW0A 5HKLA 3TKYA 3TFOA 3WB1A 5ESRA 2PLWA 3N76A 4BYGA 3BE8A 3ZGXA 4JLWA 4BL5A 1DXQA 2C0PA 3H8SA 1WBDA 3WBJA 3WP0A 3ENWA 2BGIA 3GGCA 2YV5A 4U2DA 4D4LA 4AU1A 3HI6A 4NS1A 3HG7A 1ZVQA 3E48A 1QSGA 4LQDA 4CLRB 4RK7A 2OBYA 3T0GA 1RI3A 3EEYA 4WASA 1ESEA 4JI0B 1FP7A 2RK3A 1FFAA 4FMDF 2PSFA 4HAWA 1S7CA 1TQ8A 1ZU4A 1EUCB 3TKLA 4DUYB 2AFRA 2QQ5A 4P7JA 821PA 2K5UA 4TV8A 2LCFA 3C6YA 4EH1A 1MFZA 3TSYA 1S3FA 1VLQA 4CQMA 5E0OA 1V41E 4O4HB 1GQRA 5DBIA 4GMDA 4H7HA 1PFQA 2ZG6A 4JLPA 1JHOA 1N6LA 1CEYA 3MCTA 1N3BA 1QPBA 1C1HA 3NV9A 4V02A 3Q5GA 1R6XA 1O03A 1PI3A 1XKQA 3CWQA 4Y1RB 2XUOA 3HCNA 3ZI0A 1B1CA 4M1OA 3WZMA 1RLJA 1KH2A 4WKPA 1NXPA 2JZCA 5CVVA 3T06B 1MMFB 1XA3A 4JBIA 3NEAA 1EXNA 1WM1A 3PU6A 4OK3A 2DG2A 4ZI5A 4E14A 6ABPA 2AQHA 2O3RA 3ASZA 2WWXA 3V4FA 2A9PA 2GZAA 1DO8A 2O2ZA 4IDEA 1O08A 1MZVA 1QFJA 1PW7A 1YU6A 3GDHA 4KVGA 4TVBA 4YRTA 3WK9A 2J7PD 2IUEA 2AQ8A 5EJIA 3ANTA 3JU3A 3G2MA 3L4KA 4FCTA 3NKFA 2PQ2A 3C0KA 4G41A 5B5SA 1QDLB 3W2TA 1FDRA 2WHPA 2DH5A 4UOZA 4QJ4A 1DJLA 2VTVA 4YRRA 2J30A 1WZCA 1TTPB 2I6TA 2P35A 4IZHA 4L72A 1J5XA 2BEWA 2O5RA 4IVRA 4P58A 4H2DA 1E20A 1AB5A 3T35A 3ZR4B 1SGWA 5I48A 3DOFA 4MGZR 3ZNNA 2JI4A 2VCYA 5TF4A 1UM9B 1IVYA 1Z75A 2AWNA 2Z3VA 3W5IA 3CLTD 1SHKA 3CLVA 3AJEA 3E15A 3KWJA 4N8SA 3UPDA 3ZCVA 1ZD8A 2DYKA 3PCXA 1L4EA 4DXDA 4LZLA 4DUGA 1X7XA 3HDVA 2W0MA 4BTVA 1Y9EA 3OZEA 3T7SA 3LUHA 4PAOA 3WBFA 1DEHA 4XIYA 1QVVA 3GZTB 5A4DA 2ZRLA 4EHIA 1LLFA 2ZM5A 5BQFA 3OLWA 4TV8F 4CCYA 4U4AA 3I3OA 1QIJA 2PGAA 1G9TA 4N3CA 1RXIA 1KS9A 4R9UC 1FTQA 4DCOA 4MMXB 5D6NA 1ZONA 3D7MA 1A2OA 3STVA 5KJCA 1UBNA 2P5UA 2G8NA 5ELLA 3N1UA 2IPOA 4KREA 3C4QA 4N7MA 1R3UA 4QECA 2Y71A 4WN9B 2JAPA 1KZ1A 4FWBA 4GSYA 1E3SA 2I2DA 3F6YA 3FIUA 5LQUA 4UQLA 1T5TA 3H5NA 5A9TA 1IPEA 1JTVA 2ETVA 1PUXA 2H59A 1BW9B 2IYZA 4RORA 1KXJA 5HEKA 3OCUA 4D92A 1V3VA 5LQJA 4DLWA 4UOEA 5C7IO 3HY4A 4O5AA 1UJ6A 4DDMA 5KJ6A 1AHNA 1AKWA 1L6RA 1THMA 3DEFA 3N8DA 4R01A 4QPNA 1N36B 3IEKA 3L7KA 5C32A 1SVKA 1CDZA 1M2FA 4I1VA 3CX3A 1FQOA 2ECPA 5FPYA 4ZCPA 3IUSA 2J5XA 4BV3A 3A4MA 2E5FA 2ZUCA 3EPKA 1ZVKA 4Q3DA 2QRVA 4RA6A 1A8QA 5EZ5A 1W36C 4DB4A 5ALUA 2YHIB 5DNDA 4CR8A 5K5EA 1N9KA 4G8JA 1PR3A 2IEIA 2XWSA 4QUKA 1UKVY 1YS9A 2CE7A 3KHUA 4LWPA 3SCZA 2BH2A 2RHDA 1BJRE 3E9DA 3TXYA 3D1JA 2WKWA 4P38A 1R12A 2H5JA 3KZVA 3Q6MA 2ZRFA 5AHWA 3WWPA 4CYMA 1TVEA 4BRUA 4LDQA 4ZN6A 5KX5A 5CLJA 4B6PA 1ZC4A 3EFOA 1PD0A 3TLGB 3PYXA 4MRMB 1A27A 2FUG1 3TB6A 1GKIA 1C5KA 1PFGA 3KP1A 1HNZB 4ED9A 1PJBA 1TAQA 4P4SB 4YROA 3ICOA 4IGFA 4LX8A 5DGCA 1R8XA 4RS4A 2J45A 1BO6A 4BU0A 1SBIA 1CZLA 1DQRA 3MJHA 3R0XA 3SHVA 1NNSA 1PTKA 2BJHA 4DR3B 3LF2A 3U7IA 1NVTA 1PWYE 2XGOA 3KB2A 4MWOA 2ZUTA 3RO7A 2W6NA 1TDJA 2HPVA 5HMMA 1IAVA 2IEYA 3EC2A 1RAFA 3IDQA 1P18A 1JAXA 1OT5A 2HSGA 2QLLA 3KTOA 3NONA 1CUFA 2PO7A 5F12A 2FPPA 1X1CA 2FW0A 1T24A 4G5RA 2BEUA 4WBNA 2ZCVA 5JI3E 3FPLA 3FTQA 5BVGA 3ETGA 5TT1A 2WIAA 1B6TA 1HT0A 2DUJA 4I3FA 4EZBA 4EVRA 1ISMA 3MQ4A 4ZO7A 3V1LA 2XTZA 4HWSA 4DN6A 1H4QA 2AN9A 2O2SA 4YT8A 1W0JA 5JWOA 4QT0A 1KDOA 4Y7DA 3KFVA 2P62A 1NRXA 1QCYA 1U2GA 3K73O 3OCWA 5G1OA 1C50A 2ZPAA 4E5DA 2XKAA 1X1QA 2GHIA 2HK7A 5TQ0B 3UATA 1AKRA 3QLVA 5IBPA 2Z1MA 5KQSA 2P69A 3HWWA 3IQEA 4EO9A 4OB7A 2YYSA 3BB3A 3PI7A 4TUYF 5CB4F 1AUQA 1QHYA 4Q3NA 5B55A 4PWYA 3K6SA 2ZI5A 2VDLB 3GCXA 3EVZA 3WSVA 3DE7X 5EVJA 1LX6A 2VRBA 4HNSA 4PSUA 4LTMA 1OWMA 4NK5A 4IKPA 4JH0A 1PNRA 2XADA 2YDXA 2YQ4A 1K8ZB 1LNQA 3I6BA 2C7PA 4GP9A 4KQIA 2IYSA 1N6RA 2DPHA 1ZA1A 4L3WA 1W2HA 3IAEA 4G24A 4BGDA 1XPJA 3EIHA 1HNNA 1CUSA 2XOEA 3JCZA 1IONA 4IIJF 2CJWB 2YUIA 4R7GA 5FPKA 1AK2A 2AJDA 1JXAA 4MGHA 4WEQA 4BBPA 4M89A 4CF5A 6NULA 2ONZA 1U8YA 1GO2A 1ONOA 1P4AA 3HXLA 1E96A 4FZJA 4MS3B 4TSKA 3ECCA 2BF4A 4AG3A 5KYXA 1U99A 2P77A 2ZYHA 4IUCS 5G4LA 4ACBA 2X7HA 5AESA 2EFJA 2XF2A 2DB3A 1G55A 3JQFC 1WCV1 5ADVA 5IJZA 3P9KA 3C1OA 3HJTA 1AUOA 1UBOS 5BMVA 1JEQB 2CDNA 1PUJA 2WAYA 4D42A 3AQIA 2IKSA 4H17A 2CDRA 2JIQA 3FFWA 4BQIA 4TYNA 1IQ0A 4IICA 1WMBA 2ZIAA 4EZIA 1TQDA 5FOSA 2VK4A 5E3JA 3FTNA 3ZVNA 4RF4A 2JLVA 3TRIA 4FSXA 2DERA 3DL7A 3L8HA 3I09A 1DUVG 1MAVA 5ELXA 3OSZA 2B9VA 4V1CB 4NH4A 1GU1A 4P4TA 1M5RA 4K3VA 2OGUA 2I7XA 1J97A 1ONNA 4PQYA 5NLLA 4M21A 3TGLA 3PPXA 5B1HA 3IAHA 3SQMA 2B1QA 3VO1A 3EC7A 1D1PA 1Y4SA 2CHQA 2P4HX 2B5VA 2NYUA 1ZGHA 2I8AA 3PVZA 3INGA 4IO0A 5E7MA 3U5TA 1KIMA 1E4OA 2R8ZA 1GZDA 2Q0XA 3BFJA 2X4IA 3DOCA 2C58A 3WLKX 3JQAD 4PPNA 1M0TA 2VBCA 3RARA 2GFQA 4NPHA 4TN5A 1DP4A 2FDRA 4MVYA 5IFKA 4FEGA 2PTHA 1DT5A 3UHPA 5EKDA 2WJ6A 1FFYA 4UM9B 1K08A 5FUVA 4Q7LA 3VPDA 1O7JA 4W7HA 4KAXA 4JT9A 1JS1X 4X1IA 3T9CA 4Z51A 1I9CA 4RGQA 3M1AA 3OE5A 1P74A 3FOZA 1PWXA 3SJAA 3S70A 4Z1OA 3A0UA 3ENNA 1P60A 3LCMA 1RW4A 2GAAA 2QUHA 4IKEA 4XWAA 2PSDA 1HRDA 2Q27A 2WAXA 2QSZA 4EOGA 1WLSA 1P72A 3IT1A 1JF8A 4MR7A 3ZWNA 4FGUA 4RA9B 5B7NA 2OSVA 1HQCA 1T3HA 3CH5A 1SCQA 2ZOSA 2JASA 3HADA 4R1NA 4YJ2B 4ALJA 3MT8A 4OK5A 1US8B 5HBRA 1F1BA 7ABPA 4U5QA 1ZH0A 3EXEB 4IL5A 1N5LA 4UCXA 3OH8A 4PFQA 3U3JA 1OAKA 3A9RA 4W7IA 5BO5A 3VC3A 1F1JA 3U56A 1DOZA 3JAWB 4P54A 4G65A 3CUEF 3JD0A 2WSSA 3ASVA 3WGLA 5M34A 1ZNXA 1RHMA 3LY9A 2C3YA 4NICA 1T4DA 1PF7E 1XR3A 1Y8CA 3AVPA 4QGSA 4GX0A 5B3LA 1K66A 5IEJA 1SR8A 1JR4A 3AF4A 1MC8A 3KAQA 2HSJA 2ZWVA 4X8OA 4AN1A 1ZGJA 2GRAA 2JFBA 2QZJA 3RYIB 5CFMA 1BTOA 5KQLA 4X1KB 1XN4A 5F4ZA 4ENTA 1ZXLA 1G5TA 1WXDA 2J5BA 3NR2A 1W73A 4FOLA 2ZETA 2IYWA 2POQX 1WBJB 4S1TA 5F1PA 3ZK7A 3RVBA 3LWDA 3VV3A 4KZKA 4TM8A 3E23A 4BP9A 3EXHC 3LQYA 4E03A 3F6SA 1KJWA 1EH5A 1TE2A 1OAOA 1SVMA 1NF8A 3OQHA 1UMCB 3MUOA 4QAJA 1OC4A 1J9EA 1GG9A 3N2EA 4GMHA 1Z15A 4I9NA 4QGBA 2ADFA 5DHRA 2HJWA 3RLFA 4JYCA 4WJZA 1PDWA 4PG4A 5DX0A 2O8DB 5HJ5A 1BE8A 3SKYA 1E8MA 1DWPA 2PJUA 4S1NA 3OM8A 4INJA 4YONB 4JP8A 4HQ6A 4WLEA 4X41A 1YZLA 4TWZA 3X1ZA 2BFEB 3NTOA 2EKLA 2D5LA 3KLNA 3D0OA 4XSVA 2WWYA 3K92A 4MRNA 2GJAA 2QW1A 1ZNYA 3TLGA 2ZBVA 1GA4A 5JCZA 2ECOA 2ECQA 1YB4A 1CS0A 3AB3A 3IEUA 1Z5GA 5D3MB 1LI5A 1L8OA 3LBHA 2YFQA 3A7DA 3SGLA 3WNZA 4K1XA 1DAOA 1QHHA 1V71A 3EGCA 4AULA 1N8SA 3IOBA 5KWVA 2OB2A 1PL0A 4IJUA 1I13A 3D7NA 3OC6A 2OXTA 1F2VA 1ZM4A 2I6GA 4AMZA 4BKPA 4NZZA 4Y1FA 2I6UA 4C87A 1RI1A 1KTIA 5FADA 2O8CA 3ZNOA 2Q1UA 1BEZA 2QXUA 3JWJA 2MMCA 2RH5A 4JC4A 1IHDA 2ZB8A 4IOMA 3VR6D 1NF3A 2OPBA 5KSWB 3D6UA 4YP7A 1TA9A 5AXAA 3P4UA 4W99A 4CE6A 4H08A 2V1XA 4D3DA 3E9QA 4RTNA 5DYGA 2JS7A 3KC2A 1S2GA 3IESA 4S1OA 2NYAA 4HN4B 1OWLA 4JVNA 4KQEA 3QEJA 5EIBD 1ESZA 3SLKA 1JBQA 3TL2A 4E6PA 2G17A 3I1IA 4N9WA 5FO1A 3ZQJA 1N2SA 5LZ2A 3HO1A 4JOQA 3IJRA 1GWNA 2F43B 3LXMA 4DA8A 1L5QA 1Z37A 5IBCA 2GD1O 5JMWA 3HZRA 5E1OA 1QR2A 2YBEA 2ZJOA 3G59A 1PJSA 4F5EA 4YRFA 2A7QA 4Y2UA 1E58A 5ENZA 2FEWB 2FMIA 4TYMA 4YAWA 3AW8A 4LZOA 4MV9A 3LVRE 3OF5A 1X7ZB 5A71A 2WQZA 1SKYB 3B1XA 3V1YA 2QRZA 1NATA 3DDOA 2GESA 2YIJA 1SU6A 4GQAA 4JBXA 1DBPA 2O2DA 3OO1A 2YFYA 3JPYA 4AJJA 1J9GA 3EF3A 1Y5RA 1QHGA 1TI7A 3VPGA 2NU6B 3CLKA 3U3KA 1Z2AA 3W9BA 3ZHBA 4ZVNA 1UPFA 2G5PA 2Q5FA 3KQTA 2EDCA 2GX6A 1YRBA 2P2LA 2V5UA 3C6KA 5BXQC 2VNKA 3B70A 3I2IA 5JCJA 2Z6UA 1VBFA 2DP4E 1WMEA 3R3VA 1UOOA 4C4TA 3L8ZA 3OQ6A 3TQOA 1TMYA 3LSTA 3OPVA 4XYBA 1N75A 4YV2A 3FFAA 4J7UA 5LN1A 4ZGGA 1Z6QA 3N5CA 2NO9A 4RA6B 1KVQA 1JHMA 4M7PA 1Q95A 1U5CA 3LUKA 3HUEA 3ZD9A 3I83A 2VL7A 2VYFA 2ZBGA 2VAXA 2BP7B 1FTYA 4IJKA 3P0EA 3KJGA 4K1LA 1CYEA 3ZGNA 1I3OA 2PY6A 4BP1A 3QJ5A 1HETA 2I78A 3RB8A 4LTNA 1SIBE 3WZLA 3EBOA 1U7HA 5TVGA 1Z26A 2FPMA 3PQFA 1N4DA 1XZFA 4GSKA 4G23A 2XWPA 3GJRA 4RD2A 2VHXA 3IALA 2JAOA 4YCJA 5LQSA 3QKIA 4URYR 3VOAA 1UEXC 1ID8A 1SC6A 3BDVA 2JARA 1L4LA 2JVKA 2KB0A 3KAKA 4IDCA 3AKYA 1JHVA 1P6QA 3EG9A 4GPBA 3G17A 4I50B 5AM5A 3N59A 2W4QA 4ZT3A 3O8DA 3T1TA 1GNLA 5CM9C 2JZNA 1A5BB 3QFHA 4YV1A 3H16A 3CM0A 3WKEA 1RFGE 5JS8A 2UDPA 2YV4A 3PSHA 1J8MF 3ES9A 2WV9A 2YCLA 1DXOA 1S5PA 5C4GB 1EESA 3SYMA 3V1KA 2BLNA 1GDDA 2FZEA 3J7TA 3PWZA 4HDSA 4P7FA 5K03A 1NY6A 4BWGA 4UDXX 5KTPA 2D3WA 5C1BA 1T15A 4QJ3A 2N47A 1JU9A 4GF5A 5ETJA 4X62B 4ES6A 4WXMA 1GAXA 3Q7IA 4HADA 2JIMA 2VJOA 4RDXA 1L7BA 2WWVD 2ZRJA 5CVTA 3NP9A 3WQHA 4B81A 3I92A 3O8OA 1GR1A 4ML3A 2CD7A 4GMXA 1GTL1 2CZQA 4N5LA 1X7ZA 3WB2A 2R5NA 3I1FA 4JA0A 4BP3A 5DLQC 2FI1A 1ZXXA 3PQDA 4J4TA 5FPQA 3T9AA 1P9RA 4PR0A 2PJDA 4Q3AA 1HSOA 4AZVA 4BZPA 5AJZA 3I30X 3AWIA 1U2EA 5JS2A 3O94A 4QREA 1BXRB 2JFGA 2GPJA 3NVAA 2CXHA 4U7WA 2ZSKA 2EYUA 4LDAA 1GUZA 2C8JA 2JATA 3WOHA 5A4IS 2V6FA 1VDMA 3CRVA 1OILA 5BR7A 1LI7A 4MQ4A 3TFQA 4MQLA 4CM4A 2PUDA 4HLCA 4AY2A 3K9CA 4QOFA 4AP9A 4G1VA 3KV3O 4M76B 3T94A 3GIDA 2QTAA 3QBDA 3LUCA 4DA4A 3KR1A 1V96A 5FI3A 1IXZA 1VPDA 5D7BA 3GVCA 2GASA 2WU0A 4UCWA 3KU4A 4EATA 2HIGA 3PTLA 2DR2A 3ITKA 5ALRA 4HVCA 3A11A 3QV2A 5G3ZA 5EZYA 4KZPA 4OX9Y 3JAWA 1T0UA 3I45A 4BZWA 2AF4C 1CUDA 4IMRA 4S2UA 1J2TA 1JUDA 3MJEA 3P2YA 2IHTA 4C03A 2EL9A 4RNDB 1IK6A 1SUPA 1ISRA 1V7PC 2HNBA 2C5LA 3CRMA 1MC4A 3OFKA 2H92A 4Z9BA 3T7AA 2Y1EA 2OD2A 5K3EA 4GL2A 1YFZA 3IDSA 3ANXA 4EAQA 4WFQA 2YMMA 2SCUA 4B74A 3CMCO 2AQKA 1POXA 4ZQCB 2OSBA 3DC2A 4YASA 3TW0A 3WYCA 4CWAA 4DQDA 2VJBA 3LUFA 4TQAA 2BF7A 5KYWA 1I32A 3LX6A 2W42A 1GL7A 1L3IA 1M5UA 3D6AA 1CF4A 1G9XA 2R5FA 2ACVA 5THXA 5BW8A 4P2GA 3U1TA 4DILA 2IOYA 1XDGA 5ALTA 1AKVA 1PS9A 4AJPA 4GNKA 5JMTA 3TTVA 2VWHA 3BRWA 1CUCA 4FT2A 3H8JA 3UB3A 1RU3A 3HGTA 3AR4A 1T8YA 1YA4A 1LBTA 2CD9A 3NAZA 5J5CA 2J8ZA 3B3QA 3DMFA 1UP7A 3IYLW 4YRDA 4P33A 1NE7A 4UNPA 1LVGA 4YQFA 1RC8A 1VBNA 2WE7A 4QBHA 4GWLA 3SVLA 3K1YA 3G5LA 3JYQA 4B31A 2GERA 2Y8EA 4MYTA 4PCLA 3UKJA 3ZBTA 3DDNA 2E4UA 3DUWA 2Z6QA 1K88A 5DJ5A 5NULA 2OZLB 4O5OA 2XQVA 2ZIEA 3Q72A 4C3UA 3RVRA 3HGQA 3EJWA 1EWKA 1V1MA 3EE6A 2WU3A 2ZZKA 3AFHA 2BI4A 1LW7A 2ZS9A 2QUBA 4E3ZA 5IAAA 4YP9A 4ND5A 1UPCA 1CFJA 5B53A 4PTLA 2XKJE 5JIBA 4HWKA 3LOPA 5A9RA 4N7JA 1QX3A 3D1VA 2B4TO 3EARA 4F2HA 4AJHA 4DC9A 5F52A 1QU2A 3ECAA 2DUNA 4G26A 1E94E 4Q37A 5I7HA 1JTEA 3A1EA 4PGFA 4C4ZA 3ICQB 2Q9BA 2NV2B 1TCVA 1XDBA 2D00A 3AR9A 4CW7A 1Y3IA 5F1YA 5JR3A 2PGJA 1MEOA 1W96A 4CN9A 1NW6A 1PYOA 1Y7HA 5K0LA 4GX1A 1OU4A 1U3FA 5EMNA 3WWDA 4B3BA 4B6EA 2ZVQX 3R9IA 3GNTA 3JQPA 3M5DA 4TN1A 2W2PA 1A69A 4XLTA 3RC2A 1WOYA 3KM0A 4ALNA 1Y1RA 3BJZA 4YJ2A 4FYIA 4H7IA 5IS2A 4MXDA 2OGZA 2D59A 1BYUA 4DWJA 4JL8A 5K8JB 1CQIA 1RXEA 1RP1A 4J8PA 3ESXA 4R1SA 1G38A 3AKCA 1YF3A 5KUTA 1VL0A 1XPOA 1DBRA 2HIMA 4M7OA 2OBBA 1ECBA 1OYWA 1ZGCA 3KK0A 1GZHB 5ENDA 4HUQA 1D9ZA 4EMBA 1HLGA 1NLUA 3O38A 3R5HA 2BL4A 3LY5A 1UR5A 8ATCA 3SN6A 4KH1A 3H1EA 2FVXA 4Z0TA 1D4AA 4LJ9A 5IBQA 4BQRA 4OYLA 3TBKA 1UKEA 4EHAA 2HREA 1LUAA 4QXOA 1UAAA 1VG9B 1WTAA 1UBUS 2FR8C 2OXRA 2YWFA 3X0DA 5I5EA 3N6VA 4IJWA 2BWJA 1CZRA 2ODPA 2ZSIA 1YRYE 1MDFA 2B0JA 3KWMA 3NRBA 2NZXA 5A4MS 3T5AA 4Z0NA 3VKFA 2O2GA 4OU4A 4GE0A 4R83A 3VJLA 1L4YA 2V7TA 4I5IA 4AZSA 4Z4CA 3OURA 3W5VA 5JSZA 1VSVA 1U65A 4QU9A 2W8BA 2CNKA 1XO1A 1TT5B 2WWTA 3UJ9A 3V80A 4F8JA 2HTEA 1G5HA 5AW4A 1NXTA 4DMUB 1LBQA 2WNHA 4N40A 5IJAA 2VR1A 1COWA 1JMKC 5AM2A 2Q07A 2A33A 2H4WA 3L0ZA 5I8PA 1U9ZA 2IBTA 3RUFA 3W6UA 3DLBA 1YXMA 4YAJA 3BD6A 2VWGA 4XVHA 4ZK2A 5IDWA 2MSLA 2R8YA 3ECSA 4JV5B 5IXSA 4EX7A 2J3JA 4GPAA 4M22A 4XDZA 5CJJA 3W7VA 3IA7A 4N5MA 1WCXA 1AQIA 2IW1A 4D57A 3M4NA 3TUJC 2IVZA 5DNAA 3MWEB 1VLMA 2VQ6A 4PHFA 1UZMA 3ICVA 3L5KA 3STXA 3W5UA 5L3QA 5BVGB 3IT0A 4BLSA 2FP3A 2R4TA 4NCJA 8MHTA 4L2IA 3WMFA 1U6IA 2Y6VA 4EB8A 3THXB 1RQGA 1FVOA 4RF3A 2Q5LA 1PV2A 3X3HA 1WIWA 1O9GA 3T5DA 2PLFA 1EA5A 3FHJA 1KFEB 1J1IA 4XWYA 2O2IA 3D54D 4Q4DA 3GRAA 3IUPA 3IRUA 3JR7A 1TIBA 2WJWA 3I6MA 3WIBA 1DQNA 3H0CA 3M6IA 4RV4A 3RK0A 3ZLUA 1H3FA 5HJ7A 5LD2B 1BNCA 2YIDA 1JSXA 4EG7A 1RLUA 4PAQA 3R3ZA 5BSKA 2FG7C 4IF6A 5GPBA 4B3TB 2QMOA 4DC1A 1R9NA 1VCIA 2LCIA 3JQBA 3VNBA 1NDUA 3A3OA 4DCGA 1DT3A 1PQWA 3OM1A 3QBJA 3AM5A 4HQKA 2PO5A 5E6SA 5A0TA 1VCMA 3QEMB 4I50F 3T3EA 5ALDA 2PA0A 4HZIA 4C0JA 3B5EA 4B3RB 1R6VA 1GPYA 5KVQA 1F2UA 4IQ0A 5IAEA 5K0GA 1ZUHA 2RH9B 5F7JA 1HV8A 4M4SA 1UBHS 2V7WA 1YL7A 3S29A 2FPKA 3QWIA 1E1KA 4GOKA 1Q0HA 2IOFK 3JAMA 3EPPA 3I64A 1QTIA 3LT1A 1OGYA 1PHPA 1PSWA 3UWMA 3SYLA 3NNSA 2GA9A 4AF7A 1SVWA 1Z29A 5F3WB 2Q4TA 4AFNA 2O8NA 4O1IA 1E63A 2ZRCA 1S0UA 2PSHA 2X1HA 1EB9A 5FTNA 1L3CA 2CLDX 2OTCA 4Y30A 3SBDA 5JAUA 5AVTA 2H4YA 1C9KA 3WY9A 3PIDA 2HZ7A 4C7JA 2JLWA 2JEOA 2RKWA 4CMIA 2A59A 4FJ1A 4P86A 3IUQA 2YY7A 4MB6A 3VC1A 3PE3A 1CEQA 1TCAA 1AG9A 3RF7A 2QVZX 1FZTA 2JBAB 1Q19A 1FU4A 2IGTA 1QO7A 3CG4A 4CCAA 4MYCA 1NLMA 3NWJA 3RS4A 4UTVA 3DBHA 1GKKA 1WDMA 3BH7A 3MWEA 4CFYA 4C20A 4K0KB 1T1IA 1GCGA 4EW1A 5IU6A 1JDSA 3ASUA 4BBAA 1YRLA 3B1VA 3PE4A 4R5MA 3TXXA 1TC2A 1D3AA 1LQ2A 3LVBA 1Q1QA 1TMOA 1QQ7A 5CDHA 1A9RA 2ZJ5A 4QOIA 1X1AA 1WUYA 2CJPA 4DLZA 2CYCA 2DBYA 5DSXA 3PT9A 3B6ZA 4AZ3A 1N6IA 4H77A 3ZDDA 1IOZA 1NLFA 4MGIR 4NJOA 5FPTA 3T61A 4BMDA 5D51S 2E55A 3COSA 4ILKA 1KKLA 2RI0A 4O63O 5DSZA 3ZWMA 2ZS8A 3DPUA 2JLCA 2R8XA 5JISA 2Z8YM 3NALA 1JH9A 2VCHA 1EJBA 2WVAA 4KQ1A 1RSZA 5BQ3A 3JSXA 3GARA 1MORA 2D4HA 4PYLA 1EE2A 1R8YA 2H65A 2HXSA 3C5HA 3UJ8A 3WC4A 5JH7A 3B2EA 3RWMB 1JDVA 4N0QA 3SBOA 3LZCA 3S2FA 1CP2A 3VI3B 3B82A 4PQFA 3BXGA 1CRQA 1D6SA 1C3OA 2DM6A 3QPCA 3A10A 3HV2A 4K87A 3LQ2A 2WA1A 4GKJB 2P8JA 1DC3A 2HO5A 1JG7A 1Z6ZA 1TU0A 4DDTA 1E3EA 4GR5A 1RNLA 3QELB 4JXKA 4W1QA 4Y7CA 4YUZA 5KS2A 3VZRA 5ESDA 4HGPA 1UINA 3D3JA 3KVYA 1YOVB 5FIUA 4JC0A 2X3FA 4ZOLB 1QYIA 1L7XA 4PGAA 1T4CB 4WJKB 2NQTA 3FGZA 5LB4A 3STYA 3U9LA 5B1YA 3ED1A 2J85A 2NUAB 3ZDEA 5E6UA 4OD0A 5AW6A 5J2UA 4E7PA 1E9SA 2PKYX 1KI9A 1WSWA 5F35A 4CTOA 1CUJA 4PONA 3PENA 4UC0A 2F3RA 4HAOA 3NRJA 1TM3E 4MV8A 3R8FA 2AB0A 2C2XA 3LXUX 2H63A 1M6WA 2X3YA 3OQOA 1BDMA 1U7XA 2KW5A 2WWGA 3RU2A 1BKSB 3AI1A 4JOSA 3CF0A 1FOEB 4JI5B 3RFCA 1NP3A 1OW3B 5IH7A 4KWTA 1TU3A 1UK8A 3A2MA 2BFCA 3L84A 1OSNA 1HYGA 2DKNA 5HIIA 1PEYA 1OD6A 1V8FA 1Z2EA 3QV1A 5BPFA 3IB3A 2G1JA 3GFOA 4D9CA 2B78A 3VDRA 3CRNA 1TA0A 3NP7A 3RNLA 2I8CA 3CR8A 1FYVA 3L8EA 3R3UA 1W2GA 4JUIA 3REQB 4BAUA 5KKAA 1WXEA 4GVLA 4IHAA 4A8JB 1NU6A 3M81A 1IZ9A 1TKCA 2MU1A 2VEDA 2FUKA 2ZWOA 3VKGA 4C6RA 3DKKA 3UFBA 2UYQA 4JJ7A 1OYOA 1T3ZA 3F3YA 1Y4ZA 4N0DA 1BMQA 1UMDB 1VHLA 1DTEA 1XZJA 3EJ6A 3EXG1 1FRZA 1S9HA 1WA5A 3PJFA 4MRRA 1IY8A 2V7UA 5LYJB 3LY8A 4KO1S 1H0KA 2ZT8A 1B0PA 1QYWA 4JWKA 4F4JA 1UDRA 1UC5B 3WTBA 1G7SA 5K8TA 1V8DA 1J5EB 2NZWA 4PLWA 4H0CA 4ZYVA 3SFZA 2QZZA 3ANLA 3LNTA 4WE3A 2ONJA 1UKCA 4XCVA 1KK3A 3A25A 3AEKB 3I9KA 3EIQA 2VP2A 4UMDA 1NQUA 5KVCA 3ADCA 3OICA 3HJGA 3T4EA 3O0DA 2J4CA 3FETA 1QHXA 1N0HA 2W6ZA 3SS9X 3A6ZA 2WJZB 2HT6A 1HG0A 3JQDA 1S7GA 1XD8A 3SK0A 3RRBA 2SKDA 3M83A 4QUGA 4R51A 4RZHA 4EFDA 3TMYA 1DIHA 1P1FA 4F84A 1QLWA 5JTUA 1GZUA 4P98A 3LQ1A 1WVIA 4CQJA 1K9VF 5PNTA 1A9ZA 3PDIA 3TL6A 2B2CA 3R5TA 4TL7A 1TFRA 1OLXA 4AYTA 5ISMA 4CLXA 1A9PA 1EVYA 1SQ0A 2JI7A 3IV6A 4PRYA 4IVQA 1W1WA 2G28A 4BZZA 1T3GA 5F7ZA 3ZE6A 3ZX5A 1NU8A 2WFLA 1X94A 3E18A 3EW7A 3L0CA 3PGJA 5K51A 2OFWA 1ZMRA 1M8JA 4BEWA 3B9RA 4ZMSA 1FDWA 2OCBA 4G1CA 4RVUA 2Z2IA 2P7HA 1VGVA 3Q1LA 2P6UA 2PUCA 3EBPA 4P80A 1V6AA 4FMDB 1KK0A 3WS7A 3EUAA 3ZDBA 1VJCA 3GLFB 1K0FA 3ITEA 4BX8A 2ZYUX 5CM8B 4NQRA 3HO6A 2HX1A 5KVVA 2P0YA 5HOQA 3O8BA 1KAEA 1DLJA 4KN5A 2HF9A 4QYXA 3DLCA 3I2JA 2C2ZA 1VRCA 1XF1A 1TO2E 5EGNA 3HDJA 1W1IA 1J8VA 5A2GA 4PZDA 1EWYA 2ZIFA 4L3VA 1GYRA 4EPRA 1GCUA 4CM1A 3P45A 2I9KA 3K9NA 1WVGA 1P19A 1Y1LA 2R85A 3FROA 3MGGA 4DPLA 4B3SB 5B6PA 5C5IA 1ARZA 3I01M 3KZOA 2FWPA 3G8BA 2YXBA 3Q87B 4NCAA 3DGFC 4UCQA 4YMSA 5AYVA 3SYKA 1MXHA 1M6EX 5H16A 1BCSA 1A97A 2RBEA 5TS3A 3BRQA 5JNUA 2CLSA 5KKCA 1XXHE 2YJTD 1RAGA 4HZUA 4B47A 3FLAA 3AVVA 4QPDA 3DHNA 2D7JA 3E5RA 1ZM2A 4YGYA 1YC2A 1PR0A 3ZTWA 3SR0A 1Y5MA 4L4SA 5ADHA 1J4AA 4TXJA 3WSTA 4K86A 4L76A 2FEKA 1H0HA 3REGA 3IIKA 1HEUA 2FAXA 1ZD2P 1FSZA 1K4KA 2X77A 3QOYA 4MYRA 2QQ0A 1SC9A 2OP0A 3D8TA 3L43A 1CIJA 4RHUA 3RSLA 1I7QB 2J7PA 4ICIA 2QG9A 3SDSA 2BHSA 2B8WA 3JZMA 4HDMB 2JGDA 4X3CA 2ORVA 5G0TA 3V8BA 2Y66A 4I36A 2ONYA 2GPAA 4Y3UA 4LF5B 4O33A 3CR3C 4JK3A 4IR7A 4UU0A 1ECPA 2J3LA 1V1RB 2VPYA 2YCBA 3HYRA 4DJTA 3PC8A 1Q77A 1LK5A 5AOBA 4QQRA 5TJ9A 2P5TB 1SUBA 3C74A 3K1ZA 3DTVD 4HR7A 3KU1A 5DW3A 5EIHA 3VU3A 1FTGA 1HPLA 3MTGA 2R4UA 5HIAA 1MW9X 3T4PA 3T9DA 3HU3A 1NRWA 1BXRA 5JY6A 2OFPA 4YRMA 2C97A 4KBGA 1U3UA 1E2FA 1EINA 2X5KO 3QXCA 5EWJB 3LXRA 4C78A 1JEJA 2ZJFA 3M4ZA 1R64A 4E12A 2G06A 3A06A 4F4UA 4QM6A 1A7JA 4P3NA 3I5YA 1DUSA 3LQKA 1QVWA 4ZQFA 1ZHFA 2XXAB 3ENZA 3R0JA 1J9ZA 4WNCA 4NVRA 3SFTA 5LMUB 5EAIA 1H3EA 1KL7A 1NYTA 5MF6A 3VR5H 1MX3A 2RKOA 4TS4A 4LF7B 5MN5A 3L1HA 1B3RA 2O9JA 4HUQB 2M6KA 2VP5A 2XSZA 4TYQA 1GGKA 1LLDA 4KAJA 3THYA 2EZ4A 1EQAA 3CMMA 2XD4A 2A9KA 5TJHA 3CIOA 2P78A 1WZUA 2XRMA 1R8SA 1QVAA 3CEJA 2IEDA 3A3KA 3GLHA 4DABA 2A0UA 1HTBA 2FZLA 2OAGA 3A4IA 2IY7A 3GI1A 4C6TB 2BI8A 1NMXA 2AG5A 2FJ0A 2G6BA 1GTVA 2OD9A 2OGTA 4JFRA 4DRXB 2XQJA 1NM5A 1TTQB 2NTNA 5FNZA 1JTFA 3NEYA 1XCLA 1IY9A 1P7YA 2VQ3A 3E84A 4L9RA 1USVA 4FNMA 2FMHA 3TZ6A 1N34B 2ATEA 5IC4A 2WIGA 3IULA 2Q5IA 2HUPA 3INYA 1Z0DA 5GY7A 5JE8A 2PJRA 3D7RA 1U2PA 3LUJA 2NV0A 4MVJF 2P0AA 1BA2A 1XV5A 3T3HA 4QEZA 3QELA 3CLRD 2AJTA 5E1MA 4EARA 2F1IA 4B3XA 3WADA 4D8XA 1JVNA 4BNXA 1KEPA 2AV6A 4ZI3A 1I4LD 1Z5ZA 3HKEA 4X6UA 3M70A 3ONNA 3PXAA 3BRWD 1X1DA 1Z28A 3DUFB 4M9QA 2REXB 4MPJA 5JLAA 2VDOB 3VNSA 4JHXA 1E5DA 2FRXA 2VDWA 3ZHTA 5IWAB 4Q7QA 2C8LA 2DF8A 1TVKB 1AXGA 3O91A 2BDTA 2FX2A 1NVGA 1M54A 2VWPA 3H11A 1XQXA 4OHMA 4KUHA 4TS1A 4YCBA 3ELDA 4HP8A 4F06A 1KETA 2XWJI 1XTIA 3O8QB 3JZDA 2DOKA 3IKTA 1UZAA 2AMJA 4CLEA 3M6FA 2HSWA 3KUKA 1NWHA 1YR2A 5C81A 2OP1A 4IDPA 4D9NA 1SD5A 1U0OC 2O07A 2ZIWB 2TMYA 4FHZA 4M1TA 8OHMA 1T8RA 1ZKMA 4OPMA 5CFLA 1Z2PX 1EMDA 1UKBA 1DBIA 2WF9A 1F17A 2IY8A 2A84A 4CKCB 1FYEA 4A0HA 4W9MC 3PD0A 1EIZA 3HA2A 5KOJB 5K0FA 2OQ2A 2FMFA 1X8JA 3WL7A 1L5YA 1RRVA 2YYAA 3AEQB 2R1VA 3UK1A 3F0TA 2QRQA 5DOVA 3EK2A 1ZRHA 1N25A 2R9VA 3C3EA 5H9WA 1KYIA 2Z6AA 4R1OA 1PLJA 4IV0A 3M8KA 4NATA 3VX3A 3AJRA 4G2TA 2ZKIA 3ST7A 3H9CA 1VZ3A 4YPFA 1VMIA 3FBTA 3ZYCA 4J1SA 2YS6A 1A7KA 3EEOA 1QJCA 1D2MA 4ZU1X 1C1YA 2QYOA 3KLMX 5CYFA 4J0KA 3GRYA 1P1RA 2OG2A 3EG5A 3NAQA 4YRQA 4QXRA 1OX5A 1EDOA 2AJBA 2ZITA 3N7UA 5JBIA 1YSCA 3OEHD 2NVUA 3QITA 4NR0A 3FMIA 1RCUA 3KAPA 1YQDA 3MERA 3G68A 3LG2A 3QZUA 1HE4A 4Z9AA 2X76A 1FUEA 1OXBB 4BO1A 2EQ5A 2AOUB 5FOVA 2P9ZA 4JGIA 1KI8A 1RTKA 1O5TA 3V46A 2OCXA 2W6ID 2EFYA 2UKDA 3FUVA 1UBFA 5IJ9A 3M33A 5CH5A 5ALMA 4MIOA 2IFTA 2IXBA 1GQ2A 4OMCA 3VR4D 2WIFA 4B7CA 3FNFA 4RDIA 4RQAA 4Q66C 3V8MA 2YN4A 5B2FA 1MN6A 1GQQA 3IXMA 2GLUA 1NM5C 4BNNA 2CMHA 4CZ2A 2FRDC 1H8ED 4R3UC 1ORDA 1JFRA 1R4MA 4ND8A 5JUWA 2P2DA 3OLVA 3TEMA 1VJ5A 2C4TA 1OB2A 5CX4A 1PNTA 1T9GS 4M87A 4F3RA 3GVHA 5IP5A 4ZYUA 5HKBA 3FHTA 3IUBA 3F9IA 2BR5A 5KX5F 3V2UA 2VDJA 2C3OA 3D4PA 2HN9A 2BFAA 2I80A 4B76A 4P4UA 2CEKA 4C0HA 3LKDA 2FMUA 4ZO9A 2HLNA 4Y0NA 5T8KC 1S2NA 1U7PA 3O1HB 4CMIB 4QDKA 1O95C 2JI6A 1SCNE 5DNEA 3QH4A 4KR0A 1H65A 1SU7A 3RHFA 4FSHA 2Q3JA 3F4BA 4FWIB 4PR3A 3RSHA 1HT1E 1PJZA 5FBKA 4ESHA 3OIVA 5C0OE 2R00A 1CNFA 1DTSA 5J5VA 1YASA 3AY0A 1YIDA 1PGQA 1WY5A 2IU3A 4UUBA 4ZIRB 2GETA 3PXDA 2ENWA 3RDPA 4MW7A 3QF4B 3VTAA 1A2QA 5ERGB 1ATZA 1TUGA 2OG1A 1MC1A 1CQJ