1LT1A

Sliding helix induced change of coordination geometry in a model di-mn(ii) protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKLELQGIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L13G-DF1
publication title Sliding helix and change of coordination geometry in a model di-MnII protein
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1lt1A00
4K35A 1H0TB 1H0TA 2LXBA 3RGUA 2KZIA 4GODA 2HR3A 1X0TA 2OTKE 1BDDA 4K3AA 2M0BA 1U7JA 2LR2A 2KIKA 2KUBA 5CBOA 4GOEA 4ASVA 5C39A 4NPDA 2LXCB 2UWJE 5DJTB 2K3RA 2JWDA 4MN4C 2B88A 2ZAEB 4ZNCA 5CBNA 2P58A 2KI7B 4HJGH 3FXEA 2QRXA 4NPEA 4JBZA 2B89A 1DEEG 4HKZH 4WWIA 1S3JA 2QVAA 2Q1KA 3QWOC 1EC5A 1OVRA 1ZW0A 4NPFX 2B87B 2B87A 2WMMA 1OVVA 1OVUA 1EDIA 1Q2NA 1MFTA 2KS1B 1LP1B 1LP1A 1BDCA 2M5AB 4KJMA 5K5GB 2M5AA 4CPGA 1JM0A 1Y47A 1FC2C 4BXLA 1JMBA 4ASWA 4EYYQ 1EDLA 2SPZA 2R44A 3S1KA 4IOIH 1SS1A 1NVOA 1U7MA 3MHVA 1EDKA 2RKLA 1EDJA 3PH0A 3MZWB 5DJUB 5EFWB 1LT1A 4GOFA 2KZJA 3ZDMA 4ZMDA 1ZXGA 4HB1A 2I8DA 3FXDA
chains in the Genus database with same CATH superfamily
3D6YA 2LKMA 1IK9A 3CWBG 2KIKA 3MIWA 4BRYB 4R4MA 1OW7A 3CMEP 2C0XA 3H1JJ 4JQ0D 3IF4A 1IZNB 3BCCD 1SQPE 1ZOYC 3W67A 2P58A 2PGDA 5BU8B 3B4SA 1BGYJ 1LTAC 2QVAA 3QWOC 1Y8AA 2IX7C 3M0DC 1W2EA 4C7NA 2Y0EA 1KQFB 2HYNA 2KS1B 5CCGC 2E75C 2QJKC 2NRGA 2O3JA 4R4LA 2FYUK 4C46A 1AVYA 1M57D 2BASA 1SQVG 2RMZA 2FYZA 2HPCA 3CXHD 4PD4D 1N7SC 2IYOA 1LTGC 3SSUA 3L74G 5KJ7D 1L0LG 1E79H 1G1IA 2C0WA 2Q9IA 5KLVG 3B71A 3PH0A 2CK3H 1NTMG 3VMZA 3L70D 1R8EA 1KILA 2N9BA 2BEQD 3P8CE 2IFMA 3H1KD 1HH0A 2E5TA 1MKMA 1H0TB 1FZGA 1KFMA 1SQVE 4D6TD 2GA1A 1JCDA 3L74J 1LTJB 3HE4B 4GOEA 3L71E 4QMAA 4UB6H 1L0LE 2UWJE 5DJTB 2BCCG 3GF3A 2OYHC 2P1JA 5KLVE 4NPEA 1IC2A 1YI2P 1NTMJ 4ZKPA 3VOPA 1NAFA 4YXDC 1JY3O 3G6EP 3OAKA 1Q86Q 3ITKA 5AW1B 2VRSA 1NWQA 4PJ0E 1AFOA 2E42A 3H1HG 1SQQD 2WSFH 3O8ZA 1KQLA 2IPPA 1RF1C 3EFGA 3IAOA 3EWKA 3UIAA 2BCCE 3RL0D 1N8RQ 3GG2A 5AVTB 2D2CD 3VTPC 1JM0A 5TISE 3R2PA 4KHXA 5APVA 1L4AD 3V2QA 4WY4D 3AEGC 5AVXB 5B66E 1LTBC 3H1HJ 3PHLA 3TGUG 1GU5A 2A45H 4H13C 1RHZB 3H1LD 3TNUB 2NPSD 5CMZA 1IK7A 1SQXE 4GODA 3WU2H 5APUA 3FWNA 1VDFA 2E74C 1SLQA 2WSFJ 2A45G 3GHGC 2IDBA 1HGVA 1L0NG 3S9OA 1DH3A 1GL2A 4ZNCA 3TGUE 3Q3DA 3USSA 4RESB 1SVFA 3RK3B 4HKZH 4WWIA 1LT9A 1RE4A 1PV3A 1G1JA 2B87B 1SQQK 2HFED 2AEJA 3BRTB 1N7SD 2P7JA 3A0BH 5BVZA 2WT7B 1J1EB 1SFCB 2J59M 3A7OA 2E76D 1JNMA 1BDCA 1L0NE 2QM8A 1URQB 3IR9A 5AW0B 2ZXXA 3WU2E 1K9MQ 2A45I 1MFZA 3B5ND 3RK2B 2KS1A 1U7MA 1M8OB 3V2PA 3CXHE 4PD4E 1M1JB 5H2FH 1S72P 2C9LY 2KZJA 3AE2C 4JYBA 1YHQP 1PPJD 3HD7C 4UB8H 3CXHI 4PD4I 2FYNC 3L70E 4ASVA 3IN6A 1EXJA 1RF0A 5AW4B 1ZMEC 4W80A 1YJNP 4D6TE 2QEXP 5AVVB 3H1JD 1R5LA 5KLIB 1FBMA 1GK4A 4ZKUA 4O9BA 3M9QA 4DCKA 2M8RA 4IL6X 3B8EB 3C1LA 1OVRA 1NTKG 5GTHH 1FDIA 1PZQA 3CI9A 4C7NB 1X9VA 1FJKA 1OWAA 1NOHA 3CWBD 1OW6A 2PFXA 3Q5PA 5H2FE 2KB7P 2QJPC 4I6MC 1SQBJ 2HPCB 4GT1A 3MP7B 4ASWA 4H13D 1QVGO 2P10A 1JY3N 2JEEA 1DEBA 1NTKJ 2ZT9B 3L36A 1PFIA 4EIJA 2Q6QA 1Q82Q 3MHVA 2W90A 3C8VA 2ZVOB 1X8YA 3CCJP 3PP5A 1FZCA 1KILB 3V4WA 5KKZB 1USDA 1LT1A 2E74D 1T6AA 4ZMDA 3PTZA 3I56P 4YPCA 2LXBA 4TT3H 2HR3A 1FZEA 3KHUA 1JY2P 2KYVA 1JB0J 3HUSA 4L75A 5CBOA 2CPSA 3H1LE 3A2AA 2YIUB 3L74D 2JWDA 5KJ7C 1L0LD 1SQPK 4I7ZB 5AW5B 1BCCJ 5KLVD 1RQVA 1NTMD 1S3JA 3CCMP 1N73A 2W6AA 1LJ2A 5APXA 3JCUE 1EZVG 1XTGB 2OYIB 1VQ7P 3HRNA 2XU6A 3GF7A 2C9NY 3H32A 1VQNP 1VQ6P 2ZYDA 3L72G 2K88A 2GUSA 2IYPA 1S9KE 1VQ8P 3V4QA 2IBZG 3L4FA 1FDMA 3AEBC 1ZRTD 1M90Q 4DJGA 2JWAA 4H0LD 1EZVE 3I55P 1NH4A 4TLFA 1FU1A 3H1HD 3CX5D 3W68A 1VL2A 5CCGA 2Y9YA 3O6QA 1SQVK 3RGUA 3L72J 1EZVI 4GIFA 2D2CC 1GK6A 1KORA 2HG5D 1AV1A 3HTKA 1PPJE 5TJHA 2JJLA 3LW5H 2KOGA 2PP6A 1L0LK 5AW7B 1KN7A 1GL2B 5KLVK 1BSNA 5AVZB 2YKOA 1BGYG 2KI7B 1YTZI 2RH0A 1OMIA 2JP3A 3TGUD 3TYYA 1NJIQ 1DEEG 1LT9B 1JO5A 3CC7P 1ZV8A 2OTLP 2AXTE 1LTTC 2XNDH 1HUCA 1QLED 1X79B 2NPSC 3AEDC 3H1JE 5APYA 3KZIH 2N1TC 1Q2NA 2WZ7A 4LLHA 4PV1B 2K1AA 2BEZF 1J1DB 1JCCA 1USEA 4IL6E 2OYOA 1L0ND 1RQUA 2A06D 3RK3C 2WSCH 1T2KC 4AUWA 4AYCA 3CWBE 1NTZJ 1FDOA 5AW9B 1N2DC 3LW5J 1ZR2A 4H44C 4I2LC 3E1IA 3ZDMA 2I8DA 5APWA 1FJPA 3H6PA 2E76C 3L75G 4EOTA 1SQXK 2OTKE 2M0BA 3AEFC 2LR2A 1G2CB 1K8AQ 3V2NA 1AA0A 2XV5A 2XZRA 1KMIZ 3D6ZA 1ZLLA 2B88A 3B5NC 5CCHC 1H88A 2FXMA 3U1CA 5AVUB 2WSCJ 3CLQA 1UIIA 3L74E 5KTBA 2I1JA 3CMAP 3L75J 1ZW0A 5M1BA 3CX5H 3I5CA 3MGNA 2MJZA 2XNXA 2IZ0A 5AVYB 1ZR4A 3BASA 4DZOA 1IFMA 1NTME 1LNQA 3GHGA 1L0NK 2KSJA 1KTMA 2QSIA 1FC2C 4BXLA 3AE3C 1SQBD 3TK1A 2FFDC 2SPZA 2OYIA 2R5BA 4YXWH 2FKWB 2OTJP 1FZCB 1NTKD 4DOJA 2FYUG 1K04A 1IO4A 1JUNA 2V4HA 4OGQB 4K35A 1ZRTE 1NU1G 2Y0CA 3WUUA 1LWUA 1JTHA 1U7JA 3HUSB 4UB6E 1IFDA 2O1JA 3AE9C 2M3EA 1TU3F 3H1HE 1S4XA 3CX5E 3H25A 4Y99C 3RL0B 5KKZC 2QRXA 2OGUA 1FE6A 2N1TD 3L73G 2FYUJ 1R5SA 1RE3C 3CX5I 5L8RJ 2H89C 1PGQA 1NU1J 1N73B 4WY4B 3HD7A 2O01J 3PJSK 4LGDE 2A06G 3RK3D 2KP8A 1T2KD 3M91A 1A02J 3CCSP 3H32B 2DW3A 3LIEA 4H44D 3D70A 1VQKP 2W6JH 2IFNA 3L73J 3MUDC 2L5GB 4EI2A 1SFCD 1VQ5P 4EYYQ 1KB9H 1S9KD 1URQD 3P8MC 1PGOA 1S1CX 1U57A 1JOCA 1PP9G 1NTKK 4Y28J 2YMYA 1VF5C 1YTZT 3BCCJ 5BU5A 2A06E 3MZWB 1LGHB 3RK2D 1EZVD 1ZXGA 1K05A 2E75B 2QJKB 3AE6C 3MD0A 3O6QB 1NGMB 1HVVA 5APQA 5CCHD 1E5WA 3HTKB 3L72D 1OXZA 1PP9J 2LXCB 1Z56A 2IBZD 4RO0A 2WPRA 2XKMA 2OQQA 2YKPA 2H43A 2B89A 4H0LC 3U59A 2ZYGA 1YJ9P 3M9HA 1G2CA 1KQSO 1MUUA 1KFNA 1MZ9A 1EC5A 3GLMA 1NAYA 2QIWA 2FBWC 3G9RA 5APTA 3MTUE 2R3SA 4DT0A 3A0BE 1SQBG 1MFTA 1KYOH 3R4YA 2ZJSE 1LP1A 5KJ7A 3CCVP 1S5LH 4CPGA 3H1KJ 1NKZB 5B5EH 1LT9C 4GKGA 1BGYD 3VYIA 3VMAA 2QJYB 3A3YB 1VQOP 2WWWA 1EDKA 1VQMP 3WUTA 1SQBE 1A02F 3U1AA 1L2PA 2ZT9D 1P84H 1RF1B 1J1DC 4UB8E 3NTNA 4HH2A 3BVHA 1KILD 3RL0g 2YXQB 1NTKE 3L35A 1HBWA 1M1KQ 1SQQJ 2XDJA 2GUVA 1BCCG 3KPEA 2WQYC 1DD4A 2WITA 1KQGB 4LC1A 2ZXEB 3V2RA 3A5TA 2PRRA 5GTHE 2V7QH 1OIPA 5E79H 2ZFCA 2N9YB 3AE5C 1VQPP 5AW8B 3L75D 1MV8A 1IFJA 2R32A 2AEMA 3GMAA 2K9JA 3GHGB 1BCCE 3T97A 3IFMA 4I1LA 4KJMA 2J5UA 2M5AA 4BWNA 2WPSA 1H89A 1L4AA 3CCEP 1VF5D 1PL5A 4WY4A 3RK3E 3CCQP 3SWFA 1JEKA 1LTJC 4OWFA 2JDIH 2RN0A 4W7YA 3JSVC 1AQTA 1IFNA 3AEAC 1GD2E 1NVOA 3KDPB 1AVOA 3VN0A 1M7LA 2PAJA 2IZ1A 1CI6A 2W83C 2NPSA 2FY8A 3NMDA 2QG4A 3NFQA 1JY2O 5GTIH 3H1IG 3CCLP 4AQRD 2V7QJ 1LWUB 1JTHB 3M0DA 5E79E 1QVFO 3AE7C 4OH8B 4U3FG 3CCUP 4NPDA 4N3YB 2FXPA 1BE3J 1OZHA 1HGZA 3FXEA 2Q3EA 3TDKA 2G8YA 3L72E 3AE8C 4N6JA 1N7SA 1GL2D 3HD7B 3H1IJ 2FYUD 2IBZE 1GDTA 3SWKA 1NU1D 5AW2B 1KD1Q 4U3FJ 3M0AA 2KLVA 1SQPG 1NTMK 3OJAB 2WVRA 2IBZI 3A0HH 5GTIE 1NTZG 3B5NA 5CJ0A 4PV1D 2Q5UA 2P2UA 1EDLA 2KNCA 3L73D 2Q3IA 5CHXA 1SS1A 1QL2A 4L76A 1W2BO 2WPQA 4KT0J 1LTIC 3CCRP 1QX8A 2OYHA 3PRJA 4JF7A 5AVQB 1BGYE 3E7KA 2M3BA 5AVSB 1SQPJ 4HB1A 1RY3A 2QJPB 2E43A 1DX7A 2WTYA 1NTZE 3Q2YA 1S2EA 4U7JA 3SFEC 5AVRB 2FFDA 1J1EC 1SFCC 1DIPA 2K3RA 1UIXA 3CWBJ 4WBAA 1URQC 5CBNA 1RF1A 1FOSF 3CD6P 1KILE 1QL1A 1PP9D 3A0HE 1K73Q 4EDFA 2HODA 2GM4A 3FX0A 1NHLA 3BATA 1J2JB 1QGKB 3RK2C 1NU1K 3KZIE 2G3AA 2HLOA 1HWTC 3L71G 3ABVC 1M1JC 1KB9D 1JY3P 4PJ0H 4IFDK 3VMYA 1LP1B 5KAIH 1Q7YQ 1NKNA 4GDOA 4XA4A 3L75E 1Y9BA 4Z1MH 1RE3A 4HYTB 1SQVJ 1PGPA 1FZBA 1PGJA 5TISH 3OA7A 5CJ4A 2CPBA 3L71J 1EDJA 5APSA 1L0LJ 5B66H 3OW2O 5KLIC 1H8AA 3Q1MA 5EFWB 4GOFA 5KLVJ 3D71A 1GU4A 3AECC 2Q7CA 2O01H 2KK7A 3LIDA 4C7RA 2L91A 3MUDA 1T3JA 2YNYA 2QJYC 3AE4C 4OGQD 2H7HA 4MN4C 5KAIE 2P67A 1AJYA 4JBZA 1S5LX 1KYOD 3P32A 1JY2N 2YMKA 2BCCJ 1JMMA 1GTWA 1CW5A 3SWYA 3WMM0 1AQ5A 1KZUB 4L74A 1SQXG 3K5BA 3S4RA 2ZT9C 1VQ4P 2Z4EA 1OVUA 3WUVA 1EDIA 2KXPB 2D2CB 1KILC 3CPWO 4JYCA 2H88C 1OX3A 2K9JB 3P7KA 4JPZB 3T97B 2YXRB 2M5AB 2FYUE 1L4AB 1BCCD 2W27A 1FAVA 1P84D 1NU1E 2NZ2A 4B86A 2O01N 1SQXJ 2YIUC 3BCCG 2KLUA 3PLNA 3VMXA 4I7ZC 1CI6B 2NPSB 3JC22 2E5YA 2N1TB 3HE5A 1SQBK 3CXHH 1N7LA 4PD4H 3Q5RA 3L73E 3TGUJ 2Y9ZA 1BDDA 1WRGA 3CC4P 2OYIC 5CCGD 2KUBA 2E75D 1PIXA 4YTPC 4BRYA 1HF9A 5AW6B 1XTCC 3BCCE 5C39A 2OARA 5KAFH 4H44B 3CL3D 1LTSC 1RH5B 1BE3D 1L0NJ 2ZVNB 1N7SB 2Z5IA 4N78D 2Q1KA 1LWUC 1YBKA 2J58A 1IFPA 2E76B 4NPFX 3L70G 3RBXA 2JR8A 1PP9E 3H1ID 1IFIA 3H1KG 1Q81Q 3L37A 1X22A 4D6TG 1GMJA 4U3FD 3B5NB 3SFDC 1KB9E 3G3ZA 2KNCB 3FGAD 4IOIH 3VP8A 1GL2C 3L70J 4L73A 1D7MA 2OYHB 1KB9I 5KAFE 1VPCA 3H1KE 2K9YA 1WMKA 4D6TJ 2R5DA 4WB4A 2YO3A 1RE4C 2JO1A 3FXDA 3G71P 1KC8Q 2JKVA 1KV4A 4OVNF 1SQQG 1H0TA 1SQPD 4XFJA 1N86A 2KZIA 1X0TA 4K3AA 2Z5HA 1ZN5A 1NO4A 1NTZD 3G4SP 2FFDB 1LTJA 4PV1C 3HE4A 3EQ2A 3FWLA 3II6A 3KXDA 2I1KA 1T3UA 1GZLA 3Q5SA 2ZAEB 4HJGH 4RKUJ 1VQLP 1HTLC 1GW4A 2ZYAA 2HODB 4M3LA 1WT6A 1BSHA 2R3CA 2W6BA 1NYHA 2Y0DA 1SQQE 4A7PA 2WMMA 1OVVA 3H1LG 1KYOE 1EXIA 3TF5A 3JCUH 4H13B 1S5LE 4IFFA 4Y99B 1YYCA 5B5EE 2QM7A 1FS0E 3GW6A 1KYOI 1Y47A 3VP9A 1JMBA 3F5HA 1YIJP 1YQ3C 3V5BA 2QE7H 3P8CD 2E74B 1RF0C 4IFMA 1OFCX 1SQVD 2WSEH 2AEFA 2KSEA 3H1LJ 1P84E 1EQ7A 3M06A 2WSSH 3L71D 2YKQA 5AVWB 3AE1C 3V6IA 3TNUA 3AEEC 1FZFA 5AW3B 1NTZK 2POHA 1P84I 3EFFK 3RBZA 1BE3G 3QH9A 4RJTA 1Q90D 1YJWP 3NXSA 1FOSE 1GW3A 2N1TA 2B9BA 3E1RA 1M56D 2W8ZA 2O1KA 3KYQA 3C9IA 1VF5B 2QA4P 1FZAA 1SP4A 2BCCD 1DD3A 2K37A 3KQGA 3N7NA 3TSIA 2B87A 1YITP 4XE5B 2AXTH 1FZCC 1HJBA 1PPJG 2WSEJ 1BE3E 1VQ9P 1YQ4C 2WPVB 1T8ZA 3HD7D 1HJ0A 4N78E 1OW8A 2WT7A 1SFCA 1CSBA 4OGQC 5K5GB 4W7ZA 2AXCA 2YO2A 1URQA 3N4XA 3CC2P 3M9BA 1QEXA 3H1IE 3HUSC 4H0LB 4IL6H 2FYNB 1IJDB 1ZP0C 2R44A 3S1KA 4WVZA 3F89A 3RL0C 3H1JG 4U3FE 1SQXD 2RKLA 2H8PD 3HE5B 3BRVB 1M1JA 5DJUB 5CCHA 2ITAA 2FXOA 2MKVA 1L4AC 1W5CE 1N73C 1CZQA 4WY4C
chains in the Genus database with same CATH topology
4K35A 1H0TB 1H0TA 2LXBA 3RGUA 2KZIA 4GODA 2HR3A 1X0TA 2OTKE 1BDDA 4K3AA 2M0BA 1U7JA 2LR2A 2KIKA 2KUBA 5CBOA 4GOEA 4ASVA 5C39A 4NPDA 2LXCB 2UWJE 5DJTB 2K3RA 2JWDA 4MN4C 2B88A 2ZAEB 4ZNCA 5CBNA 2P58A 2KI7B 4HJGH 3FXEA 2QRXA 4NPEA 4JBZA 2B89A 1DEEG 4HKZH 4WWIA 1S3JA 2QVAA 2Q1KA 3QWOC 1EC5A 1OVRA 1ZW0A 4NPFX 2B87B 2B87A 2WMMA 1OVVA 1OVUA 1EDIA 1Q2NA 1MFTA 2KS1B 1LP1B 1LP1A 1BDCA 2M5AB 4KJMA 5K5GB 2M5AA 4CPGA 1JM0A 1Y47A 1FC2C 4BXLA 1JMBA 4ASWA 4EYYQ 1EDLA 2SPZA 2R44A 3S1KA 4IOIH 1SS1A 1NVOA 1U7MA 3MHVA 1EDKA 2RKLA 1EDJA 3PH0A 3MZWB 5DJUB 5EFWB 1LT1A 4GOFA 2KZJA 3ZDMA 4ZMDA 1ZXGA 4HB1A 2I8DA 3FXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K35 A;  1H0T B;  1H0T A;  2LXB A;  3RGU A;  2KZI A;  4GOD A;  2HR3 A;  1X0T A;  2OTK E;  1BDD A;  4K3A A;  2M0B A;  1U7J A;  2LR2 A;  2KIK A;  2KUB A;  5CBO A;  4GOE A;  4ASV A;  5C39 A;  4NPD A;  2LXC B;  2UWJ E;  5DJT B;  2K3R A;  2JWD A;  4MN4 C;  2B88 A;  2ZAE B;  4ZNC A;  5CBN A;  2P58 A;  2KI7 B;  4HJG H;  3FXE A;  2QRX A;  4NPE A;  4JBZ A;  2B89 A;  1DEE G;  4HKZ H;  4WWI A;  1S3J A;  2QVA A;  2Q1K A;  3QWO C;  1EC5 A;  1OVR A;  1ZW0 A;  4NPF X;  2B87 B;  2B87 A;  2WMM A;  1OVV A;  1OVU A;  1EDI A;  1Q2N A;  1MFT A;  2KS1 B;  1LP1 B;  1LP1 A;  1BDC A;  2M5A B;  4KJM A;  5K5G B;  2M5A A;  4CPG A;  1JM0 A;  1Y47 A;  1FC2 C;  4BXL A;  1JMB A;  4ASW A;  4EYY Q;  1EDL A;  2SPZ A;  2R44 A;  3S1K A;  4IOI H;  1SS1 A;  1NVO A;  1U7M A;  3MHV A;  1EDK A;  2RKL A;  1EDJ A;  3PH0 A;  3MZW B;  5DJU B;  5EFW B;  1LT1 A;  4GOF A;  2KZJ A;  3ZDM A;  4ZMD A;  1ZXG A;  4HB1 A;  2I8D A;  3FXD A; 
#chains in the Genus database with same CATH topology
 3D6Y A;  2LKM A;  1IK9 A;  3CWB G;  2KIK A;  3MIW A;  4BRY B;  4R4M A;  1OW7 A;  3CME P;  2C0X A;  3H1J J;  4JQ0 D;  3IF4 A;  1IZN B;  3BCC D;  1SQP E;  1ZOY C;  3W67 A;  2P58 A;  2PGD A;  5BU8 B;  3B4S A;  1BGY J;  1LTA C;  2QVA A;  3QWO C;  1Y8A A;  2IX7 C;  3M0D C;  1W2E A;  4C7N A;  2Y0E A;  1KQF B;  2HYN A;  2KS1 B;  5CCG C;  2E75 C;  2QJK C;  2NRG A;  2O3J A;  4R4L A;  2FYU K;  4C46 A;  1AVY A;  1M57 D;  2BAS A;  1SQV G;  2RMZ A;  2FYZ A;  2HPC A;  3CXH D;  4PD4 D;  1N7S C;  2IYO A;  1LTG C;  3SSU A;  3L74 G;  5KJ7 D;  1L0L G;  1E79 H;  1G1I A;  2C0W A;  2Q9I A;  5KLV G;  3B71 A;  3PH0 A;  2CK3 H;  1NTM G;  3VMZ A;  3L70 D;  1R8E A;  1KIL A;  2N9B A;  2BEQ D;  3P8C E;  2IFM A;  3H1K D;  1HH0 A;  2E5T A;  1MKM A;  1H0T B;  1FZG A;  1KFM A;  1SQV E;  4D6T D;  2GA1 A;  1JCD A;  3L74 J;  1LTJ B;  3HE4 B;  4GOE A;  3L71 E;  4QMA A;  4UB6 H;  1L0L E;  2UWJ E;  5DJT B;  2BCC G;  3GF3 A;  2OYH C;  2P1J A;  5KLV E;  4NPE A;  1IC2 A;  1YI2 P;  1NTM J;  4ZKP A;  3VOP A;  1NAF A;  4YXD C;  1JY3 O;  3G6E P;  3OAK A;  1Q86 Q;  3ITK A;  5AW1 B;  2VRS A;  1NWQ A;  4PJ0 E;  1AFO A;  2E42 A;  3H1H G;  1SQQ D;  2WSF H;  3O8Z A;  1KQL A;  2IPP A;  1RF1 C;  3EFG A;  3IAO A;  3EWK A;  3UIA A;  2BCC E;  3RL0 D;  1N8R Q;  3GG2 A;  5AVT B;  2D2C D;  3VTP C;  1JM0 A;  5TIS E;  3R2P A;  4KHX A;  5APV A;  1L4A D;  3V2Q A;  4WY4 D;  3AEG C;  5AVX B;  5B66 E;  1LTB C;  3H1H J;  3PHL A;  3TGU G;  1GU5 A;  2A45 H;  4H13 C;  1RHZ B;  3H1L D;  3TNU B;  2NPS D;  5CMZ A;  1IK7 A;  1SQX E;  4GOD A;  3WU2 H;  5APU A;  3FWN A;  1VDF A;  2E74 C;  1SLQ A;  2WSF J;  2A45 G;  3GHG C;  2IDB A;  1HGV A;  1L0N G;  3S9O A;  1DH3 A;  1GL2 A;  4ZNC A;  3TGU E;  3Q3D A;  3USS A;  4RES B;  1SVF A;  3RK3 B;  4HKZ H;  4WWI A;  1LT9 A;  1RE4 A;  1PV3 A;  1G1J A;  2B87 B;  1SQQ K;  2HFE D;  2AEJ A;  3BRT B;  1N7S D;  2P7J A;  3A0B H;  5BVZ A;  2WT7 B;  1J1E B;  1SFC B;  2J59 M;  3A7O A;  2E76 D;  1JNM A;  1BDC A;  1L0N E;  2QM8 A;  1URQ B;  3IR9 A;  5AW0 B;  2ZXX A;  3WU2 E;  1K9M Q;  2A45 I;  1MFZ A;  3B5N D;  3RK2 B;  2KS1 A;  1U7M A;  1M8O B;  3V2P A;  3CXH E;  4PD4 E;  1M1J B;  5H2F H;  1S72 P;  2C9L Y;  2KZJ A;  3AE2 C;  4JYB A;  1YHQ P;  1PPJ D;  3HD7 C;  4UB8 H;  3CXH I;  4PD4 I;  2FYN C;  3L70 E;  4ASV A;  3IN6 A;  1EXJ A;  1RF0 A;  5AW4 B;  1ZME C;  4W80 A;  1YJN P;  4D6T E;  2QEX P;  5AVV B;  3H1J D;  1R5L A;  5KLI B;  1FBM A;  1GK4 A;  4ZKU A;  4O9B A;  3M9Q A;  4DCK A;  2M8R A;  4IL6 X;  3B8E B;  3C1L A;  1OVR A;  1NTK G;  5GTH H;  1FDI A;  1PZQ A;  3CI9 A;  4C7N B;  1X9V A;  1FJK A;  1OWA A;  1NOH A;  3CWB D;  1OW6 A;  2PFX A;  3Q5P A;  5H2F E;  2KB7 P;  2QJP C;  4I6M C;  1SQB J;  2HPC B;  4GT1 A;  3MP7 B;  4ASW A;  4H13 D;  1QVG O;  2P10 A;  1JY3 N;  2JEE A;  1DEB A;  1NTK J;  2ZT9 B;  3L36 A;  1PFI A;  4EIJ A;  2Q6Q A;  1Q82 Q;  3MHV A;  2W90 A;  3C8V A;  2ZVO B;  1X8Y A;  3CCJ P;  3PP5 A;  1FZC A;  1KIL B;  3V4W A;  5KKZ B;  1USD A;  1LT1 A;  2E74 D;  1T6A A;  4ZMD A;  3PTZ A;  3I56 P;  4YPC A;  2LXB A;  4TT3 H;  2HR3 A;  1FZE A;  3KHU A;  1JY2 P;  2KYV A;  1JB0 J;  3HUS A;  4L75 A;  5CBO A;  2CPS A;  3H1L E;  3A2A A;  2YIU B;  3L74 D;  2JWD A;  5KJ7 C;  1L0L D;  1SQP K;  4I7Z B;  5AW5 B;  1BCC J;  5KLV D;  1RQV A;  1NTM D;  1S3J A;  3CCM P;  1N73 A;  2W6A A;  1LJ2 A;  5APX A;  3JCU E;  1EZV G;  1XTG B;  2OYI B;  1VQ7 P;  3HRN A;  2XU6 A;  3GF7 A;  2C9N Y;  3H32 A;  1VQN P;  1VQ6 P;  2ZYD A;  3L72 G;  2K88 A;  2GUS A;  2IYP A;  1S9K E;  1VQ8 P;  3V4Q A;  2IBZ G;  3L4F A;  1FDM A;  3AEB C;  1ZRT D;  1M90 Q;  4DJG A;  2JWA A;  4H0L D;  1EZV E;  3I55 P;  1NH4 A;  4TLF A;  1FU1 A;  3H1H D;  3CX5 D;  3W68 A;  1VL2 A;  5CCG A;  2Y9Y A;  3O6Q A;  1SQV K;  3RGU A;  3L72 J;  1EZV I;  4GIF A;  2D2C C;  1GK6 A;  1KOR A;  2HG5 D;  1AV1 A;  3HTK A;  1PPJ E;  5TJH A;  2JJL A;  3LW5 H;  2KOG A;  2PP6 A;  1L0L K;  5AW7 B;  1KN7 A;  1GL2 B;  5KLV K;  1BSN A;  5AVZ B;  2YKO A;  1BGY G;  2KI7 B;  1YTZ I;  2RH0 A;  1OMI A;  2JP3 A;  3TGU D;  3TYY A;  1NJI Q;  1DEE G;  1LT9 B;  1JO5 A;  3CC7 P;  1ZV8 A;  2OTL P;  2AXT E;  1LTT C;  2XND H;  1HUC A;  1QLE D;  1X79 B;  2NPS C;  3AED C;  3H1J E;  5APY A;  3KZI H;  2N1T C;  1Q2N A;  2WZ7 A;  4LLH A;  4PV1 B;  2K1A A;  2BEZ F;  1J1D B;  1JCC A;  1USE A;  4IL6 E;  2OYO A;  1L0N D;  1RQU A;  2A06 D;  3RK3 C;  2WSC H;  1T2K C;  4AUW A;  4AYC A;  3CWB E;  1NTZ J;  1FDO A;  5AW9 B;  1N2D C;  3LW5 J;  1ZR2 A;  4H44 C;  4I2L C;  3E1I A;  3ZDM A;  2I8D A;  5APW A;  1FJP A;  3H6P A;  2E76 C;  3L75 G;  4EOT A;  1SQX K;  2OTK E;  2M0B A;  3AEF C;  2LR2 A;  1G2C B;  1K8A Q;  3V2N A;  1AA0 A;  2XV5 A;  2XZR A;  1KMI Z;  3D6Z A;  1ZLL A;  2B88 A;  3B5N C;  5CCH C;  1H88 A;  2FXM A;  3U1C A;  5AVU B;  2WSC J;  3CLQ A;  1UII A;  3L74 E;  5KTB A;  2I1J A;  3CMA P;  3L75 J;  1ZW0 A;  5M1B A;  3CX5 H;  3I5C A;  3MGN A;  2MJZ A;  2XNX A;  2IZ0 A;  5AVY B;  1ZR4 A;  3BAS A;  4DZO A;  1IFM A;  1NTM E;  1LNQ A;  3GHG A;  1L0N K;  2KSJ A;  1KTM A;  2QSI A;  1FC2 C;  4BXL A;  3AE3 C;  1SQB D;  3TK1 A;  2FFD C;  2SPZ A;  2OYI A;  2R5B A;  4YXW H;  2FKW B;  2OTJ P;  1FZC B;  1NTK D;  4DOJ A;  2FYU G;  1K04 A;  1IO4 A;  1JUN A;  2V4H A;  4OGQ B;  4K35 A;  1ZRT E;  1NU1 G;  2Y0C A;  3WUU A;  1LWU A;  1JTH A;  1U7J A;  3HUS B;  4UB6 E;  1IFD A;  2O1J A;  3AE9 C;  2M3E A;  1TU3 F;  3H1H E;  1S4X A;  3CX5 E;  3H25 A;  4Y99 C;  3RL0 B;  5KKZ C;  2QRX A;  2OGU A;  1FE6 A;  2N1T D;  3L73 G;  2FYU J;  1R5S A;  1RE3 C;  3CX5 I;  5L8R J;  2H89 C;  1PGQ A;  1NU1 J;  1N73 B;  4WY4 B;  3HD7 A;  2O01 J;  3PJS K;  4LGD E;  2A06 G;  3RK3 D;  2KP8 A;  1T2K D;  3M91 A;  1A02 J;  3CCS P;  3H32 B;  2DW3 A;  3LIE A;  4H44 D;  3D70 A;  1VQK P;  2W6J H;  2IFN A;  3L73 J;  3MUD C;  2L5G B;  4EI2 A;  1SFC D;  1VQ5 P;  4EYY Q;  1KB9 H;  1S9K D;  1URQ D;  3P8M C;  1PGO A;  1S1C X;  1U57 A;  1JOC A;  1PP9 G;  1NTK K;  4Y28 J;  2YMY A;  1VF5 C;  1YTZ T;  3BCC J;  5BU5 A;  2A06 E;  3MZW B;  1LGH B;  3RK2 D;  1EZV D;  1ZXG A;  1K05 A;  2E75 B;  2QJK B;  3AE6 C;  3MD0 A;  3O6Q B;  1NGM B;  1HVV A;  5APQ A;  5CCH D;  1E5W A;  3HTK B;  3L72 D;  1OXZ A;  1PP9 J;  2LXC B;  1Z56 A;  2IBZ D;  4RO0 A;  2WPR A;  2XKM A;  2OQQ A;  2YKP A;  2H43 A;  2B89 A;  4H0L C;  3U59 A;  2ZYG A;  1YJ9 P;  3M9H A;  1G2C A;  1KQS O;  1MUU A;  1KFN A;  1MZ9 A;  1EC5 A;  3GLM A;  1NAY A;  2QIW A;  2FBW C;  3G9R A;  5APT A;  3MTU E;  2R3S A;  4DT0 A;  3A0B E;  1SQB G;  1MFT A;  1KYO H;  3R4Y A;  2ZJS E;  1LP1 A;  5KJ7 A;  3CCV P;  1S5L H;  4CPG A;  3H1K J;  1NKZ B;  5B5E H;  1LT9 C;  4GKG A;  1BGY D;  3VYI A;  3VMA A;  2QJY B;  3A3Y B;  1VQO P;  2WWW A;  1EDK A;  1VQM P;  3WUT A;  1SQB E;  1A02 F;  3U1A A;  1L2P A;  2ZT9 D;  1P84 H;  1RF1 B;  1J1D C;  4UB8 E;  3NTN A;  4HH2 A;  3BVH A;  1KIL D;  3RL0 g;  2YXQ B;  1NTK E;  3L35 A;  1HBW A;  1M1K Q;  1SQQ J;  2XDJ A;  2GUV A;  1BCC G;  3KPE A;  2WQY C;  1DD4 A;  2WIT A;  1KQG B;  4LC1 A;  2ZXE B;  3V2R A;  3A5T A;  2PRR A;  5GTH E;  2V7Q H;  1OIP A;  5E79 H;  2ZFC A;  2N9Y B;  3AE5 C;  1VQP P;  5AW8 B;  3L75 D;  1MV8 A;  1IFJ A;  2R32 A;  2AEM A;  3GMA A;  2K9J A;  3GHG B;  1BCC E;  3T97 A;  3IFM A;  4I1L A;  4KJM A;  2J5U A;  2M5A A;  4BWN A;  2WPS A;  1H89 A;  1L4A A;  3CCE P;  1VF5 D;  1PL5 A;  4WY4 A;  3RK3 E;  3CCQ P;  3SWF A;  1JEK A;  1LTJ C;  4OWF A;  2JDI H;  2RN0 A;  4W7Y A;  3JSV C;  1AQT A;  1IFN A;  3AEA C;  1GD2 E;  1NVO A;  3KDP B;  1AVO A;  3VN0 A;  1M7L A;  2PAJ A;  2IZ1 A;  1CI6 A;  2W83 C;  2NPS A;  2FY8 A;  3NMD A;  2QG4 A;  3NFQ A;  1JY2 O;  5GTI H;  3H1I G;  3CCL P;  4AQR D;  2V7Q J;  1LWU B;  1JTH B;  3M0D A;  5E79 E;  1QVF O;  3AE7 C;  4OH8 B;  4U3F G;  3CCU P;  4NPD A;  4N3Y B;  2FXP A;  1BE3 J;  1OZH A;  1HGZ A;  3FXE A;  2Q3E A;  3TDK A;  2G8Y A;  3L72 E;  3AE8 C;  4N6J A;  1N7S A;  1GL2 D;  3HD7 B;  3H1I J;  2FYU D;  2IBZ E;  1GDT A;  3SWK A;  1NU1 D;  5AW2 B;  1KD1 Q;  4U3F J;  3M0A A;  2KLV A;  1SQP G;  1NTM K;  3OJA B;  2WVR A;  2IBZ I;  3A0H H;  5GTI E;  1NTZ G;  3B5N A;  5CJ0 A;  4PV1 D;  2Q5U A;  2P2U A;  1EDL A;  2KNC A;  3L73 D;  2Q3I A;  5CHX A;  1SS1 A;  1QL2 A;  4L76 A;  1W2B O;  2WPQ A;  4KT0 J;  1LTI C;  3CCR P;  1QX8 A;  2OYH A;  3PRJ A;  4JF7 A;  5AVQ B;  1BGY E;  3E7K A;  2M3B A;  5AVS B;  1SQP J;  4HB1 A;  1RY3 A;  2QJP B;  2E43 A;  1DX7 A;  2WTY A;  1NTZ E;  3Q2Y A;  1S2E A;  4U7J A;  3SFE C;  5AVR B;  2FFD A;  1J1E C;  1SFC C;  1DIP A;  2K3R A;  1UIX A;  3CWB J;  4WBA A;  1URQ C;  5CBN A;  1RF1 A;  1FOS F;  3CD6 P;  1KIL E;  1QL1 A;  1PP9 D;  3A0H E;  1K73 Q;  4EDF A;  2HOD A;  2GM4 A;  3FX0 A;  1NHL A;  3BAT A;  1J2J B;  1QGK B;  3RK2 C;  1NU1 K;  3KZI E;  2G3A A;  2HLO A;  1HWT C;  3L71 G;  3ABV C;  1M1J C;  1KB9 D;  1JY3 P;  4PJ0 H;  4IFD K;  3VMY A;  1LP1 B;  5KAI H;  1Q7Y Q;  1NKN A;  4GDO A;  4XA4 A;  3L75 E;  1Y9B A;  4Z1M H;  1RE3 A;  4HYT B;  1SQV J;  1PGP A;  1FZB A;  1PGJ A;  5TIS H;  3OA7 A;  5CJ4 A;  2CPB A;  3L71 J;  1EDJ A;  5APS A;  1L0L J;  5B66 H;  3OW2 O;  5KLI C;  1H8A A;  3Q1M A;  5EFW B;  4GOF A;  5KLV J;  3D71 A;  1GU4 A;  3AEC C;  2Q7C A;  2O01 H;  2KK7 A;  3LID A;  4C7R A;  2L91 A;  3MUD A;  1T3J A;  2YNY A;  2QJY C;  3AE4 C;  4OGQ D;  2H7H A;  4MN4 C;  5KAI E;  2P67 A;  1AJY A;  4JBZ A;  1S5L X;  1KYO D;  3P32 A;  1JY2 N;  2YMK A;  2BCC J;  1JMM A;  1GTW A;  1CW5 A;  3SWY A;  3WMM 0;  1AQ5 A;  1KZU B;  4L74 A;  1SQX G;  3K5B A;  3S4R A;  2ZT9 C;  1VQ4 P;  2Z4E A;  1OVU A;  3WUV A;  1EDI A;  2KXP B;  2D2C B;  1KIL C;  3CPW O;  4JYC A;  2H88 C;  1OX3 A;  2K9J B;  3P7K A;  4JPZ B;  3T97 B;  2YXR B;  2M5A B;  2FYU E;  1L4A B;  1BCC D;  2W27 A;  1FAV A;  1P84 D;  1NU1 E;  2NZ2 A;  4B86 A;  2O01 N;  1SQX J;  2YIU C;  3BCC G;  2KLU A;  3PLN A;  3VMX A;  4I7Z C;  1CI6 B;  2NPS B;  3JC2 2;  2E5Y A;  2N1T B;  3HE5 A;  1SQB K;  3CXH H;  1N7L A;  4PD4 H;  3Q5R A;  3L73 E;  3TGU J;  2Y9Z A;  1BDD A;  1WRG A;  3CC4 P;  2OYI C;  5CCG D;  2KUB A;  2E75 D;  1PIX A;  4YTP C;  4BRY A;  1HF9 A;  5AW6 B;  1XTC C;  3BCC E;  5C39 A;  2OAR A;  5KAF H;  4H44 B;  3CL3 D;  1LTS C;  1RH5 B;  1BE3 D;  1L0N J;  2ZVN B;  1N7S B;  2Z5I A;  4N78 D;  2Q1K A;  1LWU C;  1YBK A;  2J58 A;  1IFP A;  2E76 B;  4NPF X;  3L70 G;  3RBX A;  2JR8 A;  1PP9 E;  3H1I D;  1IFI A;  3H1K G;  1Q81 Q;  3L37 A;  1X22 A;  4D6T G;  1GMJ A;  4U3F D;  3B5N B;  3SFD C;  1KB9 E;  3G3Z A;  2KNC B;  3FGA D;  4IOI H;  3VP8 A;  1GL2 C;  3L70 J;  4L73 A;  1D7M A;  2OYH B;  1KB9 I;  5KAF E;  1VPC A;  3H1K E;  2K9Y A;  1WMK A;  4D6T J;  2R5D A;  4WB4 A;  2YO3 A;  1RE4 C;  2JO1 A;  3FXD A;  3G71 P;  1KC8 Q;  2JKV A;  1KV4 A;  4OVN F;  1SQQ G;  1H0T A;  1SQP D;  4XFJ A;  1N86 A;  2KZI A;  1X0T A;  4K3A A;  2Z5H A;  1ZN5 A;  1NO4 A;  1NTZ D;  3G4S P;  2FFD B;  1LTJ A;  4PV1 C;  3HE4 A;  3EQ2 A;  3FWL A;  3II6 A;  3KXD A;  2I1K A;  1T3U A;  1GZL A;  3Q5S A;  2ZAE B;  4HJG H;  4RKU J;  1VQL P;  1HTL C;  1GW4 A;  2ZYA A;  2HOD B;  4M3L A;  1WT6 A;  1BSH A;  2R3C A;  2W6B A;  1NYH A;  2Y0D A;  1SQQ E;  4A7P A;  2WMM A;  1OVV A;  3H1L G;  1KYO E;  1EXI A;  3TF5 A;  3JCU H;  4H13 B;  1S5L E;  4IFF A;  4Y99 B;  1YYC A;  5B5E E;  2QM7 A;  1FS0 E;  3GW6 A;  1KYO I;  1Y47 A;  3VP9 A;  1JMB A;  3F5H A;  1YIJ P;  1YQ3 C;  3V5B A;  2QE7 H;  3P8C D;  2E74 B;  1RF0 C;  4IFM A;  1OFC X;  1SQV D;  2WSE H;  2AEF A;  2KSE A;  3H1L J;  1P84 E;  1EQ7 A;  3M06 A;  2WSS H;  3L71 D;  2YKQ A;  5AVW B;  3AE1 C;  3V6I A;  3TNU A;  3AEE C;  1FZF A;  5AW3 B;  1NTZ K;  2POH A;  1P84 I;  3EFF K;  3RBZ A;  1BE3 G;  3QH9 A;  4RJT A;  1Q90 D;  1YJW P;  3NXS A;  1FOS E;  1GW3 A;  2N1T A;  2B9B A;  3E1R A;  1M56 D;  2W8Z A;  2O1K A;  3KYQ A;  3C9I A;  1VF5 B;  2QA4 P;  1FZA A;  1SP4 A;  2BCC D;  1DD3 A;  2K37 A;  3KQG A;  3N7N A;  3TSI A;  2B87 A;  1YIT P;  4XE5 B;  2AXT H;  1FZC C;  1HJB A;  1PPJ G;  2WSE J;  1BE3 E;  1VQ9 P;  1YQ4 C;  2WPV B;  1T8Z A;  3HD7 D;  1HJ0 A;  4N78 E;  1OW8 A;  2WT7 A;  1SFC A;  1CSB A;  4OGQ C;  5K5G B;  4W7Z A;  2AXC A;  2YO2 A;  1URQ A;  3N4X A;  3CC2 P;  3M9B A;  1QEX A;  3H1I E;  3HUS C;  4H0L B;  4IL6 H;  2FYN B;  1IJD B;  1ZP0 C;  2R44 A;  3S1K A;  4WVZ A;  3F89 A;  3RL0 C;  3H1J G;  4U3F E;  1SQX D;  2RKL A;  2H8P D;  3HE5 B;  3BRV B;  1M1J A;  5DJU B;  5CCH A;  2ITA A;  2FXO A;  2MKV A;  1L4A C;  1W5C E;  1N73 C;  1CZQ A;  4WY4 C; 
#chains in the Genus database with same CATH homology
 4K35 A;  1H0T B;  1H0T A;  2LXB A;  3RGU A;  2KZI A;  4GOD A;  2HR3 A;  1X0T A;  2OTK E;  1BDD A;  4K3A A;  2M0B A;  1U7J A;  2LR2 A;  2KIK A;  2KUB A;  5CBO A;  4GOE A;  4ASV A;  5C39 A;  4NPD A;  2LXC B;  2UWJ E;  5DJT B;  2K3R A;  2JWD A;  4MN4 C;  2B88 A;  2ZAE B;  4ZNC A;  5CBN A;  2P58 A;  2KI7 B;  4HJG H;  3FXE A;  2QRX A;  4NPE A;  4JBZ A;  2B89 A;  1DEE G;  4HKZ H;  4WWI A;  1S3J A;  2QVA A;  2Q1K A;  3QWO C;  1EC5 A;  1OVR A;  1ZW0 A;  4NPF X;  2B87 B;  2B87 A;  2WMM A;  1OVV A;  1OVU A;  1EDI A;  1Q2N A;  1MFT A;  2KS1 B;  1LP1 B;  1LP1 A;  1BDC A;  2M5A B;  4KJM A;  5K5G B;  2M5A A;  4CPG A;  1JM0 A;  1Y47 A;  1FC2 C;  4BXL A;  1JMB A;  4ASW A;  4EYY Q;  1EDL A;  2SPZ A;  2R44 A;  3S1K A;  4IOI H;  1SS1 A;  1NVO A;  1U7M A;  3MHV A;  1EDK A;  2RKL A;  1EDJ A;  3PH0 A;  3MZW B;  5DJU B;  5EFW B;  1LT1 A;  4GOF A;  2KZJ A;  3ZDM A;  4ZMD A;  1ZXG A;  4HB1 A;  2I8D A;  3FXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...