1LSSA

Ktn mja218 crystal structure in complex with nad+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
132
structure length
132
Chain Sequence
b'MYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDAGIEDADMYIAVTGKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLIER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trk system potassium uptake protein trkA homolog
molecule tags Transport protein
source organism Methanocaldococcus jannaschii
publication title A mechanism of regulating transmembrane potassium flux through a ligand-mediated conformational switch.
pubmed doi rcsb
total genus 50
structure length 132
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lssA00
4J9UE 4KTVE 2P5YA 1ONPA 1YJQA 4I9UA 2H9IA 2C82A 4BNIA 4YA6A 3A14A 3L9WA 5F1OA 2VOJA 4IGFA 4HFMA 4BB5A 3MTJA 3ZW9A 2EERA 1J4AA 1JAYA 3GGPA 3WNVA 1PS8A 3WJ7A 1LDGA 1LLQA 1N7GA 2IE0A 3I9NA 4FGSA 1E92A 1ZEMA 3DEYX 5G0SA 2X86A 5T8KA 1LSSA 4G5HA 3PJFA 3F9IA 1O89A 4Y98A 1ADFA 4NPCA 1XR3A 4MKZA 5H83A 4RPKA 4IIUA 4J90A 1P77A 4OH1A 3ZWOA 5A9RA 2YW9A 4EITA 4CLXA 4IDGA 1C0IA 2IYOA 3DBLB 2YJZA 4L4RA 4XEHA 3PWKA 1SBYA 2E49A 4HBGA 2G0TA 4Y6PA 5IFLA 1RM5A 1X0XA 3S2FA 1XWFA 1J49A 3IJPA 2R2GA 1O0SA 2DTEA 1JVSA 5KTKA 4Q3DA 1HDOA 3NTRA 4GBJA 1DC5A 5A04A 5BSFA 5L7TA 3DO5A 3U4HA 1DC4A 1ZJZA 2BH9A 3K31A 2NU9A 3FBGA 4YJGA 2VNSA 1G0OA 4XYLA 4TROA 4CMBA 4RPLA 3NTOA 2Y0DA 5CHEA 5DOZA 1Q7CA 3F5SA 1QYWA 2O3SA 2ZCVA 4OQYA 5L95A 4BNJA 1A7KA 1HRDA 4UUMA 5LCXA 3V1YA 3VDQA 5I7VA 4OJNA 2VNAA 1GPJA 1JN0A 4J2HA 4RF5A 1ZMTA 4A7PA 1EE2A 1I8TA 1ISFA 1DIBA 3KO8A 5CEFA 4E33A 4B4UA 4XRGA 2Y67A 3C24A 1P1FA 3K8ZA 4ZQHA 4PG7A 4XRRA 3DZKA 3TZKA 1ZIDA 3FNEA 1M66A 1PTJA 1WXDA 2H63A 4YWJA 4BNHA 3P2YA 1DAPA 3BXXA 2DC1A 4ALLA 5L9AA 3PZRA 2OFPA 1DBVO 2Q99A 3MJ4A 4CQLB 4XJSA 1M6HA 3GZNB 1UP6A 4Z0TA 3GDFA 1NFFA 1OFGA 5AXCA 4XB2A 4HY3A 2VYVD 3U9LA 4CL3A 4K1LA 2Q50A 1EVYA 2Y1DA 1PGNA 3WGGA 2B5VA 4NBWA 2I67A 4ND5A 5JMWA 3JQBA 3T7EA 2FMUA 3S2EA 3GNSA 4PVDA 4CLHA 2V6GA 4IDEA 1R0LA 2EEZA 1LDMA 1YBVA 4YT2A 3OHSX 1J6UA 3MJEA 1E1KA 3I52A 1UZLA 1WMAA 7MDHA 4M87A 4FFPA 4PGFA 4Y6RA 4DVJA 1ZMOA 4R16A 5COBA 3VTFA 2XAAA 3RUHA 1ADBA 3HDQA 2J6IA 4IJWA 3WGHA 2X6TA 1PJQA 2PGLA 4MIOA 3KYCA 4S1VA 4XR4A 5DP2A 3G17A 4O6VA 3QP9A 3TFOA 3HB5X 3HDJA 2HO5A 1JW9B 2GN4A 1DB3A 5U1PA 4OOFA 4BKQA 2ZYAA 2DFVA 2O3UA 2CZCA 2HKIA 3F3SA 3JD4A 4QO8A 1E7MA 2Y0EA 4FJ0A 5A9SA 1V0JA 3VHRA 1LSOA 3OJFA 3ON5A 2Q1WA 1VL0A 5JO0A 4OSOA 1E1LA 3FPCA 4NZ9A 3DBVO 4UVGA 1N8KA 4JN6B 3U5TA 3VTZA 1KEUA 4I5EA 3W8DA 3V2UA 4LCEA 1WLYA 1VE9A 3PZBA 5ICMA 1ONOA 3LVFO 3OJ0A 5CDYA 2HDHA 1VRWA 4GL4A 2RH4A 3V2HA 3DHNA 2C54A 3DBHA 1ZK1A 2UV8A 5JC1A 2NV6A 4ZQFA 4E13A 1KY5A 3PTZA 4PRLA 2HMSA 2V7PA 3GVPA 1DIAA 1CRWG 4XQEA 3O26A 4UVDA 1I32A 1LBEA 1QV6A 2WDZA 3BYZA 2X5JO 2FP4A 3ICPA 3P5SA 1K6JA 2V6MA 3GLQA 3WGOA 1TB4A 4YVFA 4E30A 1ZJYA 3PLRA 4FN4A 4B3JA 1KVTA 3CXRA 4UUNA 1PJ4A 3VOSA 1T2DA 3IS3A 4TMFA 3QQPA 2I9PA 3I23A 4XIJA 5DCYA 2FPPA 5KNLA 4N54A 1H9AA 2IODA 5F1PA 2JAPA 5BSHA 3VH2A 1YO6A 2YV1A 1RKXA 4TZKA 3VZQA 4CM9A 4PLCA 3OMLA 4M86A 5T6BA 3OA2A 1YH3A 2YY7A 5I9LA 1G1AA 1U2DA 2VUTA 1ZEJA 2Z1NA 1DLIA 5L51A 4OIMA 1DC6A 3RKRA 3DZHA 4II2A 2NSDA 1P31A 4CLOA 1R4MB 4IQ0A 1A4IA 3DB2A 4Z9FA 1H2HA 3OICA 3WICA 1U8FO 3WIDA 3RUEA 3GF4A 4IBOA 4CV0A 3IKVA 3OH8A 3KEQA 4FFMA 4GH5A 1TVEA 4MVJF 3RAJA 1IY8A 1M6WA 3GR6A 1YGYA 5L3ZA 1DSSG 3T4EA 3H9QA 4DGSA 2FRDA 4IDBA 3SJUA 3D4OA 2H6EA 3FRJA 2PLAA 1IHYA 5L4SA 3ZWYA 4WJZA 4K6CA 2WE7A 1BWSA 5HS4A 1T2FA 2O3QA 3H5NA 3S1LA 1ZW1A 3UKOA 4KUEA 3DFZA 4NFHA 3VC7A 4J7XA 2OO5A 3OBBA 4NJMB 1PR3A 3TZQA 2QHXA 1PZEA 1I01A 1JWBB 2X58A 3PEFA 1F17A 3I9MA 4FJ1A 2E6UX 4XZ3A 4HP8A 2VOEA 3L0DA 1HDZA 4RVSA 5EQFA 2G76A 3A4VA 2JD0A 5DN9A 1ZK4A 2NTNA 4E3ZA 4KQXA 3LT2A 2EIHA 2PH3A 4MIEA 4TWRA 2X9NA 1HT0A 2IEBA 3HWRA 1KVQA 2B36A 1Y8QA 3R3JA 2P9GA 4J0FA 2FR0A 2P5UA 4Z9XA 3GVXA 3BA1A 3ANNA 1WP4A 3VZSA 1X1EA 4BO0A 1OI7A 3WQRA 4B79A 3DAFA 5G4KA 5U4QA 3AUSA 1KOLA 3RSHA 2RIRA 5FWNA 2JCYA 1KC1A 3VPGA 4ZD6A 4BNGA 3TN7A 4ZJUA 1EE9A 3Q0EA 4LCJA 5KJFA 1GDHA 4MO2A 2GSDA 5H81A 5I8ZA 1HDGO 4HXYA 3W6UA 3LLVA 3SC6A 4BMNA 1E6EA 2UDPA 1I24A 4DIBA 4R1UA 4DQVA 4TRMA 1HF3A 1GADO 1UXHA 4EBFA 3WYBA 3A06A 4PLYA 2BGMA 4OXKA 5KWEA 1YL6A 2UUPA 2VZ8A 2X9VA 4LGVA 3RJ5A 1ENYA 3ROPA 3AUTA 3TOZA 2R6JA 3KM0A 4J4HA 4DBVO 1KS9A 1QYXA 4TVOA 3I1JA 2WEKA 3MJTA 1UAYA 1HDRA 4CUKA 3JQ8B 2HJSA 5DZSA 4B7CA 4CM4B 4B3HA 3NJ4A 1E5LA 4R41A 4D44A 2OUIA 4K6FA 2GZ2A 1YL7A 1DIHA 1ZK0A 1LUAA 3L07A 4BNNA 2P9CA 4GVXA 3KV3O 4CM4A 1DXYA 3GG2A 3WBBA 5THQA 4ZQBA 3AK4A 3KLPX 3QJ5A 3HG7A 4GSLA 3F46A 2VZ9A 1Z6ZA 2W2LA 1GV0A 4F46A 2HK9A 3QWBA 3H2SA 1B3RA 4I8XA 4P4NA 2IRWA 4BNTA 5B12A 2AXQA 4Q39A 3GDOA 2YZ7A 2ZTMA 3AY6A 4H16A 1TI7A 3EK2A 2GPTA 1MA0A 1ENZA 4M1QA 4ND3A 3JQAA 4RDIA 1QYCA 1UXIA 1OAAA 1X1TA 3M1LA 3Q1LA 3PIIA 1LC3A 1BHSA 3U0BA 4RVHA 3R1IA 5TIIA 1XDWA 3ITDA 4IDFA 1JKIA 2PGJA 3GRKA 4U6QA 4ALJA 3ZV3A 3C1TA 4FPXA 1ULUA 2B4QA 4R3WA 5JAMA 2BI8A 1DHRA 4ONEA 2Q2VA 4CM8B 1DFGA 1GPDG 3DL2A 1GEGA 1GCUA 1H5QA 4HWKA 3PLNA 1Y8QB 4RZHA 2CUKA 1O94A 1U3UA 3ZWNA 4XR9A 4NG5A 4A10A 1TXGA 2W90A 4HFJA 3RBXA 3WWYA 2PV7A 3JQ7B 3L6EA 2HU2A 4PRKA 1AHIA 1X7GA 4BO6A 1XCBA 3A9WA 2NUAA 1TT7A 2X5OA 1YE3A 2NWQA 1I3NA 2DPHA 2IYPA 3G49A 4HX5A 4RF2A 5G0UA 5FEUA 4EI2A 4BGIA 4MOWA 3I5MA 1VLLA 3CTMA 2I99A 3AW9A 4NBUA 1Q7GA 2D0IA 3ZI0A 2WWRA 4YR9A 4OQZA 1GAEO 3PDJA 4EW6A 5JCXA 4GGOA 1JU9A 2FSSA 5C5IA 1T25A 3JTMA 4XYBA 5KVSA 3N58A 4RGBA 1RPNA 5JDIC 4PCVA 3NV9A 4AJIA 2O7SA 4KDFA 5TLSA 3V8BA 2EP7A 3ANMA 5JE8A 2Y1EA 4FC7A 5TQVA 1GQ2A 2I3GA 1R16A 4TRNA 2HRZA 2IZ0A 3B1FA 1XIVA 4CL8A 5GZ6A 2DBZA 1E7QA 1DHTA 4DRYA 2HMUA 2PKQO 3WR5A 5T57A 1YRLA 1HYHA 3OJEA 1CIVA 5EMHA 4B8WA 3ZWVA 1R0SA 1PEDA 4WEOA 4R51A 1C1XA 2VTDA 2B5WA 3OQ6A 1UXGA 3Q9UA 3WYEA 1IZ9A 1H0KA 2XPCA 1P1IA 3KB6A 1YKFA 2Y66A 1ORRA 3OP4A 1MGOA 4IXWA 4Y6SA 4BKRA 2BFOA 1OC4A 4FSHA 4R1NA 4Z3KA 4GX2A 4RLHA 4YJHA 2I66A 3ZHBA 1WZIA 1ZNQO 4FIZA 1SOVA 3RBZA 1P74A 3QVTA 1C3VA 1I2CA 1EVJA 1X15A 2ZB8A 3BZUA 4IS2A 5JAQA 4NFSA 5B4TA 5C37A 2PD4A 3ETDA 2B37A 4OXYA 2PGDA 4PG4A 2AE1A 4YAJA 4AJ4A 1Q7BA 5GY7A 3RUCA 4BKUA 4DLLA 1EUDA 3A1NA 3GH3A 2I3AA 4JLWA 4HNHA 4UEJA 1YQDA 2CSUA 5CDTA 3IP1A 3TSCA 3ZNQA 1AXEA 1VL8A 3OETA 4CMEA 4D7AA 1PZHA 2DTDA 2D2IA 3E5MA 4FBGA 1DFIA 1EK5A 4GWKA 4YT4A 3ETGA 4YAEA 4H3VA 4E21A 2HMWA 3Q2IA 4CMAA 1FXSA 3KLMX 1VJ1A 4AJEA 4O1MA 4UREA 5DOVA 3DONA 4CR8A 3CZMA 4B4VA 5TJHA 4GX5A 1GFSA 3QE3A 3RUDA 3S55A 5JAZA 2C20A 4WLVA 3PHIA 2ZATA 3KEOA 1SCUA 3MTGA 5TJ9A 2AQIA 1ULSA 4ROSA 2PZKA 3G79A 1LRLA 2Y99A 3OJOA 3DOCA 3IMFA 3NJ8A 4IMPA 3GNTA 3FNHA 5ER6A 1VPDA 2Q2QA 3PFWO 4ZA2A 5T67A 3ROMA 1WVGA 5A9SB 1OZAA 3KYBA 1UJMA 5EL0A 5C7LO 1PL6A 3Q2KA 2GDZA 4YXFA 2AQKA 3I6IA 4NNJA 3ZWCA 4E5KA 5A03A 1M76A 2EW8A 4II3A 3JYNA 5L53A 3GHHA 1YL5A 4GMGA 4R3NA 2PK3A 2QIOA 1UUFA 3LQFA 5KKCA 5CDUA 1N2SA 1FF9A 3STHA 4D3DA 3QVSA 1ADGA 1E3WB 1MC4A 2VT2A 3DBRA 4D3FA 3ITKA 2HQ1A 1NHGA 2YQ4A 3PFFA 2WM3A 4M8SA 1W8DA 4FOOA 4YACA 5EESA 4URFA 4DQUA 3LF2A 5TC4A 1C1DB 2VWPA 2FHSA 1P1HA 3ZU3A 1O9BA 3EHEA 1ZZEA 4GWGA 3WNQA 2WYWA 4P4GA 3E6AA 1O8CA 3AUUA 3B6ZA 2DT5A 2NVBA 1JDJA 3C7AA 5CDSA 3F6YA 3JCZA 2O2YA 5JY6A 1R37A 1B7GO 3OIFA 4BUCA 3GUYA 4BMVA 4WLFA 4Q9NA 2NVWA 5I7EA 1DJQA 1KEVA 2Y1FA 2C29D 3L9XA 3RU7A 3FSRA 1U9JA 2Q1TA 2YDYA 1H6DA 2AG8A 3C8MA 4U8GA 5ENDA 2DPGA 1V6AA 2Q1SA 3E8XA 2JD1A 4RPHA 2H1SA 3PHGA 1IB6A 1P1JA 4IMRA 4R01A 5TRTA 1KVRA 3HN7A 1IYZA 1B14A 3WWZA 2EP5A 2VWQA 2CMDA 1FDTA 1UXJA 3GUCA 3PJDA 2G17A 5DULA 3VKVA 3HSKA 3H9JA 1QLJA 2VZ0A 1HDXA 1WDKA 2OP0A 2VWHA 3L77A 1NVGA 1R66A 1F8FA 3E03A 3PGJA 5LDHA 1LDNA 1IHXA 5CG2A 1I3LA 2PTGA 4D3SA 5IZ4A 2QZ9A 2BGLA 2GD1O 2HLPA 4BV9A 4F45A 4U7WA 3KETA 5K0ZA 3ZZNA 5B4UA 4KWIA 1KETA 2YV2A 1Z7BA 4FR5A 4YRAA 3NTQA 1JTVA 1YWGO 1EUZA 5IDYA 4BGEA 4YAIA 2J5QA 1M67A 3E1KA 4KOAA 4I1IA 3RKUA 3RQSA 3RWBA 1OBFO 1Q0HA 4DTIA 1GCOA 4WLUA 1QYDA 1ZK2A 2PKQP 4LN1A 4YYZA 3F5QA 3IAHA 1YQXA 3VPXA 1PWXA 4RZIA 3TZHA 3B1KA 4WCFB 2HCTA 3R3SA 3IUPA 3RROA 2RBEA 3KYDA 2HMVA 3C1OA 1UZMA 3TPCA 3JYOA 4A26A 1PL8A 2AHRA 3E9MA 1WMBA 4R54A 4QFDA 1YS4A 4NK4A 4FFNA 2O23A 4A73A 3JQBC 4L75A 1HLDA 1Z82A 3TL2A 3SX2A 3TL3A 5J23A 1KERA 4JBIA 3OIDA 1DRUA 3AFNA 3UN1A 5MDHA 2QYTA 3HDHA 3JYQA 3QSGA 4W9NC 1XU9A 4XGIA 1U4SA 2P9EA 4NHEA 1Y5RA 3S8MA 1GEEA 2FPGA 3LF1A 2HSDA 1QR6A 4PG6A 4H7PA 4NH4A 1P1KA 2IXBA 4RO0A 3SEFA 3I3OA 2Y93A 5CAEA 3LSYA 4A5OA 4PG8A 1EDZA 3HB4X 3FTPA 3ST7A 5K9ZA 4CM6A 1TT5A 1ISIA 2C2YA 3PK0A 1Z75A 4ZVVA 3LC7O 1LQUA 3TFQA 3BHIA 2C7GA 2B4RO 2GASA 4QFCA 1W73A 2O4CA 5A4DA 1NX6A 1YDEA 4CQMD 2QW8A 4AJPA 1X7DA 4YPOA 2FZEA 4L4SA 2J3HA 3N7UA 3JD2A 4O59O 3UVEA 3ZCXA 2ZQYA 1P9LA 5FI5A 2YUTA 1ID1A 3I83A 3PQFA 1H93A 2BF7A 4UULA 3QRWA 4D41A 4AJ1A 1U7HA 4D43A 3DHYA 3HNPA 4J1SA 4EUEA 4TZTA 2BFAA 4GKVA 9LDTA 2VYVA 3MWEB 1BXZA 2VRCD 4HV4A 4PZDA 3VKUA 4ID9A 3GVHA 1A72A 3I4FA 4L76A 4JQCA 2C5EA 3BMCB 1XU7A 1T1RA 3DZBA 2A35A 4BO9A 4BQRA 3H5RA 3HE3A 3ZWXA 2AEMA 1I0ZA 2JD2A 3HDYA 4Q3AA 2EF1A 3EYWA 4EUFA 3WQQA 4MDHA 3INTA 4NBRA 2DM6A 4DA9A 3G3EA 1O95A 5KIAA 5IXSA 3KRTA 2NVUB 3E9QA 3LC1O 4NU6A 3R6DA 1FDWA 4EEZA 1S7CA 4HFRA 1EMDA 4OYRA 1QSGA 1E6UA 1WZEA 2O50A 3BMOA 4O63O 3JQGA 3BHMA 4E2ZA 3KVOA 2NQ8A 3GT0A 4E5NA 4ALKA 1SAYA 3FTNA 1I5RA 1GTMA 2J3JA 3RVDA 1H94A 4N5MA 5DBIA 4FOSA 1BXKA 4OL9A 1ISMA 3IJRA 4OAQA 4WE3A 1UP4A 3ZDFA 1D7OA 2YV3A 3MWDB 3BMNA 1R4NA 4PVCA 4YJGB 1XQ1A 2RHRA 4CM7A 3UF0A 4IPTA 3ROKA 3VZRA 4Z6KA 4OO3A 1T24A 2CDBA 1V3TA 1SO8A 3WOHA 3W6ZA 1SEPA 4CMCA 2VRBA 4ZGWA 4BMSA 4O0LA 1BXGB 2RHCA 3W4KA 1QG6A 3QY9A 5CEJA 1GQQA 5IN5A 1L1FA 1KEPA 4BNLA 3LZ6A 3NDRA 1MG0A 1GU7A 2NTVA 1FMCA 1PX0A 4FW8A 4MVJD 4RPJA 1DAOA 2AE2A 1HE2A 4BNFA 8ADHA 2FZWA 3WGQA 3AFMA 3PYLA 4C4OA 1BMDA 4EJMA 2VT3A 4QX6A 3WFJA 3ZV5A 1PL7A 4LRTB 4CQMA 1UP7A 4I5DA 3HN2A 5KJ1A 5MGBA 3KSDO 1NM5A 4FFLA 4IDDA 2VTEA 3MCVA 4IDCA 3ZWAA 4L73A 1UDAA 1P44A 4IJKA 1LRJA 1HTBA 1Z45A 3GC6A 1MLDA 2X9GA 5ILGA 4IQ8A 5IZCC 4DLBA 1EQ2A 1PWZA 3RCBA 4C7JA 1ZSVA 3BMQA 3EGOA 1HYGA 1YONA 2CF5A 3D3EA 5T8KC 1QLHA 1JKFA 3GZ4A 2D1YA 2G5CA 4J91A 4CM9D 3IOYA 4MVJM 3Q3CA 3NUGA 4UUOA 2YHIA 3QWHA 5JMPA 4YBZA 1C0KA 5EN4A 2D5CA 3O9ZA 2Q3EA 4DUPA 4Q3EA 2PZLA 1NR7A 4K9DA 3TQHA 4GAEA 4Q3NA 4XQ9A 5DBFA 3WSWA 4CR6A 1DJNA 3U09A 2BFMA 3IIEA 5F21A 2J3KA 4CQMB 1CERA 5AVOA 1U8XX 2CVZA 1U7TA 1XQ6A 3GEDA 1OC2A 1E3EA 2Q49A 1HE5A 4JJIA 5F1KA 3JD1A 4MVJH 5K6AA 1EVZA 1Q2XA 1SPXA 1IPEA 4BO4A 1JLLA 1PZGA 3LDHA 2FR1A 1QMGA 5ES3A 3OEWA 3V2GA 2RH8A 1HL3A 2O4UX 3K96A 2WD7A 3GAFA 1XA0A 3M1AA 4QSMA 1D8AA 3CINA 2UUOA 1BDMA 3PHLA 4XDYA 4OOEA 4W7IA 5DBGA 1CWUA 4DMMA 4JGBA 2A9FA 8LDHA 2VUUA 1Y1PA 1Y9AA 1N1GA 2BI7A 1R4NB 2V6FA 5KVVA 4YTEA 3G0OA 3FD8A 3GGOA 3GQVA 4J7UA 4J9VA 5C7IO 3AJRA 1X7HA 4M89A 4Y9DA 4YJFA 4RVGA 3VH4A 2QRKA 2F00A 3TNLA 5AQ1A 2C2XA 1Z74A 4CLEA 1J5PA 4XD2A 1TLTA 3Q9NA 5IZCA 2HAEA 2ZTVA 3U4IA 4W9NA 6ADHA 3D4NA 3DXFA 1LNQA 4BO8A 3ANLA 1NAIA 3CMCO 5COQA 1UXKA 1BSVA 3PHJA 3NGXA 4PZCA 3RC1A 3OJLA 1HYEA 2NVUA 4IQGA 5JCJD 3UFXA 1GD1O 4IS3A 3G1TA 3R0IA 1B8PA 2PZMA 4W7HA 1I2BA 3IDSA 4XYEA 2PZJA 4I5FA 1T1SA 2FSVA 1BTOA 3UHAA 4CLDA 1PQUA 1F06A 5EJ2A 2E48A 4MVJP 6LDHA 1U5AA 5JY1A 1VKNA 3C85A 2VHXA 1PQWA 2JHFA 3D0OA 4R69A 1RWBA 5CPFA 2UYYA 1PJTA 3TRIA 1WDLA 4KDEA 4E31A 3H3JA 3KTDA 3DMTA 1A5ZA 3AY3A 3ONEA 5U9CA 5KVQA 4NBVA 4WUVA 3PYXA 2X0RA 3AM5A 3ZHZA 3QV1A 1NP3A 1PS0A 3W4IA 3MOGA 1H2BA 1K2WA 1KC3A 1JVBA 3ADPA 2O48X 3PWSA 4UEKA 3WJAA 3LC2O 2WD7B 1E3SA 3ICCA 3ZNNA 5FF9A 4J3FA 2ZYDA 2HMTA 4JX8A 3ZH2A 4CM5A 1EEHA 2GERA 1CF2O 4LK3A 3RFXA 1YQGA 4J1NA 2VHZA 2QZZA 4YEDA 3D4PA 3ZHYA 2VRCA 3U4DA 4A2CA 1TEHA 2AEFA 1E1MA 1P0CA 1XKQA 4OGWA 1FDVA 1X14A 1HLPA 3RFTA 1YDWA 4UAGA 3TOXA 3LT4A 4XQCA 1PS9A 4BO2A 4B4OA 3JD3A 2J5RA 1K5HA 2AG5A 5TF4A 4J0EA 4DREA 2B4TO 4PLHA 4XYGA 2E82A 1MC5A 3AM4A 3KXDA 3V1UA 4MVJG 3QA9A 1PZFA 1VSVA 2OP1A 1CETA 1PJ3A 2JCXA 3UOGA 5TGDA 5KJ6A 3UW3A 3QWFA 3CUKA 3PJGA 4ND4A 1O6ZA 4BNXA 3MJCA 1X0VA 3PYMA 1Y9EA 4WLEA 2GGSA 2ZJ1A 3C7DB 4XIYA 4BO5A 1U2GA 2OHXA 2W2KA 1BDBA 4BNYA 2YHIB 1RYDA 4IGEA 5JO9A 9LDBA 5KCZA 4DPKA 4B7UA 1P45A 1KVSA 1XYGA 3JQ9C 4CJXA 2Q2WA 3GPIA 4CMHA 4JXKA 3ZN2A 3TZ6A 2I65A 3DFUA 3D1LA 3QLJA 1MV8A 3I4CA 1HEUA 4QECA 3KBOA 3I9KA 1ML3A 2P2SA 1LLCA 1R12A 3ADOA 5CFZA 5AXDA 3F47A 4DLAA 4CMGA 3EZLA 5JBIA 2G82A 2IDZA 1ZH8A 1D3AA 1ZUD1 3O03A 4JK3A 4BL5A 2J5KA 2JL1A 4PZEA 5I9NA 3WMXA 5IF3A 4WCFA 4D0RA 3B1JA 1H9BA 4JBGA 2OXIA 3AOGA 3WGTA 3P19A 4RORA 5DCUA 4ITUA 1W4ZA 4FS3A 2EG9A 3NGLA 2YFQA 5JSFA 3RUAA 4E4YA 5ER9A 1NQTA 3F1KA 4K26A 3H4VA 4WPGA 1AN9A 4HFNA 5F5LA 1MB4A 2IXAA 5G0WA 2ZCUA 4BVAA 2O3JA 3VPHA 2BELA 5B1YA 1UR5A 1T26A 4XQGA 3LLSA 4RVFA 5B37A 2BD0A 2Q45A 4D46A 1NFRA 3AU8A 3GY0A 3W4JA 4BNVA 3CPSA 3DQPA 4MP3A 2ZB4A 3DMYA 2DU8A 4IJVA 4MVJE 3ZWWA 1UZNA 1LXCA 4IXTA 4DMLA 5JDIA 2OL4A 4P8RA 2IZ1A 1GYRA 3AY7A 2EKPA 3ZWMA 1I2ZA 3BMNB 3KZVA 4PLWA 4M55A 1ZXLA 3EW7A 3H3FA 3GVCA 5G2OA 4CUZA 5CPBA 3ZWPA 4E5MA 5TNXA 1PSDA 3H8VA 2Y1GA 4U5QA 5HRUA 1N7HA 4X54A 3UCFA 5CG1A 2GRAA 3I9JA 2QYSA 5BNTA 2B35A 4YAKA 3GNQA 3BMOB 1QYVA 4U0KA 1EFKA 4HUJA 3AU9A 1C0PA 1PIWA 1I30A 2X0JA 2EV9A 5LC1A 4OM8A 5HM8A 2XF8A 1E6WA 1VJTA 3I9OA 4RLSA 2WTBA 1A71A 3JQAD 4L9RA 5KJEA 4BO1A 2B83A 2DUWA 5JLAA 3RUFA 3JD0A 1MFPA 2V65A 5TT0A 3PHHA 4I5GA 3WMWA 5KOIA 2X0NA 2GF2A 4JP3A 4YT5A 4KWHA 3AI3A 1LA2A 2CY0A 4EYEA 3GRPA 3GAZA 3JYLA 3IP3A 3T4XA 1L7EA 1E7WA 4G2NA 2VN8A 2PR2A 1KYQA 3QWAA 3UICA 1IE3A 1K0UA 3SJ7A 4ZQEA 4MVJA 4LMPA 2VCYA 1ISJA 2NQTA 2DTXA 1IL0A 5C7OO 2O3RA 4GX0A 4HADA 1PGJA 4FJ2A 4GKBA 5TSDA 4FGWA 1G6KA 4E2YA 3UH1A 5L40A 3WG9A 3CMMA 4TQGA 1E1NA 3H7AA 3SXPA 4OHUA 2EJWA 1E3WA 2A92A 2VHVA 1QXSA 1ZO8A 2XXBA 2GN9A 3ONFA 4UVIA 2VUSA 5JYDA 5ADHA 4HNGA 3BTOA 3MOIA 4ALIA 1GZ4A 3EVTA 3H9EO 3QHAA 4MJLA 3GGGA 2NM0A 2X4GA 3JQCA 3H65A 3INGA 2CDAA 1NNUA 2PA3A 3EZYA 1KBZA 1V3VA 1KIFA 4FQ8A 1PJ2A 5KVCA 4RQTA 4I9NA 2DKNA 4AJHA 1KVUA 1TT5B 3GA0A 3WYCA 3BTUA 4LSMA 3DWFA 3SVTA 4R9SA 1PJCA 5HTOA 2AQ8A 2HRBA 2NACA 4FCCA 3U3XA 1EDOA 1NPYA 2G1UA 1D4FA 2GCGA 3WGIA 1HKUA 4NI5A 3WQSB 4XYMA 4KZPA 5I8WA 1ZXBA 4PLPA 2JAHA 2W98A 3L4BC 2D59A 3RD5A 1NPDA 3HFSA 4W6ZA 1YB4A 4CV2A 2D5AA 1HE4A 4IY1A 5BSEA 2YDXA 2NTJA 2WE8A 2YHUA 4WASA 3AUAA 3D5QA 4QEDA 3GOHA 5A3VA 2DAPA 1RJWA 3HJAA 3FBTA 4YB8A 1EQUA 2EKQA 3DZFA 3WLFA 1LQTA 2TMDA 1YBAA 3KYDB 1PQPA 1JAXA 2P4HX 1E3IA 1X13A 4ZQGA 2RCYA 3D7LA 3RIHA 4BNUA 1YJ8A 4LISA 3W1VA 4KP7A 3JQFA 4HKTA 2JCVA 4YJHB 1HSZA 4R5HA 5BNIA 1DIRA 2BFPA 4WCDA 3JQDA 2EJVA 1Y8RA 2GR9A 1I33A 5JXWA 3E48A 1HWYA 3MEQA 1ZSYA 1C1XB 5F5NA 4WCFC 1HXHA 4J4BA 2ZB3A 4S3MA 3VH3A 2WMDA 2NU8A 2AQHA 3CSDA 4U0JA 5BNFA 1BRMA 4W99A 4BNKA 2NLOA 4F6CA 1E0DA 3UAGA 4AJOA 5L45A 1LDEA 5KKAA 3LK7A 4K28A 3PIDA 1NR1A 3D3WB 3V1TC 4AJJA 3VZPA 4Z0HO 3DZIA 1CYDA 3EAGA 4PN3A 1AXGA 5JNLA 1K6XA 5A02A 4CV1A 3ZWBA 5L4NA 4D42A 1W0CA 5HA5A 2VYNA 1A9YA 1N9GB 2A94A 1N9GA 1LI4A 4QO7A 4ALMA 3AOEC 2NADA 3GDGA 3L6OO 1GR0A 1YXMA 4OKNA 5TT1A 1LEHA 1WWKA 5G0TA 2UAGA 4E2XA 2GUGA 2DLDA 1U28A 2YFHA 1HE3A 1SB8A 3F1LA 4EDFA 3PQDA 2Q4EA 4N5NA 2PKRA 3EMKA 3E5RA 4BKPA 2D4AA 2ILTA 2X8LA 3HHPA 1HZJA 2RAFA 1DRVA 5B4VA 4Y67A 4CODB 1HZZA 4IZIA 2ZKLA 1DLJA 2ET6A 2LDXA 4CR7A 4YCAA 5JCJA 4AJLA 1U3VA 2EWMA 4BS9A 1M75A 1VI2A 1XG5A 3JQ7A 4OSPA 5LDGA 2LDBA 3NEPX 1N92A 4IINA 1R6DA 2GNAA 1SZJG 3BAZA 3KHUA 4DYVA 3JQ6A 2AMFA 4KUGA 4AJNA 3WTCA 4CM8A 3JQ9A 4JJGA 1Y6JA 2OZPA 1Q0QA 3AOEA 4DXHA 3U62A 2GLXA 5JYEA 3CIFA 4AVYA 4BB6A 4CPDA 1FDSA 1C1DA 5ILOA 5F3RA 2OOSA 5TS3A 3JQFC 3AWDA 3AM3A 5EERA 3N74A 2AA3A 4AJKA 1LTHR 1VSUA 1K3TA 1GZ3A 3DAPA 1NBOA 3DBRB 4FC6A 4NMHA 4EJ6A 5CDGA 4D0SA 3MJSA 3FHLA 3EC7A 4GLOA 3S2GA 1BW9B 4XGKA 4ZU3A 4CLRA 5I7SA 2CD9A 2A4KA 3JQAB 4R5MA 4CMIB 2JFHA 3SLKA 3BTVA 4GVLA 5BT9A 3FN4A 4ZRMA 3W8EA 4GQAA 3RC7A 2HK8A 3QVXA 3UCXA 1DIGA 3OECA 3K2EA 3QW2A 4MP6A 4QQRA 3KOUA 3RC2A 2JHGA 4P22A 4QXMA 2J8ZA 3O4RA 3TDKA 4J1TA 3E82A 4YRBA 3FI9A 2JKVA 1GYPA 1U3TA 1VC2A 3ZV4A 4AFNA 5A9TA 7ADHA 1E77A 3KUXA 4IM7A 3PRJA 2FN7A 1ZK3A 2QG4A 2C5AA 4JJFA 1YB5A 1F14A 3OQBA 4EJ0A 3M6IA 3SBOA 5JC8A 1T2EA 4LRSB 1B3BA 5EPOA 4QT0A 1NWHA 3MZ0A 3FNFA 5JPIA 2SCUA 1WAMA 4TSKA 1YVEI 4WNIA 3UCEA 1UDBA 2C7VA 4CM1A 4YRDA 4PG5A 2ZB7A 5DP1A 4TVBA 5FFFA 3ASVA 3ETEA 4JBHA 4UEOA 1ENPA 2C0CA 2Y05A 1B0AA 4AL4A 4CMIA 3I9LA 5HWSA 1MXFA 1GL3A 4CLRB 1BW9A 3ZU4A 1LLUA 1Y5MA 3GFGA 1R15A 3WFIA 4KUHA 1OOEA 1TA4A 4IIVA 3WLEA 1OMOA 3NT2A 2Q4BA 1BVUA 4RJTA 2JFGA 4TKMA 3AI2A 3NT4A 3RJ9A 4CM3A 1D1TA 3ONDA 4CUJA 4N5LA 3EY4A 1VKOA 1AHHA 2XOXA 4TKLA 3KSUA 3CE6A 2WYUA 2DVMA 1A4UA 4BNWA 1WPQA 2D3TA 3GN2A 2BHLA 2C59A 4MKRA 3ZU5A 3DTYA 3FWZA 1Q0LA 2TMGA 2CFCA 3EDMA 4IUYA 2I76A 3FF4A 4WOJA 1G0NA 4GGPA 3ZV6A 1U5CA 3HFGA 4WK6A 4BV8A 3DZJA 3I6QA 3WBFA 2P91A 1IOLA 3SC4A 2V6BA 1H6AA 1VM6A 4BO7A 4KQWA 3NDIA 5AXBA 1A27A 4YQYA 5A06A 4PLVA 1VJ0A 3ENNA 3WX0A 1K6IA 3H2ZA 4NFYA 1N1EA 1EBUA 1Q1NA 1F8GA 4WLOA 4Q3BA 1I36A 1L7DA 1HDCA 4B3IA 2AW5A 2CVOA 4J2OA 2HUNA 1UH5A 1AUPA 4BIIA 3D3WA 3PWZA 1SNYA 3ZHXA 4A0SA 2QQ5A 5JS6A 4RPGA 3U49A 4FFOA 1HDYA 3JSAA 2Y1CA 4NR0A 5A1TA 1GYQA 1R4MA 5AOVA 2YQ5A 3LU1A 2P68A 3KSZO 4L8VA 4P4LA 1GUYA 1VL6A 3K9QO 1BG6A 3NRCA 4G65A 1NFQA 3HZZA 4BNMA 3D64A 3W8FA 3T7CA 4D79A 4M49A 1AGNA 1CEQA 1Y8RB 3IUSA 3C1AA 4ZICA 3GHYA 4PLFA 5BR7A 4OMUA 1NXQA 4OXNA 3RUIA 1D1SA 2OGUA 2PH5A 2Y0CA 1RM3A 3ULKA 2D8AA 3VH1A 1NWCA 4MIYA 3ENKA 3UXYA 4UVEA 4LMRA 2P4QA 2UVDA 1NQAO 4E2WA 1H6BA 1PGPA 3Q11A 4WKGA 5I9MA 2JFFA 2DBVO 3QWIA 1R0KA 4QTZA 1ADCA 2E4AA 3UUWA 2CNBA 1KY4A 5GZ3A 3K92A 2QRLA 1B2LA 3GFBA 1B26A 2YYYA 4XDZA 3WGYA 2XXJA 3GN1A 1U1IA 1KEWA 4ZN6A 3E9NA 4AG3A 4XJTA 1ONNA 2EHDA 3P2OA 5ICSA 4YAGA 1NTOA 4GI2A 4ND1A 4N18A 3IC5A 2B69A 5H82A 5IDXA 3ASUA 5L4LA 3K5PA 4R9RA 2GYYA 3FR7A 4AJ2A 1CJCA 1E7YA 3HUDA 1IZ0A 4JP2A 4KTTE 1GZ6A 1P1RA 3DTTA 1XLTA 3JQ8A 3H6KA 1A9ZA 2CDCA 3WDSA 5G0VA 2PD6A 4RF3A 1PR9A 1WDMA 4GPD1 4ILKA 2GO1A 4DWVA 2FPIA 3VAZA 5JDCC 1IPFA 1EZ4A 3K2BA 1DPGA 2H5LA 3JYPA 4GLLA 4UUPA 5DF1A 4E5YA 4OKIA 4XB1A 4WEQA 3WTBA 5JAIA 4CMJA 1GV1A 1I3MA 1U4OA 1MP0A 1RYEA 2BRUA 4MKXA 5AXAA 2NU6A 4WLNA 2W4QA 3GEGA 1T2AA 1JA9A 5A3JA 3IKTA 1LC0A 5BSGA 2DFDA 3NAQA 4ALNA 4E32A 3RU9A 4JROA 5DDIP 1ENOA 3U4CA 4KMSA 2HJRA 2EGGA 4J16A 3JQEA 5A05A 1F0YA 3PJEA 1RM0A 1DC3A 1FDUA 3B70A 1BGVA 1NVTA 5G4KB 4I9HA 4EEXA 4WNCA 4B8ZA 4QUKA 2OBNA 4FD3A 3OFSA 2WJPA 3P7MA 3PGXA 4E0BA 2EXXA 3RI3A 1JQBA 4J7CA 1IUKA 4N7RA 2HK7A 3NYWA 4PLGA 1EFLA 4NDNE 3GZNA 3RASA 3ORFA 4L74A 4CQLA 4RL6A 3PXXA 2Y1OA 2GN6A 3GMDA 4JNKA 2GZ1A 3ROQA 4CV3A 3CKYA 5JDCA 4FB5A 1GUZA 1NYTA 3DAGA 1EK6A 3ZGYA 4E6PA 5IJZA 1DOHA 3ZW8A 4NJMA 4WOKA 2E37A 5DCWA 3OF2A 3DOJA 1CQJA 1Z7EA 2ZYGA 4DBZA 3BIOA 4BQPA 5DNAA 1O5IA 4F3YA 1ZCJA 4DPLA 4U6SA 4A03A 3MJVA 5IG2A 4YJFB 4B7XA 3TZCA 1MX3A 3GPDG 4IJUA 1NPTO 3EUWA 3WIEA 3COSA 2EGHA 3IL2A 2O7QA 3QVOA 3NDJA 5G4LA 3HADA 3S2IA 3ZU2A 3K6JA 2Q46A 4RVUA 3DHEA 5I7FA 1YB1A 4C7KA 4RDHA 2X0IA 4NJOA 5TX7A 1IULA 3M2TA 1E5QA 3H9GA 4CLOB 4W4TA 2O2SA 3ZNOA 1CDOA 5L7WA 3OM9A 4F6LA 2X5KO 4TRRA 3JV7A 3WGZA 5THKA 3OSUA 4A27A 4JIGA 1V35A 4PLZA 4LVUA 2OORA 5K6AC 2BMAA 1WW8A 2WD8A 1DO8A 3LT0A 2FOIA 3C7CB 5ITWA 2Z1MA 1K89A 1XGKA 2R00A 3M2PA 1GQYA 2VYND 3F4BA 4RV9A 4ZRNA 2PWZA 5FI3A 3CZRA 1M2WA 1PGOA 3TWOA 2IEDA 4XA8A 4BKOA 5JW6A 4R1SA 4DIOA 1HSOA 1LJ8A 2BLLA 4E12A 2NU7A 4BGUA 3PI7A 1UAGA 2ZJ0A 5AYVA 4TRJA 5BQFA 1QORA 1B8VA 2B0JA 4NU5A 4Q3CA 1SOWA 4J43A 4BOYA 4IZHA 3DOOA 3E18A 1F12A 4GMFA 1V3UA 2JJYA 4R4JA 3PP8A 3F4LA 3FCOA 3BTSA 3BMQB 4DPMA 1NAHA 3GEMA 1ZKMA 2WSBA 4H15A 1ZSNA 4IDAA 3DBHB 2W2KB 1N5DA 3GG9A 4EZBA 4PLTA 4AICA 4Z9YA 2PNFA 2C07A 5EQDA 4BO3A 5EINA 1ISGA 1E3LA 2Z95A 1DEHA 4EUHA 4DC1A 1ZFNA 3L6DA 3VPFA 3FWNA 4R68A 1C0LA 3A28A 3SLGA 1RM4A 2Y68A 1I10A 4J4TA 1NHWA 4D45A 3V5NA 2WYVA 1SC6A 1EBFA 3G1UA 1PJBA 2W8ZA 5EIOA 3DMTC 1XSEA 3PPIA 2CF6A 2Z5LA 1GUFA 1LDYA 4DL9A 1BXGA 2J3IA 1C14A 1E7RA 1Y81A 1YOVA 4LW8A 3NX4A 3OQ1A 3Q6IA 2DQ4A 3OIGA 4NBTA 5HS6A 3KYCB 3OEYA 3L4SO 4LVCA 3BHJA 1S6YA 4O5OA 1MFZA 1MUUA 1AE1A 4LSWA 1FJHA 3GK3A 2DUUA 2ZTLA 1A7AA 4INAA 1FK8A 2ZQZA 3IQDB 3LT1A 4RCVA 3VVBA 3VVCA 4JCOA 2OMEA 2PD3A 2DBRA 4XX0A 3NKLA 1MG5A 3D5TA 2BGKA 4PFJA 2VWGA 1LRKA 3DR3A 1CQIA 3RC9A 5ITVA 4MINA 4DIFA 1J0XO 3VPSA 4Z0PA 1LSUA 4MVJI 4Z3DA 3O8QA 2F1KA 5A5FA 2BKAA 1B16A 4NQZA 1Y7TA 5T5QA 3ABIA 1ZBQA 1W6UA 2GZ3A 2X7HA 4NK5A 3CH6A 3JQGB 1EUCA 3TF5A 2VQ3A 2ZTUA 4B4WA 3AI1A 4MPDA 1EVIA 3K30A 4BGVA 5JFOA 3QVWA 5GMOA 1BVRA 1DDOA 5A5EA 1DRWA 1P3DA 2PY6A 1LX6A 3FR8A 4GX1A 4MP8A 3RFVA 3B20A 5IN4A 4W82A 1LSJA 2X1HA 1T4BA 3PVZA 1NASA 1QKIA 4R1TA 1T4DA 4CMKA 1SEVA 3WSVA 3NT5A 1H6CA 4FDAA 4Y8VA 1XHLA 4M54A 1QP8A 3HQ4O 4L0QA 2AEJA 1YBMA 5CP8A 5DT9A 1PJSA 3PQEA 4XGNA 1PU2A 1NQ5A 2CVQA 3O8QB 4XKJA 3PDUA 4YQZA 3QIVA 3BMCA 4RQUA 4BHTA 3DDNA 1ISHA 3VDRA 4DQXA 3DZGA 4J1QA 5L7YA 1JKJA 4YT8A 2ZK7A 2QX7A 4XWYA 2X23A 1T2CA 4RVDA 1NQOA 2QRJA 1QV7A 3H9UA 5CEEA 4J6FA 3GVIA 1JWAB 2FR8A 1HETA 4GSKA 1I3KA 3DBLA 1YOVB 2I6TA 3O38A 4P38A 2VHWA 2PFGA 2EW2A 1P33A 3UGKA 3X2EA 1ARZA 1Z73A 4XCVA 3FPLA 5IDQA 5KJCA 1P0FA 2ZIZA 1LU9A 3INRA 4YDRA 1NVMB 4NIMA 5IAAA 2O3TA 4DC0A 1PGQA 3K73O 4UVHA 3WB9A 1U3WA 1SMKA 4CMEC 3CEAA 1QRRA 1LDBA 5ENVA 1DFHA 4PIVA 1E7SA 3RBVA 1PJLA 1XEAA 5IDWA 2DBQA 4WGGA 2NNLD 2IZZA 3GMSA 3ZNPA 4WECA 1E3JA 4I08A 3H5AA 1XELA 2OBYA 5T64A 2GN8A 1V8BA 5C3MA 2Q1UA 2R00C 3TJRA 1LLDA 1MXHA 4L4XA 3OA0A 2I5PO 3FNGA 1V9LA 2EKLA 1B8UA 3EVNA 2X22A 5FYDA 2POQX 5HBRA 3DC2A 5GZ1A 1UDCA 4ESOA 4FFRA 3C3XA 4E5PA 4J49A 2FY8A 4BNZA 1GY8A 3L4BA 4YJDA 3WXBA 4DYDA 4EGFA 1ZVMA 3WS7A 2VHYA 3LYLA 1B15A 4RF4A 4ZHSA 1SB9A 4G81A 1WNTA 5COAA 4ND2A 2FWMX 5IXYA 2W2LD 3X2FA
chains in the Genus database with same CATH superfamily
1OSNA 4HWTA 1YJQA 2H4JA 1AUQA 5IAKA 4MULA 4URHA 1QRSA 1A8SA 4MS3A 5F1OA 1CR4A 2ZBRA 4KI0A 1H65A 2NXWA 2NZYA 1MQSA 3VNQA 4F2HA 4F91B 1EUYA 4N3GA 2OECA 3ZUPA 4BB5A 2PUBA 1YIDA 2FCRA 1R0WA 2LIPA 3ZW9A 1JAYA 4B45A 4BY9E 3E22A 4MV3A 2WIBA 1LDGA 4KYUA 5JQGF 3CURA 3W04A 5C35A 4GM1A 4DZRA 1B6TA 2E18A 4TTAA 1TU3A 1UDRA 3WGJA 5BR4A 3DEYX 4AY3A 4EEKA 4XGQA 1H9CA 1J22A 1ZUNA 2YWCA 1RABA 4G5RA 4UBNA 1HQCA 4Y98A 4PX2A 4CQNA 3T3OA 4MRMB 4RY0A 5H83A 2Q5IA 4J90A 4OH1A 3ZWOA 1AUXA 1U7WA 2YW9A 4M1WA 4CLXA 4BAZA 2XRMA 2IYOA 4IDGA 4PONA 3KJNA 2B0CA 5WRFA 2D2XA 3K0AA 5BSUA 2E49A 4Y6PA 4DLXA 2G0TA 2IHUA 1RYMA 2OR3A 3P0JA 1RM5A 1X0XA 2A9KA 4HTAA 4ZT7A 4EYSA 4QPDA 3GIDA 1J49A 1KJIA 1AS2A 5A3QA 5J1SB 3ORRA 4RV4A 4BMPB 1HDOA 1E9AA 3VTAA 3N6RA 2SKEA 3G5UA 4YFYA 1UOQA 3DO5A 1DC4A 3W1EA 4U63A 4JDPA 1JTEA 1VMEA 3PA8A 5K0SA 3B7WA 5LYJA 1BHQ1 3AF4A 4NJEB 2AN1A 4YJGA 1YRHA 4KO2S 3VYSB 4CMBA 5KDOA 4RPLA 3SWWA 2Y0DA 5CHEA 5DOZA 1Q7CA 1ETUA 3RE1A 5LYJF 1JMKC 1N7IA 2RBKA 3AEUA 4M46A 4QLBA 3L01A 1AQIA 1TCAA 1KAQA 4N5DA 5JZSA 3QKSB 1RQGA 4GQIA 4LS3A 3VNRA 1HZZC 2HLHA 3AUFA 2JBHA 4BNJA 1IDOA 4UUMA 3V1YA 4KODA 3VDQA 3ONNA 1LBQA 4OJNA 2C7QA 4QHSA 3FWKA 3GJ7A 3DE2X 4J2HA 4O4IB 4A7PA 1I8TA 4MJ7A 2RHTA 4E33A 4B4UA 1P1FA 5JBNA 5LOVB 3UK0A 4O2BA 3IR5A 3V4FA 3K8ZA 3OT4A 3T3PB 1F9EA 2XIQA 1DKPA 2CMKA 3USES 4H6XA 4NMWA 1XXHA 4JITA 3V80A 2OAGA 4KN9S 4RD0A 1NZFA 3V3TA 4B1FA 3G9QA 4DM7A 2XR1A 3Q85A 3TTYA 3ODGA 4CQLB 4HYEA 4L07A 5AXCA 3H4IA 1NFFA 3M4JA 2WJ4A 4MCAA 1H0HA 3CZAA 1FQOA 1U0LA 2YS7A 3E27A 4XB2A 3RSOA 4NCNA 2Q50A 2QJTA 1TTQB 3ZDXB 1PGNA 5KX5A 2B5VA 4UHHA 4MCJA 1OWPA 4FCVA 121PA 3T7EA 5KTNA 3UV7A 3GNSA 4PVDA 1E59A 1XZIA 1XPUA 3K6KA 2H5JA 3OQIB 4FMDF 2GHQA 4YT2A 4B2IA 2JFBA 4UMVA 4UTNA 2GPWA 1J6UA 4IJMA 4Q9IA 2OHFA 3A9SA 3OU7A 1YBHA 3WLIA 2DFKB 4LDQA 4PC2A 4L4YA 1WMAA 2A1TR 3TTWA 3A2KA 5HOEA 2R11A 1JYFA 3U48A 4RD2A 4NCBA 4R16A 4KRFA 5IM5A 2XAAA 2QXUA 3EF1A 2X6TA 5I3ZA 4DMHA 4DFDA 3G17A 2ZSEA 1TVKA 3TFOA 2HSZA 3HDJA 4LC0A 3RRFA 1IM8A 1DB3A 1M0WA 4QQFA 4OOFA 3ZLBA 4BKQA 5TPZD 1TVMA 5EIBC 4C89A 3C14C 2BH2A 2CZCA 4MUMA 5EMKA 4XW2A 2HXGA 1DQPA 1HFWA 2VF4X 3STTA 4QO8A 4FWIB 1H42A 3EYAA 3HCBA 3ME5A 4G24A 4I9GA 2AN4A 2BEUA 3FWPA 1Z38A 1ZU5A 3VHRA 2OBXA 1LSOA 3AR8A 1C0EA 2Q1WA 3D6FA 1VL0A 1P0IA 1TJYA 1R6TA 1E1LA 1FFDA 4RV5A 4BVGA 4RY8A 2XJ9A 2Q29A 1N8KA 1ZHFA 2C7BA 2P6NA 4JN6B 3E9CA 1KEUA 3VTZA 4EX6A 3WV4A 3I1FA 5F4BA 4L22A 5ICMA 3SQMA 1ONOA 5KAPA 5K0BA 2FPGB 2JVKA 2GKSA 3LPNA 2C54A 3DBHA 4CDMA 3DKRA 3KWJA 5DI3B 3REGA 1U9ZA 2EDCA 2F3RA 1UBUS 3OESA 2BGGA 3NTXA 3OQMA 2Y1KA 1L8XA 4XQEA 3BYZA 3H05A 1W5FA 3TXAA 4ZREA 1QS0B 4L5YA 5IUKC 1BN6A 2XZTA 4EF5A 1K6JA 2NXNA 3ICVA 4QODA 2PVSA 5AKKA 4GU5A 1LY1A 1TJPB 2QN8A 1FB5A 3PLRA 4E30A 5LQCA 4N8SA 5C46F 5E3IA 3BA6A 4MKFA 5GM1A 1RJ9B 2HV9A 2P75A 4H7IA 5ALQA 5C80A 5L3VA 3Q0TA 2BHTA 5JNUA 1GKLA 3IBSA 4G9BA 3AGQA 4JKIA 4FUTA 4UUNA 3S29A 1N2GA 1W7AA 2VLBA 3DCJA 3GH1A 3BFKA 1WSAA 3R20A 2JJ8A 5DLDA 4DQ0A 4ZO9A 1DCKA 1THMA 4KNYA 4K46A 2IDJA 2ZYUX 1T1EA 3TRKA 2JAPA 5IUNC 1XTRA 3VH2A 1N6HA 4K9KA 2EJUA 4U7DA 3AHIA 4PR3A 2PGNA 1FJ2A 3CVJA 3MQFA 4MUNA 1SVWA 4AC9A 1G38A 2J9FA 4UNPA 2P0EA 2QQFA 2G8NA 3EFHA 4M86A 4KPUB 4P92A 3QKIA 2Z4SA 4PLCA 1PZXA 3OA2A 4QBIA 4XWAA 3JZMA 5D6OA 5T6BA 4OX9Y 1AH2A 4MW5A 1G1AA 3H1BA 2HF2A 2VUTA 3E35A 3HB1A 3N2ZB 5FI0B 2Z1NA 5K01A 4DR6B 2I4TA 1U4NA 3LZCA 4QBHA 5T4HA 4YMWA 2YXBA 4HGOA 2BFDB 4PY2A 3KCQA 4YUAA 4IQ0A 4NFLA 4F11A 4D6PA 1H2HA 3DE4X 2IOFK 3OICA 4KIUA 1BXRB 1IJBA 5K0EA 2D5BA 3IVGA 2AS0A 4N0MA 2BE9A 3IKLA 3KEQA 4MVJF 3SNHA 4A0RA 2P41A 1LBTA 4Q47A 1QZXA 2BGUA 1MZVA 4RW0A 2IVFA 4B74A 2FLKA 3OD5A 4EYOA 2P67A 1AKQA 4GR9A 1NBMD 2ZWMA 3OZXA 2WPNA 1U7UA 2PLAA 1VLZA 3FRJA 4KZKA 2VI5A 5F78A 2Q4OA 4WJZA 3TQOA 3WK5A 5L4SA 5B3JA 1BWSA 5P21A 3WGMA 1HX7A 4IF4A 3NHLA 3I1YA 1T2FA 2FN3A 3H5NA 3S1LA 3K71B 1CUCA 5JATA 3I34X 4Z99A 1XKLA 4MLDA 5IJ0A 3MBIA 2JFXA 3NANA 3LRTA 2C78A 4NJMB 3W5IA 2Z83A 1Y5NA 3PXEA 5CYPA 3TZQA 3WDMA 1B43A 1PZEA 1JFFA 2B9VA 2IHYA 3WWOA 2EEPA 1CVIA 4TVSA 5LL6P 4FJ1A 1DEXA 4HP8A 4LJSA 1HDZA 1W581 2HZBA 2IKQA 3LLUA 4RKEA 1DIOB 5AJXA 4FVTA 5EQFA 3A4VA 1IOWA 1PR5A 5NULA 5LWQA 3EQZA 3Q7IA 2WR8A 3NBUA 2WTUA 5A71A 5ELXA 1NMEA 2BHSA 1FUYB 1ZL2A 2YYZA 1PT9A 1XDUA 5KOHA 1WBDA 1GPH1 1E79A 4WFIA 3THXA 1VJRA 1JBEA 1Q1QA 4I14A 4JJAA 5BR1A 3OIUA 2P9GA 4QTUB 2P5UA 4N3CA 2G7MC 3WA7A 4IXNA 4HR7A 2FVXA 2JBAA 3LNTA 5FV7A 4EECA 4EI7A 3BMXA 3ANSA 3EZNA 1YQQA 3QMMA 4UPDA 5AJUA 3FNBA 1D2RA 3M81A 4PAOA 2JCYA 3ZY4A 3NZEA 1U1GA 2BTOA 2WV9A 4MS1B 4ZJUA 5TGZA 4LCJA 5KJFA 3BG5A 1DEAA 1GFWA 4RQAA 1NVAA 4YECA 1JALA 5AW7A 4ZEVA 4I4TB 1KRHA 3WVNA 2R0QC 2PJUA 3I2KA 2F1OA 3I01A 3SJBA 2VDVE 4RL4A 4UD6A 4A6EA 4U3JA 4BMNA 4D99A 5HGXA 1L5ZA 1E6EA 2X4IA 3IALA 4BX0A 2UDPA 3GGSA 4DQVA 2GJAA 4R1UA 3CJRA 4TPKA 4XSVA 1UXHA 3HI4A 4MJXA 4Y0AA 3WYBA 2RH5A 1V5FA 5FWDA 1IN5A 1T10A 2RJNA 2PWAA 2OCPA 5FR2A 3KJXA 3RJ5A 3ROPA 4G2TA 2X7JA 3AUTA 4QXAA 3TOZA 3TTSA 2SCUB 1KS9A 1E2KA 1NXSA 2I6QA 2ZRQA 4TVOA 2HA4A 2CXSA 4PV7A 1UAYA 5CVCA 5GGXA 1JV2B 1QANA 4CUKA 1LV7A 4D6YA 3C87A 3OCXA 2ONCA 3TUIC 2HJSA 2FFJA 1WHSB 2YJ3A 4PHCA 4B7CA 4AY2A 3I0ZA 3OOEA 1E5LA 1XZGA 2FWAA 4QAJA 4RA6A 5EE1A 4D44A 3M33A 4RYLA 1E5TA 1YHNA 5A4IS 5KNCH 3MFQA 2PMCA 1PNVA 3MHPA 4OMDA 4E2FA 3DMGA 4KRXA 3L07A 4BNNA 4GVXA 4EGJA 1DAKA 2JFYA 3KV3O 2BSAA 3UAOA 4XD7D 2Z8YA 5LJIA 3U6BA 3AK4A 1RXIA 4ILEA 4N9WA 4MV6A 4WZAE 3L7BA 3VR3A 4GSLA 4MQLA 4QUIA 2XDYA 3HYRA 4KRGA 1Q1AA 4KX5A 1E99A 3O0TA 5FOVA 2HK9A 1NU6A 1OWMA 1N6NA 1E66A 4HSGA 4V1CI 2NP6A 1OZ0A 1TF7A 2AMYA 2XMGA 4I8XA 4BNTA 2AOWA 2VPPA 1G2PA 4UOEA 4JA0A 4L8FA 3TOSA 2XADA 1Z5PA 1LNZA 4US2R 5LP6A 5E6RB 1G8PA 3L0ZA 2NAPA 3DF9A 4ZCTA 3JQAA 3NI2A 4KR6A 5I7AA 1RQPA 3M1LA 1OAAA 1ORIA 4MEAA 2FDXA 2UUCB 4S12A 1JLHA 1KJWA 1LC3A 1TD1A 4PANA 3U0BA 4M1EA 5BWCA 3COJA 2PIAA 3IVRA 1XDWA 2H07A 3O2NA 4LHEA 4D9CA 4DYHA 3BJMA 3JAKB 1C7FA 4ZEOA 2Z6VA 4XM2A 2NYUA 1BJTA 1JKIA 3FPHA 4A4DA 3AO0B 5FA5A 5SYAA 4XLTA 4FPXA 3I9V1 3P8ZA 3ORHA 4DLTA 2QSYA 4MHTA 1XYYA 3HP7A 1DHRA 1SR8A 3UUEA 4CM8B 1DFGA 1H5QA 1ZH2A 1GXSB 3HEMA 3RUPA 1PWYE 4N49A 3FKSA 2FG7C 4RKYA 1NSFA 1YZNA 3ANYB 4BCCA 5FP0A 1TXGA 3OWXA 3RBXA 4LXYA 5JPCA 2PV7A 3L6EA 5DM70 1X2EA 1FPQA 4CW7A 5JS2A 3I32A 2AZXA 1MRZA 1KI6B 2VPTA 4Z5XA 1RTKA 2NUAA 1ICEA 3BH6A 2C2MA 2X5OA 3FSJX 5TQ0B 3RGGA 1YE3A 2AJ8A 3CLUC 4BFZA 5G0UA 1XKXA 2F48A 3L8YA 4EI2A 4BGIA 4G1FA 4MOWA 1GGNA 1VLLA 3OKCA 2QN6A 3V2IA 4BEJA 4YCLA 2D0IA 4H1TA 3ZI0A 4E1BA 2WWRA 2VP3A 3PDJA 1E9SA 5AHRA 5JCXA 1Q0PA 1GA1A 2OHVA 5K05A 2VF8A 1M8FA 2NPOA 4HEJA 4F9FA 5KB3A 1YMUA 3RJMA 4I4TF 2H92A 3CWCA 3CLRD 3NBAA 3OUUA 3N58A 3GPBA 3IP9A 1ECJA 1RPNA 3O3CA 3P94A 4FS8A 2FN8A 4PCVA 2PUHA 3K9HA 3G13A 3WL6A 2AG1A 3C7KA 2DF8A 2G4LA 4MKGA 1CQPA 5TLSA 4DS3A 1JJIA 2IP4A 5KSPA 4DARA 1SU4A 3D6TB 1N2IA 1AVTA 4JSYA 3BBLA 2CE7A 1R16A 2C8LA 3B3QA 2PS0A 4DCSA 5FUWA 2GMWA 4X6XA 1D07A 4BYMA 1S3SA 2PGXA 1R8SA 4PPQA 1XRMA 2HMUA 4HB4A 3G7UA 5CGZA 3WR5A 5T57A 4P34A 1YRLA 2I33A 5JCOA 1HYHA 1RP1A 3RTCA 3G59A 3RTBA 1LBHA 2IGTA 3W6NA 2P6OA 2R8ZA 1R0SA 1RSZA 3PICA 1N2OA 4X6LA 3OCUA 4ARIA 1TQ2A 4BBJA 4D8TA 1C1XA 2VP6A 2B5WA 3G9XA 4KJZA 2QTTA 5T6MA 4FXOA 1H0KA 1XXHE 2Y66A 1POWA 2I71A 2OBLA 4QPCA 5HDQA 3FAKA 3HACA 2EW1A 4BKRA 2J48A 3HR4A 3KBBA 1OC4A 3M3PA 2DWUA 3MT0A 4KAFA 4X91A 4LF7B 3A6LA 1FP4A 1EVQA 4GX2A 4RLHA 1U11A 1ZRMA 3ZHBA 2A5GA 2RBGA 2ZR0A 3D8HA 4HWSA 3RBZA 4HBZA 1ZUHA 4WBXC 3QVTA 2AOVA 1QV9A 2IGBA 2WNIA 1JECA 1X15A 2ZB8A 4XDHA 1PSZA 3RRBA 3ZVRA 5B4TA 2PD4A 4BDSA 1S01A 3ABRB 2J0QA 3P97A 4NMLA 4PG4A 1RWVA 2V96A 1HNWB 1XEXA 4YRJA 4QC2A 2A2ZA 3DDZX 2CK3A 2FPOA 3GYGA 3R4CA 1T8WA 1KEEB 4WOPA 5GY7A 4LMAA 3KEMA 4IRMA 1NOJA 4DR1B 1Z2EA 4AM8A 3W5BA 2ORVA 5DK4A 3RG8A 2JVIA 4F71A 2IT1A 4ITVA 1OPRA 2GEVA 3PLAE 4KV7A 1W34A 5LA6F 2GBPA 2YZKA 3FHOA 4OK6A 3Q2IA 4DEXA 5FBHA 4B6FA 3QHQA 4JEMA 1FXSA 1L6IA 2JNWA 4F4CA 3A3NA 3DAYA 3OJWA 1OCEA 2JASA 3HGTA 4HPWA 1YRBA 5ALMA 4AJEA 1Y6RA 4B4VA 3TD9A 2QVGA 5JJ5A 3RUDA 4A1FA 2C20A 4WLVA 5TGTA 2F3TA 2VDUE 1YZKA 5EGNA 1IC6A 3A0UA 3KEOA 3MTGA 3AR2A 2F9LA 3DVAA 3PTLA 2KJQA 4ROSA 4C5BA 2PZKA 3E7FA 4HLQB 2Y99A 1PT6A 3OJOA 1CY0A 3DOCA 2FSUA 3CZ5A 3IMFA 4IMPA 3GNTA 3P9YA 3GQBA 5T67A 5LZ7A 1S2IA 1CR1A 2ZS9A 4GMKA 1NJ8A 3SQDA 1RRPA 2HQSA 2XBUA 3CUUA 3IAM6 5F2OA 2KBFA 4I1SA 1A8QA 1OLXB 2G9QA 5EL0A 1GSHA 3SC2A 1OX6A 3Q2KA 1SXJB 3MTEA 4LTDA 4NAVA 4AKGA 1XT6A 1J21A 3I6IA 5FWYB 1UEXC 3JRWA 3KT0A 4O4HB 1W36D 3F49S 2XUDA 4EY4A 3EA5A 3JYNA 4DLVA 4IVRA 2X2FA 4M9XA 4GMGA 4OQPA 3TG2A 3BQNB 4R3NA 5BUCA 1CB0A 2YIDA 3H1AA 3VGJA 3EZFA 2IYQA 3OT5A 5F64A 4D9FA 3DW1X 5AIBA 3GO4A 1MF7A 1YCFA 1TF5A 2A88A 1F2UB 3BGVA 1XMVA 3DDHA 3K72B 4DIMA 4D3FA 1SXJD 1VIYA 2HQ1A 1N1MA 2D1QA 1O6GA 3AEKA 4M8SA 1NYRA 1W8DA 5AVVA 4JFRA 4URFA 1IN6A 3LF2A 4D5GA 5JROA 4NCIA 4GDFA 2I4RA 4PN7A 4BLRA 2QMHA 2C4HA 4QKQA 2IY9A 4CKWB 2VF7A 5LIPA 3PE3A 7GPBA 4W63A 3EGXA 3VNAA 3F8WA 5CM2Z 1ZMRA 3ZU3A 1O9BA 2D1SA 3CRNA 4EPTA 3IBGA 1ZZEA 2ZI4A 3NU1A 2I7XA 1RQRA 2IFTA 2I9KA 3BERA 4GWGA 4GPZA 4I1YA 4P4GA 4MI3A 5IAEA 3LFUA 3B6ZA 3EGDA 4C0QC 2OT3B 3LVQE 2JJMA 1Z5VA 5KC8A 1BE6A 1ZGJA 4QHYA 3TSAA 1G291 2I4LA 1B7GO 2WVGA 3GUYA 2EYUA 1WR8A 4BMVA 1WG8A 4AQ7A 4WLFA 4Q9NA 2KM1A 4ZPXA 2A78A 4YLGA 2Z04A 1I6LA 4GE0A 5G1OA 1UT5A 3TM4A 4UBJA 2DKFA 3DF7A 1B74A 1U9JA 2QS9A 1EFPB 2PZBA 2AG8A 3QKRA 2QI9C 1VGQA 2ZR8A 3E0QA 1W96A 4LMBA 3X0DA 2DPGA 4CEIB 3GV0A 4B3GA 2WHQA 1P18A 1GTG1 2V55B 3E8XA 3EN0A 4EHKA 1U65A 3PHGA 1URPA 4CN8A 4D81A 3WGVA 3A4IA 1F9AA 3KEFA 1IYZA 4LRXA 3SLRA 5BUZA 3VJKA 1RI1A 3R76A 3GUCA 4A16A 3C3BA 3OY2A 1U0SY 2QAGA 4DMRA 3B36A 2H65A 1P2FA 3REQB 3MYRA 3RVSA 1F60A 2BZSA 3GLUA 3ESQA 2D3WA 2WWIA 3FMGA 3HSKA 2JAQA 4Q00A 1HDXA 2J46A 4HDNA 4RWEA 2VWHA 3L77A 1AD2A 4YDQA 1R9NA 2E2WA 2Z2YA 1LPNA 3GLHB 4B8YA 1F8FA 1NQXA 2WIGA 1LDNA 1IHXA 1LQ2A 1XUOA 2GYVA 2PT7A 1NYQA 4HJRA 1L8OA 1RADA 4D3SA 2HHHB 1GTSA 1UBGA 3L0BA 2BGLA 2XWBF 3FCCA 2LWIA 2JF0A 4Y1GA 1XPRA 3K32A 1NP7A 4D1YA 2B2XA 4WXEA 3A6FA 1YVUA 4MK4A 2P2ZA 4EHAA 4F45A 2UUBB 5JS1A 3AVOA 3FCEA 4C6TB 4LV6A 2ETVA 2QP9X 3R74A 1EESA 4KWIA 1OX4A 2WSIA 2XQKA 1Z0SA 2EVWX 3B1YA 1UBCA 2HHCA 2P1DA 4YRIA 4AUEA 1A4RA 1Z7BA 2Z30A 4KVFA 3VU0A 1CX9B 1JDZA 2AGVA 4LF9B 5IDYA 2LUOA 4BGEA 1B4DA 4KOAA 2PRKA 4E11A 2O5EA 2WTEA 1NN5A 3RQSA 1M7BA 1OBFO 2OZKA 3K2QA 4AY6A 2DUNA 2Q6KA 4OJMX 3SR3A 1DADA 1Z0JA 1TMKA 2MINA 4M3NA 2PKQP 1ZK2A 3BRQA 5EJMA 3KQMA 1JILA 3RHZA 4RK4A 1WD5A 4FYXA 4RZIA 2CBGA 3LHKA 2FPPB 3B1KA 4KBYA 2Y4NA 4JBWA 4I1RA 2E4WA 1TZMA 1U2PA 2MSCB 2XBLA 2P6PA 4Z1MA 4EHNA 4KR7A 4YRCA 1E4EB 4CIXA 2RBEA 4ZHQF 3IMKA 2WM8A 5K0LA 3UOAB 1YFZA 3TPCA 5FA6A 3EISA 4CFYA 1P7PA 1PO7A 4IIJA 1CS4C 4E6EA 2WWXA 4OHMA 4RGYA 1QRTA 1QGYA 2AKAB 3USZA 3LX6A 3QPUA 2ZSIA 3T5GA 2LPMA 1OA1A 2H1OA 3UGQA 1JR6A 1CG6A 2FX3A 3FLMA 2MYUA 4A73A 3UC5A 3WISA 3WSVA 3GCGA 4V0LA 2WJ6A 1HLDA 5LA6A 4QM6A 1YDMA 16PKA 3SX2A 2JI6A 1ANKA 4EAAA 3OIDA 4OBEA 1M3SA 1SU7A 3AFNA 3FWHA 3PT9A 4N0QA 3TQSA 2E0IA 4XGIA 1XU9A 5CDFE 1YBFA 2DWQA 4IUBS 3W90A 4NHEA 1Y5RA 3QJGA 4YCSA 2VJQA 4CKBA 3PNQA 4PSDA 2WB2A 3O4JA 2F2TA 3FVVA 2ZIXA 1USWA 1TQ4A 2M1XA 3EDRA 3FCAA 4JL5A 1BA3A 4RHFA 1RWPA 2ZYIA 1KI3A 2QM3A 4RO0A 4Y18A 1WCXA 5EG5A 4C2BA 1KORA 4Q12A 5CAEA 5KYKA 4DIDA 4R2WA 3LSYA 4A5OA 2VJLA 1ULZA 4E1AA 3HB4X 1O03A 5K9ZA 1QM5A 1IEXA 1TT5A 1I13A 2V54A 1ISIA 2C4NA 2C2YA 1OXUA 1VLHA 1QX3A 1CR2A 2FVYA 1JF8A 1LB1B 2Y6VA 3J7TA 1Z75A 4JOCA 3LC7O 3TFQA 5EZYF 1LZKA 3BHIA 2B4RO 2GCIA 3S1AB 5AESA 2I91A 1JHAA 2GB4A 2YJTD 1KR5A 1YDEA 4IWXA 5A4DA 3W6PA 3PFIA 1JYEA 2WABA 2Q4TA 3I09A 3IT0A 1WXQA 4QU0A 2P8SA 4RZ3A 4F4FA 3KXIA 1X7DA 4QD3A 3IUBA 1PLKA 2FZEA 4X65B 3SQNA 1VCOA 1T0BA 3FA2A 4C05A 3N7UA 4MWOA 3ZZ0A 1P81A 3I6MA 4PO3X 4LY3A 1ID1A 1QH1B 3ZXUB 3QRWA 3D3NA 3ZVMA 1QPBA 3ZIAD 3FE2A 4ND8B 5F2NA 3OUTA 1N36B 3MTBA 5C1BA 4DYVA 3EODA 3CR7A 1TECE 3IAEA 3U1VA 3NWJA 3PI6A 4G9EA 1QG0A 4M6WA 1JG7A 4Q9KA 4XLZA 1OH5A 2ZYVX 4BO9A 3HE3A 3ZWXA 4PXSA 2AIRA 3WLRA 3UT0A 2N46A 1LTQA 2Z8YM 3RG2A 5SYNA 4OQEA 1ORWA 3PBKA 1M0SA 3EYWA 2BV3A 3H87A 2ORYA 2I3BA 3PHCA 4P53A 4Q3AA 3KTAA 4MPPA 1GKYA 1R6UA 2DZDA 3T5CA 4DA9A 3M5CA 2CL6X 3L7OA 2ZU6A 1BS9A 1X1BA 1VA5A 4FW9A 4G09A 2ZWIA 1G8HA 1U02A 3KRTA 3Q40A 1XWWA 2QDXA 1QIKA 5AM1A 4MAFA 1FP7A 2C9ZA 2YXNA 4HAYA 5EQTA 3TUZC 3ZBPA 1U0NA 1V11A 3FUTA 2O50A 1T3GA 4EB6A 3JU3A 1XD9A 3BJRA 5KYXA 3U7FB 2R5FA 3EAQA 4EG4A 2B8EA 1E1CA 1NRJB 5L3QB 3F8TA 1DXQA 1QBKC 3R6LA 2BFEA 2J3JA 1MAAA 5DW3A 2KX7A 1BXKA 1ZICA 2XNSA 1MOSA 3LP6A 4IYJA 4J2TA 4OAQA 4TTTS 3ZDFA 4KQEA 4CF3A 1D7OA 1QF7A 2YV3A 4KWEA 5DKFA 4MYTA 2Q8PA 3IBTA 1F2TB 1TOAA 1ZN7A 2Q6OA 2NU9B 3OEHA 3F7OA 5FH9A 1O57A 3UF0A 3OD1A 1GRNA 4IPTA 4J3NA 1SZPA 3ROKA 1DPFA 1RKUA 1L9XA 2I2FA 1UC8A 5CH8A 3ELUA 4LK2A 1QHYA 2VBGA 1J09A 2H57A 1HV8A 3EZ9A 4H3HB 4H1VA 4TL8A 1EM6A 1UMCA 2VRBA 4HTFB 4LQDA 4P7KA 3NVAA 3PDCA 2KLHA 2F1IA 2A58A 4KQIA 4KDRA 4LCBA 4O4LF 2FZKA 3BXEA 2RHCA 5GP1A 4DLUA 9MHTA 4RMGA 1XQYA 1QG6A 2VP2A 5CEJA 1GQQA 4LXXA 5IN5A 1I3OA 1L1FA 4Z86A 1DAFA 3ABZA 5IBRA 3RK1A 2C4MA 4ZEWA 4BNGA 1FMCA 4V39A 2BC9A 4MR7B 4LGCA 1YQUA 4G4GA 1HE2A 4RY9A 2L2QA 3L8HA 2GPSA 4YRLA 3S5UA 4BZWA 1YHYA 1CE8A 1TYZA 2O8EA 1TUEA 1E9BA 3DL7A 4C0HA 4AMUA 5LQJA 1AUVA 2J33A 4PF1A 2V5AA 3SOZA 3JR7A 2O8DA 4LRTB 4U2EA 3QVKA 5MGBA 2ODQA 1LX7A 5EYPA 3C6YA 1KWKA 3MCVA 3R6WA 4U7JA 3HP4A 5BQPA 1K63A 5TR9A 3O8CA 2ZJOA 1R4AA 3SS8A 4IJKA 2O8FA 1R5BA 5IJ9A 1NURA 3WLKX 2XB8A 1D4OA 2W2MA 3GC6A 1YMQA 2QR5A 2X9GA 4XWGA 2D74A 3BXZA 4EMUA 5IZCC 3D54D 4B2PA 1L7BA 3G02A 4DLBA 3VKGA 2ZS7A 2HA3A 2K87A 3NAZA 3PUKA 2W48A 1MKYA 4JX9A 5DT2A 1H2FA 4E08A 3BMQA 3IJ5A 3IPYA 2GBFA 3UMFA 5B58C 4PYMA 1YONA 3TEJA 5D00A 4BP9A 5JAHA 1Z9BA 3A3OA 4LWPA 5T8KC 1UM8A 5KYGA 4RENA 3AEXA 5LQNA 1BCSA 4DJAA 3VDNB 3A3PA 1IBMB 2XRYA 1O96A 4J91A 1GTZA 1YZYA 1OWOA 4MVJM 2J9ZB 2OV8A 5GQSA 3Q3CA 5H9VA 1SKUA 3NUGA 3E4DA 2YHIA 5E1MA 5BSRA 2VZEA 1XTJA 4YBZA 1C0KA 3EEOA 2D5CA 2O5RA 4DHEA 2OHIA 4XJVA 2B78A 2IPMA 3A6KA 5EFZA 1BIFA 1USGA 3O9ZA 4WERA 4OP3A 1T0UA 4WN3A 4C87A 4FGLA 4ZJPA 1YFLA 3DNMA 3A4YA 1NR7A 3AG5A 1SBNE 5FUYA 3B9QA 5DBFA 5TB5A 4N82A 5EKDA 1FX0A 2W2QA 3D6VA 3SZRA 3ER9A 1KHTA 1VHJA 2JH9A 2IYAA 2D0PB 3IIEA 1Z35A 5F21A 1MJNA 4B6OA 2O8DB 3EXAA 1RKQA 5CB4F 3SJCA 3T15A 3WGUA 2MR6A 4FGJA 4JASB 4KN8A 1SBTA 3RS4A 2B6HA 2ETXA 1OC2A 4IO0A 3QOYA 5AQEA 5FOXA 4DUYB 3UMGA 3C48A 5F1KA 5TS2A 4MR7A 1JR4A 2CB9A 3JD1A 4C21A 5K45A 4BMOB 1EVZA 1QRUA 1Q2XA 1M34B 1SPXA 1VE1A 2QQEA 3I2YX 4LPKA 1M5TA 4BO4A 5I7HA 2G77B 1T2UA 1QGOA 1SUIA 3LDHA 1TGYA 1V7ZA 3V2GA 2OK8A 1EM8B 2O4UX 2NNWB 5K1ZA 1X74A 1X9HA 1B00A 5EFOA 3ZJ5A 3GLRA 3MINA 1KDYA 2VSXA 3T1OA 4D8XA 5MN4A 4LPSA 1BDMA 1FX1A 2DFNA 1SN7A 3LG2A 4KFSA 4P3YA 4P98A 4PBRA 4QGBA 2FSIA 4M60A 4TWJA 4JMPA 4W7IA 4DMMA 2LBPA 5K20A 4TL7A 2JLXA 5EA2A 1RXCA 5L3SB 2OHHA 2VUUA 3WAGA 3R5SA 4RBNA 1UXOA 3TQRA 1N1GA 1L7VC 2QWXA 4OXQA 1RYBA 2EZ4A 2V6FA 4MYSA 5KVVA 4YTEA 4QU5A 3D4LA 4YPVA 3ONWA 3GGOA 2IU3A 5HGJA 2H06A 1WIWA 2QTLA 5JALA 2JBWA 1E1RD 4PC1A 3SBDA 2BFEB 4RZXA 1Z4PX 6PFKA 1F0KA 2ATIA 2Y2UA 3VH4A 5BSKA 3K5HA 3TNLA 4V0SA 5MN5A 3UJ3X 3GLSA 4EY8A 1Z74A 4CLEA 4LF5B 1A3CA 5EVJA 1ODLA 3QU9A 1QOPB 3H42B 5IZCA 3U4IA 1ZLYA 3D4NA 3DXFA 3E9DA 3ANLA 4BO8A 1W36B 5ERYA 2O14A 3H6GA 4CG0A 5C8YF 4NZNA 4MA4A 3OPQA 2Y1XA 4ZVQA 4D4MA 5JADA 3KDSE 4RZUA 2DWOA 1X8KA 3OZCA 1A9QA 1OUMA 3IPRA 4TT3A 5AM0A 4AMBA 4EUNA 4HK4A 1C4XA 4MW9A 2QE7D 2PZJA 2WFZA 3OZSA 4N47A 4YIHA 2FSVA 1GG8A 2C99A 2PSSA 3E53A 3D02A 3KTAB 3LHDA 4C6HA 3FWYA 1PQUA 1NXOA 3GOQA 1YS1X 3QU7A 2HREA 3IAAA 3VXKA 1OYOA 4X1IB 1RWBA 3RS9A 3G2KA 4BRZA 4OLAA 3RIXA 4HG2A 4OQ4A 5CXXA 1WDLA 4GNRA 3LL7A 3N0RA 3IEPA 1I1NA 4DZTA 3W3AD 4XX0B 3T7DA 4HWPA 5DPMA 1ZD9A 2JLZA 1GLGA 3PYXA 2EX0A 3AM5A 2NO6A 4KXFB 1B6SA 2RGBA 3W4IA 3R0JA 5HQTA 4L72A 4PTZA 1JB9A 1GARA 1X94A 3M9XA 1I7NA 2BHRA 4L16A 4BB0A 2H2HA 4FYJA 3U7QA 4NE2A 5FF9A 2ADFA 4CM5A 4UNRA 4Y2RA 4YRMA 1FQJA 2NO7A 4LK3A 2XE7A 1YQGA 3P20A 2YASA 3DE3X 4EJFA 3KSBC 4YEDA 3D4PA 3M8KA 5ESXA 2QE6A 3ZHYA 4A2CA 1P0CA 1JR2A 1IVYA 1B8OA 5IKOA 3TE7A 3IH5A 3RIYA 3G9TA 4MWBA 2WSLA 2Z2IA 1T0HB 2ZSBA 3DR5A 4ON9A 5FRDA 4B40A 2VPIA 3F90A 1C9KA 5IWAB 4XUEA 1A7UA 4YROA 3AW8A 3TCXB 2FMFA 2RGAA 5D3QA 3JD3A 3KE9A 3AF3A 2J5RA 2G1JA 4HAUA 1G6Q1 3WKDA 4DVGA 4S05A 4FKBA 5KO2A 4TYWA 1IXSB 4PLHA 5CAEB 2ZVDA 3AM4A 2QPLA 3QA9A 1VSVA 3HDVA 4II7A 2XGSA 5ALVA 3WWDA 1PQYA 2VT7A 4NULA 3IR6A 5BYBA 4C6SA 1CZHA 3QWFA 2EX1A 1IRIA 1ZGAA 3OWHA 2B2CA 1N0WA 2P4SA 4AECA 2QN2A 3PYMA 3RFFA 1XP8A 1Y9EA 4D4KA 2I4IA 3C7DB 5JD6A 2GK3A 3D9QX 1U2GA 3ITEA 2W2KA 3K20A 4GICA 1L4YA 4Q7JB 3JS5A 4CKBB 1RVV1 4KMMA 3TSWA 3T5PA 5JO9A 3AL0C 9LDBA 3CE9A 3QPWA 1CJUC 5EP2A 1P45A 1QIGA 1KVSA 3PFKA 2Q2WA 1DT5A 3GPIA 2XGJA 5K5EA 3NM4A 2EZUA 4LJLA 3DFUA 4Y6LA 5TPWB 4ND6A 3TZ6A 3W34A 1JLKA 2ID9A 3O2QB 3QLJA 4GC9A 4H4EA 1L5WA 1RKVA 2FEAA 5EMLA 4CQJA 4WNYA 2FJUA 1GPUA 3I9KA 3BD6A 4H7JA 5LZ9A 1NNLA 4IIJB 4V3BA 1F4VA 3E3OA 2BKVA 4FE7A 3EZLA 5JBIA 2G82A 3P2EA 3WOVA 5DTEA 1SU6A 2VDOB 1ZH8A 2R8BA 4JLBA 4JEUA 3CNLA 4U7PB 1E4EA 2C5SA 2JL1A 4BL5A 1P5RA 4TWZA 3RVJA 4D0RA 3B1JA 3PVSA 2OXEA 5LNK1 3MCWA 1BHJA 4DT1A 1OI3A 2P3QA 1KPHA 2H0QA 3GJ4A 4BJ6A 1FJGB 4ITUA 3CV3A 1W4ZA 1KR2A 3OMXA 2JVJA 3NGLA 4MRNA 4I66A 5JSFA 3BKWA 3N59A 4TM7A 4BMDA 4DA0A 1IQPA 1DBWA 1RAAA 3F1KA 3TBKA 1TCCA 1KFBB 3K7EA 4WPGA 1VDZA 3CGWA 3PR3A 1MB4A 2IXAA 4QG7A 2VDQB 1TK9A 3IHLA 3VI4B 3PPYA 1NTRA 2BELA 3C6ZA 4X5OA 1S8FA 4AWXA 1PEYA 1T26A 4CIDA 3LCUA 4RVFA 4B82A 2BD0A 2Q45A 4D46A 3AU8A 2PL1A 3W4JA 3ZI7A 1GNTA 3LPLA 4URYR 2ZUFA 1UWVA 1A76A 4URZR 5C53B 1I6KA 4YMLA 4WI1A 3T95A 1EHYA 2DU8A 1KAGA 4FCWA 4V0OA 1BAPA 2ZZKA 4R8KA 4E46A 3ZWWA 3H5IA 5EJFA 3QVGA 2H8GA 5FJJA 1KK2A 1LXCA 1GPNA 5CT4A 3TSOA 1J56A 3VX3A 4KO8A 4D9KA 4DMLA 5JDIA 1AXRA 1UT6A 1WETA 1U0OC 1GNPA 2IZ1A 3W9UA 3ZWMA 1I2ZA 2ZSAA 4JL6A 2B8WA 1K5DA 3STXA 3MWDA 4HDNB 4PLWA 2DPYA 3GPLA 4NZMA 5DYYA 5LN1A 4R0NA 4MKIA 2QXYA 1YI8A 3DOUA 4FN5A 3REQA 3ZTWA 3ZWPA 5TNXA 3TRFA 4D9HA 4ZHQB 3ICOA 3A9VA 2Y1GA 4U5QA 5ECWA 1N7HA 4YH1A 1Z08A 2IYTA 2QT0A 4J0IA 4LDRA 1RHRA 3QI7A 3CH5A 4NH0A 4RE6A 2DMRA 3PRYA 1CQJB 3FDFA 1ZJWA 3CF2A 2B35A 4IJ6A 3GNQA 1TF2A 3BMOB 5BOSB 1QYVA 3MUNA 1EFKA 2ERXA 1RI5A 2O8NA 3OE4A 2QSZA 4H7DA 5B6PA 1I30A 5DNVA 2QTAA 1WZCA 2FW7A 2OVFA 2QZPA 1VJTA 2GD0A 2EFJA 2WTBA 1U9IC 3ZKAA 1NBME 3ESXA 1NSYA 1EVLA 2BMDA 1C8VB 4BO1A 2E1RA 2MWMA 3L93A 3L7JA 4YPFA 3JD0A 1MFPA 2V65A 4KWCA 3PHHA 4I5GA 5TT0A 5JNTA 4XASA 2P90A 4LOJA 4BCBA 1QIJA 3DDWA 5LB2A 2G1AA 4EYEA 1IG3A 2FP3A 3JYLA 2XZOA 4L5IA 1IBKB 3B13B 3IP3A 5CNKA 2P6RA 2OKCA 3EGDB 4NYJQ 1IWPB 3AZPA 3BD8A 2J3QA 3CLSC 4Y1EA 3ZCQA 3L1IA 1BROA 4M0EA 3ZGZA 2FEOA 2OCLA 1K4KA 2JI9A 4MVJA 3ZYZA 1CEXA 5HXAA 3PPXA 2Q3BA 3UAZA 4GEKA 1IL0A 4CHTA 5C7OO 2A9OA 4HADA 3QNWA 4X7MA 1BYIA 4PU0A 4TWAA 5CIYA 2IH5A 1G6KA 3MLEA 4X3PA 3AEKB 4JGGA 2LVBA 5E2IA 1GAQA 4B6SA 3WG9A 5MF6A 3CMMA 4TQGA 3V7UA 1KO1A 3M9WA 4OHUA 2EJWA 1KMCA 3NIBA 3SXPA 3ZU6A 1OILA 3H1GA 5JJLA 5C4MA 3ND9A 4RCZA 1DMRA 2I03A 2VHVA 3C1UA 2Y9PB 3DE6X 4PZPA 4R9VA 4U2CA 3RF7A 2REXB 3K0EA 4WZAA 5IMSA 4QDZA 5FFMA 1KPIA 5C37A 2PMBA 5KQGA 3O9MA 2J4FA 4E5SA 4BRWA 2RAUA 4C3VA 2AH5A 3MOIA 3HV0A 2WLSA 3H9EO 4O4HA 3RV4A 2B94A 2GZHA 1T9DA 2JGLA 3SYTA 1CULC 3PNVA 4O29A 1SXJA 1LJUA 4FQ7A 1XJCA 1JIQA 1VMKA 1OLXA 1KIFA 2IP1A 1PJ2A 2H29A 1M1ZA 4I9NA 3WLMA 3BTUA