1LT1A

Sliding helix induced change of coordination geometry in a model di-mn(ii) protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQGIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L13G-DF1
publication title Sliding helix and change of coordination geometry in a model di-MnII protein
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1lt1A00
1Y47A 2LXCB 2QVAA 5CBNA 2B87B 1LP1A 2QRXA 2KS1B 1ZXGA 4GOFA 3FXDA 1EC5A 1S3JA 5K5GB 2JWDA 2LXBA 2M0BA 4GOEA 1NVOA 1OVUA 1H0TA 3ZDMA 2KI7B 1JMBA 2K3RA 2KZJA 1OVRA 4KJMA 2SPZA 4HB1A 3S1KA 4CPGA 1OVVA 3MZWB 1H0TB 3RGUA 1EDJA 1DEEG 2I8DA 1EDLA 4NPDA 4ZMDA 1BDDA 2P58A 4ASVA 1FC2C 4HJGH 3MHVA 1BDCA 3FXEA 2M5AA 1LT1A 2OTKE 5C39A 4MN4C 2HR3A 2ZAEB 1MFTA 4NPEA 5EFWB 1EDIA 4IOIH 1Q2NA 1ZW0A 3PH0A 2M5AB 4HKZH 4ZNCA 4GODA 4K3AA 1X0TA 5CBOA 1JM0A 2B88A 2KUBA 1EDKA 1U7JA 2KIKA 2UWJE 5DJUB 2Q1KA 1U7MA 2LR2A 3QWOC 4WWIA 4ASWA 4NPFX 1SS1A 2B89A 2B87A 4EYYQ 4K35A 1LP1B 2KZIA 4JBZA 4BXLA 2RKLA 2WMMA 5DJTB 2R44A
chains in the Genus database with same CATH superfamily
2AXCA 1L0NJ 3IF4A 2B87B 2QRXA 4XA4A 3FWNA 1SQBK 1NTMG 4L75A 1S3JA 1EZVG 3A0HE 2WWWA 4PV1C 1FJPA 3MIWA 1EZVI 1NTMK 1SQQJ 3P8CD 3C8VA 2GUVA 2I1KA 1NGMB 2Z4EA 1OFCX 4I7ZB 2FFDB 2O1KA 4JF7A 2KYVA 3A5TA 1LTSC 3GLMA 2WPQA 3B5ND 5CCHD 3CCRP 1QX8A 1URQC 2H88C 4W7YA 2E74D 2P67A 3MHVA 2QEXP 1JEKA 2ZVNB 3OW2O 1GK4A 1M1JB 3L4FA 2K1AA 2YO3A 1S4XA 2KNCA 2M5AB 3G9RA 2MJZA 2H8PD 1JM0A 1M1JA 2J58A 2KUBA 2WQYC 1RQVA 3D6YA 2FY8A 3Q5PA 4W80A 4NPFX 3AE9C 3V6IA 2B89A 1QGKB 2QIWA 5B5EE 1N2DC 1PGPA 2RMZA 1JY2O 3AEAC 2IZ1A 3A0BE 1ZRTD 3H1KD 5CCHC 1GL2B 2N9BA 2W90A 2O01J 2M3EA 1KZUB 3LIDA 1BCCG 4L74A 1AQ5A 4JPZB 2BEZF 3BASA 3HUSC 1KMIZ 4L73A 4GOEA 1NVOA 3CXHH 3G6EP 4TT3H 3I56P 3SFEC 1BGYJ 2GA1A 3JCUE 3H1IG 4OWFA 3HE5B 1H0TB 2ZYDA 1LTTC 4WBAA 4GIFA 1BSHA 1KTMA 3CI9A 5KAFH 3FXEA 3L74D 4WY4B 4I1LA 2ZJSE 1SQQK 3M0DC 1DD3A 2C9NY 2ZAEB 2IZ0A 1UIXA 5H2FE 5KJ7D 4WY4A 3PH0A 4HKZH 3PP5A 1AVYA 1NU1E 4AYCA 4PD4D 2BASA 3HD7D 1FDMA 2HPCA 1KB9E 3L70D 3V5BA 1SFCA 1SQXJ 1K05A 1KFNA 3FGAD 1T3JA 1CW5A 1T2KD 3TF5A 3H1JD 4PJ0H 1M8OB 3VMZA 1VF5C 5AW4B 4TLFA 1Q82Q 1EXIA 2JDIH 1LT9A 5AW3B 1LWUA 1HH0A 3EQ2A 1HJBA 1N73C 5KJ7C 5AVTB 1IFNA 4YXDC 1KQSO 3AE8C 1RY3A 5KLIB 1SQVE 3L35A 3HD7C 4CPGA 1OVVA 4YPCA 1JTHA 2FYNC 2N1TB 3AE1C 5AVVB 5AVYB 1IK7A 2KK7A 4PD4H 3GF7A 1KN7A 2PRRA 2KOGA 3AEGC 2N1TA 4HJGH 1GZLA 3V4QA 1T2KC 1NTME 1BGYG 1EZVE 3PRJA 3B71A 1E5WA 3CC2P 2FYUD 2D2CD 3L72E 2QM7A 4AUWA 3RL0B 3K5BA 4H44B 1P84H 2KLUA 1SQPE 1OZHA 1FDOA 4UB8H 3BCCE 3CCUP 3L74G 2R5BA 3GG2A 2VRSA 5DJTB 3CC7P 2Y9ZA 1CZQA 1M56D 3M91A 3L71J 5CCGA 3V2PA 1PPJD 1JCDA 1IC2A 3R4YA 3TGUD 5AW5B 1M57D 1NU1J 4PD4I 2IBZD 1VL2A 3L70G 4N3YB 1SQXG 2PGDA 2ZT9B 1OVUA 1YBKA 3CX5I 4I6MC 3ZDMA 2ITAA 2D2CC 4D6TJ 3SWYA 1SQXK 3KZIE 2K3RA 2QJPC 1L4AB 1OVRA 4GDOA 4GKGA 3RK2B 3RK3B 1JOCA 1HGZA 2AXTH 4JYBA 1VPCA 3W68A 3EFFK 2I8DA 3UIAA 1L4AA 1YITP 5BU5A 2JEEA 3MUDC 1X9VA 1LTJA 4ASVA 3D70A 1MKMA 1BDCA 3GHGC 2HYNA 3SWFA 1KQLA 1MZ9A 1S9KE 1BCCE 1T6AA 3AE6C 1JUNA 4IOIH 2C0WA 1Z56A 1YJNP 1SQVJ 3CCSP 1RE4C 1U7MA 2OYHB 2H89C 3L75D 3H1IE 2R3CA 1NAFA 2K88A 3H32A 5E79H 3GW6A 3PHLA 3RL0D 2QA4P 3P8CE 3L72J 3M0AA 4H44D 3V2NA 4Y99C 3NFQA 2WT7B 2JKVA 1SQPJ 3G3ZA 4LLHA 1PP9J 2WSEJ 1VQ9P 2WPRA 2Q3EA 3BCCJ 1RF1B 2GM4A 2WT7A 1NTKD 3OJAB 4N78D 1NAYA 3L71G 2WSSH 1NWQA 4KJMA 1OX3A 1RF1A 3BVHA 1NU1G 3SWKA 2HFED 2P58A 5KKZB 5KLVD 2K9YA 3F5HA 1BSNA 1NU1K 1USEA 2ZT9D 5M1BA 4ZKPA 4D6TG 2G3AA 1QL2A 3RL0C 5B66H 5CCHA 1GW3A 1LNQA 1N7SB 1H89A 5AW1B 1ZP0C 1GD2E 4DCKA 5DJUB 2Q1KA 1N7SA 3S4RA 1LTAC 4Y28J 1YHQP 1ZV8A 3H1KE 3C9IA 4BRYB 1PZQA 2A06D 2NZ2A 1PV3A 4R4MA 5APYA 1ZXGA 1BCCJ 4GOFA 4QMAA 2E5TA 1SQVG 3H1LJ 1FZCB 2FXPA 4UB6E 3CCVP 1M90Q 2ZT9C 1TU3F 5AW2B 1IFIA 1BGYE 1SQVK 2NPSD 1FZCA 1Q86Q 2ZVOB 3I5CA 3VP8A 1KYOI 3H1IJ 2IDBA 4DOJA 2YMYA 3AE3C 2KZJA 4OGQC 5AW6B 2N9YB 3MZWB 3L72G 1L2PA 2KSEA 3L74E 1VQ7P 3H1HD 5AVXB 5GTHE 1L0ND 4EIJA 3AE2C 1DH3A 2PAJA 1SQPG 1FC2C 2QJKB 1PP9G 2J59M 2K9JB 1YTZI 1RF0A 3BCCG 2IYOA 3MP7B 1L0LD 1Y9BA 4KT0J 1SQPK 4NPEA 3CC4P 1SQQD 1RH5B 2K9JA 5AW9B 2YO2A 3CX5E 5AVSB 3T97A 1W2BO 3L70E 1N7LA 1QVGO 1SQXE 1S5LE 2OYHC 1QEXA 2NPSC 4YXWH 2KNCB 3CXHD 2WTYA 1GK6A 2JO1A 2CPBA 1BE3D 1MV8A 1J1DC 4K35A 2JP3A 2KS1A 1NTZD 4EOTA 2RKLA 4IFMA 3B4SA 2A45H 3VMXA 3WU2H 1JY3N 3RL0g 1IK9A 2R32A 1FZGA 1HWTC 3WUUA 1H8AA 2L5GB 2O3JA 3PLNA 3L73D 4HH2A 1ZN5A 3H1KJ 2I1JA 3B5NC 2IYPA 5AVUB 2E74C 3H1LG 2QJYC 1W2EA 2Q3IA 3RGUA 1USDA 5KTBA 5KKZC 2FBWC 1EDLA 3U59A 3Q5RA 3HE4A 2RN0A 2FYUE 3FWLA 3TNUA 3PJSK 2OYIA 2E42A 5TISH 1DX7A 3VTPC 3CCJP 3M9HA 2A45I 4WB4A 1EXJA 2Y0DA 1PGJA 1EDKA 2UWJE 2W6JH 1X8YA 3L74J 4WWIA 3L71E 1LP1B 1SLQA 2WMMA 5BVZA 1EQ7A 1PPJE 2HPCB 1LTBC 1SFCB 3RBXA 5CBNA 1LP1A 3E7KA 2IFNA 3CWBD 4U3FD 3JSVC 2BCCD 3BRTB 2JWAA 1NKZB 2ZXEB 3L70J 1AFOA 3RBZA 4D6TE 2POHA 4LGDE 2M0BA 1VQ5P 3AECC 2P7JA 1VDFA 2O01H 3IN6A 3CXHI 5KAIH 1OW7A 3H1JJ 1LT9B 1JMBA 1LWUB 1P84D 3IR9A 1E79H 2Z5IA 3QH9A 1HBWA 4I7ZC 1JTHB 2FFDC 2ZYAA 4WVZA 1LT1A 2MKVA 3H1KG 3HRNA 4W7ZA 3A0HH 1AA0A 1GL2D 3G4SP 3R2PA 4RO0A 1CSBA 1RHZB 1KYOE 3L75E 4GODA 1YJ9P 1HJ0A 1MFZA 3NTNA 2KIKA 1PL5A 1M1JC 3A7OA 2KLVA 1DIPA 1HF9A 1LJ2A 1RE3C 4JBZA 5GTIE 1VQNP 1YJWP 2FYUJ 1K9MQ 3Q3DA 2WITA 2LXCB 3GF3A 4U7JA 1PP9E 1JY2N 3VP9A 3PTZA 1MUUA 3NXSA 4H13B 5APTA 3CCEP 1OW6A 4WY4D 2W6BA 3CL3D 1KILE 2L91A 1GL2C 3VOPA 1K04A 1OWAA 4RKUJ 4IL6E 1PFIA 1FZFA 1FE6A 1SFCD 2SPZA 1VQMP 1AJYA 1IFMA 5AW0B 2FXMA 2BCCG 1DEEG 5B5EH 3KYQA 4ZMDA 4JQ0D 3LIEA 3A0BH 3USSA 1Q81Q 1FDIA 1FZBA 3W67A 1J1EB 1KILA 3H1JG 3U1CA 1YIJP 3AE5C 1NYHA 1LTJB 2HR3A 3TYYA 3H6PA 2PP6A 2YIUB 4K3AA 2B88A 4WY4C 1P84I 3N4XA 2A06E 2Y0CA 2WZ7A 1G1JA 3I55P 3D71A 2JJLA 3AEEC 3JCUH 4EYYQ 2W27A 4PV1B 1SFCC 3H1LE 2XNXA 3ABVC 1Y47A 2N1TD 1IFDA 1KORA 3Q5SA 2M8RA 3L75J 4C46A 2RH0A 5K5GB 3H32B 5H2FH 2XNDH 3EFGA 2WSFH 5CHXA 2YKOA 2Y0EA 2FYUG 1IFPA 3C1LA 5TJHA 3H1HE 1KQFB 4O9BA 1SQBD 1GW4A 3S1KA 1SP4A 2FYUK 3LW5J 1KB9H 1URQA 3CPWO 3CMEP 1WT6A 3KXDA 1CI6B 1NTMD 1L0LE 4H13D 1EZVD 5KLIC 5CCGD 2LKMA 1NTKJ 1M1KQ 5AVWB 2N1TC 1CI6A 2AEJA 4MN4C 1MFTA 3II6A 1PPJG 2BEQD 4GT1A 3TGUG 2OTLP 4ZKUA 2HG5D 1NOHA 3CXHE 1ZMEC 2IX7C 3U1AA 1GTWA 1X0TA 1BE3E 2IBZG 5KLVJ 1D7MA 2M3BA 1NTZE 2E43A 2C0XA 1FU1A 3O6QB 3AEFC 1VQ8P 2IBZI 1SS1A 4M3LA 1GDTA 1OMIA 1L4AD 1FAVA 3B5NA 3HUSB 3O6QA 4H44C 3RK2D 3RK3D 1GMJA 5KAFE 3TDKA 2KP8A 1H88A 3L73E 4N6JA 4H13C 3HUSA 2V7QH 1ZRTE 3CCQP 2WPSA 3EWKA 3G71P 1HGVA 3AEDC 1OIPA 2WSCH 2KI7B 2ZYGA 3P7KA 2OGUA 2WSEH 2O01N 3AE4C 1VQPP 4AQRD 3A3YB 3L75G 5APXA 4PJ0E 2AEFA 2QE7H 1NHLA 1J1EC 1L4AC 1IZNB 3M0DA 2KB7P 3RK2C 1LTJC 3RK3C 5C39A 3O8ZA 2H43A 3CCMP 4EI2A 3H1HJ 2HODA 1AVOA 4ZNCA 3H1ID 2YKQA 1JY3P 3VMYA 5APSA 1JMMA 1U7JA 2LR2A 3QWOC 1T8ZA 1FS0E 3KZIH 2Q7CA 3T97B 1NTKG 1L0LJ 2B87A 2OTJP 3KPEA 4PD4E 4KHXA 1VF5B 1W5CE 3VMAA 2KXPB 3CWBE 3V2QA 4U3FE 2BCCE 2R44A 2QVAA 4BWNA 1NTKK 4C7RA 1N73B 2KS1B 3BATA 3FXDA 1EC5A 5KLVG 4RESB 3WUTA 1N73A 3H1JE 1BE3J 2JWDA 2YMKA 4LC1A 3HD7B 5KJ7A 2FYNB 2V4HA 1NTZJ 2FFDA 1JO5A 5KLVK 1FJKA 1P84E 2W83C 3E1IA 3HD7A 4UB8E 1N7SD 4IL6X 3AEBC 2H7HA 2YXRB 1S1CX 1RF1C 5L8RJ 3L73J 1ZLLA 2A06G 2G8YA 4H0LB 2FXOA 4DJGA 2XKMA 2M5AA 1RE3A 4EDFA 1R5LA 1YQ3C 1EDIA 3HE4B 1Q2NA 2J5UA 2K37A 3E1RA 2R3SA 3KHUA 3TNUB 2AEMA 3L37A 2OYIB 2XU6A 2DW3A 4R4LA 4ASWA 2AXTE 2A45G 1SVFA 1GL2A 1N7SC 1RQUA 1K8AQ 5AW7B 2FYZA 2XZRA 5APWA 3H1HG 1BGYD 1L0NG 2HLOA 2D2CB 2QJPB 4RJTA 2P1JA 1VQLP 1L0NK 4XFJA 2LXBA 1L0LG 2CK3H 3HE5A 3TGUE 1LTIC 1SQQG 1GU5A 1VF5D 2W6AA 1H0TA 1FZCC 2E5YA 1L0LK 2IBZE 5AVRB 3CWBJ 4U3FJ 2BCCJ 4HB1A 3GHGB 3MUDA 3MD0A 1IFJA 4IFDK 1BE3G 4DT0A 3MGNA 1BDDA 2Q9IA 3GHGA 5E79E 1NTZG 2R5DA 4JYCA 3CX5D 1SQXD 1RF0C 1NTZK 3BRVB 4DZOA 1IJDB 2OYOA 4UB6H 1VQ4P 2QJKC 1RE4A 4B86A 3H25A 1KV4A 3L73G 1JY2P 3P8MC 1YTZT 4H0LD 3S9OA 4Y99B 4OH8B 4BXLA 1AQTA 1QL1A 5GTHH 1AV1A 3M9QA 5B66E 2PFXA 1N8RQ 4OVNF 1SQBE 3V2RA 1ZOYC 3CX5H 3D6ZA 1S2EA 1S5LH 3CCLP 2IPPA 1U57A 1K73Q 1HTLC 3KQGA 3M9BA 2E76B 1XTGB 1EDJA 1NTKE 4N78E 4H0LC 1FZAA 3P32A 4HYTB 2Q5UA 1Q90D 2OQQA 1Q7YQ 3Q2YA 3N7NA 3WMM0 2NRGA 1DD4A 3L36A 4L76A 2ZXXA 2WPVB 3CWBG 3TGUJ 5KLVE 4U3FG 4XE5B 1M7LA 2OYIC 1ZW0A 2QSIA 2XV5A 3L71D 1J2JB 1KILB 3IAOA 3VYIA 3HTKB 5APUA 5AVZB 2WSFJ 2W8ZA 1NU1D 1VQOP 3RK3E 2E75B 5BU8B 1JB0J 1ZR4A 1A02F 1UIIA 1FBMA 3HTKA 5CMZA 1KB9D 3VN0A 1Y8AA 4D6TD 1NH4A 1S5LX 2C9LY 4OGQB 3AE7C 1LGHB 3CMAP 3SSUA 1FZEA 3V4WA 1X79B 5CJ4A 5APVA 2O1JA 3ITKA 1WRGA 1NKNA 2P2UA 2XDJA 1VQKP 3CD6P 4NPDA 3KDPB 1SQVD 3WU2E 1NJIQ 1GU4A 1LT9C 1YQ4C 1LWUC 1URQB 1WMKA 1IO4A 3TSIA 3SFDC 1A02J 1KYOD 2NPSB 1L0NE 1KC8Q 1SQBJ 5EFWB 3M06A 1X22A 5CJ0A 1J1DB 2OYHA 2V7QJ 2NPSA 2E76D 4Z1MH 1NTMJ 4I2LC 5CBOA 2YNYA 3OA7A 1SQQE 3L72D 2WVRA 1N86A 1S72P 2YXQB 1HVVA 2WSCJ 1JCCA 1T3UA 2KZIA 2QG4A 5AW8B 1JY3O 1SQPD 1PP9D 3MTUE 3GMAA 1G1IA 3BCCD 2FKWB 1FOSE 1NO4A 2Y9YA 1KD1Q 2Z5HA 1ZR2A 1QVFO 1KILD 3B5NB 4C7NB 5TISE 3F89A 2E74B 3WUVA 1VQ6P 3B8EB 2QJYB 2E75D 2GUSA 1HUCA 4C7NA 5AVQB 1XTCC 2OARA 1KYOH 3IFMA 2E76C 1YI2P 1PGQA 2JR8A 1KB9I 5CCGC 1PIXA 3A2AA 1LTGC 1OXZA 5GTIH 1YYCA 4OGQD 3NMDA 2QM8A 4PV1D 3LW5H 4YTPC 2B9BA 3Q1MA 1OW8A 5APQA 2OTKE 4IFFA 1KFMA 2CPSA 1R8EA 1R5SA 1KILC 1JNMA 5KAIE 1FOSF 1DEBA 1G2CB 3JC22 4A7PA 4BRYA 1S9KD 1BCCD 2ZFCA 2E75C 3H1LD 2YKPA 1PGOA 3FX0A 2KSJA 4IL6H 1G2CA 2HODB 1KQGB 1URQD 3TK1A 3CLQA 2YIUC 2IFMA 3OAKA 2Q6QA 1SQBG 1QLED 2P10A
chains in the Genus database with same CATH topology
1Y47A 2LXCB 2QVAA 5CBNA 2B87B 1LP1A 2QRXA 2KS1B 1ZXGA 4GOFA 3FXDA 1EC5A 1S3JA 5K5GB 2JWDA 2LXBA 2M0BA 4GOEA 1NVOA 1OVUA 1H0TA 3ZDMA 2KI7B 1JMBA 2K3RA 2KZJA 1OVRA 4KJMA 2SPZA 4HB1A 3S1KA 4CPGA 1OVVA 3MZWB 1H0TB 3RGUA 1EDJA 1DEEG 2I8DA 1EDLA 4NPDA 4ZMDA 1BDDA 2P58A 4ASVA 1FC2C 4HJGH 3MHVA 1BDCA 3FXEA 2M5AA 1LT1A 2OTKE 5C39A 4MN4C 2HR3A 2ZAEB 1MFTA 4NPEA 5EFWB 1EDIA 4IOIH 1Q2NA 1ZW0A 3PH0A 2M5AB 4HKZH 4ZNCA 4GODA 4K3AA 1X0TA 5CBOA 1JM0A 2B88A 2KUBA 1EDKA 1U7JA 2KIKA 2UWJE 5DJUB 2Q1KA 1U7MA 2LR2A 3QWOC 4WWIA 4ASWA 4NPFX 1SS1A 2B89A 2B87A 4EYYQ 4K35A 1LP1B 2KZIA 4JBZA 4BXLA 2RKLA 2WMMA 5DJTB 2R44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y47 A;  2LXC B;  2QVA A;  5CBN A;  2B87 B;  1LP1 A;  2QRX A;  2KS1 B;  1ZXG A;  4GOF A;  3FXD A;  1EC5 A;  1S3J A;  5K5G B;  2JWD A;  2LXB A;  2M0B A;  4GOE A;  1NVO A;  1OVU A;  1H0T A;  3ZDM A;  2KI7 B;  1JMB A;  2K3R A;  2KZJ A;  1OVR A;  4KJM A;  2SPZ A;  4HB1 A;  3S1K A;  4CPG A;  1OVV A;  3MZW B;  1H0T B;  3RGU A;  1EDJ A;  1DEE G;  2I8D A;  1EDL A;  4NPD A;  4ZMD A;  1BDD A;  2P58 A;  4ASV A;  1FC2 C;  4HJG H;  3MHV A;  1BDC A;  3FXE A;  2M5A A;  1LT1 A;  2OTK E;  5C39 A;  4MN4 C;  2HR3 A;  2ZAE B;  1MFT A;  4NPE A;  5EFW B;  1EDI A;  4IOI H;  1Q2N A;  1ZW0 A;  3PH0 A;  2M5A B;  4HKZ H;  4ZNC A;  4GOD A;  4K3A A;  1X0T A;  5CBO A;  1JM0 A;  2B88 A;  2KUB A;  1EDK A;  1U7J A;  2KIK A;  2UWJ E;  5DJU B;  2Q1K A;  1U7M A;  2LR2 A;  3QWO C;  4WWI A;  4ASW A;  4NPF X;  1SS1 A;  2B89 A;  2B87 A;  4EYY Q;  4K35 A;  1LP1 B;  2KZI A;  4JBZ A;  4BXL A;  2RKL A;  2WMM A;  5DJT B;  2R44 A; 
#chains in the Genus database with same CATH topology
 2AXC A;  1L0N J;  3IF4 A;  2B87 B;  2QRX A;  4XA4 A;  3FWN A;  1SQB K;  1NTM G;  4L75 A;  1S3J A;  1EZV G;  3A0H E;  2WWW A;  4PV1 C;  1FJP A;  3MIW A;  1EZV I;  1NTM K;  1SQQ J;  3P8C D;  3C8V A;  2GUV A;  2I1K A;  1NGM B;  2Z4E A;  1OFC X;  4I7Z B;  2FFD B;  2O1K A;  4JF7 A;  2KYV A;  3A5T A;  1LTS C;  3GLM A;  2WPQ A;  3B5N D;  5CCH D;  3CCR P;  1QX8 A;  1URQ C;  2H88 C;  4W7Y A;  2E74 D;  2P67 A;  3MHV A;  2QEX P;  1JEK A;  2ZVN B;  3OW2 O;  1GK4 A;  1M1J B;  3L4F A;  2K1A A;  2YO3 A;  1S4X A;  2KNC A;  2M5A B;  3G9R A;  2MJZ A;  2H8P D;  1JM0 A;  1M1J A;  2J58 A;  2KUB A;  2WQY C;  1RQV A;  3D6Y A;  2FY8 A;  3Q5P A;  4W80 A;  4NPF X;  3AE9 C;  3V6I A;  2B89 A;  1QGK B;  2QIW A;  5B5E E;  1N2D C;  1PGP A;  2RMZ A;  1JY2 O;  3AEA C;  2IZ1 A;  3A0B E;  1ZRT D;  3H1K D;  5CCH C;  1GL2 B;  2N9B A;  2W90 A;  2O01 J;  2M3E A;  1KZU B;  3LID A;  1BCC G;  4L74 A;  1AQ5 A;  4JPZ B;  2BEZ F;  3BAS A;  3HUS C;  1KMI Z;  4L73 A;  4GOE A;  1NVO A;  3CXH H;  3G6E P;  4TT3 H;  3I56 P;  3SFE C;  1BGY J;  2GA1 A;  3JCU E;  3H1I G;  4OWF A;  3HE5 B;  1H0T B;  2ZYD A;  1LTT C;  4WBA A;  4GIF A;  1BSH A;  1KTM A;  3CI9 A;  5KAF H;  3FXE A;  3L74 D;  4WY4 B;  4I1L A;  2ZJS E;  1SQQ K;  3M0D C;  1DD3 A;  2C9N Y;  2ZAE B;  2IZ0 A;  1UIX A;  5H2F E;  5KJ7 D;  4WY4 A;  3PH0 A;  4HKZ H;  3PP5 A;  1AVY A;  1NU1 E;  4AYC A;  4PD4 D;  2BAS A;  3HD7 D;  1FDM A;  2HPC A;  1KB9 E;  3L70 D;  3V5B A;  1SFC A;  1SQX J;  1K05 A;  1KFN A;  3FGA D;  1T3J A;  1CW5 A;  1T2K D;  3TF5 A;  3H1J D;  4PJ0 H;  1M8O B;  3VMZ A;  1VF5 C;  5AW4 B;  4TLF A;  1Q82 Q;  1EXI A;  2JDI H;  1LT9 A;  5AW3 B;  1LWU A;  1HH0 A;  3EQ2 A;  1HJB A;  1N73 C;  5KJ7 C;  5AVT B;  1IFN A;  4YXD C;  1KQS O;  3AE8 C;  1RY3 A;  5KLI B;  1SQV E;  3L35 A;  3HD7 C;  4CPG A;  1OVV A;  4YPC A;  1JTH A;  2FYN C;  2N1T B;  3AE1 C;  5AVV B;  5AVY B;  1IK7 A;  2KK7 A;  4PD4 H;  3GF7 A;  1KN7 A;  2PRR A;  2KOG A;  3AEG C;  2N1T A;  4HJG H;  1GZL A;  3V4Q A;  1T2K C;  1NTM E;  1BGY G;  1EZV E;  3PRJ A;  3B71 A;  1E5W A;  3CC2 P;  2FYU D;  2D2C D;  3L72 E;  2QM7 A;  4AUW A;  3RL0 B;  3K5B A;  4H44 B;  1P84 H;  2KLU A;  1SQP E;  1OZH A;  1FDO A;  4UB8 H;  3BCC E;  3CCU P;  3L74 G;  2R5B A;  3GG2 A;  2VRS A;  5DJT B;  3CC7 P;  2Y9Z A;  1CZQ A;  1M56 D;  3M91 A;  3L71 J;  5CCG A;  3V2P A;  1PPJ D;  1JCD A;  1IC2 A;  3R4Y A;  3TGU D;  5AW5 B;  1M57 D;  1NU1 J;  4PD4 I;  2IBZ D;  1VL2 A;  3L70 G;  4N3Y B;  1SQX G;  2PGD A;  2ZT9 B;  1OVU A;  1YBK A;  3CX5 I;  4I6M C;  3ZDM A;  2ITA A;  2D2C C;  4D6T J;  3SWY A;  1SQX K;  3KZI E;  2K3R A;  2QJP C;  1L4A B;  1OVR A;  4GDO A;  4GKG A;  3RK2 B;  3RK3 B;  1JOC A;  1HGZ A;  2AXT H;  4JYB A;  1VPC A;  3W68 A;  3EFF K;  2I8D A;  3UIA A;  1L4A A;  1YIT P;  5BU5 A;  2JEE A;  3MUD C;  1X9V A;  1LTJ A;  4ASV A;  3D70 A;  1MKM A;  1BDC A;  3GHG C;  2HYN A;  3SWF A;  1KQL A;  1MZ9 A;  1S9K E;  1BCC E;  1T6A A;  3AE6 C;  1JUN A;  4IOI H;  2C0W A;  1Z56 A;  1YJN P;  1SQV J;  3CCS P;  1RE4 C;  1U7M A;  2OYH B;  2H89 C;  3L75 D;  3H1I E;  2R3C A;  1NAF A;  2K88 A;  3H32 A;  5E79 H;  3GW6 A;  3PHL A;  3RL0 D;  2QA4 P;  3P8C E;  3L72 J;  3M0A A;  4H44 D;  3V2N A;  4Y99 C;  3NFQ A;  2WT7 B;  2JKV A;  1SQP J;  3G3Z A;  4LLH A;  1PP9 J;  2WSE J;  1VQ9 P;  2WPR A;  2Q3E A;  3BCC J;  1RF1 B;  2GM4 A;  2WT7 A;  1NTK D;  3OJA B;  4N78 D;  1NAY A;  3L71 G;  2WSS H;  1NWQ A;  4KJM A;  1OX3 A;  1RF1 A;  3BVH A;  1NU1 G;  3SWK A;  2HFE D;  2P58 A;  5KKZ B;  5KLV D;  2K9Y A;  3F5H A;  1BSN A;  1NU1 K;  1USE A;  2ZT9 D;  5M1B A;  4ZKP A;  4D6T G;  2G3A A;  1QL2 A;  3RL0 C;  5B66 H;  5CCH A;  1GW3 A;  1LNQ A;  1N7S B;  1H89 A;  5AW1 B;  1ZP0 C;  1GD2 E;  4DCK A;  5DJU B;  2Q1K A;  1N7S A;  3S4R A;  1LTA C;  4Y28 J;  1YHQ P;  1ZV8 A;  3H1K E;  3C9I A;  4BRY B;  1PZQ A;  2A06 D;  2NZ2 A;  1PV3 A;  4R4M A;  5APY A;  1ZXG A;  1BCC J;  4GOF A;  4QMA A;  2E5T A;  1SQV G;  3H1L J;  1FZC B;  2FXP A;  4UB6 E;  3CCV P;  1M90 Q;  2ZT9 C;  1TU3 F;  5AW2 B;  1IFI A;  1BGY E;  1SQV K;  2NPS D;  1FZC A;  1Q86 Q;  2ZVO B;  3I5C A;  3VP8 A;  1KYO I;  3H1I J;  2IDB A;  4DOJ A;  2YMY A;  3AE3 C;  2KZJ A;  4OGQ C;  5AW6 B;  2N9Y B;  3MZW B;  3L72 G;  1L2P A;  2KSE A;  3L74 E;  1VQ7 P;  3H1H D;  5AVX B;  5GTH E;  1L0N D;  4EIJ A;  3AE2 C;  1DH3 A;  2PAJ A;  1SQP G;  1FC2 C;  2QJK B;  1PP9 G;  2J59 M;  2K9J B;  1YTZ I;  1RF0 A;  3BCC G;  2IYO A;  3MP7 B;  1L0L D;  1Y9B A;  4KT0 J;  1SQP K;  4NPE A;  3CC4 P;  1SQQ D;  1RH5 B;  2K9J A;  5AW9 B;  2YO2 A;  3CX5 E;  5AVS B;  3T97 A;  1W2B O;  3L70 E;  1N7L A;  1QVG O;  1SQX E;  1S5L E;  2OYH C;  1QEX A;  2NPS C;  4YXW H;  2KNC B;  3CXH D;  2WTY A;  1GK6 A;  2JO1 A;  2CPB A;  1BE3 D;  1MV8 A;  1J1D C;  4K35 A;  2JP3 A;  2KS1 A;  1NTZ D;  4EOT A;  2RKL A;  4IFM A;  3B4S A;  2A45 H;  3VMX A;  3WU2 H;  1JY3 N;  3RL0 g;  1IK9 A;  2R32 A;  1FZG A;  1HWT C;  3WUU A;  1H8A A;  2L5G B;  2O3J A;  3PLN A;  3L73 D;  4HH2 A;  1ZN5 A;  3H1K J;  2I1J A;  3B5N C;  2IYP A;  5AVU B;  2E74 C;  3H1L G;  2QJY C;  1W2E A;  2Q3I A;  3RGU A;  1USD A;  5KTB A;  5KKZ C;  2FBW C;  1EDL A;  3U59 A;  3Q5R A;  3HE4 A;  2RN0 A;  2FYU E;  3FWL A;  3TNU A;  3PJS K;  2OYI A;  2E42 A;  5TIS H;  1DX7 A;  3VTP C;  3CCJ P;  3M9H A;  2A45 I;  4WB4 A;  1EXJ A;  2Y0D A;  1PGJ A;  1EDK A;  2UWJ E;  2W6J H;  1X8Y A;  3L74 J;  4WWI A;  3L71 E;  1LP1 B;  1SLQ A;  2WMM A;  5BVZ A;  1EQ7 A;  1PPJ E;  2HPC B;  1LTB C;  1SFC B;  3RBX A;  5CBN A;  1LP1 A;  3E7K A;  2IFN A;  3CWB D;  4U3F D;  3JSV C;  2BCC D;  3BRT B;  2JWA A;  1NKZ B;  2ZXE B;  3L70 J;  1AFO A;  3RBZ A;  4D6T E;  2POH A;  4LGD E;  2M0B A;  1VQ5 P;  3AEC C;  2P7J A;  1VDF A;  2O01 H;  3IN6 A;  3CXH I;  5KAI H;  1OW7 A;  3H1J J;  1LT9 B;  1JMB A;  1LWU B;  1P84 D;  3IR9 A;  1E79 H;  2Z5I A;  3QH9 A;  1HBW A;  4I7Z C;  1JTH B;  2FFD C;  2ZYA A;  4WVZ A;  1LT1 A;  2MKV A;  3H1K G;  3HRN A;  4W7Z A;  3A0H H;  1AA0 A;  1GL2 D;  3G4S P;  3R2P A;  4RO0 A;  1CSB A;  1RHZ B;  1KYO E;  3L75 E;  4GOD A;  1YJ9 P;  1HJ0 A;  1MFZ A;  3NTN A;  2KIK A;  1PL5 A;  1M1J C;  3A7O A;  2KLV A;  1DIP A;  1HF9 A;  1LJ2 A;  1RE3 C;  4JBZ A;  5GTI E;  1VQN P;  1YJW P;  2FYU J;  1K9M Q;  3Q3D A;  2WIT A;  2LXC B;  3GF3 A;  4U7J A;  1PP9 E;  1JY2 N;  3VP9 A;  3PTZ A;  1MUU A;  3NXS A;  4H13 B;  5APT A;  3CCE P;  1OW6 A;  4WY4 D;  2W6B A;  3CL3 D;  1KIL E;  2L91 A;  1GL2 C;  3VOP A;  1K04 A;  1OWA A;  4RKU J;  4IL6 E;  1PFI A;  1FZF A;  1FE6 A;  1SFC D;  2SPZ A;  1VQM P;  1AJY A;  1IFM A;  5AW0 B;  2FXM A;  2BCC G;  1DEE G;  5B5E H;  3KYQ A;  4ZMD A;  4JQ0 D;  3LIE A;  3A0B H;  3USS A;  1Q81 Q;  1FDI A;  1FZB A;  3W67 A;  1J1E B;  1KIL A;  3H1J G;  3U1C A;  1YIJ P;  3AE5 C;  1NYH A;  1LTJ B;  2HR3 A;  3TYY A;  3H6P A;  2PP6 A;  2YIU B;  4K3A A;  2B88 A;  4WY4 C;  1P84 I;  3N4X A;  2A06 E;  2Y0C A;  2WZ7 A;  1G1J A;  3I55 P;  3D71 A;  2JJL A;  3AEE C;  3JCU H;  4EYY Q;  2W27 A;  4PV1 B;  1SFC C;  3H1L E;  2XNX A;  3ABV C;  1Y47 A;  2N1T D;  1IFD A;  1KOR A;  3Q5S A;  2M8R A;  3L75 J;  4C46 A;  2RH0 A;  5K5G B;  3H32 B;  5H2F H;  2XND H;  3EFG A;  2WSF H;  5CHX A;  2YKO A;  2Y0E A;  2FYU G;  1IFP A;  3C1L A;  5TJH A;  3H1H E;  1KQF B;  4O9B A;  1SQB D;  1GW4 A;  3S1K A;  1SP4 A;  2FYU K;  3LW5 J;  1KB9 H;  1URQ A;  3CPW O;  3CME P;  1WT6 A;  3KXD A;  1CI6 B;  1NTM D;  1L0L E;  4H13 D;  1EZV D;  5KLI C;  5CCG D;  2LKM A;  1NTK J;  1M1K Q;  5AVW B;  2N1T C;  1CI6 A;  2AEJ A;  4MN4 C;  1MFT A;  3II6 A;  1PPJ G;  2BEQ D;  4GT1 A;  3TGU G;  2OTL P;  4ZKU A;  2HG5 D;  1NOH A;  3CXH E;  1ZME C;  2IX7 C;  3U1A A;  1GTW A;  1X0T A;  1BE3 E;  2IBZ G;  5KLV J;  1D7M A;  2M3B A;  1NTZ E;  2E43 A;  2C0X A;  1FU1 A;  3O6Q B;  3AEF C;  1VQ8 P;  2IBZ I;  1SS1 A;  4M3L A;  1GDT A;  1OMI A;  1L4A D;  1FAV A;  3B5N A;  3HUS B;  3O6Q A;  4H44 C;  3RK2 D;  3RK3 D;  1GMJ A;  5KAF E;  3TDK A;  2KP8 A;  1H88 A;  3L73 E;  4N6J A;  4H13 C;  3HUS A;  2V7Q H;  1ZRT E;  3CCQ P;  2WPS A;  3EWK A;  3G71 P;  1HGV A;  3AED C;  1OIP A;  2WSC H;  2KI7 B;  2ZYG A;  3P7K A;  2OGU A;  2WSE H;  2O01 N;  3AE4 C;  1VQP P;  4AQR D;  3A3Y B;  3L75 G;  5APX A;  4PJ0 E;  2AEF A;  2QE7 H;  1NHL A;  1J1E C;  1L4A C;  1IZN B;  3M0D A;  2KB7 P;  3RK2 C;  1LTJ C;  3RK3 C;  5C39 A;  3O8Z A;  2H43 A;  3CCM P;  4EI2 A;  3H1H J;  2HOD A;  1AVO A;  4ZNC A;  3H1I D;  2YKQ A;  1JY3 P;  3VMY A;  5APS A;  1JMM A;  1U7J A;  2LR2 A;  3QWO C;  1T8Z A;  1FS0 E;  3KZI H;  2Q7C A;  3T97 B;  1NTK G;  1L0L J;  2B87 A;  2OTJ P;  3KPE A;  4PD4 E;  4KHX A;  1VF5 B;  1W5C E;  3VMA A;  2KXP B;  3CWB E;  3V2Q A;  4U3F E;  2BCC E;  2R44 A;  2QVA A;  4BWN A;  1NTK K;  4C7R A;  1N73 B;  2KS1 B;  3BAT A;  3FXD A;  1EC5 A;  5KLV G;  4RES B;  3WUT A;  1N73 A;  3H1J E;  1BE3 J;  2JWD A;  2YMK A;  4LC1 A;  3HD7 B;  5KJ7 A;  2FYN B;  2V4H A;  1NTZ J;  2FFD A;  1JO5 A;  5KLV K;  1FJK A;  1P84 E;  2W83 C;  3E1I A;  3HD7 A;  4UB8 E;  1N7S D;  4IL6 X;  3AEB C;  2H7H A;  2YXR B;  1S1C X;  1RF1 C;  5L8R J;  3L73 J;  1ZLL A;  2A06 G;  2G8Y A;  4H0L B;  2FXO A;  4DJG A;  2XKM A;  2M5A A;  1RE3 A;  4EDF A;  1R5L A;  1YQ3 C;  1EDI A;  3HE4 B;  1Q2N A;  2J5U A;  2K37 A;  3E1R A;  2R3S A;  3KHU A;  3TNU B;  2AEM A;  3L37 A;  2OYI B;  2XU6 A;  2DW3 A;  4R4L A;  4ASW A;  2AXT E;  2A45 G;  1SVF A;  1GL2 A;  1N7S C;  1RQU A;  1K8A Q;  5AW7 B;  2FYZ A;  2XZR A;  5APW A;  3H1H G;  1BGY D;  1L0N G;  2HLO A;  2D2C B;  2QJP B;  4RJT A;  2P1J A;  1VQL P;  1L0N K;  4XFJ A;  2LXB A;  1L0L G;  2CK3 H;  3HE5 A;  3TGU E;  1LTI C;  1SQQ G;  1GU5 A;  1VF5 D;  2W6A A;  1H0T A;  1FZC C;  2E5Y A;  1L0L K;  2IBZ E;  5AVR B;  3CWB J;  4U3F J;  2BCC J;  4HB1 A;  3GHG B;  3MUD A;  3MD0 A;  1IFJ A;  4IFD K;  1BE3 G;  4DT0 A;  3MGN A;  1BDD A;  2Q9I A;  3GHG A;  5E79 E;  1NTZ G;  2R5D A;  4JYC A;  3CX5 D;  1SQX D;  1RF0 C;  1NTZ K;  3BRV B;  4DZO A;  1IJD B;  2OYO A;  4UB6 H;  1VQ4 P;  2QJK C;  1RE4 A;  4B86 A;  3H25 A;  1KV4 A;  3L73 G;  1JY2 P;  3P8M C;  1YTZ T;  4H0L D;  3S9O A;  4Y99 B;  4OH8 B;  4BXL A;  1AQT A;  1QL1 A;  5GTH H;  1AV1 A;  3M9Q A;  5B66 E;  2PFX A;  1N8R Q;  4OVN F;  1SQB E;  3V2R A;  1ZOY C;  3CX5 H;  3D6Z A;  1S2E A;  1S5L H;  3CCL P;  2IPP A;  1U57 A;  1K73 Q;  1HTL C;  3KQG A;  3M9B A;  2E76 B;  1XTG B;  1EDJ A;  1NTK E;  4N78 E;  4H0L C;  1FZA A;  3P32 A;  4HYT B;  2Q5U A;  1Q90 D;  2OQQ A;  1Q7Y Q;  3Q2Y A;  3N7N A;  3WMM 0;  2NRG A;  1DD4 A;  3L36 A;  4L76 A;  2ZXX A;  2WPV B;  3CWB G;  3TGU J;  5KLV E;  4U3F G;  4XE5 B;  1M7L A;  2OYI C;  1ZW0 A;  2QSI A;  2XV5 A;  3L71 D;  1J2J B;  1KIL B;  3IAO A;  3VYI A;  3HTK B;  5APU A;  5AVZ B;  2WSF J;  2W8Z A;  1NU1 D;  1VQO P;  3RK3 E;  2E75 B;  5BU8 B;  1JB0 J;  1ZR4 A;  1A02 F;  1UII A;  1FBM A;  3HTK A;  5CMZ A;  1KB9 D;  3VN0 A;  1Y8A A;  4D6T D;  1NH4 A;  1S5L X;  2C9L Y;  4OGQ B;  3AE7 C;  1LGH B;  3CMA P;  3SSU A;  1FZE A;  3V4W A;  1X79 B;  5CJ4 A;  5APV A;  2O1J A;  3ITK A;  1WRG A;  1NKN A;  2P2U A;  2XDJ A;  1VQK P;  3CD6 P;  4NPD A;  3KDP B;  1SQV D;  3WU2 E;  1NJI Q;  1GU4 A;  1LT9 C;  1YQ4 C;  1LWU C;  1URQ B;  1WMK A;  1IO4 A;  3TSI A;  3SFD C;  1A02 J;  1KYO D;  2NPS B;  1L0N E;  1KC8 Q;  1SQB J;  5EFW B;  3M06 A;  1X22 A;  5CJ0 A;  1J1D B;  2OYH A;  2V7Q J;  2NPS A;  2E76 D;  4Z1M H;  1NTM J;  4I2L C;  5CBO A;  2YNY A;  3OA7 A;  1SQQ E;  3L72 D;  2WVR A;  1N86 A;  1S72 P;  2YXQ B;  1HVV A;  2WSC J;  1JCC A;  1T3U A;  2KZI A;  2QG4 A;  5AW8 B;  1JY3 O;  1SQP D;  1PP9 D;  3MTU E;  3GMA A;  1G1I A;  3BCC D;  2FKW B;  1FOS E;  1NO4 A;  2Y9Y A;  1KD1 Q;  2Z5H A;  1ZR2 A;  1QVF O;  1KIL D;  3B5N B;  4C7N B;  5TIS E;  3F89 A;  2E74 B;  3WUV A;  1VQ6 P;  3B8E B;  2QJY B;  2E75 D;  2GUS A;  1HUC A;  4C7N A;  5AVQ B;  1XTC C;  2OAR A;  1KYO H;  3IFM A;  2E76 C;  1YI2 P;  1PGQ A;  2JR8 A;  1KB9 I;  5CCG C;  1PIX A;  3A2A A;  1LTG C;  1OXZ A;  5GTI H;  1YYC A;  4OGQ D;  3NMD A;  2QM8 A;  4PV1 D;  3LW5 H;  4YTP C;  2B9B A;  3Q1M A;  1OW8 A;  5APQ A;  2OTK E;  4IFF A;  1KFM A;  2CPS A;  1R8E A;  1R5S A;  1KIL C;  1JNM A;  5KAI E;  1FOS F;  1DEB A;  1G2C B;  3JC2 2;  4A7P A;  4BRY A;  1S9K D;  1BCC D;  2ZFC A;  2E75 C;  3H1L D;  2YKP A;  1PGO A;  3FX0 A;  2KSJ A;  4IL6 H;  1G2C A;  2HOD B;  1KQG B;  1URQ D;  3TK1 A;  3CLQ A;  2YIU C;  2IFM A;  3OAK A;  2Q6Q A;  1SQB G;  1QLE D;  2P10 A; 
#chains in the Genus database with same CATH homology
 1Y47 A;  2LXC B;  2QVA A;  5CBN A;  2B87 B;  1LP1 A;  2QRX A;  2KS1 B;  1ZXG A;  4GOF A;  3FXD A;  1EC5 A;  1S3J A;  5K5G B;  2JWD A;  2LXB A;  2M0B A;  4GOE A;  1NVO A;  1OVU A;  1H0T A;  3ZDM A;  2KI7 B;  1JMB A;  2K3R A;  2KZJ A;  1OVR A;  4KJM A;  2SPZ A;  4HB1 A;  3S1K A;  4CPG A;  1OVV A;  3MZW B;  1H0T B;  3RGU A;  1EDJ A;  1DEE G;  2I8D A;  1EDL A;  4NPD A;  4ZMD A;  1BDD A;  2P58 A;  4ASV A;  1FC2 C;  4HJG H;  3MHV A;  1BDC A;  3FXE A;  2M5A A;  1LT1 A;  2OTK E;  5C39 A;  4MN4 C;  2HR3 A;  2ZAE B;  1MFT A;  4NPE A;  5EFW B;  1EDI A;  4IOI H;  1Q2N A;  1ZW0 A;  3PH0 A;  2M5A B;  4HKZ H;  4ZNC A;  4GOD A;  4K3A A;  1X0T A;  5CBO A;  1JM0 A;  2B88 A;  2KUB A;  1EDK A;  1U7J A;  2KIK A;  2UWJ E;  5DJU B;  2Q1K A;  1U7M A;  2LR2 A;  3QWO C;  4WWI A;  4ASW A;  4NPF X;  1SS1 A;  2B89 A;  2B87 A;  4EYY Q;  4K35 A;  1LP1 B;  2KZI A;  4JBZ A;  4BXL A;  2RKL A;  2WMM A;  5DJT B;  2R44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...