1LSSA

Ktn mja218 crystal structure in complex with nad+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
MYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDAGIEDADMYIAVTGKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanism of regulating transmembrane potassium flux through a ligand-mediated conformational switch.
pubmed doi rcsb
molecule keywords Trk system potassium uptake protein trkA homolog
molecule tags Transport protein
source organism Methanocaldococcus jannaschii
total genus 50
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lssA00
3HQ4O 1VE9A 2DTDA 3K6JA 4J2HA 3D0OA 4HNGA 4XR9A 1B7GO 1WDKA 3JQ7B 3C1AA 4GL4A 4QSMA 4GSKA 1LSJA 1WW8A 2GRAA 1WDLA 1QG6A 1MG0A 4Z6KA 3JD4A 2EJWA 2GGSA 3RU9A 3WYCA 4FS3A 2QW8A 1LSSA 3RUIA 3ZWBA 5BNTA 2ZATA 1H9AA 1DBVO 2RBEA 4GKBA 4LCEA 4BNGA 9LDTA 5DT9A 1PGQA 4GMGA 4BNNA 1R4MA 3GVHA 1YQXA 4YTEA 1PL8A 2YV2A 4WLOA 4ND5A 3E9NA 2Y1FA 4CMBA 1V3UA 2X58A 5C37A 1CQIA 4PG6A 4IXTA 1HETA 3ST7A 4J90A 3PI7A 5AVOA 1VL8A 2W2LD 1CWUA 1AN9A 4JBGA 4BVAA 2PR2A 5IDWA 1CETA 4RPKA 1RM3A 4IDFA 1AHIA 4U7WA 3GEDA 2GF2A 4QFDA 1LQUA 4RVFA 2GZ3A 3V1UA 2R6JA 4E33A 1GDHA 2Y1GA 2VTDA 5KTKA 3E9MA 1PZHA 2AQ8A 3Q0EA 4YVFA 3RC7A 1ENPA 3H2ZA 3FNHA 2GERA 4GVLA 4XQ9A 1Y8RA 4ND4A 1NVGA 3MZ0A 4FGSA 4BGVA 1YOVB 3ANMA 3DBRA 4M87A 1DRVA 2VRCD 4R5HA 5JDIA 4NQZA 3RUEA 3TWOA 3ADOA 1XU9A 3WMXA 4RORA 5H82A 4BOYA 3NT5A 1YWGO 3TL2A 4BV9A 4EJ0A 2X6TA 1KIFA 1LC3A 4J1TA 3NTQA 4E3ZA 1NASA 2EP5A 1NXQA 4IDGA 4MJLA 2X86A 4RLSA 4E6PA 4KTVE 4R9RA 1PTJA 1R66A 3RAJA 1XELA 1D8AA 3VOSA 4BV8A 5CDYA 3BMCB 3K2BA 4KQXA 4BO1A 3KUXA 2NU8A 2VYVA 4O5OA 4R69A 2Q45A 3BTUA 5KVCA 2A94A 4BNHA 1JAXA 4P22A 1Z74A 4TZTA 4PZCA 3VPFA 3CSDA 1Y8QB 3G1UA 2X22A 1NVTA 4L4RA 3H3FA 1UXGA 3OHSX 3RWBA 4DBVO 1L7DA 1R16A 1GUYA 2O7SA 1DXYA 1NNUA 3GDOA 4WKGA 1GU7A 2PA3A 1A7AA 2W4QA 3FBTA 1EUDA 2VHZA 1ZSNA 4CM4A 5FI5A 3IUSA 3JCZA 2VWHA 1OC2A 5A4DA 1KETA 1WZIA 2P9EA 4QO7A 4IJKA 5JAMA 1BRMA 3ZV6A 3D7LA 5JFOA 1FDSA 3AI1A 1EMDA 3AJRA 2GUGA 1PJ2A 3ZU2A 3KYCB 4NBUA 1KBZA 1AXGA 1HYEA 1ADGA 3ZW9A 3L4BA 5L3ZA 3FWZA 5GY7A 1XYGA 5TSDA 4YWJA 3WOHA 3WWZA 2VUTA 4L74A 2LDBA 4HBGA 5KKCA 5JCJD 4DPLA 1PJ4A 3AY3A 4LRSB 3K73O 4XDYA 4Q3EA 3N58A 3HFGA 4FFRA 3H6KA 2X0JA 3ABIA 4ND2A 3LC2O 1PWZA 1DIAA 1R6DA 1FDUA 4RVGA 3OFSA 5CDTA 1WWKA 3GG2A 2H1SA 3HDHA 4UUNA 3Q9UA 1P1HA 3PYXA 1SEVA 1HE3A 4BNMA 3D1LA 3JQFC 5KJFA 2G17A 2FZWA 3DFZA 1L1FA 3BTSA 4AJHA 4QO8A 1A4UA 3JTMA 2RH4A 2B5WA 1TI7A 1F17A 4DBZA 1PQWA 4NK5A 1E77A 1MA0A 3DHEA 1VKNA 1R0KA 1T25A 3UN1A 1NYTA 4CMIA 4JROA 1PJLA 4MVJH 5JDCC 1Z73A 1JTVA 2Q49A 4QT0A 5KJEA 1NQTA 2UYYA 3TPCA 2B4QA 3GMDA 3ANNA 3L07A 3JYOA 1SC6A 2FHSA 4CM8A 3IDSA 3NEPX 1IULA 2JCYA 3WNVA 4W82A 4NNJA 2HRBA 2QIOA 1YBMA 1BSVA 3JQ8A 4ZQFA 4DWVA 1ZK1A 3JQ6A 1WPQA 2BELA 4ZQGA 2C07A 2PH5A 4M54A 4IMPA 4PZEA 5I7VA 4FFMA 1RYDA 4WCFA 4YJGA 1T4BA 1YS4A 3WX0A 2B4RO 3IC5A 3VDRA 3AY7A 1IUKA 1B15A 3ANLA 2BLLA 5F1OA 4Z9FA 4BNLA 5L4SA 1T2FA 1ZK3A 2OFPA 1LUAA 3DZHA 2V7PA 1A4IA 2UDPA 2IXBA 5I9LA 1NFRA 1HYHA 3EVTA 2FMUA 1VC2A 3W6ZA 3GH3A 1A5ZA 3DEYX 2HRZA 3VZSA 3B1FA 1ENOA 1M6HA 3PTZA 1KVUA 2D0IA 1QXSA 4ZN6A 4FDAA 5KVVA 1N92A 2O3QA 4I9UA 1R12A 4JBHA 4Y98A 4EBFA 1U2DA 3PDUA 2Y93A 3RBVA 4UEOA 3MOGA 3IP1A 3ZH2A 5G4KA 3DZFA 1X0XA 4WEOA 2I76A 4E30A 1P0FA 4CLRB 1YDEA 4L9RA 3GGGA 3VVCA 2XPCA 3MJEA 1HDRA 2DPGA 3HADA 4HNHA 1VL0A 4IQ0A 4YJFB 1LNQA 1MGOA 2H5LA 4GX2A 4W9NC 3A1NA 1NM5A 2CF5A 5A9SB 3KOUA 4NBVA 5A06A 1JKFA 1IL0A 2EGHA 1IZ9A 4GKVA 3LLSA 3F4BA 2HU2A 5I7FA 4L76A 5CDSA 3QVOA 3TN7A 4E2ZA 5DULA 3RUDA 2PD4A 2RIRA 2C29D 3H2SA 2HAEA 1C14A 1J0XO 2DAPA 2OO5A 3JV7A 5L95A 4HUJA 1P0CA 3VC7A 2WYWA 5BT9A 1PQPA 2DKNA 3L6OO 5TGDA 2QYTA 4DTIA 3IJRA 3JD2A 5EN4A 3MWEB 1U1IA 4NU5A 2E48A 4A7PA 1T26A 2IYOA 2YQ5A 2AHRA 3RASA 1WLYA 1JKJA 1GQ2A 4F45A 5TJ9A 3LC7O 5IZCA 2BH9A 2RHRA 3DBHB 3SX2A 2NUAA 2OBNA 4WOJA 5FYDA 3E5RA 4WLNA 4XYBA 2PD6A 2AEJA 4Z3DA 2CDAA 3O4RA 5I8WA 1H2HA 4BKPA 5T67A 1HL3A 1XR3A 4W6ZA 3ZNQA 3AFNA 4OYRA 2O50A 4F3YA 1UXIA 2EV9A 2Y66A 3H9GA 3O8QB 3I3OA 2NVUB 4MINA 3ZWYA 3UGKA 4YJDA 1HDXA 4ZU3A 4M55A 3WR5A 4WASA 4DQXA 5JBIA 4UEJA 5AXBA 4XQEA 3QWFA 1E3WB 4AJEA 1U7HA 5HBRA 3LC1O 2CZCA 1ZBQA 3V2HA 2OBYA 4IJWA 5JYEA 3SJUA 5TRTA 1HXHA 2PGDA 1PJSA 3E5MA 2XAAA 1DFIA 1DEHA 3DL2A 3SJ7A 1Y5MA 1PS8A 3F46A 3MJCA 3NDRA 2AW5A 4IDDA 3TFQA 4D3DA 1HLDA 4LMPA 4A10A 4BGEA 1UZNA 3IQDB 1O9BA 2GSDA 1G0NA 1ZK2A 4IIVA 1DC6A 4R4JA 3AUUA 2DT5A 2ZTMA 3PHGA 4JQCA 2Q4EA 4FCCA 1EZ4A 4CMCA 1XA0A 4AG3A 3WJAA 1O89A 2XOXA 1KVQA 1TT7A 3HN2A 3RC9A 4YQYA 1U8XX 3LT0A 3FPLA 5I7SA 1KC1A 2VZ0A 4CM9D 4F6CA 1IZ0A 1WZEA 1XDWA 3DTTA 3I23A 5FI3A 1A71A 1ONNA 2NTNA 4IS2A 1EUCA 2WDZA 1GQYA 2WJPA 1EQUA 5DOVA 4XYLA 4XIJA 5JDIC 5DCUA 2EKQA 5I8ZA 3R3JA 4R16A 4YQZA 4J9UE 4CQLB 1GCUA 3I9LA 4EDFA 4KUHA 5G2OA 3WLFA 3F5QA 2CVZA 1UP6A 3I9KA 3V1YA 1T2DA 4M8SA 3GY0A 3AOEA 3ZW8A 3N74A 4HFMA 3QVTA 5C7IO 2Y1DA 3RUAA 4HFJA 4R01A 4LRTB 1ISMA 1MC5A 1K0UA 2FP4A 3DOOA 4L73A 2PGJA 3TZHA 4BNTA 2PWZA 3FBGA 1N1EA 1CERA 5B1YA 5I9NA 3PWZA 1ZSVA 1B14A 3DWFA 1QV6A 2DUWA 2VZ8A 4ZA2A 1DLJA 4AJPA 4UULA 7ADHA 4J4BA 3KYDB 3H3JA 1PZFA 4I5DA 4QUKA 3JYNA 1OOEA 1LDMA 4EEZA 2V6GA 3ORFA 4PRKA 2HK9A 4E0BA 3OJFA 5ICSA 4J1QA 4B4UA 1ORRA 3PQFA 1DPGA 3ZWVA 1Z6ZA 4FD3A 2JCVA 4FC7A 1OZAA 1PEDA 1OI7A 2O4UX 3QA9A 2F1KA 1UAYA 2DLDA 2JD0A 1Y7TA 2PH3A 2Y0DA 3RKRA 3BA1A 3JYQA 4TWRA 4E5KA 3G1TA 4YACA 1YL5A 4MKRA 1FMCA 3RI3A 3VZQA 2C2YA 4IPTA 3TL3A 3FTNA 2AXQA 3OIGA 4GLLA 3RUFA 3V8BA 1MUUA 4AICA 4B7UA 3RFTA 4JGBA 1ULSA 3L4BC 4CUZA 1LBEA 3HSKA 1YO6A 3L6EA 4PG7A 3NAQA 2IDZA 3VH4A 1WNTA 2HK7A 2C54A 3GGPA 3GN2A 3QHAA 4J2OA 3TNLA 5HM8A 2AEMA 1MXFA 1SEPA 3BMOB 1CRWG 2YFHA 2OMEA 3DOJA 1R37A 2CVOA 3P2OA 3FNFA 4D3FA 2P5UA 3CMCO 4M49A 2HK8A 4GX1A 1GZ3A 4HADA 1I3KA 3HDQA 4YJHB 1GY8A 1IHYA 1AHHA 1UAGA 2GN8A 4N7RA 3KEOA 3ZWPA 2X8LA 3IIEA 3CTMA 4S3MA 5B4UA 5IDXA 3PEFA 3ROQA 5TIIA 5DP1A 2J5RA 1BMDA 4IBOA 1ADCA 5DP2A 4EYEA 1I30A 1CF2O 4D45A 4OJNA 4DXHA 4RO0A 4BNKA 4CLOB 1EVZA 2D5AA 1N9GA 3QWIA 4CLDA 4RDIA 4BMNA 1XQ1A 2DU8A 3OEWA 1MC4A 4I1IA 2H9IA 4PIVA 4L0QA 4YRDA 5BSHA 2HJSA 3EW7A 1PZEA 4CL3A 4ID9A 3A28A 1KOLA 2CUKA 3GR6A 3PQEA 2QZ9A 3JD1A 4J7UA 3WLEA 3UCFA 1LRJA 2NLOA 3L0DA 5EERA 5G0UA 4GBJA 5HS6A 2PTGA 4WOKA 4BNYA 4FFNA 1PU2A 5A03A 1HYGA 1R0SA 2ZIZA 3D3WA 2HMSA 4IUYA 4BO6A 3QVSA 4WPGA 3S1LA 4CQMB 3GLQA 1S7CA 1T1RA 3PIIA 3WFIA 4BO4A 4WK6A 4FSHA 3UW3A 3NV9A 5CEFA 1RM5A 3GPDG 1W6UA 1KEWA 2B0JA 4YEDA 4ND3A 1U9JA 2O2SA 1Q1NA 1Z82A 2IODA 3L6DA 4MVJA 1JQBA 2J5QA 4HP8A 1R4MB 2O3SA 2VHVA 1P1IA 3D4PA 1T24A 2FR8A 4R1SA 4C7JA 8ADHA 2Q1UA 4BNXA 1MXHA 3C24A 3QV1A 1CDOA 4CM7A 1U2GA 2I9PA 3LT2A 5GMOA 3KM0A 4PLZA 4CR7A 5A3VA 1GYPA 4U5QA 3WGTA 3O9ZA 3FHLA 4EI2A 3I4FA 1IHXA 1X13A 4CMEA 1WVGA 2BMAA 3VPGA 3KV3O 3U4IA 1BG6A 2D2IA 3GUYA 1E1LA 2JD2A 4YA6A 1QKIA 4PG8A 4OHUA 3WYBA 1M67A 3SLGA 3MCVA 2J8ZA 2JL1A 4B7CA 3WGGA 4E13A 4IY1A 5IJZA 5JO9A 2P5YA 5BQFA 3ZWMA 1LRKA 4FR5A 4RVDA 4U0KA 3WNQA 1UJMA 3ZI0A 3ETEA 1I01A 3HWRA 4PGFA 1EK5A 3KYBA 2DQ4A 1FK8A 3DBRB 4A03A 3DBLA 4IS3A 3ZGYA 5JNLA 4XGIA 1YL6A 3C1OA 3BMNA 1ADBA 1PGPA 1S6YA 2W2LA 3GVPA 2QRJA 4ALMA 1NVMB 4GLOA 4PLFA 4PFJA 4S1VA 5JPIA 3U9LA 3BMQA 4YPOA 4FBGA 4F46A 3W4IA 5JYDA 1TVEA 3AU8A 1QP8A 2A92A 4ZQEA 3WSVA 4MVJM 3KETA 1SPXA 2C7GA 3M2PA 4R41A 3RFVA 4KOAA 2RCYA 4NZ9A 2VHXA 3RIHA 4CR8A 4D79A 2Y0CA 1YKFA 2GNAA 2V65A 1DLIA 1Y81A 3DOCA 3PZRA 5DNAA 2PY6A 3U49A 2X1HA 1X7GA 1XLTA 3KSDO 1T2AA 1Y9AA 2P9GA 4J1NA 4YT8A 4DLAA 2P4QA 1K6IA 1PQUA 5C7LO 2ET6A 1NQOA 3VAZA 2O23A 3RUHA 3CMMA 3HFSA 2AA3A 4B4VA 6ADHA 3JQAD 1U5AA 2EIHA 1XQ6A 4CM4B 4QEDA 2C20A 1SB9A 5CDGA 5K6AA 5CG1A 1Q0HA 2GDZA 3X2EA 1IPFA 2JAPA 5JAQA 1ZCJA 1XWFA 4IQ8A 1C0KA 1DB3A 3D3EA 4AJKA 4A0SA 3ETGA 1QYCA 3JD0A 1GCOA 4DC1A 3TZCA 3D4NA 3KLPX 3AOGA 3H5AA 3CIFA 4ILKA 5U1PA 3PFWO 3WSWA 4YAIA 1H0KA 3TF5A 3LT1A 4YT5A 1Q7CA 1G6KA 2Z1NA 2YHIA 3INGA 3AI2A 4OXKA 5KWEA 5L45A 2OGUA 3FRJA 4DMLA 4RPHA 5F5LA 1XIVA 2X23A 1ZSYA 4CLHA 3ZNNA 4JJIA 4GMFA 3AM4A 5ICMA 3AW9A 5DF1A 1R4NA 1X15A 1Q7GA 3ZCXA 4ZGWA 5JLAA 2VNSA 4M89A 2FY8A 4WLFA 3WBBA 3OECA 4C4OA 1A7KA 4R51A 4RF5A 5JXWA 1B2LA 2J3KA 1BGVA 4RF4A 1ZFNA 1MV8A 4CV2A 1EVIA 3F5SA 4NFHA 3ZV3A 1U3VA 1DAOA 1ZJZA 4O1MA 5KJ6A 2YDYA 3NT2A 3GRPA 1M76A 1ZZEA 3F4LA 4MPDA 5IF3A 1VRWA 3HNPA 4XDZA 2O3UA 4CMIB 4OOEA 5JCJA 2BI7A 1U3TA 2FOIA 3QE3A 3VTFA 1KEPA 2VHYA 2I3GA 3CH6A 3HB5X 4BGUA 4MVJP 4CM8B 4BO7A 1P74A 4BNJA 4CMAA 2NV6A 4JJFA 4UVGA 1P1FA 1GYQA 4RF2A 3ROKA 1F14A 4IQGA 1SAYA 2B35A 1J4AA 1QORA 1NR1A 5THQA 1LU9A 1PR9A 1E1MA 1GTMA 3EZLA 1YJ8A 5L9AA 1PSDA 2DBQA 4LVCA 4YJGB 2AEFA 4B4WA 1H6BA 1K89A 2D59A 1PS0A 5DCYA 3PJEA 4PLTA 2AQIA 1GUFA 2Q50A 3GFBA 3R1IA 1P44A 4KUEA 1GADO 4RVUA 1HE2A 3PP8A 2YQ4A 1BXGA 4NH4A 4TMFA 4AJIA 4IXWA 1SO8A 1I8TA 1W73A 3Q2KA 1ZH8A 2Y68A 4IIUA 1B8VA 5GZ3A 1E6UA 4W7IA 1DHTA 1HF3A 3C7DB 4JJGA 2R2GA 3EDMA 1YXMA 5A5EA 4ZD6A 3KTDA 2B36A 3JQ7A 5G0VA 1OBFO 1DSSG 4I5GA 1LQTA 1I33A 4RZHA 4XB2A 4EEXA 3B70A 1DIGA 5J23A 1ONPA 5G4KB 2DBZA 3LT4A 3S55A 5KNLA 1LLCA 2V6BA 3CKYA 3UH1A 2P91A 3ZWWA 1DRUA 4K28A 1KS9A 4KZPA 3RJ9A 3L4SO 4DIOA 3WMWA 2O7QA 3OIDA 3FTPA 3AK4A 3PFFA 4WE3A 4E31A 3PHIA 4BB6A 1ULUA 3GMSA 4G5HA 5T8KC 2CDBA 2EWMA 4YAGA 3W8EA 4FW8A 3ZV4A 4TRJA 1ZMTA 2NACA 1X7HA 4PCVA 1C0IA 3STHA 1FF9A 5EIOA 4BO5A 2G1UA 2VQ3A 3RFXA 4TSKA 3OJ0A 3GAFA 4OMUA 3UCXA 1NBOA 1F8FA 1HSOA 4Q3DA 3H9EO 3JD3A 3QY9A 3OQBA 2B4TO 1KVSA 2NU6A 1W8DA 2Y05A 3GRKA 3I52A 3Q3CA 3UXYA 5IDQA 1O8CA 4J7XA 4UUMA 4EUEA 3JQEA 4D41A 2VOJA 4NMHA 1E3LA 3OJEA 2GO1A 3P19A 3WFJA 4RF3A 1E7RA 3VVBA 5EINA 3WDSA 4K9DA 4XIYA 1SBYA 3BHMA 7MDHA 5A9TA 1K6XA 4OAQA 1PJTA 1TT5A 3NTOA 4PZDA 1WXDA 1OMOA 3OSUA 4RGBA 3LF2A 3NJ4A 3WXBA 1E7YA 1YONA 3B1KA 5BSFA 4GX5A 2A35A 4KQWA 5EQFA 1XGKA 2PGLA 2VUUA 3ZHZA 4QX6A 3SC4A 4MP8A 1BXKA 3GEGA 2OOSA 3KRTA 5TLSA 4PLWA 4P8RA 5AYVA 2W90A 4DPKA 3SBOA 1JA9A 1JWBB 4XB1A 3EAGA 3DZIA 3W6UA 1I2ZA 2IEDA 4RZIA 1V9LA 4I9NA 4MVJE 4NJMA 5T57A 2R00C 1E1KA 2Q4BA 4J4TA 1JKIA 4TRRA 3QIVA 1ZXLA 2BHLA 2BGKA 1N1GA 3AFMA 2VUSA 3PGJA 4ZQHA 1NHWA 2C59A 3WQRA 4NBWA 2DFDA 3ITKA 2C2XA 3LK7A 1I32A 1Y6JA 4TKLA 5JE8A 3NKLA 3EMKA 4Q39A 4FFPA 2YY7A 3PYMA 1PR3A 1CYDA 2EXXA 5G0WA 1QRRA 2YJZA 4ITUA 2FWMX 4DPMA 2WYUA 2P9CA 5THKA 3U4HA 3ONFA 3JQDA 4GGOA 4LVUA 4EUHA 3DQPA 3PRJA 3WGYA 3RVDA 2GD1O 5GZ6A 1BW9A 1EFKA 3LF1A 2WM3A 3LLVA 3K9QO 4BKQA 2ZB4A 1U3WA 1Y5RA 1H6AA 1NHGA 2HJRA 5B12A 4UUOA 1R0LA 4CLXA 2H6EA 2ZB8A 1CEQA 1LDYA 2DBVO 3KVOA 4DLBA 5TT0A 2CF6A 4QTZA 1UDBA 4U6SA 1MFZA 2ILTA 3MJVA 5LDGA 2W2KA 3DZKA 2Q2WA 3RUCA 1E1NA 4DRYA 4OH1A 3K2EA 3PJDA 1H6CA 3JQCA 3JYPA 4TVBA 4CM9A 1RM4A 4WEQA 3KXDA 3I1JA 3RC2A 3ICCA 2AQKA 3OETA 4IM7A 4BO8A 5L51A 5ADHA 1Z7EA 1HDZA 5A05A 1J5PA 3EC7A 5TF4A 2Q1WA 1D1SA 3JQBA 4N54A 1IE3A 1FDVA 1O5IA 1HZZA 4J91A 4TRMA 5KIAA 1P31A 3KEQA 3ZWCA 1ZO8A 3GN1A 5T6BA 1E5LA 4JLWA 1B3RA 1Q0QA 5AOVA 3GPIA 3ZU3A 2J5KA 5K6AC 4Z9XA 3K8ZA 4E4YA 1ISHA 4J16A 1Y1PA 1DJNA 4YDRA 2G0TA 2UVDA 1GV1A 4BNZA 3VH1A 3W4KA 4LMRA 4CMGA 3IAHA 3GNTA 1T4DA 1X1TA 4YT2A 5B4VA 1QLHA 4FIZA 4IJVA 3BTVA 3G17A 4FC6A 4N5NA 4M1QA 4NDNE 1I24A 4MVJI 3C85A 2E49A 2JHGA 1UZLA 3TZKA 1ISGA 1CQJA 5AXCA 1LTHR 1N7HA 1UXHA 5A9RA 2ZYDA 3QJ5A 4J0EA 4WUVA 4BO0A 6LDHA 4D3SA 3ROPA 4RQTA 3GGOA 2EHDA 4YBZA 4WCDA 1RPNA 1ML3A 4LN1A 4A26A 3GNQA 3KB6A 2CNBA 3NDIA 1HRDA 1NPYA 2VTEA 2VYND 3QSGA 2B83A 1WMBA 4Q3AA 1U4SA 2O3RA 2YV3A 4NFYA 5A04A 3LDHA 3SVTA 1HDOA 3S2GA 4E12A 4AL4A 1K5HA 3EGOA 4J43A 5EQDA 4J3FA 4OXNA 2FSVA 4TVOA 4E32A 1ENZA 2VT3A 1U28A 2BGLA 2PK3A 4IZIA 2P68A 3NTRA 1XHLA 4NG5A 4QXMA 2SCUA 3VDQA 2VZ9A 4F6LA 5TQVA 3K92A 4G65A 4YAJA 1N9GB 2NNLD 3JQGA 2PD3A 3DZBA 4RVSA 1PZGA 3U3XA 3WICA 1BDBA 5HS4A 3OMLA 2GYYA 3M1LA 1E3IA 3OF2A 3TRIA 3RSHA 3F3SA 1A72A 1MLDA 1T2EA 2BKAA 3FPCA 2PKQP 3SLKA 1PGOA 1LXCA 3KO8A 3OBBA 8LDHA 3Q11A 3WB9A 3DMTA 4GQAA 1C1XA 3NJ8A 4LSMA 1JVBA 3GVCA 3HDYA 3EYWA 3ZU5A 1OFGA 2O2YA 4FFOA 3FF4A 3MEQA 2FSSA 3B6ZA 3D3WB 2GASA 1B8UA 4R3WA 4XGKA 1D4FA 1KEUA 2XF8A 1HT0A 2YHUA 3ON5A 1E7MA 2JAHA 1XKQA 5ITVA 3D64A 3E18A 3DR3A 3MJTA 5ENDA 5IXSA 1N7GA 2VHWA 4XQCA 1LLQA 1K6JA 1O95A 3GT0A 4IGEA 1ZEJA 5B37A 4JBIA 1SNYA 3F1LA 4Z0PA 1GPDG 3EK2A 4CV0A 3BIOA 1PWXA 5HTOA 4ZVVA 5C3MA 3W1VA 1SOVA 1E5QA 3AWDA 4PLHA 2CMDA 2EKLA 4KDFA 3IKVA 3ZDFA 1IY8A 1LRLA 4RQUA 5EESA 4NU6A 4XYMA 1SB8A 3HHPA 3PGXA 3CZMA 4FGWA 4PG4A 4B3JA 1PGNA 1Z75A 2BFOA 2NVWA 3FNGA 3RD5A 1EFLA 4OO3A 5TS3A 2FPPA 1M2WA 1B16A 4OGWA 3KZVA 3JYLA 4C7KA 1GZ4A 2BFAA 3PIDA 1U5CA 2OHXA 1GL3A 2G5CA 5ENVA 2NU7A 2PZLA 1IYZA 3FR7A 5F1PA 4GGPA 2EEZA 1FXSA 1GEGA 4KMSA 2X0IA 3VPSA 4PVCA 5A1TA 3GOHA 2BF7A 4OKNA 4XEHA 3ZHBA 1O94A 3ZNOA 5TT1A 4YT4A 3K31A 4BQPA 5HRUA 1WP4A 2IE0A 2VWQA 2WWRA 3OJLA 5L4LA 3DONA 1ADFA 4J9VA 3PHLA 1HDCA 2Q1SA 1EBUA 1LX6A 3C3XA 2HMWA 4JXKA 2BGMA 1ZJYA 1UUFA 2AQHA 3IL2A 1U8FO 3DBLB 1R15A 4II2A 1GEEA 2ZK7A 3BMNB 4YCAA 2YV1A 2ZTUA 4GH5A 5DN9A 3Q6IA 3VTZA 4A2CA 4AJLA 3VPHA 1KVTA 4HX5A 1E6EA 4XD2A 4Z3KA 2TMDA 3ADPA 1PX0A 3BMQB 1NAHA 3D4OA 4WLEA 3GDFA 1MB4A 5JY6A 2WD7A 2YW9A 3U0BA 3WQSB 2AE1A 5ITWA 3M2TA 2HSDA 1VL6A 2WEKA 4M86A 4ROSA 4RJTA 1O0SA 1CJCA 1QR6A 3RQSA 3DTYA 3GZNB 2VN8A 4GSLA 2IZZA 5EJ2A 2JFFA 2CFCA 3IOYA 4EITA 4TKMA 2HO5A 3PDJA 3ICPA 4CL8A 1ZVMA 1DAPA 2Y1CA 3DZJA 3GUCA 4CQLA 5DBGA 2EG9A 3JQFA 3FNEA 1EUZA 1QLJA 4DYDA 3DO5A 1PIWA 2WMDA 4WCFC 1NWCA 3DAPA 4WNIA 3T4XA 3TQHA 3UHAA 4BKOA 4CM6A 1UP4A 2B5VA 4N18A 2AG5A 4NBTA 4J1SA 1P45A 5BSEA 1AGNA 2WTBA 4PRLA 1HE4A 5F3RA 4NR0A 4URFA 1NX6A 1BHSA 2VRBA 1MX3A 1LSUA 4H16A 5CPFA 3RKUA 1V0JA 1MP0A 2CD9A 3ZZNA 2CY0A 4B79A 4FOOA 2G82A 5I7EA 3GEMA 3DFUA 3GDGA 3NGLA 1EK6A 1VJ0A 2A4KA 2ZKLA 2PZKA 2B37A 2YHIB 4CM5A 2BRUA 4XJTA 5BR7A 1E3EA 2NQTA 1F8GA 3HZZA 4A27A 4OKIA 5G4LA 1HEUA 1VJ1A 4INAA 4A5OA 2QRKA 4JCOA 1SOWA 3JQAA 3NGXA 5EPOA 1R4NB 4GWGA 3IMFA 3ZHXA 2POQX 3D5TA 2I67A 5T64A 4UAGA 2DM6A 3IKTA 2RHCA 2C5EA 1D3AA 3QWHA 3V1TC 4IDBA 4Y6RA 2X9VA 4PN3A 2E6UX 4FJ2A 1B8PA 1ZNQO 3NX4A 1Y8RB 3PPIA 1NP3A 1FDWA 5CEEA 4HKTA 4ALIA 2WE7A 3INTA 5TNXA 3ZWOA 5C5IA 2TMGA 1KEVA 1LDBA 1PL7A 2ZB7A 3MTGA 2Q1TA 3HB4X 3HDJA 5DBIA 4CUJA 4TRNA 4RPLA 3WIDA 2EGGA 5JS6A 2X5JO 5IZ4A 4D0RA 2JHFA 5COQA 3JQ9A 3PJGA 3GFGA 2J6IA 3TOZA 4EJMA 2NU9A 3V5NA 2C7VA 1NFQA 3GAZA 2LDXA 4O0LA 5IZCC 3BTOA 2VOEA 4BMVA 3W8DA 3E1KA 3ASVA 4D7AA 5JMPA 3EZYA 3LQFA 1UZMA 2X9GA 3LZ6A 3JQBC 2BI8A 1BWSA 1ZMOA 3OA0A 2QYSA 4XRGA 3DHNA 5CAEA 5T5QA 2E37A 1UXKA 4E5NA 4MP3A 3HG7A 1BXZA 4RVHA 2HLPA 1Q2XA 2X5OA 1P1RA 2JCXA 3H9JA 4CUKA 3OP4A 4D42A 3PK0A 5GZ1A 1N5DA 2Y67A 1P1JA 2P2SA 3IJPA 3NYWA 2O3TA 1NQ5A 3A14A 1X7DA 3C7AA 1EE2A 1XU7A 1LJ8A 3PLNA 2JFHA 4BGIA 1DFHA 1VLLA 3ENNA 4W7HA 5FWNA 1IPEA 5CG2A 3ITDA 1LSOA 4P4GA 3VH2A 5K0ZA 4AJ1A 3WQQA 3H5RA 3U4CA 3WWYA 3BYZA 4OOFA 4R3NA 4CQMA 3LU1A 3WG9A 1RWBA 2VNAA 3L9XA 1EDZA 1LC0A 3PYLA 1PJQA 2UUPA 3DDNA 3ZNPA 3NT4A 2GZ2A 3E03A 4Y67A 4J0FA 4XQGA 1KC3A 2FR1A 1H94A 5EL0A 5U9CA 1I3MA 4ZRNA 3DC2A 4RCVA 4OQYA 4DIBA 1RKXA 1H6DA 1YBAA 4LK3A 3O26A 4B7XA 2FZEA 4BQRA 4MIOA 3PWSA 4PLPA 1BVRA 2YFQA 4UUPA 3C7CB 1ARZA 1YQGA 4BNUA 3QLJA 4YAKA 3ULKA 2PKQO 4BNVA 1XEAA 2C0CA 3EHEA 4WECA 5KKAA 2C5AA 4U0JA 5I9MA 3TSCA 3DHYA 4XYEA 4CM3A 4YXFA 1KVRA 3V2GA 1V3TA 1E7WA 3AY6A 4R68A 4CM1A 4ZICA 1I0ZA 1M75A 4R1TA 2HKIA 2IEBA 4DC0A 4PLCA 4OSPA 5G0SA 3AOEC 5JW6A 2EW2A 5AXDA 3PLRA 3TJRA 1QSGA 2Z95A 4B8ZA 3WTBA 1T2CA 2A9FA 3I9NA 5K9ZA 3DMTC 2IXAA 2QQ5A 2ZYGA 4R9SA 1DC3A 3GHHA 1DHRA 1GD1O 2W98A 4E21A 5A3JA 3QW2A 3L77A 1PJBA 1W4ZA 2EF1A 4DREA 1I5RA 4XA8A 2PZJA 2HCTA 3WJ7A 3FD8A 1BDMA 3C1TA 4CQMD 1ID1A 1P3DA 4BHTA 2ZTLA 3JQ8B 4DQVA 1TT5B 3COSA 1E3SA 1E7QA 1LI4A 4PVDA 5ER6A 4J6FA 1Z45A 5DZSA 2PZMA 3WS7A 4BUCA 3WTCA 4WCFB 3GF4A 3GNSA 3K96A 1PJ3A 1UXJA 4NBRA 4FJ0A 1VSVA 1KY4A 5TJHA 4UVDA 1XCBA 5JAZA 1KYQA 3HN7A 2UUOA 1DIHA 1VI2A 1C1DA 3O03A 3I9OA 3GVIA 1WMAA 4YYZA 5JO0A 2QX7A 1H9BA 2GLXA 4GPD1 2X4GA 3PHJA 3VHRA 1SZJG 4NJMB 4K6CA 4AFNA 4ALJA 3HJAA 1LEHA 5ILOA 3T7CA 4CV3A 1JWAB 2X5KO 4L4XA 3UFXA 1ISJA 1NPTO 2NM0A 4UREA 1NPDA 1Z7BA 3DXFA 3U4DA 1YH3A 3C8MA 1GAEO 1H5QA 3OA2A 2Q3EA 3RC1A 5C7OO 2EKPA 1HZJA 2I99A 4JP3A 1J49A 1Q7BA 3IUPA 4CLEA 2C82A 2AG8A 1QYVA 4AJNA 1PJCA 4CMKA 5JY1A 4CPDA 4O59O 1GQQA 3MTJA 5ILGA 4D46A 1ZW1A 3QVWA 3CE6A 5FF9A 5IG2A 5IFLA 1BW9B 1L7EA 2OL4A 1VSUA 3ONDA 4J7CA 3UOGA 1B0AA 3PJFA 3E8XA 3FCOA 1UP7A 3QVXA 2OXIA 1WDMA 1PS9A 2FPIA 3PXXA 4EZBA 1V6AA 1K2WA 2ZCVA 5EMHA 4IDEA 1ISFA 4Q3CA 1M66A 1D7OA 3DAGA 1I3LA 3T4EA 1HDGO 4K6FA 1K3TA 3FN4A 3KBOA 3VPXA 2GN4A 2W2KB 1UDAA 2DPHA 1A27A 2ZQYA 1DO8A 2X7HA 4Y9DA 2YUTA 2ZJ1A 3WGIA 2BD0A 3H4VA 4IDCA 2P4HX 1JU9A 1UH5A 3SC6A 3WGHA 2I3AA 2VYVD 1QV7A 4CMJA 3S2EA 4BNFA 1BVUA 3AUSA 3H5NA 4ZHSA 1YOVA 1D1TA 2NVBA 4CR6A 5IN5A 2X9NA 4DVJA 4H7PA 3ROMA 4AJ2A 2DTEA 2HUNA 1AXEA 2QZZA 4MP6A 4MVJF 3TZ6A 3E6AA 3I6QA 4Y6PA 3WYEA 3PQDA 3X2FA 2FR0A 4DQUA 3W4JA 1JVSA 3EY4A 1N2SA 4DMMA 3OH8A 5B4TA 1NTOA 1RM0A 2Q46A 2DBRA 4IMRA 2VWGA 1DC5A 2VWPA 3V2UA 4L8VA 1BTOA 1HTBA 3CEAA 3DMYA 5TX7A 3WIEA 4J4HA 1B26A 4RPGA 2OORA 4RV9A 3CINA 3BMCA 4BO9A 4E5YA 1RJWA 4KP7A 4JN6B 1DFGA 3I6IA 4J49A 2Q2QA 4HXYA 2ZJ0A 2Q2VA 5JCXA 1ZK4A 4CMEC 3WGZA 1HLPA 1DIBA 1QYDA 1Y8QA 2JKVA 2OUIA 2X0RA 3MWDB 2OP1A 4MIEA 4XZ3A 4Q3NA 2E4AA 3KHUA 4NPCA 4RDHA 1E3JA 5DOZA 4ALKA 1UDCA 1E0DA 1ZXBA 3UUWA 1EVYA 3NUGA 4I9HA 4HFRA 1UR5A 3DZGA 3H65A 4N5MA 4ONEA 2Y1EA 1NWHA 1E6WA 1TXGA 3G0OA 3P5SA 2FN7A 4YRAA 4EJ6A 1QMGA 2RH8A 1LDNA 2GR9A 3KYCA 1FDTA 4HFNA 4FOSA 4QFCA 3RU7A 4DLLA 2IRWA 3UF0A 4L4SA 5LCXA 4NFSA 4G81A 5CEJA 4XX0A 3L9WA 4TROA 2O3JA 3JQGB 4BNIA 3JQ9C 1G0OA 1SCUA 4GI2A 3UKOA 1P77A 5CP8A 4BNWA 1LLDA 5A5FA 4Z0TA 3KSUA 4K26A 4QECA 4L75A 4PG5A 4R5MA 4WGGA 2IZ0A 1HSZA 3IS3A 4I8XA 4PLVA 2W8ZA 3F1KA 1DC4A 2VYNA 4GX0A 3CUKA 5L53A 1YB1A 2FRDA 4NJOA 1C1XB 3Q1LA 2WE8A 5LDHA 4IZHA 4FPXA 2HMTA 4GVXA 5G0TA 1GV0A 1LLUA 1QYWA 4DYVA 4BS9A 1U7TA 2I5PO 5L7YA 1DJQA 1ONOA 3GZ4A 4XR4A 4UVHA 1KY5A 1QYXA 4AVYA 5HA5A 2O4CA 1C3VA 2XXJA 1Y9EA 2Z5LA 3BHIA 3QWBA 1MG5A 3SXPA 2GN9A 2PLAA 2G76A 4MKZA 3H7AA 3F47A 4R1NA 3I9MA 3WGQA 1TA4A 3I5MA 2CVQA 1IB6A 5H81A 1I10A 3I4CA 5AQ1A 1JW9B 5MDHA 1DIRA 3K30A 3RCBA 4WLVA 3SEFA 4EUFA 1P9LA 3DBVO 3H9UA 2ZYAA 2DTXA 4R54A 2D8AA 3INRA 5KVQA 1ZUD1 5KVSA 3TDKA 3GA0A 3H8VA 4ESOA 1HKUA 4LISA 3A4VA 3F6YA 3GG9A 2EP7A 4U6QA 4WNCA 1F12A 1PL6A 4P38A 3UCEA 2HQ1A 1WAMA 3E48A 3MJSA 3P7MA 3R6DA 3B1JA 4KUGA 2PNFA 1ISIA 4UEKA 3ZWAA 5KJ1A 1LA2A 5L40A 5FFFA 1YDWA 1N8KA 3KLMX 4TZKA 4ZJUA 1AE1A 3AUAA 4EGFA 1YRLA 4AJ4A 4LSWA 3OIFA 2WD8A 3VZRA 3QP9A 4MO2A 3W8FA 1GZ6A 2WSBA 2E82A 3AM3A 3O38A 4E5PA 1ZK0A 4D44A 2CDCA 2GCGA 1NFFA 3PZBA 4PLGA 3JSAA 1TB4A 4LGVA 2Y99A 4XKJA 4NHEA 1GUZA 1E7SA 3G3EA 2WD7B 4Y6SA 5FEUA 2IYPA 2F00A 3OICA 4CLRA 1GYRA 4K1LA 3LVFO 3GK3A 3OQ1A 3PVZA 4YJFA 2PKRA 4ALNA 2NWQA 2YYYA 1ENYA 5A9SA 1YJQA 3EVNA 1A9ZA 3QQPA 1XSEA 3ONEA 4IINA 3LYLA 3HUDA 5IDYA 3TFOA 4ZRMA 2ZTVA 2Q99A 4AJOA 4BO2A 1EE9A 3UVEA 2J3IA 4XJSA 3VH3A 3ZU4A 4E2XA 5F1KA 4DUPA 5IXYA 2X0NA 3S2FA 2NSDA 1JAYA 1I2BA 4BKRA 1TLTA 2J3JA 4HY3A 1DRWA 4MDHA 5F5NA 4BO3A 4DIFA 4JP2A 2DVMA 4UVEA 2JJYA 5H83A 3TOXA 3VKVA 3S2IA 4BMSA 4X54A 5KCZA 1NR7A 1VM6A 2JFGA 3E82A 3BXXA 3DBHA 3FI9A 4RL6A 4BL5A 3ETDA 5CDUA 5JSFA 3OJOA 2YZ7A 3G79A 2EERA 4FQ8A 3FWNA 2UAGA 3DAFA 2ZCUA 3RBZA 2IZ1A 3R3SA 1KERA 4I08A 1OC4A 3OEYA 2DC1A 4FFLA 5U4QA 1XG5A 4Y8VA 4YAEA 3UAGA 3CXRA 1EEHA 3O8QA 1YVEI 2V6FA 3ZN2A 4E2WA 2NVUA 4NI5A 3QRWA 1X0VA 3AUTA 3RJ5A 4Q3BA 3GVXA 3NDJA 3JQAB 2Y0EA 2Y1OA 1E3WA 4MIYA 3MOIA 3DB2A 4Z0HO 3AM5A 4B3IA 1M6WA 3OM9A 3P2YA 1C0LA 4E2YA 1YB4A 1SMKA 4B4OA 3U5TA 4IJUA 4UVIA 4YRBA 4YB8A 4H15A 2WYVA 3OQ6A 4E5MA 1HDYA 4G2NA 4WLUA 5KOIA 4KDEA 3ASUA 2PFGA 1B3BA 4DA9A 5COAA 4ZQBA 3QWAA 4FN4A 2QHXA 4CJXA 1C0PA 2VT2A 4OIMA 4OXYA 1O6ZA 4KWIA 4NIMA 2D3TA 3BZUA 3CPSA 3CZRA 4W99A 4H3VA 5BNFA 2RAFA 4D0SA 2BFMA 3BHJA 2I6TA 4DL9A 5JMWA 3E9QA 4JX8A 3FR8A 4HV4A 1I2CA 1I3NA 3D5QA 4MVJG 5T8KA 2HMUA 5A02A 4Z9YA 1ZKMA 1YQDA 2NQ8A 4EW6A 5L7TA 5CHEA 1AUPA 2H63A 1EQ2A 4N5LA 1P1KA 1YE3A 3TZQA 3I9JA 5AXAA 5MGBA 1X14A 3Q9NA 1G1AA 4O63O 1U4OA 4PLYA 4TQGA 2DUUA 3F9IA 5HWSA 3K5PA 4P4LA 5CPBA 5KJCA 3T7EA 5IN4A 1VJTA 4CODB 1HWYA 4YR9A 5COBA 4P4NA 1JLLA 3B20A 4RPJA 2GPTA 3H9QA 5ER9A 5JDCA 3GC6A 1GFSA 4R1UA 2D4AA 1NAIA 3VKUA 4D43A 2GZ1A 5JC8A 3LSYA 4WJZA 4I5FA 2J3HA 3A9WA 3M1AA 1H2BA 1MFPA 2O48X 2AMFA 3G49A 5L7WA 1VKOA 4XRRA 3KYDA 3A06A 4I5EA 4BIIA 4ND1A 1VPDA 4OQZA 5CFZA 4Q9NA 2PV7A 1CIVA 4B3HA 5F21A 4GAEA 4BB5A 4FJ1A 4HWKA 2ZQZA 1GR0A 3ENKA 2OP0A 1T1SA 4CMHA 1IOLA 1GPJA 1YBVA 3GQVA 1FJHA 2HDHA 5JC1A 4OL9A 2NTJA 3FSRA 4II3A 3HE3A 2XXBA 2CSUA 2UV8A 5DDIP 2AE2A 4AJJA 4FB5A 1ZIDA 2GN6A 3ZWNA 2I66A 4NK4A 4QQRA 2B69A 4XWYA 3WGOA 4O6VA 4U8GA 4MOWA 3ZV5A 2R00A 1DOHA 4W4TA 1F06A 1YB5A 3KSZO 4OSOA 4RLHA 1A9YA 1EDOA 1YGYA 3MJ4A 5TC4A 2JD1A 2V6MA 1LDGA 1I36A 1ZEMA 3R0IA 3BMOA 4IDAA 2YDXA 4JK3A 5LC1A 4JIGA 2Z1MA 4LW8A 3UICA 3WBFA 4BKUA 3I83A 3AU9A 4XCVA 5BSGA 1EBFA 4B8WA 2DFVA 5IAAA 3U09A 1U3UA 4YJHA 2EJVA 4KWHA 2BFPA 4W9NA 3ZWXA 2VCYA 1JDJA 4IGFA 2I65A 3M6IA 4GWKA 1W0CA 3PHHA 3N7UA 1V8BA 5DCWA 1YL7A 2NTVA 3VZPA 5L4NA 1LDEA 3RROA 5JAIA 3BAZA 2D5CA 1OAAA 1TEHA 4XYGA 3IP3A 4ALLA 4DGSA 3U62A 4JNKA 2ZB3A 4CLOA 3RBXA 1JN0A 2QG4A 4MVJD 5ES3A 3ZHYA 1J6UA 1RYEA 1F0YA 3AI3A 1V3VA 3GHYA 4MKXA 2D1YA 3EUWA 1EVJA 1C1DB 9LDBA 4LCJA 1PGJA 1X1EA 5DBFA 2FPGA 1BXGB 2NADA 4A73A 2HMVA 3S8MA 3GZNA 4KTTE 2EW8A 1E92A 1P33A 2OZPA 1HE5A 1DDOA 1Q0LA 1NQAO 4XGNA 5BNIA 1V35A 1H93A 2QRLA 4OM8A 3NRCA 3PWKA 2VRCA 3Q2IA 4CV1A
chains in the Genus database with same CATH superfamily
3HQ4O 3Q40A 3RTDA 3RVJA 3S7TA 3ZVRA 1VE9A 1G8JA 3FYTA 1HOXA 2YNMC 2W0SA 3HDVA 5SZKB 1LZLA 3UFXB 2C7QA 1OJLA 4EKGA 4GSKA 1LSJA 4DLKA 1UQTA 1T3SA 1BAPA 4GPIB 1S3FA 4JJ8A 3W5DA 2DEUA 4AUMA 2WABA 3KQLA 4UMVA 2GM5A 3ZIAD 3HVKA 2OHGA 2QW8A 1SZCA 1E6CA 2XNSA 3BGSA 4RHXA 1FBNA 4JAVC 1UM9B 3ZWBA 1XCGB 5F4BA 1F48A 2PUTA 9LDTA 2KBFA 2HMAA 4J0QA 4GMGA 4BNNA 2VP9A 1G5IA 3ZLJA 3M4JA 1RTKA 3L7CA 4J3JA 1YQXA 2KLBA 3P9YA 3MQFA 4WLOA 5IULC 1GGJA 4GEKA 2FV8A 5KYVA 2JB9A 3HKEA 4CMBA 3EPPA 3MTDA 3UGQA 5D8DA 1QHYA 1QO9A 3QLUC 1F4PA 2HN9A 3PI7A 5AVOA 2H7YA 2I7XA 3NRBA 2FPIB 1JJBA 2WWVD 5FULA 3T1VA 1SUIA 2L82A 1AN9A 3PXUA 4X3OA 2B0CA 2PR2A 1KU6A 5CD1A 2Q4RA 2RGYA 4JWTA 2ZJBA 4Z8YA 3QGMA 4GPTA 4TZ6A 4E4RA 5HUQA 4IDFA 3PE4A 4BMXA 3RWOA 3HSYA 5DLYA 5LBIA 3NONA 5ALXA 4ZWNA 4P08A 5CVVA 1JF8A 2XKAA 3E9MA 4XWKA 3LVBA 2G8LA 2QD3A 2AQ8A 1AO3A 1TJ4A 3C14C 3I32A 1QGUB 2B3TA 3RC7A 1ENPA 1TUIA 4DR1B 1KAGA 1CJTC 2P1DA 3NI2A 4GVLA 1Y8RA 1V43A 1REQB 1CUSA 3KG2A 1XA3A 3FHJA 1U2ZA 1U94A 2ABWA 1LK5A 2QU8A 3PCRB 4JI1B 3UWKA 1FFGA 3ANMA 2VLIA 5DXFA 1OLOA 3TQQA 2MCFA 2A9RA 3DFKA 4M87A 2YN4A 3G2QA 1FVHA 1L4FA 1E2EA 3LXXA 3OT5A 3QXCA 4R5HA 5JDIA 1XU9A 5H82A 3LM8A 4X91A 5HF6A 3I2GA 1IJEA 2B8TA 4IF6A 2XEXA 1GPBA 4XIIA 3OQMA 2R7NA 1KIFA 1R9MA 3VQTA 5BNWA 1XZCA 3ANXA 4LJYA 4ZV4A 2D00A 4PS1A 3HI6A 5HJ2A 3V9PA 2NT4A 1Q1EA 1NRWA 4E6PA 1FDOA 4B48A 4Z4HA 1PTJA 4NYIR 2FFJA 1I7DA 4E5UA 2CLOB 2H9AA 2JIMA 1II8B 2PGXA 3VOSA 4BV8A 4K6KA 3WLSA 5CA0B 5CDYA 3KUXA 3UT0A 5BVHA 2VYVA 2XV1A 4O5OA 5E7MA 5J40A 1K3UB 4ZVKA 4QEZA 2QMEA 3FTDA 2D1FA 4QAJA 4GOND 4ZOAA 1S2IA 4B46A 2IEGA 1Z2AA 2OAP1 3RTBA 3U3MA 4C20A 2FWJA 2X22A 1QE5A 3CU5A 5JG7A 4UUQA 3P71T 2GPWA 3RWBA 4X45A 5BN5B 2XF2A 4WZBB 1GNVA 1CNMA 3T0GA 4AP9A 5JAOA 1TUBA 3F97A 1TF2A 3G5LA 4B5LA 3RSZA 2W4QA 3TNJA 2VH1A 2M6LA 1EUDA 2VHZA 5KSZA 3TTSA 3V8PA 1ZAKA 2ZDHA 5FI5A 4DWJA 2Q0SA 4CTOA 2G9RA 1OC2A 2JJ2D 3OFJA 4EF5A 5A4DA 2LXNA 2F7SA 5DW3A 4H7DA 1A8SA 4F2GA 3GP5A 4WKOA 4DM4A 5C8YB 4PR3A 1WE2A 3KSMA 2UZ1A 5JFOA 5LNK1 5J1TB 3DTVD 4A5SA 3ZU2A 5JEEA 3T3IA 1A1VA 1N2XA 4NBUA 3VISA 4CNBA 3A3NA 1AXGA 3ZK9A 1HYEA 4B40A 5BUZA 1TMOA 1ADGA 1Y1RA 2JAOA 2X19A 4G5QA 3QQ5A 4PO8A 5L3ZA 5DTRA 3FWZA 2X0KA 1DAGA 3CZ5A 1GGVA 1WMSA 3GLGA 4EW2A 4ZAGA 5DNYB 2FPXA 3IBSA 4UHCA 3WOHA 3WWZA 3DD5A 4R98A 5LBTA 4MPTA 3ABOB 2GCEA 1HYQA 4UBLA 1TPZA 4MGKR 2EQAA 4OA8A 4S12A 4G84A 2VJMA 3HM2A 4LRSB 4DPLA 3K73O 4JLBA 4ZCRA 2ZE5A 4M9SA 3N58A 5IDVA 3V4PB 1SELA 3GDWA 2RI6A 3MJFA 2WAAA 3ZV7A 3CVVA 2PKCA 3B3FA 4HGNA 4AZTA 1JHRA 1N36B 3QBJA 4ZZIA 2Q62A 5KSWB 3I2JA 5C80A 1AS3A 3AUXA 1GSAA 1NSTA 3NBYC 5DYTA 5FHQA 3ZXUB 3A0RB 5FD8A 4QYIB 3OFSA 2OC9A 2ZTSA 4QUDA 4RVGA 3HDHA 4UUNA 4UMEA 4M1WA 1O96B 1Z38A 1NRXA 1HE3A 1DG1G 3C5WP 2V7BA 3JQFC 5EC8A 4AWXA 2R68A 2WF9A 1L1FA 4DCGA 4IDNA 3KQOA 1UJBA 3PUVA 2YJ3A 1RWQA 2B5WA 1TI7A 1ZOIA 1HTWA 4UATA 5TQ0B 4UZSA 4JL5A 1VKNA 3FSJX 1M8JA 1QHEA 1I6KA 1NYTA 4A27A 3TM5A 4YCSA 5JDCC 3UWMA 2DETA 1QOZA 3WLJA 2NXEA 3AL0C 3P9KA 1H2WA 4I6GA 1NBAA 3EZFA 5KJEA 1RXIA 3LUGA 1UJCA 4C4TA 1IVSA 1NW8A 1M1XB 4QUBA 3LQ1A 1KR5A 1M34A 3GMDA 3S70A 1S8NA 2I4TA 4NENB 3L07A 3JYOA 3MMSA 2QENA 1V9SA 2EG5A 1UKYA 1X1QA 2FB9A 3AHDA 1JG1A 2AR0A 2UZ0A 3HBNA 3OCXA 1IN5A 5HIAA 4N6GA 1OFTA 1S4QA 3WNVA 2O06A 2HRBA 2IXDA 5IYZA 1YBMA 1ZH4A 4FQ7A 4XD7D 3M89A 1ZK1A 3OEEA 4PC3A 5DTMA 3VR6A 1G2QA 2B98A 4M54A 3WKAA 3C8DA 3M4XA 1R1DA 3PDIB 4FFMA 3QVGA 3THOA 1GRNA 4QDUA 1T4BA 1G21E 4OFZA 3ND7A 1W49A 1Y3BE 4X95A 2GF0A 1W6RA 1TMYA 5J4LA 2HPHA 3CR8A 2VPXA 2VT7A 3D0KA 5K8IA 1IUKA 3ANLA 2BR4A 1K9VF 1X86B 3QI7A 1MDBA 4IWXA 3PUIA 4NH0A 5L4SA 1LUAA 1KRHA 2V7PA 1IOVA 1SXJD 1LV7A 4D56A 2IXBA 1SUDA 1HQCA 4AXXA 2G63A 3T1YB 1QIHA 1HYHA 4TYYA 1WF3A 4NS1A 4C29A 1A5ZA 2X2OA 5HRAA 2YBDA 3M3HA 4RY2A 1MJHA 1Y1QA 4AURA 3B1FA 4L78A 3DMGA 1M6HA 3A1VA 1KVUA 1QIJA 4RHFA 2D0IA 4AY4A 3N2KB 4WJKB 4JR1A 1EFPB 2VDWB 2W2PA 4RA6A 4G1VA 4I9UA 5GM2A 4JBHA 4EBFA 4REQB 1U2DA 4MA5A 3JU3A 3LUJA 4KE8A 2O8VA 2Y93A 2C4TA 3IV9A 5KX5B 3A9VA 4WVLA 5K8LA 3MOGA 1KZYC 1L6RA 2Q9BA 3ZH2A 5G4KA 4BYGA 3TQOA 3WKEA 1ZYUA 1RVV1 1VXRA 1JILA 9ATCA 1YDEA 3U3KA 3VVCA 1CQWA 3ZKWB 3QEMA 1E60A 4WOBA 4EG6A 1VDMA 4IQ0A 1XVLA 1L4BA 4GX2A 3GD5A 3GFRA 2JGRA 1OFVA 4J2TA 3KEGA 5ALDA 4BLOA 3ZDAA 4CGZA 4OBWA 1OX6A 2R62A 4MQ5A 3SZGA 2AX4A 1IL0A 3F2IA 3FE2A 3CLSD 3LLSA 4YRTA 2JI8A 3H0CA 3Q7TA 3P9PA 2C2ZA 4BMZA 3HXLA 3ZJVA 4DR6B 4D6YA 3H83A 3W3AA 4TMXA 4WUTA 5C2JB 2RIRA 2ZRPA 1ZICA 2R6GA 2IL1A 1OZFA 3C45A 3CWZA 2OO5A 2XY4A 3JV7A 1UDXA 2GLUA 2WG0A 5DK6A 4GRDA 3PQ4A 4MS4B 4DLYA 2JAUA 4GKJB 2QNBA 1U9IA 1Y9ZA 5DFAA 3IJRA 1MV5A 1NN3A 3D3KA 2J0EA 3PFCA 3VO1A 4GOOD 5FOXA 3MWEB 1E61A 2FW7A 4NU5A 2E48A 1FLAA 5ANRB 2F17A 1E8DA 1CZOA 1WLYA 3PVCA 1GQ2A 2BMFA 4ZI7F 1IZ7A 4DJ5X 1Z06A 3LMKA 5F98A 3LC7O 3O7WA 4QUEA 1EM8B 1XZHA 2H1OA 2BH9A 3GU3A 2Q5HA 3DBHB 2HCRA 2CL6X 3I6BA 3DE5X 4WOJA 5FYDA 1CUCA 4WLNA 2RSLA 1N5KA 4XYBA 1L5MA 2AEJA 5LQAA 4DCJA 2CDAA 5KNCD 2HDNB 4YHBA 5T67A 3G23A 5EKDA 1XR3A 4Q1BA 4FXPA 1JXQA 2VXCA 1JHXA 2D74A 4Q82A 2E0IA 4YV2A 1UXIA 2OV3A 4L0DA 1I0LA 1NONA 3H9GA 2AN1A 4OX9B 1MJGM 3PDWA 1MZVA 1AQLA 1VSBA 2XB6A 2V98A 5K3SA 4R8RA 5AW2A 1R0ZA 1XLVA 3O0TA 5JBIA 2C58A 4UHFA 4DQXA 3ZE9A 5ESWA 4E46A 2CNDA 2YIMA 1UC5B 2Y1WA 1GUDA 3OC0A 5BXYA 3KOWA 3U7GA 4M8LA 6GPBA 2MSLA 3RS4A 2RHBA 1A5SB 2CB9A 1MF7A 2Q2OA 3HV2A 1JEOA 2AV6A 4IJWA 4UM8B 3R9KA 4OXXA 3WC4A 3SU8A 3BRCA 5KPJA 3HR8A 1HXHA 3E5MA 5H80A 1DFIA 4XSHA 3D6FA 3ISTA 1B42A 1Y5MA 1V71A 2PGIA 3NDRA 3SJ7A 4B3DA 4O4HF 3AH8A 3UMYA 3D8HA 5C7YA 4JBWA 4QU8A 5KTSA 1HLDA 2ETXA 1CC1S 1Q95A 2OR3A 1UZNA 2FSIA 5HILA 3F3KA 1QRUA 3GLIA 2XR1A 2FG6C 2WIKA 3GNLA 4HH4A 4IIVA 2E4WA 3LHFA 3OU2A 1W0JA 1XI2A 3IE1A 1HFEL 4R8MA 3M34A 4N76A 3E61A 2WVAA 3D4LA 3X1MA 1AKYA 1T13A 1OLXA 1WPXA 2IPLA 5BN1A 1YHNA 3WZ2A 2YIJA 2B6NA 2PBFA 3HNRA 1JSXA 3A26A 1OZGA 1T8SA 4AG3A 1KVQA 1TT7A 2JGDA 4YH1A 3RC9A 3WLHA 2BL4A 3MGAA 3LT0A 1Z36A 3DT8A 1T5LA 4RDXA 4DV2B 3K8YA 1G1MA 2VZ0A 4GLBA 4XVCA 4DCUA 4RTLA 4X1YA 1E89A 5FI3A 3VR3D 1XDWA 3WP1B 4UW9A 1IG0A 1PFWA 1J2TA 1ONNA 5DOVA 1GQYA 3OQJA 1EE1A 5KTMA 3EVZA 1K3FA 5I4KA 3SDZA 1CX9B 1CR4A 2PZEA 2WILA 4MUEA 3VTKA 1I1HA 4KPYA 1SU6A 4J9UE 5E3IA 1GCUA 3I9LA 4KN8A 1TQ4A 2BLNA 4RM2A 3B78A 1O0BA 4EG5A 2CVFA 3I9KA 1H2YA 4CR8A 2II6A 5IT0A 4IUDS 5NULA 1NG1A 2B9VA 3N74A 3QVTA 4E15A 4D5EA 5JSHA 1Y4SA 2FDXA 1XZMA 3FPGA 3I05A 3OWXA 4LRTB 4N8EA 5JPDA 1Y3FE 5EXXA 1X39A 1MC5A 2J07A 1K5DA 5AJXA 1DADA 2VS1A 1UIRA 2X4LA 3WLPA 4NCXA 4BNTA 2PWZA 1LW7A 1N1EA 3A27A 3LQRA 5CIWA 2WFZA 3DXXA 3I92A 3UJ6A 3FPAA 3ZDBA 1TPYA 4J8PA 3ZQ4A 3F8TA 2IHUA 1E9DA 3H3JA 3QPBA 4ZVUA 5BXQC 4QZVA 1T6YA 5LYJB 4L9AA 1DAMA 1E2BA 1B23P 5EE0A 3ETLA 2HK9A 4E0BA 2XYHA 3OJFA 2QDKA 2QMUA 1DTWB 2APJA 4ZC1A 5CLQA 1ORRA 3OZDA 3LX4A 3G0HA 1XDBA 3Q6NA 1CUGA 1EVEA 4FKBA 1M2OB 1Z6ZA 3O4IA 1H3NA 2E55A 2J9GA 1CU1A 2JCVA 2AJ8A 4UEWA 3N0TA 3OKPA 2O4UX 3QA9A 4GOKA 1LTKA 1UAYA 1ZU4A 1A9PA 1U8CB 1ZD3A 2Y0DA 2WFMA 3FROA 4BBAA 3U48A 3BA1A 1DC8A 5B2EA 3ROXA 3W05A 5EJ6A 4YACA 4O3MA 1T9BA 3VOTA 4IX1A 1C2YA 2A86A 1FFCA 4KE7A 4IPTA 3R7LA 3W8NA 1FZTA 2AXQA 3OIGA 3V8BA 3FPFA 3ZHUA 3SBDA 5L3SB 2Y2UA 3RFTA 1IY2A 2FN9A 3K1YA 3R0XA 4DSOA 5FFNA 5LYYA 4CUZA 1MC8A 4DB2A 1YO6A 4JYZA 121PA 3PD0A 3MCAA 5CX1B 3KJXA 4NAHA 2HK7A 3VH4A 2C54A 3QHAA 2BIFA 3MCZA 1RI4A 3NC1C 1O87A 3PXBA 2AEMA 4I2VA 3FPSA 4YRCA 4YMVA 2YFHA 2WUFA 3KTAB 3HB9A 5IP5A 1R37A 2HIAA 5HQJA 2VAPA 3LX5A 1WB6A 1WG8A 2DZDA 3P2OA 1JLMA 5BW6B 1OXKB 5KTPA 3FOZA 1WBDA 4JVNA 4ZGGA 4D6XA 5ICGA 4V0QA 3EARA 3I8OA 5DKFA 5DTJA 2NU9B 5DM60 2VTBA 4LVNA 3QSYA 4IUBS 4YCMA 3KR1A 2H9YA 3AYZB 1D2CA 1XZDA 2GN8A 4N7RA 1OVGA 3AEKA 5LD2B 1ZN9A 3IIEA 2H5EA 3CTMA 5IDXA 1YS7A 3OY7A 2WU8A 3QKTA 5ERXA 1KDOA 5DP1A 2G3YA 1ZGZA 2ZZMA 2C2OA 1XPRA 4TKUA 2YYZA 4KKVA 5IHXA 2G28A 3ANYB 4OJNA 2DHQA 2ECQA 2JAXA 2WF8A 3O4GA 3KJIA 4CT0A 1P9RA 3HJFA 2K87A 3Q1KA 2Q5QA 5LQMA 1N9GA 5G53C 2BTOA 2EBHX 2HPZA 1DQRA 3I6ZA 3UY4A 3VR6H 3WL8A 3ORHA 4CLDA 4ENTA 4I1IA 1CVIA 4PIVA 1G55A 4L0QA 5BSHA 1JFRA 2BSQA 1SGWA 4MO9A 3E9RA 2CXHA 1JBEA 2A0UA 5CA0F 2J0UB 5FL3A 4MR8B 2ZRCA 1ANKA 3RBAA 2WJWA 5P21A 2FPGB 2Y71A 4B83A 2BT4A 3IQGX 1SRRA 2OBFA 1YAJA 4KAJA 1O08A 2P77A 2CHVA 2OG2A 3HXPA 3RSOA 3EGXA 4YHHB 5G0UA 4Z4QA 4L3OA 1SKQA 4MVXA 2PTGA 3IEXA 4LK2A 4WOKA 1MW9X 5CVTA 1HYGA 1R0SA 2BW0A 3D7NA 2FFRA 3NM4A 3OAAD 5MGNA 1SXPA 3D3WA 3P5BA 4IUYA 4LRWA 4N3CA 2QJFA 4BO6A 1ZUHA 2A6PA 1IDN1 4BJ6A 4KC0A 3TSAA 2QRVA 1NJ5A 1WR8A 1S7CA 1ZCZA 1T1RA 2I6UA 2ZSBA 3GLQA 4M36A 4ZOLB 2WOJA 2XUIA 3QUTA 4GPEA 4Y2QA 2D0OB 2VSYA 4BO4A 4YUXA 3H84A 3A6HA 2A9VA 4PTZA 4JI8B 4UQPA 4AIRA 3PJRA 1G5QA 1RM5A 4P3YA 3GPDG 2ZI7A 1TRHA 2Y8EA 3OD5A 1KEWA 2FHPA 1RTTA 3A58B 4ND3A 4PAWA 1U9JA 2O2SA 1Z82A 2IODA 3AF3A 4TQUS 3R9WA 2A84A 4W5QA 3IHWA 5C8YF 1DKRA 4KWEA 3O8CA 2GARA 3PC7A 4HB3A 1MXHA 3MRTA 3QV1A 3S29A 4YUYA 4RULA 3B89A 3TIFA 2CHEA 4GRAA 2OCDA 2OCIA 4Q19A 3LT2A 3QI2A 3QYPA 4URHA 4CR7A 2PTHA 4XWWA 2OZKA 2G72A 4LJAA 4U5QA 4V38A 4LEIA 2GO7A 5CXUA 3BFVA 3G89A 2HF8A 4LDRA 4MGYR 1FSZA 5BT8A 1DKQA 1IHXA 3HNOA 1QIIA 4JKOA 5CW2A 2BMAA 1TYCA 3NAGA 3EX7C 2C94A 3DXYA 1E1LA 1K8XB 1C0EA 2AFIB 2J9YB 2WAYA 1W36B 3LJKA 3MB5A 3RK1A 1T1IA 2J3MA 1E0JA 3MCVA 1O9GA 2J8ZA 2XGOA 1EZ1A 3DO8A 4PC7A 4TTQA 3V33A 1DJMA 1YDFA 5IJZA 2WMYA 3P9QA 1IOWA 4B33A 5I3CA 3P9IA 3EEFA 5EXPA 5K0NA 3V7UA 5JO9A 4BRSA 3HFRA 4PZ9A 2P5YA 4D80A 4KQ6A 4MYCA 3VYUB 2JIZD 5BQFA 5KTRA 1KTIA 1LRKA 1WKBA 3ZLTA 1SQ0A 1R6VA 3B12A 3P94A 2ZFUA 4UXHA 3HL0A 4AYWA 4JU9A 3D4IA 3LPCA 2OCGA 1QHIA 1X1BA 4PGFA 5F2KA 3FUUA 5LFAA 1V11A 3N59A 1FK8A 4F1KA 3DBRB 4A03A 3K53A 3DBLA 4WN9B 5CNKA 5CRIA 5IJAA 3ZGYA 3TNYA 4F12A 1T9AA 2GK7A 1HT2E 1MX1A 5FTMA 5JRJA 5E7QA 4LDJA 1XFDA 1S6YA 1U90A 2PSDA 1YMUA 2Q5OA 2XQVA 2Z9DA 2QRJA 1KYZA 4YDHB 4DMRA 4GLOA 2QMYA 1H4SA 1M8FA 2CXTA 3A8TA 5KWIA 2K7FA 4AG5A 3A9UA 3D6JA 5AHOA 2PV0A 2J85A 3F9CA 1DVRA 4TVKA 1Z17A 1T5OA 10MHA 3WJ1A 4CN9A 4F46A 3W4IA 3DE2X 2ARKA 2WK1A 4MVJM 3FYCA 3KETA 2F1JA 4TTAA 1ZR2A 4L85A 1SFRA 4NV1A 3V9AA 5IHPA 2VHXA 3D43A 4J94A 3E84A 1YKFA 2GNAA 4HDRB 2B25A 4EHDA 4MJXA 1YZQA 3DOCA 1L9KA 2NU8B 3PKJA 2UYHA 2BM0A 3H04A 4M0FA 1E2JA 1XLTA 2M98A 3JR7A 2IYFA 5AW9A 3RFCA 3IPAA 1Y9AA 2P9GA 5I01A 3B85A 2AB0A 1I7QB 1PQUA 4F1JA 2WFLA 4MPPA 4JOBA 2F8TA 3K2IA 2RJ3A 1VCMA 1RR6A 2O23A 4YYEA 1YS2X 1SKYB 2ZETA 1WMDA 3HFSA 3EDQA 4FZ5A 5KEIA 4ESEA 5JJCA 5KYUB 3VR5D 1CVLA 4B4VA 1EFRD 1PSWA 1Z8HA 6ADHA 2NZ2A 3VX3A 3HWX1 4LF5B 4NZYA 1L7MA 1LPMA 1U5AA 2EIHA 3GFQA 5HOQA 2BUAA 3CW2A 2FE1A 3CEPB 4L1KA 4INPA 3HUUA 1U5BA 1GTSA 4P31A 2QI9F 2GDZA 4HUTA 2P6OA 4NZNA 5C0OE 3X2EA 4DR3B 3FMIA 5IJWA 2OCYC 2JH9A 3IDFA 1C0KA 4MITA 1DB3A 1EX7A 1Z5GA 2C57A 3D3EA 4HN2A 4DLXA 5K45A 2CCKA 5EJ5A 2VC2B 1PR5A 3D4NA 1R8SA 2FPOA 3KLPX 3E9YA 1R0YA 1ZONA 3WSWA 1D4OA 2P9BA 3I6MA 3N05A 3T35A 4LYJA 4YAIA 5KX5F 2A8YA 3F6EX 4H0NA 4YT5A 2DKFA 2Y1KA 2XCOA 4TLCA 3INGA 3QE4A 2C3PA 4GBMA 3AI2A 4HAVA 4OXKA 2JLXA 3TNFA 3B9RA 1X80B 2CLHB 3PHBE 3PNKA 1CZLA 1NJFA 4I55A 1Z9BA 4RPHA 4KQ1A 1AZLA 3LPMA 4WMLA 5BSMA 4IO1A 2GAOA 3R6LA 2QW0X 2IOYA 1I4LD 4JJIA 5AJTA 2SICE 3U4AA 1Z25A 1FTGA 2HZ7A 3AM4A 3AW9A 4U7GA 4WKBA 4MDEA 5IC4A 1Q7GA 2ON6A 1U0LA 3DYIA 3IXQA 2F1IA 4WLFA 2Y0PA 3N39C 3EA4A 2VDQB 4M2LA 4EX7A 1QQBA 1XJCA 4HYEA 1Q22A 4K9RA 5JXWA 1RU3A 5AOAA 4KR6A 2C1EA 3UMBA 3QUSA 3KWJA 3ESDA 3GLHA 4RTNA 3PUKA 1Z33A 1E2GA 1EVIA 1W19A 1Z6GA 4OP1A 4PHGA 3FETA 3LKDA 3ZBQA 4QIHA 1PT8A 3FYHA 4OA5A 4O1MA 2C0QA 2F43B 2M6SA 1SUCA 4TLLB 2YDYA 5TEVA 3GRPA 1NU6A 1ZZEA 3F4LA 1QFJA 3V4SA 1T3LA 1YZGA 5IF3A 1CBUA 4A36A 1I80A 2O3UA 1UK8A 2QVZX 3OLVA 1ZVJA 5JCJA 3BXGA 4YN3A 3OX2A 2ADOA 1X9IA 4H1TA 1JMVA 4FYKA 1FMTA 1Q50A 4MWOA 4HEQA 3CWQA 2GX6A 3HDGA 2FOIA 1XRLA 3LZCA 4BMCA 2OD9A 1PNTA 2I3GA 4N0PA 3KD3A 4ZVMA 3NAMA 4JT9A 1ZM2A 4BGUA 2BH2A 5HJEA 4ZYYA 4BO7A 5B58C 2QX4A 5KC9A 3HB7A 1P4HA 4K9LA 1P1FA 3U2QA 3ROKA 3ER6A 5HHTA 2UYOA 4I1OA 4PQYA 1SAYA 1T3ZA 1V7ZA 3MHTA 1NR1A 5THQA 4U2BA 2AFHB 2V58A 5D6OA 5KDDA 4PY2A 1WQ1R 2B82A 1QF9A 1ZH6A 3E1SA 5JVDB 1YJ8A 1QH1A 3CUTA 4KN6A 4LVCA 2ODBA 4YJGB 1UBOS 1JIKA 1QU3A 2IPOA 3FSGA 3TLAA 4JP8A 4B4WA 1Z0UA 5BMOA 1RW4A 3LWZA 5DCYA 5GIPE 2R3SA 2AQIA 3AHGA 3BXEA 3CG0A 2Q50A 2VYFA 3LUKA 2C61A 1R50A 2BBOA 2ZEJA 4LY3A 3TZLA 3UV3A 2B6HA 4OUDB 1UPAA 2VQFB 1MEEA 5K3CA 1E2QA 2YQ4A 4COOA 3CLHA 1G8SA 2Z08A 4KAXA 3OF3A 3HBFA 2DQZA 4UTNA 4B3MB 1I8TA 3KAQA 3QG5A 2FKAA 4NJEB 4DLTA 1DHTA 2Q3BA 5DM70 4WV3A 3R0VA 2WU1A 3KKNA 3THYB 1YR2A 2VHCA 3OPYB 1CQXA 2IDMA 2WU0A 2DUMA 4F4UA 1Q2UA 1MIOA 1UPCA 3KV1A 1SCIA 4C0WA 1GVNB 8MHTA 4GNKA 3QU5A 3UJBA 3STTA 1MN6A 4KODA 1NBEA 4C0LA 4EEXA 1KMNA 4RZHA 3O47A 1SUFA 2FCRA 5FP0A 4ZVSA 3HU3A 1EXVA 2DBZA 1GAJA 3LT4A 4D4LA 1M1YA 5KPDA 2PUGA 2J7PD 1NZFA 2OV8A 2V6BA 5F1YA 3UH1A 5K2OA 1DRUA 1R74A 3HCFA 1KS9A 4OQQA 4Y0NA 3ZE6A 4M1TA 2ZUDA 4QELA 2EBUA 2JLQA 1QOPB 3NATA 3CM0A 3AK4A 1J0CA 3MWFA 3PFFA 1SG9A 4WE3A 1EFCA 3PHIA 2F6RA 3NCHA 2EYUA 2IW1A 1U9YA 4G5HA 4EUKA 4DG9A 5CBPB 5J4YA 1Z6PA 1ZP6A 2CDBA 1ZNXA 2JF0A 2WD9A 1M6EX 3JW8A 3WYDA 2QIPA 3OCVA 1KU0A 2SKCA 4PCVA 1Y4ZA 1KFCB 3FPHA 4KN5A 1GPYA 4YROA 3ZGXA 2EDAA 3E53A 3FNQA 1X1CA 1JI0A 3LY7A 5E1OA 5FEMA 1E20A 1CY2A 1KY2A 2C5FA 4BO5A 5CITA 4W5TA 2VQ3A 2AKAB 5B3JA 2GPBA 2CE2X 4TSKA 5EWJB 4FMDB 3UCXA 1F8FA 1HSOA 3UAOA 2XNKA 1YE8A 1Z4QA 2HBRA 3LV8A 3OQBA 4GI1A 4P53A 4YDQA 2NU6A 1CUZA 1W8DA 2ZWAA 3FLEA 3WV4A 1AK2A 1UJ6A 2DP4E 5IWCA 3UXYA 4JXZA 3AUYA 1EX6A 1JKJB 2GVNA 1E4OA 2B34A 2ZBQA 4UUMA 2A59A 1RXUA 1NUPA 4HWOA 5EYPA 2FEKA 1DWUA 1FNNA 2QVLA 4I46A 3OJEA 2P6NA 4XFDA 5IKXA 4ZVRA 3F73A 2V1XA 2Z56A 2J0SA 4FSXA 3UAXA 5LYJF 2JLWA 3BVPA 2R5WA 1AT1A 4HX9A 3VVBA 1C8VB 1YS6A 4DLZA 3CF4G 4D4KA 3EZXA 1NE7A 5C46F 4C2BA 2GYVA 2W2OA 4P7FA 1CEYA 1Z0IA 3CLRD 3BB4A 4FHDA 4QODA 1K6XA 2W6MA 4OAQA 3MK31 4D96A 4JLPA 1T4GA 3G2MA 1MTOA 4CFSA 2BGUA 3NJ4A 3WXBA 3QVVA 5D84A 1E7YA 3ZQJA 2DWUA 3S81A 2ZIVB 4IJ6A 2AJBA 5CK5A 3W5BA 5C32A 1E5DA 1CUIA 3E7PA 4K8OA 4DA0A 5K7SA 1U6IA 1XJWA 2FE4A 2XB8A 4M0MA 1HORA 2PMFA 1J1UA 4RGYA 5DI3A 4G0UA 3VXKA 1U2GC 3WLKX 3ZDXB 5AYVA 4DGQA 4ML3A 4TTTS 4PN7A 3IXMA 3VDNB 3ADCA 1TW2A 4EATA 1W9HA 4X1IB 1RWMA 4XB1A 3K16A 5IH7A 3JRNA 3DZIA 3WL5A 3H86A 1EA7A 2Q0XA 4HVLA 5T57A 3LBNA 1N3YA 4J4TA 4A8JC 1LVGA 2ZR9A 4LXTA 1C30A 2BHLA 4Q6WA 1WVMA 5CB0A 1N1GA 2VUSA 4QDJA 3WQRA 1NHWA 2DFLA 3FCCA 4NBWA 3C15C 1X87A 2CEAA 3LK7A 2HX1A 2P0YA 1I32A 1Q1ZA 3ASYA 3O4JA 5TQJA 5JE8A 1TTHA 1M54A 2R8ZA 3FDZA 3UB4A 1VYTA 4Q39A 3QKSB 3A05A 3LKBA 2YY7A 2I6XA 2XVYA 3PYMA 4WN3A 1PR3A 1ECBA 5K3FA 4JJAA 3HXQA 3FZQA 5MFPA 5EMNA 4V2UA 2JW5A 1UBGA 2CKMA 4X24A 1RHMA 1NI3A 1J9EA 1SUSA 1XXHE 2JLSA 2P9CA 2PANA 2WYUA 3BQNB 3JQDA 4G0NA 4GGOA 3RF6A 4EUHA 3KZKA 2ZPUA 2YOFA 3SYKA 5JNSA 1XUOA 1NXSA 3WDKA 1EUCB 4LJRA 3LGXA 1JHOA 5IWAB 2AMVA 1RP7A 3KS9A 4PSDA 2WM3A 3W5AA 3O2JA 4JMPA 4BKQA 4KQKA 1EJBA 1U02A 2QSUA 2XADA 1PX2A 2ZRMA 5B12A 5B7NA 3M6MD 2ZYRA 4QGFA 3IOEA 2ZS7A 3RIXA 1XB2A 1ABEA 4TS4A 2B99A 3T5TA 2H6EA 4LC9A 1NVXQ 3JSXA 4YRRA 1LDYA 1KRXA 2CF6A 5AVTA 5F2OA 4ETIA 1UKBA 3FIUA 1PV1A 5JLJA 5BOSA 2E4ZA 4OH1A 2HF7A 3MUNA 3HP1A 4N7MA 3RVMA 1RAEA 4TVBA 1RM4A 1XTIA 3H42B 4I4CA 4MHTA 2XRMA 3ESAA 4ZOLF 1IBMB 1GNRA 2P9ZA 5EE9A 4IM7A 3V1MA 5L51A 1Z7EA 1XRSB 2AOWA 5A05A 5KSOA 2YMLA 3EC7A 5TF4A 4CEIB 2Q1WA 1D1SA 4I81A 3K4PA 5IX8A 4MAAA 3TI7A 1IE3A 2P1ZA 4XOUA 2I1QA 2QRZA 1ILWA 1MU0A 3NRJA 3TPFA 5EHZA 5FPKA 3ICVA 3KZMA 4B75A 3QITA 3TLXA 2COKA 4PO9A 5TQ0A 4B09A 4BQNA 3NHUA 1ZUNB 2QY9A 4PX3A 4Q37A 3DEHA 5BRNA 1YFKA 4F38A 1V25A 2ZAMA 3R5XA 1A9RA 3AT1A 2CNKA 2J5KA 3E22A 4Z9XA 5EVCA 3S0JA 4D2IA 1FC0A 2VKTA 2ZPAA 4JD5A 1ISHA 3PENA 3O92A 4A73A 3ND5A 4ERNA 1DJNA 4EF4A 1TTTA 4C6TB 2UVDA 1ZCFA 4NBKA 1JL3A 1M1NA 2PJZA 3F5DA 2FN3A 5DWDA 1N7IA 4G0XA 5B4VA 2CLFB 3HWSA 3FPKA 3PEEA 4IJVA 4U2EA 3BTVA 4C0AC 1Y5LA 5DWVA 1VRCA 1XA4A 3KKEA 3LXRA 4M1QA 3S28A 2PZBA 2G8NA 2W5UA 3VAAA 4MVJI 4EJSB 3DMNA 2JHGA 4G01B 4QREA 3M3DA 5FTKA 1XKLA 4DW8A 2FPLA 4D9BA 1CLEA 3EQ8A 1OAKA 2ZSKA 1HE1C 1DXHA 4WUVA 2P11A 1D2AA 3MWDA 2C88A 3ROPA 4EH1A 2L2QA 4B2LA 3BERA 3KQYA 5AK6A 3WLAA 2IEYA 2ZYVX 4ZVOA 3EIUA 1Z4MA 1FYEA 3MPOA 1RPNA 2ZJFA 4G8DA 4X1KA 4A26A 4LQLA 3NDIA 3DT6A 2B83A 1WMBA 1GG5A 1JZSA 2YV3A 1CDZA 5D3MA 3GARA 1A9XB 2FF7A 1IEXA 2AOVA 4H7KA 4E12A 3R6WA 3OD1A 3GFTA 1ZGGA 1OSNA 3EGOA 1G60A 2J5BA 5EQDA 5DLDA 3M0EA 4OXNA 1QF6A 2H4WA 1FPMA 5CB4F 1Y4AE 4UARA 5LNK6 4EFKA 2O8CB 3K4HA 2VT3A 3THWB 4PZPA 4IYRA 1Y1KE 4N47A 2EC5A 2VIIA 2P68A 3FMOB 1XHLA 2VDWA 1SHTX 3G8BA 1EESA 3PFKA 5LXTB 1BD3A 2ZE8A 1DV1A 1CK4A 2E4UA 4WINA 4U7TB 1G3UA 3AHJA 1DNPA 2NNLD 1TM3E 4W1PA 3EC2A 2PD3A 5DJ5A 3U3XA 3C7TA 3TTXA 4DDVA 2NW6A 4G0YA 3IBCA 3DOEA 3UMSA 3TRIA 4FK8A 5F12A 3RSHA 4G1UC 4ZALA 3UMVA 1T2EA 5FPTA 2R4UA 3A3PA 3FPCA 1U31A 3PUWA 1PGOA 1LXCA 2DR3A 3KO8A 5DNEA 3DVSX 3Q11A 3WB9A 5JEDA 4KFRA 5LUAA 3RRNA 4HNUA 2G7ZA 2HFJA 1FRVA 2O2YA 4FFOA 5AHRA 4IV0A 1XTUA 2WWWA 4R8VA 4JB2A 2XE7A 2GASA 2QPOA 1B8UA 3P2IA 4KPGA 4OK3A 1D4FA 3AZOA 3CBQA 3HBMA 4XGKA 2XF8A 4B73A 4EA6A 3NWJA 1I4EB 3H19A 3ON5A 4ZAXA 2X3YA 2I0FA 2J9XB 2JAHA 5JS1A 1B4DA 1XKQA 4FCVA 1ZRSA 4F5WA 1VLQA 2OKCA 2I54A 2TSYB 2YNMD 2R97A 3MJTA 1FW6A 5IXSA 1I4OA 4RYLA 1F6WA 5J2TA 4QBKA 3GT0A 4IGEA 1FQOA 1H0HA 1ZEJA 3URMA 4I1UA 4QARA 2NZXA 1COWD 1GPDG 1DEKA 2A1IA 3EK2A 4QUIA 2O59A 5AK5A 4MQEB 4OH7A 2HNKA 3RRMA 4AN4A 4EY5A 2PUVA 3DCJA 4IOJA 1N57A 1EM8A 3ZXIA 2HO4A 3W1VA 4PFQA 3AVPA 3IGFA 5CT9A 3M49A 2B8JA 1L6IA 1AGXA 2X8AA 5JD5A 2J33A 2G04A 4XE5A 1SB8A 1Z0ZA 2JDID 4UCFA 3CZMA 2QXYA 1RI5A 4FGWA 2Q5EA 3DDOA 3JWHA 5K01A 1EI9A 5AW4A 2FPPA 1ADYA 1JR3A 3L7OA 2XRFA 3T0FA 2QJWA 4C7KA 1FYFA 1OTXA 1JHQA 3PIDA 1XRNA 3KEFA 2G5GX 2NU7A 2PZLA 4YALA 3TTVA 3FPBA 3WGKA 4GGPA 3W9BA 7GPBA 5HNKA 1FXSA 1IONA 1SD5A 2CLCX 1DCMA 4X63A 4KMSA 4KIWA 1QHHA 1WZUA 5FPQA 1BN7A 3RS9A 3SIPA 3L02A 4LKOA 2G9UA 2JPDA 2BF7A 2VSFA 4NC9A 4Z1MA 5KYWA 1W8IA 4ND8B 3ZNOA 5TT1A 4RVOA 1DAEA 1MB0A 3N76A 4O33A 2WWRA 4BQPA 1JI3A 5HRUA 3E3NA 5IMBA 4G86A 3DONA 1ADFA 3PHLA 1Z7YA 3MCUA 2J9FB 1LX6A 3DCIA 4JXKA 5DTEA 3BS4A 5EHGA 1UUFA 3IVCA 3MMXA 2XMSA 2GSWA 3A1DA 4MV0A 4KWCA 4B82A 1R15A 4MMXB 3FLMA 4RETA 1ZESA 3DHVA 4II2A 1GCGA 1XCOA 2E5LB 4GH5A 1UEJA 5ALZA 1OBVA 3DCYA 3VTZA 4A2CA 4AJLA 1PKXA 3SF8B 4HX5A 3VPHA 5B1DA 4XD2A 4RH3A 4WZAB 3EGIA 5TXGA 1KS2A 5E3JA 1E1CB 1Y1SA 3DW1X 2IUFA 4RIHA 1UIMA 2VF8A 2X4IA 3O93A 3D4OA 2FUNB 2P75A 2WD7A 4YP0A 3IUEA 5HIMA 3ODGA 3FFWA 2AE1A 3MINA 4LGCA 3T1NA 2HSDA 1VL6A 2JGKA 3BCUA 2EX0A 3E4DA 3O9MA 4M86A 1IXYA 1T8UA 1O0SA 3GT4A 4BX3A 3N7TA 1CJCA 1QR6A 5LDDC 1L7OA 3KQHA 1MB2A 3BH6A 4R05A 3WL4A 4EITA 4QJ4A 3FZEA 2HO5A 2JIDA 3PDJA 5JVDF 3MRXA 4FNGA 3ICPA 4YRJA 1C41A 1F4LA 2XKBA 4X6XA 1KMQA 3PX3A 4K05A 4QE3A 4XSGA 3WYAA 4B76A 3ESZA 3FNEA 4L02A 4JMLA 2VT6A 3TLJA 2HGZA 4S05A 3DCNA 4X9XA 4IKOA 2C9DA 2ONKA 2WMDA 3DAPA 4P4TA 4WNIA 5CLHA 4A91A 4UOEA 2GTHA 5EJ7A 1UP4A 1KYTA 2B5VA 4N5IX 1BWPA 1L9XA 4N18A 1DQNA 2VJOA 2CFRA 4LZLA 2WTBA 4DCMA 3GP8A 4P83A 1E98A 1ZJ6A 5F3RA 4NR0A 3TPZA 4DDWA 2HHAA 2PEZA 2FW9A 1D5WA 4I99A 1QANA 2PRKA 2YJNA 3ORSA 1IEWA 3ADDA 3UO8B 1WP9A 4JI3B 1QGDA 3QVJA 4B79A 1AS2A 3P2EA 5HF9A 4F2WA 2HY7A 2XYQA 4EVIA 2G82A 1QR2A 3LD9A 3K8QA 1GLNA 3E3LA 2HEGA 2ZKLA 4HDCA 4PZAA 2KLHA 1WUTA 5EZYB 4OB8A 3D59A 3LDUA 3MWYW 5IW8A 2I4RA 1W52X 3QBDA 1L4KA 1C1HA 2PA0A 3CRRA 2EKBA 2OCBA 2AN4A 4W8HA 2X9QA 3WA6A 2XTNA 4B8YA 2O0JA