1LSSA

Ktn mja218 crystal structure in complex with nad+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
MYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDAGIEDADMYIAVTGKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLIER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trk system potassium uptake protein trkA homolog
publication title A mechanism of regulating transmembrane potassium flux through a ligand-mediated conformational switch.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transport protein
total genus 50
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lssA00
5B12A 1NFQA 2WJPA 1E7WA 3IDSA 5CDSA 1N92A 1P1JA 4CV3A 2ZB8A 2BKAA 4CQMD 4BQRA 1PR9A 3B1KA 3OECA 1XWFA 4RVHA 3G3EA 1PQUA 3N74A 2X5JO 1CRWG 3I3OA 3KYCA 3JQ6A 2TMGA 4D41A 2JCXA 4AJLA 4XR9A 1IHXA 4WLVA 4J1TA 4WJZA 1R0SA 1NHWA 3H4VA 1GTMA 3OIFA 1QYVA 4MKXA 3WICA 1PZHA 1X13A 3KSUA 3RI3A 3BMCA 4FGSA 5JAZA 1SCUA 2G5CA 4XJTA 4AJEA 5G4LA 2Y0CA 5BSFA 1MXHA 2OP0A 3GFGA 1T2AA 2WE8A 3OA2A 3QVTA 4IJVA 4EGFA 3I9KA 2V6GA 3ROKA 1V3TA 2ZB7A 3ZV5A 1I32A 1MP0A 2W2LD 3QVOA 1RKXA 3GG9A 3I6QA 2PH5A 3P2YA 3KYDA 3VZQA 1I8TA 3ETDA 3JQ7B 1I0ZA 3KRTA 4ZQBA 4WNIA 3WGOA 1E3IA 1DC4A 1U8XX 1PGQA 4NHEA 3ZHYA 1Y8QA 3UAGA 3FNFA 4RLHA 2O7QA 5I7SA 4IY1A 3VTFA 3QA9A 5I9LA 5I8WA 3STHA 4BMVA 2XPCA 3JQ7A 1UUFA 3RU9A 5CEFA 1W6UA 4CMKA 5KTKA 4XYBA 4A03A 3UN1A 1K3TA 1ISGA 2X58A 3DR3A 3ICPA 4KP7A 3AFNA 3RUAA 2AEJA 3WQQA 4EEXA 2V6FA 3QY9A 2Q1WA 5C5IA 4GWGA 1TEHA 2HDHA 3PI7A 4RF2A 2OFPA 3GPIA 1XEAA 2GNAA 5HTOA 5JDIC 2VNSA 4QFDA 4OMUA 1YO6A 3BMOB 1UP7A 4EI2A 5A9SA 5ITWA 4YRAA 4YJFB 1E5LA 4M1QA 1PL7A 3V5NA 1DFIA 1VL6A 3TZHA 3K8ZA 4IZIA 1X7HA 3HDHA 1EFKA 1E6WA 3ZU5A 5GZ3A 1I3LA 1R37A 2HMUA 3PFWO 4FD3A 2GSDA 2CVQA 1I24A 3ABIA 5ER9A 2AE2A 3U0BA 4J7CA 3I9NA 3F9IA 5A06A 3JD3A 3DEYX 2IDZA 1Y5RA 5L45A 4Z9XA 2C20A 1DLJA 1Q0QA 1ADBA 5ITVA 2VWPA 2NTJA 3WS7A 4E5MA 4IDEA 1I3MA 1VPDA 1GYRA 5B4VA 1YRLA 3AY3A 3I9MA 3FBGA 1T1SA 1U3WA 4FOSA 4I5EA 4NZ9A 1IZ9A 3X2EA 2DC1A 1PU2A 1GDHA 2O2SA 2H9IA 5CDTA 4KUGA 2CDCA 5IFLA 2WE7A 2A92A 4BGEA 2EKLA 4F3YA 1NWCA 2VCYA 1BXKA 1LLCA 2V6MA 3I4FA 4TQGA 4TZKA 3VPGA 4KQWA 2NUAA 3ADPA 3T4XA 2P5UA 4KDFA 3ZNOA 5EQFA 5EL0A 5FI5A 4ALIA 1E7MA 4HFRA 1PZFA 1HE3A 4FS3A 1UAYA 4B7UA 3BMQB 4LCEA 2UYYA 4YJHA 3WIDA 4C4OA 2HMVA 3B6ZA 4ZRNA 2GDZA 2IXBA 5IZCC 3ZH2A 1ZCJA 3JQ9C 3D7LA 4FOOA 2X9VA 4YAGA 4RQUA 3VAZA 2ET6A 3KXDA 4BO7A 2EXXA 3EAGA 4IDGA 1D8AA 2P4QA 3ENNA 4XJSA 4MINA 2BGLA 2FMUA 3H3JA 1E1LA 3OJOA 2JAHA 5F1KA 4BVAA 4GSLA 1Y9EA 4RPLA 4FFNA 4JP2A 2GO1A 2VUTA 2ZATA 1NFRA 3O8QA 3SVTA 3ZWWA 3GUCA 3ZHXA 4LSWA 2H6EA 2YW9A 3IMFA 5U9CA 2SCUA 1EZ4A 2B69A 1M6WA 2PA3A 3GDFA 1E5QA 3WSVA 3WLFA 3OFSA 2B37A 3GNTA 3D3WA 3ZWBA 1LJ8A 1PTJA 4DIBA 3VPHA 4YWJA 3CXRA 4PRKA 5ER6A 5F3RA 5JPIA 4BNIA 1QMGA 1PJ4A 2GASA 2C7VA 3PQDA 5AVOA 2FPPA 3OP4A 4E5PA 3AUTA 3GZNA 5EMHA 4OSOA 3V2GA 3MJTA 5KOIA 2I65A 2G82A 1NBOA 3SC6A 3WTCA 3HB5X 2BI8A 3PXXA 1TLTA 3I9JA 4S3MA 3RU7A 3DBLA 1U3TA 4BUCA 3O9ZA 4K9DA 2ZB3A 4OHUA 2P68A 4YXFA 2FSSA 1A9YA 1AUPA 2EJWA 2C0CA 3PRJA 3CZMA 2YUTA 4ONEA 4Q3AA 3GMSA 5JDCA 1L7EA 3ROQA 1JAXA 1WZEA 1Y7TA 4IXWA 4PZCA 1ZVMA 1PJ2A 2H63A 4TRMA 4WLEA 4QO7A 3JYPA 4Z3KA 4NK5A 4XCVA 2YV1A 3EVNA 1FDSA 3GGGA 3JQEA 2VHWA 1HDCA 4J9UE 5TS3A 3QIVA 3MWDB 1RWBA 2FR1A 3OF2A 4JNKA 3WMWA 4OKIA 5G4KB 2XAAA 5BT9A 5JY1A 1A9ZA 3AM5A 4JJIA 1DHRA 4J43A 3AY6A 1KC3A 2PTGA 4PLVA 1QLJA 2NVUB 3F46A 1E7YA 1O8CA 4J4HA 2OMEA 1UDBA 3WFIA 1GFSA 2P9EA 1ZKMA 1GEGA 3TNLA 3F5SA 5EQDA 4QSMA 5KVVA 3ASVA 4BNZA 1E7SA 4WK6A 3OQ6A 1EBFA 5L4SA 2VQ3A 1DIBA 4BO0A 3BHIA 3WBFA 1RM0A 1A5ZA 1UXHA 3WFJA 2DAPA 4CM1A 1DO8A 5CEJA 1V35A 2FY8A 1SEPA 2P9GA 1A27A 3D4NA 2O3UA 3P7MA 1NPDA 3GNQA 2FHSA 1OMOA 4YAEA 2DKNA 4KWHA 4MKRA 3ZNNA 4P38A 4IMPA 4CV2A 3OM9A 4WGGA 5L4LA 1V6AA 4CMAA 3I9LA 3E9MA 4FIZA 5DBGA 5L7TA 4UUOA 3DXFA 1PQPA 1K89A 2FWMX 3K96A 4CLRA 3HSKA 5COBA 4OYRA 4KUEA 4ND1A 4DA9A 4JROA 3VH2A 5CEEA 4D79A 1VSVA 1UZLA 2X5KO 5JCXA 2X0NA 2CF6A 3TZ6A 4E2WA 4M55A 4Y9DA 2ZCVA 3L4SO 4XQCA 3UICA 2Q99A 5F1OA 4NBWA 3TZCA 3PHGA 3U4CA 3PTZA 3S2GA 5I7FA 1J5PA 3CMCO 1HZJA 4XA8A 4J0EA 2D59A 5EIOA 1FDVA 3FI9A 1HF3A 3HG7A 1YB4A 2PZJA 1PIWA 1C1DA 2AEMA 2YQ4A 3H5RA 5JSFA 2C59A 3Q0EA 4NFHA 1NR1A 3WGZA 4CMJA 1KY5A 1JKFA 1Q2XA 1LRJA 4Z9YA 2G76A 3WWZA 3KLMX 4YJGB 3FWNA 3P19A 4A7PA 4ZQGA 2ZB4A 1I5RA 5A1TA 1R4NB 1PGPA 1KS9A 2Q46A 4MVJD 1UR5A 1XELA 2PK3A 4WASA 3DHEA 1H9AA 4BV8A 1LQTA 3JD0A 4DMLA 5JFOA 1R4NA 5FF9A 4UEJA 1LC3A 2YQ5A 4HKTA 5DBIA 3Q11A 1D3AA 1BXGB 3GA0A 3F47A 5TNXA 1E6EA 5IF3A 4BNXA 5I8ZA 3PGJA 3WQRA 2HRZA 4YR9A 1DAOA 3LC1O 1X7DA 5A9TA 3ZHBA 1BXGA 4UEKA 3WG9A 2HK9A 3OIGA 4J1QA 2I3AA 3L4BA 3ETGA 3HADA 1FK8A 3OQBA 2BI7A 5F1PA 3BHMA 1TB4A 4OH1A 4GLOA 5AXBA 1TT5B 5DCWA 1B8UA 1GD1O 3W6UA 1F14A 4Y67A 3ZWAA 1X0XA 3X2FA 4CODB 4XIJA 4ESOA 4RVFA 4MO2A 3MOIA 4DUPA 4ZN6A 4KWIA 4E5NA 3M2TA 3T7CA 4JIGA 1PWZA 3G49A 4CLXA 4W9NA 4J90A 2Q1TA 3K30A 1TA4A 1E92A 1CETA 1P44A 2RCYA 3I6IA 3IAHA 1QV7A 1Q1NA 2D0IA 4NQZA 2VZ9A 1KC1A 3BTOA 4B4WA 2HMWA 4GX1A 3EDMA 1GUFA 3RUEA 3D1LA 3DZBA 5KKCA 4KMSA 4LMRA 5KNLA 5JCJA 4R41A 2IE0A 4XYGA 2ZJ1A 3WGYA 4XGKA 4CV1A 1LSUA 3JQGB 4YACA 4WCFA 2OL4A 4MP8A 1Z75A 3DZJA 5A3VA 2P4HX 3NX4A 4MKZA 1XA0A 4CMIB 1VJ1A 4W7IA 4GX5A 4UVEA 2Z1NA 5DOZA 1LNQA 2Y0DA 7MDHA 5ICMA 1QSGA 1HE5A 2YV3A 2A4KA 1GZ3A 3PWSA 3KTDA 3TZQA 2VWHA 4YJDA 1GYPA 1FXSA 4FN4A 3V2HA 1B0AA 3LQFA 4IBOA 3C24A 3WOHA 2VRBA 1HKUA 2VN8A 3FD8A 3VPXA 1MFPA 4HFMA 3K73O 2NACA 3G1TA 2HU2A 4U6SA 4WPGA 1KVTA 2ZTLA 1F06A 1B8VA 4G81A 4MVJF 3ANMA 3TL3A 3VVBA 3IP3A 4Z0TA 3Q6IA 4GH5A 2OZPA 3ONEA 2I5PO 4FBGA 1C1XB 4A26A 1BMDA 5A9RA 3LT2A 5DP2A 1JN0A 1F12A 4NU6A 4J49A 3I9OA 4IDAA 3OJEA 4S1VA 1V3VA 4NFSA 3RC9A 3ZV4A 4CL8A 5B4UA 3GK3A 3JQCA 4WKGA 3N7UA 4OKNA 4A10A 3TOXA 1RYEA 5A03A 1JW9B 1UJMA 3C3XA 4TVOA 1VL8A 1CWUA 1I2CA 3A9WA 4MIYA 2YHUA 3PZBA 5LCXA 7ADHA 1LTHR 2PR2A 4FPXA 4EUHA 5MDHA 1JLLA 3PJEA 2W8ZA 3SJ7A 3KOUA 3EY4A 3JQFC 2H1SA 2HJRA 4BL5A 3OA0A 2IODA 3PIDA 2XF8A 1KEUA 2DPHA 4O63O 2CFCA 4WLUA 3VZRA 1EK6A 4CM4B 1LA2A 3QJ5A 1ZO8A 2VT3A 1O95A 3EYWA 4UVDA 2VWGA 5T8KC 4BKOA 3WYCA 5CHEA 4QFCA 1HEUA 2HMSA 4MP3A 1TVEA 2AQKA 4CM3A 1BSVA 3GN1A 2NLOA 3FF4A 3FBTA 4EDFA 3COSA 2DQ4A 5GMOA 3ZN2A 4D46A 3JQDA 1JKJA 2YFQA 3Q1LA 1Z45A 5KJ6A 5L7YA 2VRCD 4RPKA 4E30A 4P22A 1D1SA 2JJYA 3PJGA 1T2EA 2I99A 3B1JA 4IS3A 1XIVA 3RUDA 3NGXA 4NU5A 1M6HA 4PLGA 1XGKA 3RC2A 4EJ0A 3WLEA 4PCVA 3UVEA 1XKQA 4WNCA 4PVCA 2RH4A 1U1IA 4YB8A 5HS4A 1NQ5A 2IXAA 4TRNA 1OC4A 1TT7A 4NBRA 1KIFA 3O03A 4JX8A 4Q3BA 1VE9A 4UUMA 1EVIA 4GMFA 1A4IA 2LDXA 2WD7A 4H7PA 4NMHA 2B83A 1MG5A 3TOZA 3ON5A 1OC2A 4HUJA 2DM6A 2BFPA 5TGDA 4AG3A 8ADHA 3KEQA 3RFXA 2I76A 2WM3A 4NI5A 3NRCA 1EQUA 1M75A 4PG7A 2GYYA 3U5TA 3H7AA 5A5FA 5U4QA 3HDQA 2X4GA 5CPBA 2HAEA 1LLDA 2P91A 1AHIA 1EUDA 2BFMA 3AM3A 4A27A 4XX0A 4BGUA 4CM8A 1LRKA 3VKUA 3HFGA 1XU7A 2EERA 2QIOA 1T4DA 2AXQA 2HMTA 1Q7CA 1ZZEA 4Y6PA 1E3WB 1EUZA 2IZ0A 2WMDA 4E5YA 5L3ZA 1LRLA 3S2IA 3FN4A 3LC2O 4FFLA 4JJFA 3TFOA 1A7AA 1ZXBA 2JD2A 3U4HA 2Y1FA 2QZZA 4DIOA 2GN9A 5EPOA 2DBVO 5TSDA 3UGKA 1SO8A 3HDYA 3QRWA 1FJHA 2CSUA 4LK3A 1E3WA 1LDMA 2WSBA 5JC1A 2HK8A 3ZU2A 4DLLA 1HDGO 4RZIA 2VYVA 3MJSA 1A72A 4CMCA 4XB1A 2Y1CA 3DAGA 4GWKA 5C3MA 2J3HA 3LK7A 1YVEI 3KYCB 1WZIA 2QG4A 1DEHA 3VZSA 3OEWA 3UW3A 4E2XA 1WLYA 4U0JA 4JCOA 3NJ4A 3EUWA 1HRDA 3RWBA 1Z7EA 5IXSA 5ILOA 2PKQO 3NV9A 4M89A 4D43A 2IZ1A 3BMCB 3KB6A 5EINA 2W90A 3LT0A 3CMMA 1IULA 4R5MA 4RVSA 5HS6A 2UV8A 3DTYA 3PWKA 1ISMA 4IIVA 1H94A 4BO8A 4YT4A 5AOVA 1B3BA 3DZGA 1JVSA 2C2XA 4XZ3A 4HV4A 4OL9A 3IC5A 3VKVA 4CQMA 5F21A 4RPJA 2JD1A 2HO5A 5FFFA 4WECA 3MTJA 4YPOA 4U0KA 3TZKA 1MB4A 3KYDB 2E4AA 2O4UX 3OJ0A 5K9ZA 2W98A 1B2LA 1HYGA 3DBHA 3JCZA 2WYVA 4DYDA 1QYCA 4YRBA 4L8VA 4LSMA 4B7XA 3B70A 3EGOA 1Y8QB 1P0FA 4N7RA 4BKQA 2FPIA 2PWZA 4R1TA 3PVZA 3ZNPA 3WWYA 1NVGA 4B3HA 1Q0HA 3H9QA 2ZQZA 3RIHA 4PG8A 2Y05A 2YDXA 3ST7A 5T64A 3CH6A 4E21A 4D7AA 4J7XA 1N9GA 2J8ZA 3GDOA 4UULA 3E6AA 3H9JA 2B35A 3MJEA 1H2BA 4DL9A 2AQ8A 2X8LA 3ZWVA 1YONA 3WGGA 2B36A 4B8ZA 1LC0A 3AUUA 2J3JA 4G65A 4OM8A 2WWRA 4NBUA 3AOEC 5A9SB 3RUHA 3U09A 5A5EA 3VVCA 1LDYA 3H5AA 1U4OA 5ILGA 4BOYA 2I67A 2R00C 1GCUA 2C82A 1XLTA 4O0LA 3BTUA 3DC2A 3EZLA 4D3DA 4Y98A 1F17A 4ZU3A 4P4NA 2HKIA 4RVDA 4NIMA 4B3JA 3DMTA 3H5NA 4A2CA 3JYLA 3FRJA 3D4OA 5A02A 4F45A 1K6IA 4XRRA 5CG1A 4ALNA 4BNGA 1RJWA 5TQVA 3Q3CA 5K0ZA 5T67A 5C7LO 5GZ6A 3H8VA 2J3KA 2OP1A 4CMEC 4YAKA 2PD3A 3GDGA 4BB6A 1FMCA 3HUDA 2J5KA 4IQ0A 4F6CA 5C37A 1IZ0A 4DLAA 3R3SA 2NVWA 1L7DA 4EYEA 4LRTB 4HXYA 2Y93A 1F8FA 3U62A 5CAEA 2Z5LA 3IIEA 2ZTUA 3ZWOA 1JU9A 3UCXA 2VHYA 2EG9A 4LVCA 4ZVVA 2Q4EA 4EJ6A 1MGOA 5L40A 2E82A 3OMLA 3C8MA 1K6XA 3GPDG 3AUSA 3M6IA 1XDWA 4OJNA 4R3WA 5F5LA 3OIDA 1E77A 3GT0A 1YL5A 2O3RA 2QW8A 4GGPA 3GGOA 1BHSA 4IDDA 3PDUA 4WE3A 2GZ3A 1DHTA 3GOHA 1NP3A 2C5AA 5KWEA 2X22A 3TSCA 1GUZA 2AE1A 3GHHA 1V0JA 4OQYA 4PIVA 3PHIA 2R2GA 3LLSA 4M87A 4YJHB 3KSZO 3CEAA 3W6ZA 3RAJA 3HWRA 1R66A 3FPLA 5IDYA 4Z3DA 1R15A 1N7GA 3MJ4A 4K6FA 4WCDA 2O3SA 3NYWA 3QHAA 5K6AC 1AXGA 1IPFA 1ZW1A 4DWVA 5JXWA 1GEEA 4OXKA 2ZIZA 3VZPA 3L77A 3UUWA 2X23A 3V2UA 4GX2A 3ZU4A 4IGFA 4Y8VA 2BELA 1X1TA 3LF1A 2AG8A 2WTBA 2DTDA 3ZV6A 4I08A 4R1UA 2YV2A 1LXCA 1XSEA 2CD9A 3IJPA 1YJ8A 2Y1EA 3O8QB 4BQPA 4BKRA 1DRVA 4CMGA 3PZRA 2PD6A 2ZKLA 4HWKA 1IY8A 1SOVA 3I5MA 1J49A 4MVJG 1JA9A 4HNHA 3WGQA 3E8XA 3GY0A 4DLBA 3IQDB 4E2YA 3D3WB 3HN7A 1TI7A 4BNUA 5KJ1A 4R54A 1LQUA 3JD4A 1K2WA 3GMDA 4C7KA 1DRWA 5DCYA 1C14A 1LSJA 1QLHA 4IDBA 3TQHA 3ENKA 5L9AA 1EEHA 2EV9A 3FNEA 5DN9A 1H5QA 2GN6A 4CM9A 1HE4A 4LMPA 2DTEA 2BH9A 3GZNB 3WNVA 1HDOA 4E33A 5EJ2A 1O6ZA 3OHSX 4O1MA 1YB1A 2QYTA 4PLCA 4U6QA 3T4EA 4FJ0A 4FJ1A 3W4IA 3ZDFA 1ISIA 3BTSA 4LISA 4AVYA 4BO3A 1P45A 3D64A 3DBLB 3EVTA 4WLNA 5CDUA 3C1TA 1E3JA 2G0TA 4PZEA 3UH1A 1QP8A 1D4FA 3VOSA 5TF4A 2I3GA 5AXAA 5DT9A 3RJ5A 3S8MA 3WDSA 3PHHA 2JFFA 1Z82A 4BO1A 1SAYA 3GEDA 1U7HA 3QQPA 1J4AA 4MIOA 3QVWA 1IOLA 4WOJA 4ZJUA 2GN4A 2X5OA 2DVMA 2VNAA 2O50A 4BNJA 2GERA 1ARZA 3LT4A 1MA0A 4CLOA 2VWQA 2X86A 1Y9AA 1WW8A 1RM3A 1BG6A 2Z1MA 3IUSA 4CMHA 1G0NA 5ES3A 1WVGA 3RD5A 4L73A 4X54A 1DXYA 3G17A 1ZUD1 1C0KA 2FN7A 5EERA 3DB2A 4JBIA 1KVSA 4R4JA 3BTVA 1X0VA 1DJQA 1NR7A 3AFMA 1H6CA 5G0WA 1YBVA 3MOGA 2FZEA 2RH8A 3KYBA 3RUFA 3MTGA 4DMMA 1MC5A 2Z95A 4QECA 4R3NA 5LDHA 2G17A 1BW9A 1P1RA 1PJLA 4Q39A 4ALKA 4EITA 4FCCA 3W4JA 2O3JA 4HX5A 4R1SA 5LC1A 4GX0A 4JGBA 1FDUA 1I3KA 1N1GA 3E9NA 4QUKA 3VH3A 1ISFA 3D3EA 1YQXA 2NU9A 2RIRA 3KV3O 4L0QA 4XYEA 4J1SA 4PLYA 2HCTA 4D3FA 4D0RA 1QKIA 1FDTA 1HSZA 1E3SA 1R4MA 4RPHA 1LU9A 1Q7BA 1B26A 4CLRB 1GUYA 1UDAA 4FC6A 3NDJA 4OIMA 1SBYA 3ONDA 4JLWA 4IJWA 4N5NA 4QTZA 2XXBA 5THQA 4H16A 3WB9A 1QYWA 2ZYGA 5AQ1A 3GUYA 4HNGA 5JYDA 3A4VA 4INAA 4XYLA 2VZ0A 3GNSA 1ZBQA 4GLLA 2QQ5A 2Q1UA 4R9RA 1JWAB 4CV0A 4TROA 4RF4A 2GLXA 1I33A 2W2KA 1E0DA 2PGLA 4ZRMA 5DF1A 1C1DB 1G0OA 2FRDA 5ENDA 1CF2O 3Q9UA 1YOVA 2GD1O 2CDBA 2QYSA 1LSOA 1YBAA 4I5GA 1ULUA 2C07A 1K5HA 1P74A 4I9UA 1O94A 4IS2A 1VKOA 3I1JA 2RBEA 4YT5A 5H81A 4P8RA 3JQAA 1KVRA 2JKVA 3E9QA 1X7GA 5BQFA 4FC7A 4PRLA 1XG5A 3DZHA 3RC7A 2OUIA 3GF4A 4L74A 4B4OA 4J3FA 3TDKA 2XOXA 3L0DA 1E6UA 2IEDA 3ANLA 3PLRA 3H2SA 3RROA 1QYDA 3JQ8B 3FSRA 1V9LA 4MVJE 4OXYA 3BIOA 3OBBA 4BNLA 4TWRA 4DBVO 3ZW8A 3UCFA 1AGNA 4A5OA 3KETA 1PQWA 2QX7A 3PEFA 4NDNE 1R16A 2J5QA 3C7DB 4AJOA 2HSDA 1GADO 3JQ8A 1V8BA 4GBJA 2A9FA 4PG6A 3V1UA 3D4PA 1P77A 1YWGO 3ZZNA 4M54A 1MV8A 2DTXA 3FNHA 4DPMA 1DC6A 4W82A 5JO0A 3ANNA 1ZK1A 2EP5A 3VDRA 4GVXA 3UOGA 1IPEA 1H6AA 2EWMA 4K6CA 4EEZA 2BFAA 2X0JA 1Z6ZA 2BHLA 3DFZA 5A05A 1G6KA 4YVFA 3GGPA 1ZXLA 3NDRA 2YZ7A 3RASA 3TF5A 1O0SA 1N8KA 1PS8A 2FR8A 1JKIA 3GC6A 3GRPA 4NH4A 1T2DA 1YJQA 2NTNA 2X1HA 2O4CA 4Q3NA 3WX0A 4BHTA 1LBEA 1SC6A 1A4UA 2E49A 3RVDA 3TFQA 4I8XA 4BGVA 5ICSA 3DBRA 2AW5A 4YAJA 3K9QO 4BNHA 3PGXA 3VHRA 1H6DA 1MC4A 3LF2A 3EW7A 1HWYA 5CFZA 2DUWA 3AUAA 3GHYA 4MVJI 4D0SA 4YDRA 3GVIA 1R0LA 4XQ9A 5C7OO 4WCFB 2Y1GA 2YJZA 4BNNA 3BAZA 5B4TA 4BO2A 1IL0A 5FI3A 5JCJD 3JD2A 4Q3DA 1B15A 1Y8RA 2CNBA 2E48A 3A14A 1QYXA 4I5DA 2X7HA 4WLFA 3ZU3A 1EE2A 2B5VA 2Y68A 3OETA 4Q9NA 1ENZA 3AM4A 2JCYA 1KY4A 4FDAA 5TRTA 3GR6A 5JLAA 2WEKA 4GKBA 3BHJA 1HXHA 3KVOA 3ZV3A 4TRRA 4AJIA 1LLUA 4CM6A 1U5AA 4CQLA 2X0RA 3H6KA 5BSEA 5JMWA 3WYBA 5T6BA 4BIIA 4CPDA 3QW2A 3E18A 2PD4A 1WDMA 4B4UA 5JDIA 3CPSA 5BNIA 2UVDA 4AICA 1PJ3A 4WUVA 3DL2A 4N5MA 3MWEB 3DTTA 4EBFA 1J0XO 2IYPA 2PV7A 2I66A 2B4TO 4E31A 4URFA 1DDOA 5BNFA 3DOCA 3KM0A 1CQJA 2NVBA 3VH1A 1K6JA 4NPCA 1ENYA 4LN1A 4CJXA 4RZHA 4FW8A 4XDZA 5C7IO 4PLPA 4PZDA 4B8WA 1HLPA 4CM5A 2UUPA 1Z74A 4Y6SA 3WGIA 1ISJA 1U7TA 6LDHA 2OO5A 2NU7A 3L6DA 4J1NA 3EZYA 5EN4A 3SLGA 1GL3A 3ZI0A 1GZ4A 2JHFA 3ZW9A 1JVBA 1XR3A 1T2FA 1VSUA 3FNGA 3JQBC 3LT1A 3H2ZA 2JFGA 3CTMA 3NEPX 3PP8A 2EW2A 4CMBA 3ADOA 2DBZA 1LUAA 4DPLA 1VJ0A 3QWHA 4IJUA 3K92A 4JBHA 4NJMA 2E37A 4E3ZA 5JY6A 2B4QA 2EJVA 3H9UA 4FFMA 2PZKA 3F5QA 3AOGA 2NU8A 4RF5A 4QO8A 3ZWNA 4K1LA 1SOWA 3ZWMA 1UZNA 2W4QA 3NGLA 4GKVA 2CMDA 3W4KA 2FSVA 3H9EO 3EHEA 5JDCC 2A94A 4RGBA 5IZCA 3GQVA 3JQ9A 1AHHA 3PQFA 1KVUA 4R5HA 4RQTA 3PLNA 3M2PA 2PY6A 3DFUA 2O7SA 2X6TA 2I6TA 4ND4A 1NX6A 1Y6JA 2DBRA 4R69A 1WNTA 1ZSVA 4FQ8A 2CUKA 1X1EA 5IZ4A 3NTRA 5JBIA 1P3DA 2JD0A 3ORFA 1PS0A 1UP6A 3JYNA 3IL2A 1PJSA 3ONFA 4NBVA 1F8GA 8LDHA 3QE3A 1GR0A 3H9GA 3FWZA 1I2BA 2WD7B 3HE3A 4R51A 4E13A 4LVUA 3FR8A 1EDOA 5G0TA 3E48A 2BFOA 2D4AA 4TZTA 4O5OA 3HN2A 5CPFA 4YCAA 5A04A 1AXEA 1LI4A 3PFFA 4IQGA 3S2EA 3AI3A 5KIAA 4PG5A 4E6PA 1IE3A 2X0IA 5IN4A 1HE2A 3GVXA 3WJ7A 3GFBA 2HRBA 4CR6A 1T2CA 2VYNA 1GYQA 1DJNA 1M66A 1EE9A 4P4LA 4XD2A 1NTOA 3RJ9A 3ZWCA 4CM8B 3PJFA 2H5LA 3HQ4O 4IUYA 4DQUA 4MOWA 2P9CA 4ZA2A 4N54A 3AK4A 3E82A 1N5DA 2QZ9A 1DB3A 1DPGA 1NWHA 1SMKA 2Y67A 5BSGA 1QR6A 4HBGA 4L9RA 4OGWA 1I2ZA 1LEHA 2RAFA 3B20A 1KEVA 1KEWA 1PGOA 2Y1DA 1BWSA 3RBZA 3TRIA 5CDGA 3DHNA 3RBXA 4LCJA 3BMNA 4IZHA 1M67A 3NT4A 3CIFA 4XQEA 3VPFA 1SB8A 2EGGA 2HK7A 3LVFO 3OSUA 4RF3A 5FYDA 1N1EA 5I9MA 2PZMA 4FR5A 1P31A 1YXMA 4I9NA 4BNFA 4BV9A 3KLPX 2D5AA 4W4TA 4ZD6A 1PEDA 1EBUA 4NG5A 1OBFO 2AG5A 4FJ2A 3TWOA 4Q3CA 3CKYA 3TL2A 4D42A 4CLHA 4GSKA 4LRSB 4WLOA 2VYVD 3WYEA 4ILKA 3ZNQA 2GZ2A 1JAYA 1PX0A 1WMAA 4PGFA 2P5YA 1T4BA 4BO4A 2ZQYA 1PJCA 4E2ZA 2FPGA 4AJJA 1R6DA 3S55A 1YQDA 2BGMA 1VC2A 2ZCUA 1W0CA 2ZTMA 3HDJA 4YTEA 1JDJA 4A73A 3GVCA 4DVJA 3QLJA 1DIHA 4CL3A 1ADFA 1OZAA 3ICCA 3AJRA 3W8EA 5L53A 2NSDA 1KBZA 3RUCA 5I7VA 4E32A 4RDHA 1ZMOA 3C7AA 4Z9FA 1DSSG 3DBHB 5COAA 1ZEMA 2Y99A 1BTOA 3R3JA 4II2A 1R0KA 1EDZA 2BGKA 3FTNA 1GZ6A 1A7KA 3Q2KA 1QORA 1EFLA 1S7CA 1GAEO 3BXXA 4IJKA 4J0FA 4KQXA 3L4BC 3WNQA 5GY7A 2Y1OA 2PFGA 4AJ2A 2VTDA 1T25A 3NUGA 1ZJZA 1Z7BA 1N9GB 2D5CA 4PN3A 2X9GA 4IIUA 5IDWA 4QX6A 2Q50A 4J2OA 1HT0A 3I4CA 4DC1A 1LX6A 3L9XA 3LC7O 1DC5A 1DFGA 4J9VA 3RFTA 5HM8A 3DZIA 3R6DA 4KOAA 1YS4A 4MVJM 3MEQA 4K28A 4PLWA 1HETA 3QWBA 4W9NC 3GVPA 4ZGWA 2LDBA 2W2LA 2O48X 1PGJA 2PH3A 1SNYA 3AI1A 2WD8A 4UVGA 2NQ8A 2AHRA 4U7WA 3AWDA 3HNPA 1QV6A 3FCOA 3Q2IA 2EGHA 4UAGA 3WGTA 1Y5MA 3HZZA 1GQQA 4JJGA 3U3XA 4WCFC 4UUPA 4JQCA 3ROMA 4B4VA 1I3NA 4MDHA 4BNVA 2DLDA 3NDIA 1U3VA 3GZ4A 1B3RA 4ITUA 2WDZA 4J6FA 3G1UA 1ONPA 3RKUA 3AW9A 3PK0A 1ZIDA 4KTTE 4MVJP 5BSHA 4CM7A 1HZZA 5L4NA 3Q9NA 3I23A 3ETEA 3F1KA 5FWNA 2AQHA 3G0OA 3FPCA 3W1VA 1W8DA 1CYDA 4G2NA 1VKNA 2VHXA 4HFNA 3KZVA 3SC4A 4O6VA 4JK3A 1E7RA 3F4BA 4ALMA 1ZK3A 2ZYAA 2JFHA 4Z6KA 4J7UA 4ZQHA 3WIEA 4DPKA 5IDXA 3E03A 1HTBA 1I10A 1YKFA 2AA3A 3JV7A 5TLSA 4FFPA 4M8SA 2IZZA 3QSGA 3KHUA 4AJKA 2BF7A 2C54A 3CZRA 3S2FA 4M86A 4BMNA 4EW6A 3HJAA 2PKQP 4GGOA 3BMOA 5G2OA 1J6UA 2CZCA 4OO3A 4U8GA 1NQAO 4CQMB 3WTBA 4YJFA 1UDCA 1O5IA 2FP4A 3FHLA 4R1NA 1DC3A 5JYEA 3H3FA 2E6UX 2VTEA 2PNFA 3O26A 2OHXA 3KO8A 3L6OO 1GPJA 1YDEA 1DIGA 5TJ9A 3VH4A 2Q2QA 1H6BA 3KBOA 4FFRA 1P1KA 1DFHA 1SEVA 4L76A 4L4XA 2Q49A 4AL4A 2NQTA 5KKAA 1NVMB 2R6JA 3DQPA 3CINA 4PLTA 1PZEA 2IEBA 4RVGA 4FFOA 2C7GA 2IYOA 1E7QA 1IUKA 1E1MA 1KERA 1MX3A 1XQ6A 4IMRA 1BRMA 5DNAA 1QG6A 5HBRA 5F5NA 4B79A 1L1FA 1WAMA 1UXJA 4AJ4A 2O3TA 1DOHA 4BKPA 5DCUA 4BB5A 2NNLD 1EMDA 1NYTA 2CF5A 2HLPA 1MLDA 4UREA 5CP8A 2C5EA 4PLFA 5ADHA 3RC1A 3WGHA 2JCVA 3GEGA 4GVLA 4D44A 3PQEA 5FEUA 2J6IA 1PJBA 1OFGA 1YDWA 3U4IA 1AN9A 2XXJA 1ORRA 5L95A 4RO0A 2YYYA 4HADA 4WEOA 3PWZA 3TJRA 3BMQA 2DFDA 2HQ1A 4TVBA 3GRKA 3C1OA 1HYHA 4XEHA 1Q0LA 4BO6A 3RKRA 5HWSA 3HFSA 1WP4A 1P0CA 4I5FA 5IJZA 1HDYA 4C7JA 4QXMA 2VUUA 5BNTA 4Z0PA 1I36A 3ZGYA 3IKVA 4JXKA 1KEPA 4UEOA 4Q3EA 2GCGA 4CM9D 1NHGA 4NR0A 2OBNA 4W99A 4QQRA 1WWKA 1LDBA 5I9NA 4XGIA 3HHPA 3GEMA 1B16A 5G0SA 1IHYA 3CUKA 4GQAA 5GZ1A 2D1YA 2PKRA 4DQVA 1XU9A 3GN2A 5DDIP 4YYZA 1RYDA 1C0IA 2ZJ0A 4CLOB 1HDZA 3DONA 2DU8A 1ENPA 4O59O 1VM6A 1NAHA 1R12A 3SX2A 2V7PA 3ULKA 5CG2A 4IDFA 4EJMA 4D45A 1NXQA 1PZGA 3R0IA 1BVRA 3JQBA 4R9SA 3ZWXA 3UXYA 1KVQA 1VRWA 2HUNA 1B8PA 2B4RO 4BNWA 1W4ZA 3LYLA 3JQFA 1QRRA 1ZK4A 4WEQA 3BA1A 1BW9B 1EVYA 4UVIA 4BO9A 1ID1A 3IS3A 4FSHA 4DYVA 4OOEA 4CUJA 2P2SA 5T8KA 3V1YA 3RCBA 4MJLA 4LW8A 2VHZA 1EUCA 4RVUA 1GV1A 1BGVA 3OH8A 4DIFA 1DBVO 1LDNA 5TX7A 4DRYA 1CERA 2GRAA 2ILTA 3CE6A 1OI7A 4Z0HO 3WMXA 2QRLA 2EEZA 4YT8A 4JN6B 1U8FO 1UZMA 3SXPA 1B7GO 3L07A 1R4MB 1HLDA 1PS9A 3E1KA 3QVXA 3ROPA 1DAPA 1ZSYA 3DZFA 4E4YA 2GPTA 3M1LA 1B14A 1KETA 2POQX 1MUUA 3K2EA 3E5RA 4CR8A 4PVDA 3BZUA 3PHJA 3H65A 3ZWYA 2JL1A 3GAZA 1DLIA 3TN7A 2Q3EA 3A06A 5KVCA 3QWFA 1W73A 2ZK7A 3U4DA 1BXZA 5G4KA 4MVJH 3ITKA 1XYGA 1GV0A 3O4RA 3O38A 3L6EA 4TRJA 1KOLA 1GQYA 4J2HA 4BO5A 4XRGA 3MCVA 2GR9A 4DQXA 3V1TC 1JQBA 2WYUA 1XCBA 4ZICA 2W2KB 3K6JA 2YHIB 3A1NA 2NVUA 3K2BA 1UXIA 2Q2WA 1CJCA 3I83A 2AEFA 2PLAA 3MZ0A 3VDQA 1ML3A 1YOVB 4IPTA 4L75A 4A0SA 4BNYA 3P5SA 1ZJYA 2YHIA 4ZQFA 3QVSA 3JQAB 1KYQA 2DPGA 1HSOA 2TMDA 4LGVA 5TT1A 3UFXA 4MIEA 5DBFA 1H0KA 1YL6A 5LDGA 3WSWA 2D8AA 2F1KA 1V3UA 3OJLA 4I1IA 1JTVA 4J91A 3WBBA 1ADGA 4OXNA 5TIIA 3JQAD 3PIIA 2F00A 4L4RA 4BNMA 5THKA 4GAEA 3LLVA 3UHAA 3VPSA 1MFZA 4AJPA 2OOSA 1SZJG 3PHLA 1EK5A 2OXIA 3L9WA 1H9BA 3AU8A 2V65A 2CVOA 4RL6A 3IP1A 4ID9A 2O23A 5KJCA 1K0UA 3KSDO 3IJRA 4N5LA 4YQZA 3G79A 4RPGA 3JYOA 3DDNA 4PLZA 4EZBA 4OQZA 3MJVA 4ROSA 5JS6A 3WXBA 4YEDA 1X14A 1BDBA 2OBYA 3GH3A 5TJHA 1DRUA 5TT0A 1U9JA 1ZEJA 1VLLA 3KUXA 1ZMTA 5DULA 3DZKA 2EIHA 2QRJA 1G1AA 3DMTC 5U1PA 3QP9A 3GVHA 1O9BA 3A28A 4IQ8A 3DOJA 1I30A 4NFYA 4BNKA 4TSKA 3PYXA 2X9NA 1ZNQO 1CDOA 5AYVA 5MGBA 1C0PA 3RFVA 4IDCA 3LSYA 3QWAA 4MVJA 4ND2A 3V8BA 3BYZA 1OAAA 2UDPA 5A3JA 1ZFNA 1ULSA 3NT5A 3OEYA 1T1RA 1Z73A 1NASA 2G1UA 1IB6A 1E1KA 1GQ2A 4MP6A 3W8FA 2DUUA 2O3QA 4YJGA 1UXKA 4DREA 3WJAA 2GN8A 3DBRB 3FR7A 2CVZA 2UAGA 4TKMA 1E3EA 1E3LA 2HJSA 2EF1A 4F6LA 4DGSA 1PL8A 1HYEA 1VL0A 3ITDA 3OQ1A 3QV1A 5JNLA 3DWFA 4XR4A 3EMKA 1N2SA 4W6ZA 1PR3A 2GZ1A 1EVJA 2DBQA 1PGNA 3UF0A 1ENOA 2PZLA 1TXGA 4RDIA 2AMFA 4NK4A 4XKJA 3PYLA 4J16A 3JSAA 2YFHA 4TKLA 4XWYA 5B1YA 3AY7A 2YY7A 2OORA 1ONNA 5EESA 4H3VA 1P33A 3SEFA 4EUEA 5JAIA 1Y8RB 4G5HA 1NFFA 3RUIA 3RBVA 4XDYA 3DOOA 1NPTO 2FR0A 4R68A 4UVHA 4AJHA 5IAAA 2VHVA 3F4LA 4P4GA 1U3UA 1C3VA 1NVTA 1WPQA 3D0OA 4IM7A 1PSDA 4ALLA 5CDYA 3HB4X 4JBGA 1P1FA 1TT5A 3F6YA 3LZ6A 5DZSA 4CQLB 4ND5A 4BGIA 2I9PA 5DP1A 1X15A 3DO5A 2Q1SA 3SJUA 3U9LA 3INRA 3OJFA 4B3IA 1SPXA 3I52A 3IUPA 4GMGA 4N18A 2Y66A 2Y0EA 5G0UA 2Q2VA 2EKQA 3AOEA 5JE8A 4M49A 2NTVA 1YB5A 4NBTA 4XGNA 2R00A 3C1AA 2RHRA 1NAIA 4BS9A 1PJTA 1WDKA 3OICA 4Y6RA 2EP7A 2B0JA 3K31A 5IDQA 3GAFA 4FGWA 4RLSA 3K5PA 4MPDA 1CIVA 4ALJA 1M2WA 4F46A 3NKLA 3JQGA 1UAGA 4DTIA 1HDXA 2VOJA 3D5QA 4E12A 5L51A 3PDJA 5JAQA 1YQGA 2D3TA 2QHXA 4CMEA 3W8DA 2DT5A 3GG2A 3SLKA 4R01A 4CMIA 2VOEA 5J23A 3LU1A 4RCVA 4WOKA 5KJEA 2D2IA 4YQYA 2J5RA 1U28A 1UP4A 4KUHA 5JO9A 4PFJA 1WXDA 4K26A 1GY8A 3D5TA 5H82A 3PJDA 4J4BA 3IKTA 2C2YA 2A35A 4NJMB 4XB2A 5ENVA 3T7EA 3U49A 2EKPA 5L7WA 4HP8A 4KZPA 1IYZA 3C7CB 4CUKA 4U5QA 2NM0A 5BR7A 4RORA 3SBOA 4II3A 3P2OA 4GL4A 1F0YA 1H2HA 3QWIA 1QXSA 3EC7A 1HDRA 3ASUA 4HFJA 1WDLA 1NQOA 1P1IA 3ZCXA 3FTPA 2RHCA 1ADCA 1VJTA 2NWQA 2YDYA 2IRWA 1LDGA 1A71A 5KCZA 1YL7A 4XQGA 1HL3A 4YRDA 3WR5A 1LLQA 4OAQA 1WMBA 4BMSA 4E5KA 3NAQA 1C1XA 1EVZA 4CUZA 2OGUA 1ONOA 2GUGA 2ZYDA 5K6AA 3F3SA 2EW8A 1MXFA 1ZK2A 3NTQA 1T26A 4FB5A 1U2GA 4CLEA 3UCEA 2ZTVA 3VC7A 3R1IA 4D3SA 3INGA 4IINA 4AFNA 5JAMA 4IXTA 4BNTA 1SB9A 1NPYA 2CY0A 1Q7GA 3E5MA 1ZSNA 2BMAA 3LDHA 1UXGA 5T57A 3M1AA 4YT2A 5HRUA 1D7OA 1PL6A 4XYMA 2JHGA 2BD0A 4DXHA 1ZH8A 3NT2A 4AJ1A 1NQTA 3PPIA 4QT0A 1P1HA 1CEQA 1YE3A 4B7CA 1S6YA 3DMYA 3IOYA 5KVQA 4CM4A 5JC8A 3AI2A 2CDAA 2BRUA 4BKUA 4ND3A 4RV9A 1RM5A 3RQSA 5COQA 3B1FA 4XIYA 4NNJA 2VRCA 5JW6A 2EHDA 4DC0A 3RSHA 2Q4BA 2GGSA 3JD1A 1RPNA 2O2YA 5JMPA 4CR7A 5A4DA 5KJFA 2PGDA 5B37A 5TC4A 5IXYA 2FOIA 1E1NA 1XQ1A 2VT2A 3NTOA 4KTVE 2Q45A 4I9HA 1T24A 1Y81A 5AXDA 3DBVO 2PGJA 1ZK0A 3CSDA 3GLQA 2VYND 2FZWA 1D1TA 4IGEA 1FDWA 2C29D 4EUFA 4YAIA 4L4SA 1XHLA 2QRKA 3BMNB 1YH3A 1FF9A 3VTZA 1PJQA 3C85A 1O89A 4YA6A 2AQIA 5HA5A 1BDMA 5H83A 5DOVA 1JWBB 4QEDA 1GU7A 4CLDA 5IG2A 1P9LA 3PYMA 1N7HA 3KEOA 1LDEA 2NV6A 4H15A 4HY3A 4UUNA 1BVUA 1CQIA 1NNUA 3INTA 1UH5A 3MJCA 4JP3A 4RJTA 1GCOA 4YBZA 4E0BA 2BLLA 1Y1PA 2DFVA 2GF2A 2NU6A 1PWXA 9LDBA 4ZQEA 3DAPA 4NJOA 5G0VA 1DIRA 5KVSA 4KDEA 4J4TA 4ZHSA 1NM5A 4TMFA 3TPCA 3UKOA 1RM4A 1U5CA 2JAPA 1U2DA 1YGYA 3DHYA 1AE1A 1M76A 1YBMA 3JYQA 3DAFA 4GI2A 4R16A 1GPDG 4DBZA 6ADHA 4W7HA 1DIAA 1MG0A 2J3IA 9LDTA 4GPD1 3ZWPA 1VI2A 1C0LA 1OOEA 2B5WA 2VZ8A 3S1LA 1U4SA 3JTMA 3NJ8A 5I7EA 2VUSA 3ZHZA 1EQ2A 5AXCA 1LSSA 4AJNA 1H93A 2UUOA 3WQSB 3N58A 4OSPA 1ISHA 2WYWA 5T5QA 3F1LA 5IN5A 1I01A 4OOFA 2NADA 2V6BA 4PLHA 3AU9A 4PG4A 3EK2A
chains in the Genus database with same CATH superfamily
4EG1A 1NFQA 5B12A 1Q11A 4PM4A 2I6FA 1KZYC 2JFUA 5J1TB 4BFCA 3E3LA 1N92A 1P1JA 3EBLA 3HJTA 3O8LA 1LX7A 4BQIA 4CQMD 4F11A 1JJIA 3HO8A 2JGFA 4KYTA 2WG1A 4BFUA 1E0AA 4Z4EA 4N5IX 2ODQA 2ODNA 1G21E 2QMYA 1XWFA 3K0EA 3BDVA 1XTBA 5F2EA 2QU7A 1JBQA 2P0YA 4F12A 1X1DA 4LGMA 1BWQA 4MARA 1PQUA 3UKDA 1IN5A 2XUGA 3BE5A 3KYCA 3GX1A 1Z6GA 4KWCA 2TMGA 4DRXB 3K4QA 2GZRA 3TUJC 4YUZA 4P31A 4M7RA 5AVKA 2ESRA 3MBOA 2BFCB 5DSXA 4RQAA 3C15C 2YNMC 1Z5GA 1UBCA 3KUCA 2ZSAA 4IP0A 2FR8C 3LO8A 4YN3A 4BX3A 2H2IA 3L7MA 4QTYA 5F7OA 4CT0A 1DINA 3B9BA 3KSUA 3BMCA 3KCNA 4HCJA 3TXXA 1SCUA 2G5CA 3NFRA 4D6XA 1IK4A 3RQIA 3ESAA 3ADCA 3T7DA 2ZSDA 3FVRA 4OTZA 5THXA 3ZQUA 4YMVA 4P7BA 5CXUA 4DTCA 1EZ1A 1E6KA 1SXIA 1ZMRA 2FE4A 4BZWA 1DEKA 2I1WA 3R3HA 1DBQA 4KNVA 2WE8A 3OA2A 3QVTA 3SS9X 3I9KA 5DM2A 3T9FA 1XTUA 2ZB7A 1AT1A 1H1DA 2W2LD 4PTZA 2YZ2A 3RTEA 4DDUA 4LXQA 3RM3A 1C0EA 4D8VA 1KDTA 3I6QA 3VZQA 4XFJA 5FRDA 4ARIA 4GG1A 1I8TA 4JR0A 1M0TA 2XX3A 2AKYA 1IZYA 1I0ZA 2D2FA 4FEAA 4ZQBA 1PQYA 5FI0B 1W52X 1V48A 3ZHUA 2GZHA 1PGQA 1T3ZA 1I94B 4B3XA 3R77A 1F2TA 1TMKA 3PUIA 1L5ZA 3VTFA 1TKCA 3NDPA 1SUDA 4GOJA 3WL6A 4BJHB 2X8AA 4BMVA 2WAXA 2H0AA 3RU9A 1SXJA 1K3TA 1UK6A 2X58A 4KP7A 5IFLA 1ZIXA 3OZIA 4EEXA 2PUAA 3E9ZA 2CV0A 5ESDA 1SQ5A 4N7JA 1MU0A 2ID7A 1QH1A 2BUCA 4WKPA 3HZOA 5C5IA 2CL5A 4YMSA 2ZM6B 3K2IA 4YMLA 4HNQA 2WKQA 4ZXFA 1KQPA 2B1IA 2DWUA 3R5HA 1FSGA 4RF2A 4RIIA 5U4XA 1KY2A 2V5VA 3FM9A 4FKMA 1XZHA 1XEAA 2GNAA 2HSEA 2ZROA 3GPIA 2F8MA 3KTOA 1Z39A 2IHVA 2NP6A 1YO6A 3BMOB 1MJNA 5ITWA 2BR4A 1NN1A 2X6RA 3VUEA 1E5LA 3THOA 5BVHB 3OPQA 3GGJA 3V5NA 1M2OA 2DG2A 3K0BA 1E2DA 3AT1A 4BB0A 2CZGA 4Q02A 3L8YA 1MC8A 3PVCA 2JH3A 1CQZA 1FSSA 4QRDA 2ZDHA 3HGMA 4LYHA 2AEEA 5FPTA 2J9ZB 4KL8S 3Q5GA 2B2NA 1PSWA 2CVQA 1I24A 4URYR 3WA7A 1G7TA 4R2KA 3SNHA 5B58C 4RTRA 3HYLA 4J7CA 5A06A 4NAUA 4KREA 5KS2A 2A1TR 4TN1A 1XTSA 1KDPA 4S35A 2Z8YM 3REFA 3UB4A 3UMBA 2J0VA 3U4QA 4G1BA 2C20A 1DLJA 1Q0QA 4MCHA 1V8FA 2OO5C 2NTJA 5ALKA 5MGNA 1HR0B 4K86A 3RRYA 1GKKA 4G3XA 4ZAWA 4BU1A 1VPDA 2JEOA 4Z4QA 3GA7A 3A37A 4KQFA 1NKSA 3FBGA 1T1SA 1JEYB 1P6XA 4OHXA 4GQBA 3W9BA 4I5EA 1XX6A 4NZ9A 1W35A 4Q00A 1PU2A 2NIPA 2H9IA 2O2SA 1G8AA 4O29A 1CUVA 5HZHA 1ZCZA 3C3PA 4OHYA 2ECFA 2FOXA 1NWCA 4ZAXA 1LLCA 3CEPB 1VHTA 1JEYA 4AYWA 4FHGA 5ALMA 3U1BA 2NUAA 1Y6GA 1GKUB 2O1XA 1DAFA 2P5UA 3ZNOA 5EL0A 1DCKA 2A7XA 4HFRA 1E96A 2PCJA 1HE3A 2IEIA 1UAYA 4MAMA 2QPOA 2FFAA 4TKUA 2CNDA 2ZSEA 3S7TA 4B7UA 3AF3A 1BS2A 2FDRA 3FPSA 3SCZA 4BVGA 5LNK1 1L5YA 2BHTA 4G0NA 1HKHA 1L4NA 1TYZA 2GRUA 4QEKA 4XAQA 9GPBA 2G1JA 3CBGA 4CIBA 4F5EA 3B6ZA 3I6ZA 1J2TA 3A32A 2H2WA 4JASB 3ZH2A 3CZ5A 3WZMA 1ZCJA 1J8QA 3JQ9C 4YAGA 2QZSA 3BGSA 3IPYA 2WFZA 4KQ2A 2IH2A 4BCCA 1QHGA 3FPJA 5I7WA 4UTVA 1UBKS 2DMRA 3IHTA 4IDGA 2XHEA 4PIMA 5BR1A 3VU0A 3BXPA 2EZ9A 4IWXA 4XJSA 2LNDA 2C1ZA 5HIMA 2ZYSA 3S5UA 2HCFA 4A36A 1W36C 2VDWA 1E1LA 1ZM3A 4B32A 3OJOA 2QPAA 2O2HA 3Q5EA 1N6HA 4J03A 3TB4A 3GQBB 1FLAA 4LKOA 2ZUBA 2O5CA 2AWOA 2GO1A 5C1BA 2ZATA 4EF4A 1NFRA 1YIAA 1YAHA 4XE5A 1T5TA 2IX3A 4WA7A 3ZHXA 4EHDA 3SVTA 2H6EA 3IMFA 4YP9A 1NNI1 5GIPE 4RWEA 2WJ3A 1ADYA 5U9CA 1H2EA 3M6WA 2VLIA 2PA3A 2B69A 2DUMA 3LY7A 3RRNA 3GDFA 1S7GA 2G3YA 2GM9A 3HCWA 1BJRE 1HT3A 1MENA 2EFEB 3OFSA 5B53A 2B37A 3W7BA 4L5JA 2PUBA 5CGZA 3VYRB 1DC8A 1YQTA 3EISA 3ZWDA 3O7WA 3EXFA 1U8ZA 4TS3A 2PJDA 1Z0IA 3CTPA 5F3RA 5JPIA 1CJBA 3BGIA 5I7UA 4TV9B 2RMKA 1NW9B 2B8EA 5DMXA 1XZPA 2CHVA 1Z5UA 2H06A 2OM6A 1U3CA 3M6UA 2GASA 4IGIA 2LGJA 2PGAA 1RFLA 2C7VA 2GKSA 3F3YA 2FPPA 2D7JA 3NVAA 4FS8A 5EMHA 2NAPA 4ZHQB 3RIYA 1E1RA 3MJTA 3TQFA 4O4LF 1QS0B 1WB4A 4JEIA 4YQEA 3LUBA 2O2CA 2VG8A 4F1JA 5LOVB 1HQYE 1FXWF 1OBCA 2JASA 3O83A 3ORRA 2ZJYA 4OP1A 3SC6A 3ZS8A 4AF7A 2D2XA 3EQ7A 3PGLA 4YCNA 2DPXA 3SS7X 1ETUA 1ZA2A 2V98A 2WPDD 5J5VA 4NL4H 5JD6A 4N0EA 4QG3A 3DB1A 2JVKA 4N3CA 3B3QA 2J45A 3E7XA 4JQSA 3CSUA 3G6WA 5FOXA 4DLPA 2EQAA 3VTAA 5HBGA 1JHQA 3SF8A 1JBKA 3V4PB 4YXFA 4JV5B 3AB7A 1SCNE 2EJWA 2VNJA 3PRJA 1FTSA 4WW0A 2EJBA 1EHCA 4IDHA 4R1LA 2RFLA 3SHWA 5AW0A 2C2KA 2EQ5A 1L7EA 2BZGA 3GMSA 3UPDA 4BP1A 1BWPA 1JAXA 1Y7TA 2J07A 4G85A 4PZCA 4TRMA 2H63A 4HVTA 1LPAB 2YY6A 3PU6A 1ESCA 3ELDA 4NK5A 2XCLA 4S1TA 1FDSA 5JV5A 2GLUA 3O47A 4DG5A 5EP4A 5B36A 2FEKA 4LQLA 3WIBA 4JNKA 4OKIA 3SKXA 5EKUA 2CB9A 3C3DA 3II6X 3VSEA 3IQFA 3BD7A 1U80A 4XTCS 4FFWA 2WKPA 2ZJAA 2PGOA 3K9GA 3SHOA 4JJIA 4G9EA 2XMBA 1SVWA 4JUCA 5TQ0A 3EIHA 1JPNA 1VG8A 3E3NA 3OMWA 3QNWA 4HH4A 3C6YA 2VC2B 3NHRA 5K8IA 2AOXA 3F46A 1XROA 4I1RA 5KVAA 2B3DA 4YAOA 4J4HA 4JVOA 2JANA 5DM4A 2OAEA 4FMDF 4K6HA 5IRCD 1UDBA 4K40A 3ND6A 1XN1A 2I4NA 4DB2A 1L4KA 3WFIA 4BN0A 2GA9A 1GFSA 1MR3F 5B1DA 3QUBA 1BVYF 1ZKMA 2D06A 2WUFA 2Z5VA 2YFYA 4KSYA 8GPBA 4QSMA 4EYOA 1NSYA 3LX4A 1KDYA 5KWIA 3UWKA 2WWGA 2AYZA 2BEWB 2ZJOA 1E7SA 2BEJA 3EGXA 1FMFA 2XWBF 5YASA 1EBFA 4HH3C 3ZHVA 2VPPA 2GAOA 4P32A 2PGXA 1UXHA 2HWKA 2I2WA 1U81A 2DAPA 3AQIA 3DFFA 4FHFA 4Q24A 4Q9HA 5CEJA 5EYPB 3ZK9A 2BEWA 1A27A 1AV7A 1WSBA 4G2TA 3IT2A 4DDTA 2W6OA 1XXHA 4MV5A 3GYBA 2HHCA 5JSHA 1J9ZA 2F3RA 3FGOA 4IMPA 5L4LA 4UMFA 1CZHA 4WXMA 2B82A 2A5JA 2TMKA 3O4GA 3ZYZA 1QP7A 1LVGA 2IH5A 2ZS7A 3SEZA 4KUEA 1YOBA 1VLMA 4NZOA 3WLJA 1QIEA 1ZCBA 2PSDA 1P2FA 4KRYA 3OCZA 1O97D 5KX5B 1QG0A 3B7WA 1G16A 4D79A 1MOQA 2Z3WA 1VSVA 4W7SA 2X5KO 3KJHA 5JCXA 3LTNC 3OESA 2X0NA 1H4QA 3AKCA 1XB2A 1K8ZB 1W0JD 5DLEA 4MVCA 4UPEA 1C9EA 3TRDA 4M55A 3UICA 2ZCVA 4MQ5A 2OENG 2DBYA 5KOHB 1L1QA 3S2GA 1UF9A 5I7FA 5KX5A 4K1XA 3OLYA 3CMCO 1NW3A 2BUBA 3GFFA 3EW9A 3FI9A 3HG7A 1GNSA 1XEXA 4UM5A 3AETB 2PZJA 3H84A 4GPIB 4TOIA 3H5RA 4GF5A 3RFFA 4BX2A 1G18A 5JSFA 4P3OA 3HL4A 1OB5A 4G0WA 3LV8A 4HPWA 1JKFA 3EWSA 3BH0A 1OH5A 1SWVA 3KLMX 1N2CB 1U6JA 2OWEA 3P19A 2J0EA 3ZXXA 3PQ8A 4FDMA 4XWGA 4Z8XA 5DX0A 5SY4A 1PGPA 3WO1A 2Q46A 3SVLA 3W77A 3QUSA 1TYDE 1RKVA 3BX1A 4MA4A 8AT1A 1CQWA 3FTEA 5CGQB 3MQ4A 4OA8A 4Q1EA 4B9AA 4U3JA 3TRHA 3IV7A 2RB5A 4BFZA 2JLZA 5FPQA 5D1NA 4DMLA 4PXAA 3R8CA 2G0AA 3MW8A 4H3HB 2QM7A 4KPUB 1P5HA 1C9KA 4LF5B 4NMLA 5HZKA 1D3AA 5SZHB 2EDCA 3P9CA 1U94A 3W2EA 4G5GA 4K0KB 2VP3A 1Y1RA 1MB0A 2V7GA 5I8ZA 3WE7A 4AUMA 4C2TA 2G07A 3H5WA 4ENUA 6REQA 4KAAA 1ZNZA 2HO4A 2C61A 1GNQA 3LXRA 3UK0A 1A2BA 4UEKA 4OK6A 2HK9A 3OIGA 5C8YB 2W5UA 3NHKA 4IF4A 3HADA 3RYTC 4QM6A 1GFWA 1TB4A 4OH1A 4UE3S 1KBOA 4UBMA 4B4DA 5DHRA 2Q9CA 4KAFA 1R8JA 1TT5B 4AYTA 2R6HA 3V34A 3TDMA 2QAGA 5LP6C 4IIBA 5C18A 2Z2XA 4G56A 3ZWAA 2YC2C 4TMTA 4QQ8A 4WY5A 4XIJA 5HIJA 3X2FA 4D9GA 4F1KA 5K01A 1NTRA 3SF0A 4WKCA 1UK8A 4DUPA 4ZN6A 2VPYA 3TS1A 3M2TA 3T7CA 2D1TA 2VDKB 3G49A 5DHAA 1FS6A 4J90A 4LJLA 5BMOA 2X4LA 3K30A 4WY8A 5DNVA 1E92A 1CETA 1TA9A 4HYTA 1J42A 4EHLA 1QV7A 3I2GA 3U4AA 1B8OA 5CLFA 2I1LA 4NQZA 4DA8A 3UMMA 3BTOA 5TEWA 2HMWA 3FRHA 1QFYA 4GX1A 5FBLB 5LQCA 3D1LA 4KMSA 4EY6A 3AVYA 1QHYA 3CG0A 5KNLA 2IS2A 4RFLA 1KP9A 4XYGA 821PA 4XGKA 2WJ4A 1LSUA 2BM8A 2HQSA 4LBVA 3C97A 3OPXA 2YYSA 2F17A 3DZJA 4XUEA 1G9XA 2P4HX 5A3VA 3NX4A 3EGIA 4YRGA 3T54A 3T9AA 1XA0A 1EFRD 4G24A 4CMIB 2PX2A 1IMJA 1YFZA 2JATA 3EX7C 3BIFA 4JFRA 1NKVA 1Y89A 2BM1A 1Y5LA 2MSKA 2ZWAA 1D6SA 3N2NA 4NCXA 4PIPA 4UM9B 4G1MB 1LNQA 5LQRA 5TGTA 1Y6QA 2P9FA 2Z2JA 4DSTA 1Z56C 3V55A 1DAMA 1HE5A 2F43A 2A4KA 3IP9A 3ODPA 1NX9A 3UBMA 2FW1A 3V4LA 4RK1A 2VWHA 5HKBA 4GE3A 1UEXC 4JB3A 1GYPA 5FV4A 4RHEA 1ZRMA 1DWPA 3A1DA 3KJIA 4IBOA 4V0SA 1MB9A 5CX1B 3VC1A 3ESBA 3IRUA 5AHRA 3ZIAD 3MTIA 1Z8FA 5E4TA 5BUSA 5H5JA 1MQ9A 1V39A 4HFMA 4JVMA 1JLHA 3OTWA 2Q7XA 5BPHA 2REOA 5EUQB 2FH5B 2VRWA 1F06A 2E7ZA 1B8VA 4MVJF 4B74A 2ORED 5JZ9A 3IP3A 1BD3A 5HIKA 4KAXA 2CWDA 1K8RA 2HDWA 2IPMA 4UJ3A 4GH5A 3C7TA 3L0ZA 3ONEA 3BS4A 2Q7OE 3JX9A 4W9RA 1JIIA 3N0WA 1DAKA 1ZI8A 3IT1A 1O4WA 2ONKA 5DW3A 4Z51A 1WUIS 1X9GA 1ISRA 1JN0A 3ND7A 1SC4A 4WZBB 2M2IA 4J49A 1EDDA 4JJZA 5ADVA 3DP9A 4IDAA 4CL8A 3FYHA 1V3VA 3RC9A 1J24A 5B4UA 1U2EA 5BYKA 1AQNA 5EHQA 1HUQA 1WUHS 1BCRB 2QAIA 2ATIA 4L9WA 3FCAA 3N7UA 1W5BA 1CNMA 3T0GA 1PHRA 3WB0A 3ONWA 3KC2A 5ARCA 4YAWA 4V03A 1CWUA 2XVYA 3CRMA 3EUFA 5DNWA 1JQ3A 3M9XA 3A9WA 4MIYA 1FVFA 2YHUA 4HDAA 1HMPA 1JYSA 4K87A 3EPLA 3KT6A 2Y76A 3O0DA 1FTYA 1HNZB 4JB2A 3U44B 3PFBA 3FVTA 4EUHA 1FUEA 4XDYA 3KT8A 2XKKA 3KOUA 3SDBA 5BXYA 1HX7A 1Y0BA 4WH0A 2HJRA 3FMPB 3FXAA 3OA0A 4BL5A 3PSAA 3QU4A 4G25A 1F6BA 2DPHA 4NU0A 3VZRA 1NBWB 1EK6A 1LA2A 5H3CA 2ON6A 4UVDA 1SXPA 2G9QA 3QPUA 1SUWA 1TM4E 5A5GA 4G07A 1CG6A 5LZ7A 3Q9SA 2X19A 3HFRA 2AQKA 4MV6A 4B87A 1G5TA 4HNVA 3ZLTA 2QPTA 2NW6A 3BZWA 3WA6A 4E22A 2PO7A 4EPXA 4YMGA 2BYTA 1Y98A 4CFSA 5C51B 1QGOA 4AKEA 2JBHA 3COSA 4FFBB 3JYHA 1SC1A 1XMJA 5DBEX 5HEKA 3Q1LA 5IAJA 3AJDA 4IH1A 5L7YA 2Q5CA 2WICA 3KR0A 5CNIA 2ZRDA 4QBTA 2Y27A 1T1IA 2BFFB 3CW8X 4KHPB 4L9AA 1MCZA 4CMGA 1OAOC 4M46A 5AW6A 3RADC 2VATA 1GITA 2RGBA 2QV0A 1U0LA 5EGSA 5ED0A 3E5NA 4IS3A 2I99A 3B1JA 3RUDA 4JFAA 4TL7A 3NGXA 2CHGA 1KI2A 3IOMA 3ISJA 2IXTA 3F3MA 3LQ2A 3PPYA 4PLGA 4QPDA 4U0KA 3V4OA 1KKLA 1XVTA 2QMEA 3WLEA 3KSBC 3UVEA 4AZSA 2PRKA 2XRMA 1COWD 3L06A 4Y9RA 1U3DA 4PVCA 4GLJA 1FMLA 2QVBA 2EFDB 3K35A 5FB3A 2F1HA 5IM5A 3TCXB 1Z4OA 3D2CA 4AQDA 3MGBA 1IEXA 5DYIA 1ODSA 3SHQA 4HWPA 1II8A 3BJZA 5KTTA 4B40A 4PRYA 1W34A 2QIPA 3ABSB 3M49A 3MXOA 4GMFA 1L8AA 4NMHA 2XNSA 1K4YA 3KXPA 5DU2A 1ZGBA 5G3YA 4YV2A 3EQ6A 2PSEA 4QU9A 2DOKA 4JLDA 3ED1A 3LX5A 3KAPA 1ZVQA 3LRXA 3N7TA 5CVDA 3SHVA 2G80A 1QIJA 4CDGA 4R1OA 3EFOA 4PG7A 3U5TA 2GEJA 4B31A 1U3GA 5A2GA 5J43A 5ECDA 1O6GA 5D1HA 5A5FA 3A3YA 3FGNA 2X4GA 4Y2JA 3U7JA 1LLDA 1AHIA 1NURA 2GFHA 1T91A 2CNOA 3TUZC 2WVAA 3MK31 4JJ6A 2VZLA 3R4VA 1FX1A 4P93A 4M9UA 3VKUA 2ZT7A 5JFTA 3NKFA 1EJ2A 1L1RA 1QCYA 2EERA 2V97A 1K6MA 1KI9A 3DFIA 3OLZA 2OLJA 1A1VA 4WI1A 3TE6A 4Y6PA 4REMA 5I9TA 1E3WB 3E9YA 2J3EA 4KPGA 3QF4A 1X1RA 3EULA 3SLRA 4CF4A 2JZNA 3FKQA 3G6KA 1P0MA 1USIA 2ID8A 2Q2NA 3G8AA 2PX5A 1A7AA 2JD2A 3D6JA 3SXUA 3A9TA 2KYRA 2QZZA 2R8PA 5KDDA 3W2TA 3H8JA 3UGKA 3FZNA 1SKMA 1X7XA 2CSUA 4TTQA 1E3WA 5J2UA 2ZYVX 3ENWA 4ZVRA 3ZU2A 1OXKB 1T9AA 2BDUA 2VYVA 1OW3B 1A72A 1JA1A 4BQQA 4CMCA 4C01A 2K2WA 4OHMA 1TC2A 3V7YA 2J3HA 4X0EA 4FYJA 2IPAB 2CUNA 1DEHA 2QVZX 3DL4A 4YRRA 4JI4B 4U0JA 3QOYA 4JCOA 1XTKA 2HJVA 3AC0A 3EN0A 5J59A 2X3UA 4KVGA 2PKQO 4B44A 4D43A 3ND8A 4U9UA 3KB6A 2JGDB 2W90A 4RVSA 3A05A 5DM1A 3SJBA 3WLMA 1ZGZA 5KAMA 2OFOA 1VYTA 1VB5A 3KKZA 5K8TA 5AOVA 1B3BA 1U3FA 2X14A 4KQ9A 2WB4A 2C2XA 4IKPA 1U9YA 1OUMA 4OPMA 3VKVA 4GBGA 2PMDA 5HKLA 2W2PA 1PKXA 2JGDA 1M1XB 4PAWA 2O8DA 3U81A 1UXOA 3HKBA 1TIBA 2P2LA 1B42A 2XD9A 1NBMD 3NHMA 3UV7A 3CY6A 1GAQA 4YPOA 3TZKA 1C8VB 1MB4A 3KD3A 4QPCA 5JXHA 3OJ0A 2FZGA 3JCZA 3KKNA 1QYCA 1YVRA 3PXCX 1Y1LA 4CHGA 1YS1X 4B7XA 3PTLA 4EP1A 2I8LA 3EGOA 1B2RA 3G2IA 3DVRX 3N0VA 4N7RA 2NNWB 2PWZA 1VCNA 2FWIA 3PVZA 2QMQA 1PFVA 3ZNPA 1T5DX 3FNQA 3WWYA 1VLHA 1D2GA 2AMLA 2NV0A 3F7TA 4URZR 2I4RA 1DJPA 2J9GA 5LWHA 2VPQA 5C52B 1F2UA 2Q1XA 3WO0A 2VF4X 3QPAA 3A1FA 1TJ5A 1GTJ1 2ZU6A 3CN7A 3LNTA 4PO3X 4D7AA 2ZIAA 4DSZA 4UULA 5KOJA 3H9JA 4MW1A 1ZGJA 4O2AA 3DOHA 2IT1A 3WGGA 4Z2AA 2OXEA 3ZQ6A 2OGTA 5KNBA 1LC0A 4TT3A 4FUQA 2W22A 4HZUB 1NZFA 1QBGA 3OFJA 3TLJA 3R7NA 5A5EA 4UTOA 1EINA 1S2NA 1J0DA 3O8RA 2C82A 4I6EA 4UXIA 4D3DA 1AB5A 2ZUUA 3BTUA 3MHTA 2WSSD 1DQPA 1F17A 4Y98A 5GM1A 3WV4A 3G89A 4RVDA 4B3JA 4Q48A 1QTNA 2PX8A 3HV2A 4GOKA 2HH9A 3I09A 4YRTA 1TL7C 2NT3A 5A02A 4RBNA 1I9CA 2QD2A 2XA9A 2WWYA 4LGCA 1EX7A 5IULC 6YASA 3MWLA 1LH0A 1X7YA 3AIMA 5C7LO 4U8HA 1NN0A 3DJYA 3OLVA 4MS4B 4RE5A 2J33A 4K88A 2J3KA 3AKYA 1GGFA 4NE7A 5BSRA 2JGIA 4EL5A 3LDGA 6Q21A 5C37A 1XRPA 1UKZA 2Y6VA 3LYAA 1I7DA 4B3TB 3LGXA 1JXMA 2WHYA 2Z5LA 1CY0A 3IIEA 1NLZA 1IDOA 3AHEA 1QHHA 3ESXA 4HRVA 3HN6A 3RVRA 3RIGA 2VHYA 4FZ3A 1WM1A 3STYA 4YASA 3OMLA 1K6XA 5AOAA 4EX6A 3GEIA 2I6SA 3GLTA 3GPDG 3M6IA 1XDWA 4R3WA 2IUUA 3HJGA 5F5LA 3TW8B 4KQJA 2C83A 1E99A 2LVBA 3NUZA 1K06A 3OIDA 5KTOA 1L7MA 4Z4FA 1E77A 2FPMA 2IHYA 3DCNA 4R81A 1CZLA 4WE3A 1OXVA 2BBTA 4KITB 5IXJA 2CW5A 2GZ3A 2HT6A 4FI3C 5LYJB 1FXWA 1B6SA 2X22A 3TSCA 3QEBZ 4QTUB 1TGYA 5FLKA 1NC3A 1DXHA 3MS7A 4OQYA 1JDUA 4M87A 1E4OA 2IWRA 5KYYA 3DYVA 1WF3A 2YXNA 1BHO1 3CEAA 4UBLA 3R7WA 3RAJA 3W6ZA 3B38A 2QY9A 3UQZA 2C9YA 4WBNA 3OX1A 3FPLA 5IDYA 4JHXA 4IRXA 3U7FB 1R15A 1CY2A 3MJ4A 1Z0JA 2C7PA 1IH8A 1Y4SA 2JB9A 2VIIA 3W2HA 1G3MA 3UEOA 3NYWA 3QHAA 1Y48E 1JR3D 4MR7B 4MRAA 4JUAA 4RK5A 3ZDZB 1OR8A 2AR0A 4PQFA 1OH6A 5JJBA 4RESA 4DWVA 5JXWA 2FSVC 2LCFA 5KYKA 3MT8A 4IIJA 4OXKA 3GCWA 4H7DA 3L77A 5CA1A 2X23A 3R44A 4K46A 1E6CA 3ZU4A 4IGFA 4AO6A 5ADWA 2NXNA 3TR6A 4OFZA 2WTBA 4HRXA 3DD1A 3WMFA 4N3GA 3WXMA 2CE2X 3UMCA 4F6RA 4R1UA 2YV2A 1PR2A 1JILA 2JAOA 4LDJA 2HDNB 1XSEA 2W6CX 1G64A 2A9OA 4UBOA 4WJKB 1I0IA 2AX4A 4BQPA 2NSHA 4BKRA 5JNRA 1DRVA 3PZRA 1L5GB 3NC0C 3CGWA 1UKYA 2SCUB 2WA2A 4XM2A 5EP2A 5J9FA 1IY8A 2COKA 5DLYA 5BRJA 4MVJG 4HNHA 3WGQA 3ZDYB 4LJ8A 3WQBA 4DLBA 3REQB 1ZRNA 3HN7A 2BRUC 4R54A 1LQUA 2C8VA 4C7KA 2R84A 2RARA 1A9XB 4P81A 3W2IA 1AKVA 1VHLA 3OE4A 2OSVA 4Q9KA 1T9HA 2J3DA 1Z68A 2PL1A 2Q28A 3WLSA 5KNDA 2I8CA 2QY6A 3BB1A 2QD4A 3NHJA 3NTVA 1ULTA 4CETA 4GS5A 2X0DA 3X2SA 4ZTUB 4FYHA 3ZJ5A 3O1HB 3KQNA 5DN9A 4ARZB 3VYWA 2F64A 1UAAA 4YCDA 4FYXA 4BN4A 3THXB 2M6SA 5EQJB 2OC9A 1OGIA 4C0QC 4DCNA 4NFLA 5DWQA 4X24A 4X91A 4GOXA 4RULA 1HGXA 4LX8A 2YIJA 4FJ0A 1C3JA 3W4IA 3ZDFA 2OY0A 5K1ZA 1F1BA 2GEFA 2C0PA 1JEEA 3K1ZA 3L2OB 4B80A 3O2QB 2HHHB 4KK3A 1ZIYA 4FU0A 4BXOB 4OBEA 5D5HA 5TMBA 1E3JA 4PCAA 4PZEA 2WUGA 3L02A 4OHVA 3VNBA 3UJPA 4A6DA 2I3GA 5AXAA 4W63A 3DL7A 5ALNA 4BRUA 2DFNA 4GYJA 5DNDA 5KHAA 2FG7C 3NBZC 4HAWA 3M3DA 1X19A 2NZVG 3T7SA 1OTXA 1DQZA 3X1ZA 1QX3A 4RVNA 4D2IA 4BO1A 1SAYA 2P8JA 2BJVA 2X15A 4KQKA 3VNAA 1IHOA 1RXIA 3C6ZA 1M8GA 3DL0A 3SYRA 3YASA 2GN4A 1LKZA 2EX4A 2OCDA 5DHSA 5AVVA 4LOHA 3IR5A 2DXIA 2O9JA 4Q3OA 4TM8A 3LHIA 1BJTA 3LT4A 1MA0A 3TQQA 3VO8A 1WRBA 1GN8A 4KJXA 4UMDA 1NM5C 2C5HA 1EM8B 1TD1A 2ALJA 3E3OA 3IQXA 3PFIA 4C0XA 3NIBA 4LHVA 1DXYA 2CV1A 2B98A 3OJXA 5E6RA 4JBIA 1KVSA 1TCAA 1JRLA 1NR7A 1X0VA 3ED5A 3OCYA 4OHZA 1DRKA 1RYBA 4OQQA 1H6CA 4WACA 3EZFA 4Y0VA 2RH8A 3KYBA 3UWMA 3DS8A 4EG4A 4YREA 3DE0X 1YRWA 3GJYA 1A04A 2BN4A 2D2VA 5IKEA 1QRSA 3PVSA 4EW1A 5P8WA 2QEQA 1BW9A 1PJLA 2VXYA 4ALKA 3PPWA 4E5UA 2QJWA 3AVPA 4YCMA 4EB3A 4CLOA 2AZTA 2ZRMA 4EITA 3QFHA 3VYUB 2WM2A 4C07A 5JSQA 5ALDA 4DQKA 1GR1A 1E2QA 3BUSA 3VMMA 3WL5A 3IDFA 4XOUA 2JGRA 1DPFA 4HQRA 4JGBA 4QUKA 1I3KA 3FBWA 3VH3A 5F2OA 1XQXA 1ISFA 2OGWA 3ANYB 3LHKA 4WIAA 5DCLA 4AB1A 4UBNA 2JKZA 4AXBA 1YQXA 3OTIA 1VCMA 2RIRA 2YV5A 3MN1A 4L0QA 1OD6A 1V37A 1JEQB 1AQIA 4XYEA 3SYNA 1XTVA 4JYAB 3A6HA 1VHDA 3HP4A 1SG6A 3HLKA 1QKIA 1WCXA 2P2YA 2AK3A 2LKCA 1R4MA 1XTIA 4FX5A 4IJMA 4RPHA 4GRDA 2XDAA 1RQLA 4LZNA 1B26A 3GLIA 1KI7A 4O1HA 4CLRB 1E4YA 4HO1X 4YHHB 3BD8A 1BXRB 2C58A 4ITVA 3X1DA 1UOEA 1TO6A 1XXHE 2QTVB 3NDJA 1DUIA 3AX6A 4OIMA 4ZI7A 3N6XA 1D2NA 1SBYA 3B6MA 5IASA 1OJ7A 1KARA 1TZBA 2OAGA 1JQEA 2VTVA 4MZDA 5GVRA 5THQA 4CKBA 4MQEB 3A3NA 3VR4H 2AVNA 4HGOA 3GUYA 3KQYA 3LKBA 4IYRA 3TD9A 1U7PA 5ALFA 5CB4A 1OI4A 1P5ZB 4INAA 4DNPA 1Z2NX 4G5SA 2BCEA 4KX3A 4MGKR 1TQDA 2GPWA 1FP2A 1TYAE 2Z98A 5AVWA 3MFYA 2CXTA 3S27A 2PGLA 5DF1A 2WR8A 2OA0A 4BTVA 3CRZA 4JD5A 3A2NA 2DHCA 4OQPA 5J2TB 3H2YA 2LUOA 3Q9UA 2HGZA 1SK9A 3KWFA 4FGUA 2QYSA 4GI3A 1LSOA 1YBAA 4I5GA 3D31A 4J0GA 4I9UA 4TTPA 2B61A 2UUBB 3B85A 4ZDIA 5FWDA 2XSZA 2OO3A 3AV0B 5H81A 4EJFA 3HSYA 3JQAA 2G88A 4C0HA 4WGFA 4J6EA 4X9XA 1JI3A 3EA4A 4G4SO 2FMFA 3OD1A 3PENA 3DLTA 1LZKA 3RC7A 3AVQA 1IZZA 1GUDA 1P61B 2PVSA 4B4OA 3BL8A 4ICIA 1CUSA 1SXJC 4J3FA 3S6JA 1ESMA 5AM4A 1AXRA 3VX4A 5K05A 3PLRA 4LV6A 3X3HA 3JQ8B 3OU2A 3BIOA 2QTTA 3WISA 4Z3OA 2X7XA 3UCFA 3ZW8A 4A5OA 3UOWA 1RTTA 3OTQA 1IM2A 2QX7A 4KMRA 3O90A 2G6BA 1VPVA 4RDCA 2J5QA 1TZJA 4Y6OA 2OCIA 2OCYC 4BCDA 4OB8A 1GZDA 3JQ8A 3TYXA 5E7IA 3CURA 2A9FA 4GBJA 3UJNA 2Z9BA 1BEUB 3D4PA 1KHHA 4ZVLA 1SVUA 1WEKA 1IM8A 1S9HA 1KK0A 3H5TA 4HAOA 1BRTA 3O9VA 3UH0A 2DWQA 3A1VA 4NZYA 3ODGA 1L4EA 2EP5A 1KDOA 2PVPA 3UOGA 3PDWA 4C6TB 1FLVA 3QM1A 3AH8A 3QVMA 3BSYA 1BHJA 1EP3B 1CEXA 2FWAA 2O1EA 1BHQ1 1R3DA 1WBBA 3HEMA 2C5LA 4DQLA 1TZMA 2W0MA 2NXJA 3NDRA 3WLQA 5FBZA 1E94E 1SELA 5C1DA 3TF5A 4DMFA 1F38A 3H1FA 3S70A 2QWXA 3GRPA 4LNUA 2R8RA 1NXTA 2NTNA 4N82A 1G3QA 3UJ3X 3C3MA 4Q3NA 1MX5A 2CMGA 4G0PA 1QO9A 3SG0A 1QUFA 1SC6A 5IABA 3S4YA 4ZYXA 3TFQA 4I8XA 1UPCA 4FCWA 4CWAA 1FFCA 2W8BA 1XOIA 4KO1S 2H08A 3PGXA 4OCZA 1G8MA 7REQA 1RAHA 2ZYWX 3LI2A 3F67A 1E89A 1LB1B 3G9TA 3LW7A 1T0UA 1C3XA 1CRLA 3BA6A 3FRIA 3GHYA 3ZBUA 2YYAA 2P30A 4F9EA 4ZGGA 5M2QA 2V3CC 1MDFA 4D99A 5FBWB 3PR3A 4WCFB 5CM9C 2Y1GA 2YJZA 4KOEC 4UZEA 3IBFA 1QQ6A 2JIRA 4ITRC 4YLGA 5ESRA 5ANRB 2B2CA 3P4XA 2G5TA 5LKAA 4V2UA 1ORDA 4N9WA 1T35A 4Q3KA 3Q7SA 2MYNA 3KJNA 1R4ZA 5FI3A 4OMCA 1L8QA 4UDXX 2QTLA 5LB2A 3IP7A 5EZQA 1UBGA 2CNBA 1DQRA 1PHPA 2E48A 2WQZA 3QFFA 5BT8A 4I5DA 4DLZA 1MRZA 1XAHA 3EBPA 1J7JA 4HBZA 1ENZA 4DKXA 2WVJA 1F51E 4K03A 5GAJA 2OILA 3GR6A 4QBKA 3IPCA 5JLAA 4GKBA 2YHAA 3WLRA 4WNYA 1L5LA 1LPBB 3NHZA 1O8BA 1SUFA 1TRHA 3WVNA 5AUOB 4G4GA 1LLUA 2VDJA 5J63A 1ZWKA 2EX0A 2OLKA 4FWBA 2IBTA 1GPH1 2X0RA 4I5IA 5KQSA 4QG7A 1M2FA 2NO1A 3S1AB 5LKRA 5T6BA 4ZKDA 1VG1A 4MI6A 2V8OA 4BIIA 1L7BA 3T5BA 2H4XA 4MUEA 2FEOA 1CHDA 2OO7A 2E9SA 1IN6A 4B4UA 1YZNA 3KCQA 2WU0A 3OHPA 4LXGA 1PJ3A 2J0SA 1V16B 1NJ2A 4EZIA 4P80A 2CGEA 3CEJA 3MWEB 2WK1A 4NEQA 1J0XO 1A9QA 2PV7A 2VHJA 3KPWA 4IGAA 4CEHB 3A31A 2H5IA 1YJ5A 2VQSA 3T5GA 5H68A 1YUNA 2QSUA 4FOPA 4DXDA 5EXXA 5M34A 3E9EA 2M32A 5KWSA 2GJAA 1A3CA 4W8HA 1MVOA 1V16A 4LN1A 5ALTA 3T7TA 3U37A 4RZHA 4CJXA 1P6UA 1ZNYA 1W46A 1ND5A 2WJ6A 1QGAA 1JIUA 2C2BA 4CEHA 2X1VA 3SZGA 1EFHA 4FR0A 1LS6A 2PUJA 4JI3B 3H0EA 1G3IA 1Y7PA 4WHMA 4HNAB 4CYMA 6LDHA 3UUGA 3R9KA 2CVPA 1P39A 3U19A 4MW4A 3EZYA 4IRMA 1GGJA 1L6IA 3AY0A 5BV8A 1JFVA 1GL3A 4Q66C 1GZ4A 1PLJA 2VAXA 2OZLB 3QE0A 3QH4A 1HG1A 1JTEA 4TXHA 3KL2A 5LYYA 6ADHA 1JVBA 2OUKA 3C98A 4L5AA 1M54A 2BEKA 1S8FA 4BEVA 2D5LA 5AFSA 1XR3A 2HCJB 5IJ9B 1YK0A 1ZD4A 3VXKA 2WYOA 1IATA 3H2ZA 3LPNA 3M4ZA 2XYPA 4K8OA 4MMYB 2IH4A 1NDQA 1VI6A 1VJ0A 3CT6A 4JBHA 3ZD7A 1EHYA 4NJMA 1J22A 4TXNA 3ZGNA 4N7BA 3LDFA 4E3ZA 1KI8A 1TM3E 2DSNA 5B64A 1KMMA 1QRAA 5G02A 5KYVA 5IUNC 3F5QA 3AOGA 1HDEA 4RF5A 4CL0A 2WM9B 4OQEA 2CNNA 1L4FA 4OATA 4RZ3A 1JKJB 1UZNA 2W4QA 3NGLA 4RDXA 2PZBA 2CMDA 2H2GA 1D9XA 2FUG1 2PAAA 1YU9A 4AP9A 1GARA 3AL2A 3KPVA 5JDCC 2CKDA 3DA8A 4LG1A 3L79A 4RGBA 3TPZA 4PO1A 5DTQA 1TJ3A 2Y8EA 5FX2A 2FRXA 3FB4A 1X7WA 3PQFA 4ARUA 1SIBE 3CRRA 3FMIA 4RQTA 1JFSA 3KKKA 4K9QA 3M2PA 2R6CA 2R1VA 2H4HA 1C41A 1KMNA 2EJTA 3LQYA 4A2WA 4CEJA 4Q1AA 3W90A 3HACA 4R69A 4B8YA 5AKHA 2CUKA 1WSAA 2XKJE 4UHBA 3QUAA 3OZFA 1NP7A 2A0FA 4W5QA 5JS1A 1UPTA 2D4HA 3VNUA 4YS6A 1P3DA 2JD0A 5F98A 3ZJTA 3LFHA 4P5PA 2ORYA 1O57A 1PS0A 3PX3A 4BRZA 5GM2A 3ONFA 2CFRA 3J81k 2C77A 3ZZ1A 4D81A 5CIYA 1CUUA 4L8YA 3FWZA 1IJEA 4R51A 1X7ZB 1GLGA 1XAIA 2WVGA 5AHXA 5EIHA 2J08A 1JU4A 1EDOA 1YC2A 2FK8A 4HAUA 3E48A 4IHJB 5G0TA 1S2LA 2OHFA 2WU3A 4P5DA 4O5OA 5TVGA 5A04A 3ESQA 4Q4HA 4XVQA 3G23A 2M1ZA 4YCAA 3PFFA 1D0IA 6CHYA 3F6PA 1RVV1 1ULBA 1JDBB 4PG5A 5C31A 5IN4A 2ZG6A 2FUKA 1CR2A 2XXAB 3R09A 3U9SA 4M36A 1NQVA 1P80A 3GFBA 3FF1A 3UG7A 3H1BA 1PR6A 2YINC 2ZS9A 4XX0B 3FTCA 4XD2A 3GT7A 3WRVA 1Q6YA 2EFYA 1JTFA 2H5LA 4MYSA 4Q7KA 4TTRA 2O54A 4PX9A 4UUAA 4ZA2A 4ZZ0A 3SY8A 3O5AA 3E82A 3HJNA 3FNBA 4P7GA 3RHFA 1DPGA 2VP6A 4XX1A 1SMKA 4L4UA 5HK8A 5BSGA 4EI9A 2AG1A 3AMVA 1LEHA 2A3RA 3JTEA 1WMEA 5EAIA 4TLEA 4Z1OA 4LF8B 3QX7A 4M60A 2MSWA 3RBZA 1M5RA 1NE2A 2GPSA 2R60A