1LT1A

Sliding helix induced change of coordination geometry in a model di-mn(ii) protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQGIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sliding helix and change of coordination geometry in a model di-MnII protein
pubmed doi rcsb
molecule tags De novo protein
molecule keywords L13G-DF1
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1lt1A00
1FC2C 2KUBA 2K3RA 1LT1A 4GOFA 4ASVA 3RGUA 4IOIH 2SPZA 2LR2A 3S1KA 1U7JA 1EC5A 4GOEA 4K35A 4NPDA 4NPFX 5CBNA 2QRXA 2UWJE 4KJMA 2QVAA 2R44A 1LP1A 1ZW0A 1MFTA 2WMMA 2LXBA 3FXDA 5DJTB 2M0BA 1OVRA 1LP1B 1EDLA 1NVOA 1JM0A 2B88A 4MN4C 2Q1KA 2B89A 1X0TA 4HB1A 4CPGA 4EYYQ 2ZAEB 4ZNCA 1H0TB 2B87B 1EDIA 5C39A 1BDCA 2OTKE 4ZMDA 4K3AA 1BDDA 2JWDA 5CBOA 2RKLA 4HKZH 2KZIA 2KZJA 3MHVA 1DEEG 1SS1A 4GODA 2M5AA 1Y47A 1OVUA 4NPEA 1U7MA 1EDKA 1S3JA 2HR3A 1H0TA 2KI7B 1Q2NA 3ZDMA 4JBZA 2KS1B 2P58A 3PH0A 1ZXGA 5DJUB 1EDJA 4WWIA 2KIKA 4ASWA 3QWOC 4BXLA 2I8DA 3FXEA 4HJGH 5K5GB 1OVVA 3MZWB 5EFWB 2M5AB 2B87A 2LXCB 1JMBA
chains in the Genus database with same CATH superfamily
2KUBA 4ZKPA 1FJPA 3KDPB 1L4AB 2QJPB 1KILD 1HBWA 2Q6QA 2W90A 4QMAA 1EZVI 4UB8E 3H1JJ 4GOFA 1NTZE 2E75B 5CJ4A 2Z4EA 4DT0A 2D2CD 2P67A 2Y9ZA 2OYHA 2QEXP 1SQBK 3JCUH 3WU2H 2SPZA 1BGYE 2P7JA 1OFCX 3CLQA 1MV8A 1PPJE 4R4MA 2AXCA 3CL3D 1JEKA 2W27A 5CCGC 2E75D 2A06D 2H8PD 2JO1A 2M8RA 3H1IJ 2K37A 1G2CA 2UWJE 2WSSH 1A02J 4LLHA 3A7OA 1YYCA 2JJLA 2NPSB 4OGQD 2BCCE 1HH0A 3VTPC 2WSEH 1GL2A 2E74C 5KKZB 3L73G 3W67A 1LP1A 1LT9A 1S9KE 5TJHA 2FYUK 2K9YA 2HPCA 3FWLA 2DW3A 1RQUA 5KAFH 2WMMA 4B86A 1VQMP 1BE3J 2LXBA 4R4LA 2YKOA 1K8AQ 1RF0C 3Q5SA 3KHUA 2IYPA 1OXZA 4TLFA 1LTAC 2WQYC 2CPSA 3NXSA 3H1KE 1LP1B 1LT9B 1RE4C 2OYOA 5AW5B 2O1KA 1N7SB 3V2PA 5KJ7D 2ZT9B 3RBXA 1FZBA 1SQQD 2C0WA 1URQB 1RE3A 2I1JA 3H6PA 1BE3E 1HTLC 3CCSP 4PD4E 1N8RQ 1N73C 1MUUA 1NU1D 1M57D 3KXDA 1T3JA 4W7YA 1D7MA 1NTKD 1PP9E 2CK3H 5AVRB 3SWFA 3M0DA 2Q1KA 3JC22 4OWFA 1KB9E 3HUSB 4OGQC 1VQNP 4EYYQ 2QJKB 1P84H 1N73A 3ITKA 4JF7A 3L71J 5CCGA 2IYOA 2PAJA 3TGUG 1MZ9A 1ZRTD 4KT0J 3V6IA 4OH8B 1RH5B 2Y0DA 5CJ0A 5APYA 1SFCC 3V5BA 2JR8A 5C39A 1NTKG 1NTMJ 1PV3A 3HE5B 4PJ0E 5AW0B 4EIJA 1YI2P 1FZCC 3KZIH 1A02F 1IZNB 3GLMA 3TDKA 1OMIA 3E1IA 5KAIH 3CX5E 2A45I 1U57A 3PRJA 3OW2O 1ZP0C 4K3AA 1FS0E 1RQVA 1X22A 2H88C 2OARA 3L4FA 3GG2A 1RF1B 3H1ID 4IL6E 2WWWA 5CBOA 3H1HG 1TU3F 5AVQB 2OYIB 1JO5A 2ZJSE 2A45H 3A0BE 1P84I 3L71G 2C9NY 4XFJA 1QVFO 3H1LD 3H32B 2KZJA 1DEEG 2VRSA 1IFPA 3AEEC 3MD0A 1PP9J 2M3EA 1U7MA 2FYZA 3E7KA 3OAKA 5KLVD 3L72E 2JKVA 1QX8A 1FZEA 3F5HA 3BRVB 3L75D 3M0AA 5KJ7C 2ZT9D 2C0XA 3R2PA 1FZGA 1SQBD 2Q7CA 5CHXA 1CSBA 3H1IG 4A7PA 5E79H 2A45G 4I2LC 2WVRA 4RJTA 1VPCA 1NU1J 3L72J 4JBZA 5H2FH 2IZ0A 2P58A 4PV1D 1NJIQ 1J2JB 2HLOA 1Q90D 3L70D 3CWBJ 1ZXGA 3LIDA 1Q7YQ 1GK6A 1M56D 4JYBA 1FZAA 1NU1E 1OWAA 2O01H 5AW3B 1EQ7A 3L73E 4ASWA 2KNCA 1L0LJ 4N6JA 4JQ0D 2ZYGA 3CI9A 2WPRA 3QWOC 5AW2B 5AW9B 1BE3G 4BXLA 2KXPB 3IN6A 2WTYA 1T2KC 3RK2B 1ZMEC 1NWQA 2K1AA 1P84D 4HJGH 4LC1A 1RF0A 1OVVA 5KLIC 3B5NC 4YPCA 2XKMA 1PFIA 2R5BA 2IPPA 3E1RA 3H1KG 2E43A 3BASA 1PGJA 3AEAC 3CX5I 3FGAD 3VMZA 1W2BO 1GTWA 1NAYA 4IFDK 1FC2C 2KSJA 5APSA 1L4AA 4U7JA 1SQVG 2IDBA 1KV4A 3SWYA 1FAVA 1GL2C 2H7HA 3L70E 1AQ5A 2HG5D 3O6QB 1VQKP 1KFMA 1Q86Q 3CC4P 1IFDA 4H0LC 5KLVJ 1MKMA 3RGUA 1VQ7P 3TGUD 1L0LG 1YBKA 2K9JB 2R3SA 1L0LK 2LKMA 4UB6E 1N73B 1AJYA 1USEA 1JY3O 1EC5A 2XNDH 2V7QH 3B5NB 2WT7A 1JMMA 2KNCB 2WPVB 1URQC 3VMAA 3TGUE 3RK2C 1VF5D 3CXHE 4K35A 4NPDA 4NPFX 3TK1A 1GZLA 5CBNA 3D6YA 1KFNA 4C46A 2QRXA 1YQ3C 1SFCA 1L0LE 4Y99C 5APUA 5KLVE 3D71A 4N78E 3V4QA 1GL2B 1Y8AA 3H32A 3JCUE 3L74D 5AVZB 3WU2E 3D6ZA 3M9HA 1KC8Q 1MFTA 5BU5A 1K04A 1CZQA 4BRYB 2XZRA 4D6TG 3GMAA 2YMKA 3LW5J 3RK3D 1XTCC 1BGYG 2YKQA 5H2FE 1GD2E 3I5CA 5DJTB 1GL2D 5AVYB 1NTMD 1NO4A 2QG4A 3CX5D 3OA7A 2G3AA 3AE9C 2H43A 1JY3N 2FXMA 3II6A 3WUTA 1W5CE 3IAOA 2GM4A 2AXTE 1PGQA 4H44C 1VQ9P 2HYNA 1FZCA 1EDLA 2AEJA 3V2NA 1QLED 3HE4B 1JNMA 2E76B 3AEDC 1NTKE 1PP9D 5AVTB 3PJSK 3U59A 2B89A 1X0TA 2E75C 2P1JA 1S4XA 2POHA 2R5DA 5TISE 1OX3A 2P2UA 4D6TJ 1GK4A 1KYOI 3NMDA 2BASA 1DIPA 2B87B 1J1DC 3HD7D 1DX7A 1KTMA 2ZYAA 3WUVA 3A3YB 1NTKJ 2YMYA 3H1HE 2KK7A 3R4YA 2N1TD 2OTLP 5AW8B 1GW4A 3HE5A 2W6JH 1GMJA 2WSEJ 4AUWA 5CMZA 1HGZA 5CCGD 5GTHE 1QEXA 1AVOA 1NTMK 4ZKUA 1YTZI 3RL0D 1HJBA 1BSNA 3VMYA 1JY3P 3S4RA 1SQPG 2Q3IA 2IZ1A 3FWNA 4PD4I 1NU1K 3CCEP 4H44D 1BDDA 5CCHA 1HF9A 4UB6H 3PP5A 2KYVA 3HD7C 2OYIA 1X9VA 2A06E 2RKLA 1L2PA 1ZR4A 5AVUB 2WITA 1M1JC 2W6BA 2OQQA 2NPSD 2Q9IA 2OGUA 1SS1A 4GKGA 2IFMA 1PL5A 1OVUA 1ZRTE 4GODA 5M1BA 5CCHC 2FY8A 3Q2YA 2HR3A 1OZHA 1NTKK 1L0NG 3BCCJ 4H13C 1IO4A 4W7ZA 4H0LD 4I7ZB 2JDIH 5AVSB 1L0LD 4DJGA 2ZFCA 4RESB 4U3FG 1AQTA 1Q2NA 1SQPJ 5L8RJ 2Y9YA 4IFMA 1IFJA 2KLUA 2WSFJ 1KYOD 4PD4H 2WZ7A 1VQ5P 1RE3C 5AW6B 3TNUA 4PV1B 2WT7B 4BRYA 2FKWB 2C9LY 1G1JA 1SQQE 2JP3A 2RMZA 2BCCG 2V7QJ 1N86A 3L72G 2V4HA 5DJUB 3I56P 1KQLA 1NKZB 2KOGA 3VP8A 3VN0A 3A2AA 2AEFA 5APTA 4DZOA 1H8AA 4PD4D 3H1IE 2ITAA 2HODA 5KLVK 2GUSA 3AEGC 2NPSC 3V2QA 1EXJA 3F89A 1SQXE 2OYIC 4JYCA 3KZIE 1SVFA 1BCCJ 2QIWA 2B9BA 5K5GB 5B66E 3CX5H 2HODB 1VL2A 3H1LE 2NPSA 1SQVJ 2R3CA 1LTJA 3GF3A 5AVWB 3A0HE 1SQXG 2M5AB 2QJYB 3U1CA 3BATA 4N3YB 2LXCB 4IL6X 1JMBA 1KORA 2ZVNB 2P10A 1PP9G 2D2CB 2GA1A 2IBZD 3H1KJ 3L74E 1NKNA 3LIEA 1Z56A 2MKVA 1VDFA 4UB8H 3HE4A 1RHZB 1CW5A 3FX0A 3G6EP 1Q82Q 2R32A 2FBWC 2XNXA 1FOSE 4AYCA 3L37A 5B5EE 1SQBG 1R5SA 3GHGC 4IOIH 1JCCA 1USDA 2L5GB 2QJYC 2WSCH 4WY4D 1LTSC 2I1KA 2LR2A 1U7JA 2KS1A 3S1KA 2KSEA 5E79E 3Q5PA 3USSA 4GOEA 3L75E 1X79B 1K73Q 1SFCB 2FXPA 1LWUB 1SQBE 1CI6A 1T2KD 1SQXJ 2QVAA 2FXOA 4N78D 2FFDC 2R44A 2FYNC 1E79H 5APWA 3SWKA 2D2CC 4DCKA 2L91A 3AE1C 3P8CD 4H0LB 2H89C 5AW4B 1YJNP 3RK3E 1IK7A 1H88A 4OVNF 2IFNA 3AE8C 5KAFE 1VQ8P 3G3ZA 3FXDA 1NAFA 1FDIA 2A06G 1KILC 1ZOYC 2M0BA 4KHXA 3AEFC 2E5TA 3CXHI 3L74J 1YQ4C 2FYNB 2IBZI 4WBAA 2IX7C 1IFNA 3AECC 2M3BA 1W2EA 2J5UA 3L73D 1KN7A 1GU5A 5BVZA 1JM0A 3O6QA 1N2DC 4TT3H 3WMM0 1M8OB 5AVXB 1BCCD 3B8EB 1JTHA 2FFDA 1VF5C 1FU1A 4C7NA 3RK2D 2XDJA 1KB9H 4HB1A 3EQ2A 4HYTB 3CCMP 5AVVB 2ZYDA 4WY4A 1FBMA 1LTBC 2N1TA 4I6MC 1P84E 3TNUB 1ZV8A 2ZAEB 3L72D 3OJAB 1EDIA 1S5LE 1SQQG 2BCCJ 2QM7A 3N7NA 4Z1MH 5BU8B 2Y0EA 1YJ9P 1HWTC 1VQLP 2XV5A 1NU1G 5APQA 1JOCA 3L71D 1QL1A 3H1LG 4GIFA 4C7RA 1VQOP 1WMKA 1N7SA 1YJWP 4LGDE 1T3UA 1LT9C 5KAIE 2E5YA 1L4AD 3P32A 1M90Q 1URQA 3CC7P 3V2RA 4ZMDA 1KILE 2Z5HA 1M1KQ 4GT1A 3L74G 1J1DB 5B5EH 1NOHA 3B5ND 2JWDA 1KQSO 1ZR2A 3UIAA 3VMXA 1GDTA 1NTME 1OIPA 1QL2A 2JEEA 1KYOH 2FYUD 2KLVA 3CXHD 1HVVA 1K05A 1J1EC 1PPJD 2N1TC 3A0BH 4HKZH 3S9OA 1LJ2A 4C7NB 3CCRP 2WSFH 2KZIA 3H1JG 3Q3DA 1YITP 2J58A 2PFXA 2YNYA 2M5AA 2PP6A 4NPEA 3B4SA 1L4AC 2Z5IA 3HRNA 3IF4A 3HTKB 1NYHA 4O9BA 1AVYA 4OGQB 5APVA 2RH0A 1PZQA 3RK3B 3L71E 3PHLA 4Y28J 3EWKA 4U3FJ 3L70J 3NTNA 4I1LA 1DH3A 2O01J 4BWNA 3SFEC 1HUCA 3IR9A 2QA4P 3BCCD 1KB9I 2KS1B 1Q81Q 1VQ6P 1YIJP 5KLVG 1FZCB 5TISH 1OW7A 1RF1A 2O01N 3L75G 3AE3C 2HFED 1J1EB 1E5WA 4EDFA 2E74D 1CI6B 1NH4A 1N7SD 3H1KD 3MTUE 4WWIA 1QVGO 3TYYA 3L35A 1URQD 3M91A 3MUDC 5AW7B 1RF1C 3PLNA 4YXDC 3B5NA 3WUUA 3RL0C 1T8ZA 2I8DA 3FXEA 4DOJA 3M9BA 5GTHH 1R5LA 2E74B 4WVZA 4Y99B 3HD7B 5KKZC 1FE6A 2CPBA 1M1JA 3L70G 3HTKA 1JTHB 3QH9A 2FFDB 1LTTC 1QGKB 3AE4C 2O1JA 1KILA 1LWUC 3AE7C 1FOSF 1LTIC 1IC2A 4EOTA 4WY4C 1N7SC 1SQXK 5EFWB 2E42A 3I55P 2O3JA 4YXWH 3C1LA 1YHQP 2E76D 2PGDA 2W6AA 1M1JB 4H13B 4L76A 2K3RA 2OTJP 1ZN5A 1LT1A 2K88A 4U3FE 2Q5UA 4M3LA 3KPEA 4GDOA 4ASVA 2YIUB 1S5LX 1X8YA 2N9YB 2Q3EA 2RN0A 3K5BA 3MUDA 3CC2P 3CCUP 1KB9D 3CWBE 4WY4B 3CCJP 1RE4A 3HUSA 3KQGA 1EZVG 3MGNA 3IFMA 1S2EA 3AE6C 1SLQA 1GU4A 2E76C 3CWBD 3CXHH 4D6TE 3GHGA 3H25A 2FYUE 2ZXXA 1LWUA 1NTMG 3L73J 1IFMA 2BEZF 3RL0B 1R8EA 1S72P 1H89A 1G2CB 4KJMA 1JUNA 3RBZA 2BCCD 3EFGA 1PIXA 2KP8A 1ZW0A 3P8CE 2FYUG 3EFFK 1PPJG 3AE2C 1FJKA 2QJPC 1LTJC 3H1JD 3MP7B 3U1AA 5GTIE 3BVHA 2W83C 2YO3A 1OVRA 3AE5C 3SFDC 2K9JA 1KQFB 1L0NE 2ZVOB 1AV1A 2QSIA 2YXRB 5B66H 1G1IA 1NVOA 1IJDB 2B88A 1S1CX 2WPSA 4MN4C 4D6TD 2Y0CA 2WPQA 3A0HH 3GHGB 1BGYD 3D70A 3O8ZA 1JCDA 2G8YA 1S9KD 3CPWO 1NTZG 1L0NJ 3BCCG 4PJ0H 2N1TB 3TGUJ 1LTGC 4I7ZC 3VOPA 1RY3A 3C8VA 3W68A 4CPGA 2OYHC 1LTJB 1DEBA 1OW8A 2FYUJ 1FDMA 1YTZT 1SQPE 2YIUC 2J59M 1JY2P 2W8ZA 3JSVC 1N7LA 3LW5H 2B87A 3G71P 1H0TB 3CMEP 3VYIA 4JPZB 4XE5B 3Q1MA 4IL6H 1BDCA 2YKPA 3RK3C 5AW1B 1SQQJ 1PGOA 1MFZA 4L74A 1NTZD 2QE7H 3CMAP 1BE3D 4PV1C 1FDOA 1IK9A 2ZXEB 3NFQA 4H13D 5APXA 1ZLLA 2OTKE 3G9RA 3M0DC 2YO2A 2ZT9C 1S5LH 3T97A 4ZNCA 3H1HJ 5KLIB 1JB0J 3PTZA 1BSHA 1L0NK 1JY2O 1LGHB 1SFCD 3P8MC 4YTPC 5KTBA 2QJKC 1SQVD 3MHVA 3MIWA 3T97B 1VQPP 3KYQA 3HUSC 1Y47A 1HGVA 3P7KA 4XA4A 1FZFA 1AFOA 2PRRA 1EDKA 2JWAA 2HPCB 1S3JA 1SQPD 1VF5B 2QM8A 1OW6A 4L75A 1JY2N 1H0TA 2NZ2A 3N4XA 3CD6P 2MJZA 1Y9BA 1GW3A 1KYOE 1DD3A 1SQQK 2KI7B 4HH2A 1EZVD 1AA0A 1KMIZ 1NGMB 3L36A 4RO0A 1DD4A 1HJ0A 1SQPK 2KB7P 4WB4A 1BCCG 3M9QA 3RL0g 3CWBG 3ZDMA 4AQRD 1NTZK 1XTGB 3GF7A 5GTIH 1IFIA 1EZVE 4L73A 3CCQP 3CCVP 1NHLA 3PH0A 1KD1Q 2XU6A 1L0ND 3SSUA 1M7LA 1EDJA 2GUVA 1BGYJ 2WSCJ 1BCCE 4W80A 3VP9A 4IFFA 4U3FD 3A5TA 3Q5RA 2KIKA 1SQXD 3H1LJ 3V4WA 3TF5A 3L75J 1KZUB 1SQVE 5KJ7A 1KQGB 2IBZG 1SQBJ 1K9MQ 1WT6A 5CCHD 3ABVC 1SP4A 2AEMA 3HD7A 3TSIA 3G4SP 2OYHB 2AXTH 2BEQD 3C9IA 4H44B 1KILB 1SQVK 2N9BA 3B71A 3H1JE 3AEBC 4EI2A 3MZWB 1VQ4P 1T6AA 3GW6A 3BCCE 2IBZE 3BRTB 4RKUJ 1NTZJ 2YXQB 3M06A 1UIIA 3H1HD 1EXIA 3CCLP 1PGPA 2NRGA 1UIXA 1WRGA 1LNQA
chains in the Genus database with same CATH topology
1FC2C 2KUBA 2K3RA 1LT1A 4GOFA 4ASVA 3RGUA 4IOIH 2SPZA 2LR2A 3S1KA 1U7JA 1EC5A 4GOEA 4K35A 4NPDA 4NPFX 5CBNA 2QRXA 2UWJE 4KJMA 2QVAA 2R44A 1LP1A 1ZW0A 1MFTA 2WMMA 2LXBA 3FXDA 5DJTB 2M0BA 1OVRA 1LP1B 1EDLA 1NVOA 1JM0A 2B88A 4MN4C 2Q1KA 2B89A 1X0TA 4HB1A 4CPGA 4EYYQ 2ZAEB 4ZNCA 1H0TB 2B87B 1EDIA 5C39A 1BDCA 2OTKE 4ZMDA 4K3AA 1BDDA 2JWDA 5CBOA 2RKLA 4HKZH 2KZIA 2KZJA 3MHVA 1DEEG 1SS1A 4GODA 2M5AA 1Y47A 1OVUA 4NPEA 1U7MA 1EDKA 1S3JA 2HR3A 1H0TA 2KI7B 1Q2NA 3ZDMA 4JBZA 2KS1B 2P58A 3PH0A 1ZXGA 5DJUB 1EDJA 4WWIA 2KIKA 4ASWA 3QWOC 4BXLA 2I8DA 3FXEA 4HJGH 5K5GB 1OVVA 3MZWB 5EFWB 2M5AB 2B87A 2LXCB 1JMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC2 C;  2KUB A;  2K3R A;  1LT1 A;  4GOF A;  4ASV A;  3RGU A;  4IOI H;  2SPZ A;  2LR2 A;  3S1K A;  1U7J A;  1EC5 A;  4GOE A;  4K35 A;  4NPD A;  4NPF X;  5CBN A;  2QRX A;  2UWJ E;  4KJM A;  2QVA A;  2R44 A;  1LP1 A;  1ZW0 A;  1MFT A;  2WMM A;  2LXB A;  3FXD A;  5DJT B;  2M0B A;  1OVR A;  1LP1 B;  1EDL A;  1NVO A;  1JM0 A;  2B88 A;  4MN4 C;  2Q1K A;  2B89 A;  1X0T A;  4HB1 A;  4CPG A;  4EYY Q;  2ZAE B;  4ZNC A;  1H0T B;  2B87 B;  1EDI A;  5C39 A;  1BDC A;  2OTK E;  4ZMD A;  4K3A A;  1BDD A;  2JWD A;  5CBO A;  2RKL A;  4HKZ H;  2KZI A;  2KZJ A;  3MHV A;  1DEE G;  1SS1 A;  4GOD A;  2M5A A;  1Y47 A;  1OVU A;  4NPE A;  1U7M A;  1EDK A;  1S3J A;  2HR3 A;  1H0T A;  2KI7 B;  1Q2N A;  3ZDM A;  4JBZ A;  2KS1 B;  2P58 A;  3PH0 A;  1ZXG A;  5DJU B;  1EDJ A;  4WWI A;  2KIK A;  4ASW A;  3QWO C;  4BXL A;  2I8D A;  3FXE A;  4HJG H;  5K5G B;  1OVV A;  3MZW B;  5EFW B;  2M5A B;  2B87 A;  2LXC B;  1JMB A; 
#chains in the Genus database with same CATH topology
 2KUB A;  4ZKP A;  1FJP A;  3KDP B;  1L4A B;  2QJP B;  1KIL D;  1HBW A;  2Q6Q A;  2W90 A;  4QMA A;  1EZV I;  4UB8 E;  3H1J J;  4GOF A;  1NTZ E;  2E75 B;  5CJ4 A;  2Z4E A;  4DT0 A;  2D2C D;  2P67 A;  2Y9Z A;  2OYH A;  2QEX P;  1SQB K;  3JCU H;  3WU2 H;  2SPZ A;  1BGY E;  2P7J A;  1OFC X;  3CLQ A;  1MV8 A;  1PPJ E;  4R4M A;  2AXC A;  3CL3 D;  1JEK A;  2W27 A;  5CCG C;  2E75 D;  2A06 D;  2H8P D;  2JO1 A;  2M8R A;  3H1I J;  2K37 A;  1G2C A;  2UWJ E;  2WSS H;  1A02 J;  4LLH A;  3A7O A;  1YYC A;  2JJL A;  2NPS B;  4OGQ D;  2BCC E;  1HH0 A;  3VTP C;  2WSE H;  1GL2 A;  2E74 C;  5KKZ B;  3L73 G;  3W67 A;  1LP1 A;  1LT9 A;  1S9K E;  5TJH A;  2FYU K;  2K9Y A;  2HPC A;  3FWL A;  2DW3 A;  1RQU A;  5KAF H;  2WMM A;  4B86 A;  1VQM P;  1BE3 J;  2LXB A;  4R4L A;  2YKO A;  1K8A Q;  1RF0 C;  3Q5S A;  3KHU A;  2IYP A;  1OXZ A;  4TLF A;  1LTA C;  2WQY C;  2CPS A;  3NXS A;  3H1K E;  1LP1 B;  1LT9 B;  1RE4 C;  2OYO A;  5AW5 B;  2O1K A;  1N7S B;  3V2P A;  5KJ7 D;  2ZT9 B;  3RBX A;  1FZB A;  1SQQ D;  2C0W A;  1URQ B;  1RE3 A;  2I1J A;  3H6P A;  1BE3 E;  1HTL C;  3CCS P;  4PD4 E;  1N8R Q;  1N73 C;  1MUU A;  1NU1 D;  1M57 D;  3KXD A;  1T3J A;  4W7Y A;  1D7M A;  1NTK D;  1PP9 E;  2CK3 H;  5AVR B;  3SWF A;  3M0D A;  2Q1K A;  3JC2 2;  4OWF A;  1KB9 E;  3HUS B;  4OGQ C;  1VQN P;  4EYY Q;  2QJK B;  1P84 H;  1N73 A;  3ITK A;  4JF7 A;  3L71 J;  5CCG A;  2IYO A;  2PAJ A;  3TGU G;  1MZ9 A;  1ZRT D;  4KT0 J;  3V6I A;  4OH8 B;  1RH5 B;  2Y0D A;  5CJ0 A;  5APY A;  1SFC C;  3V5B A;  2JR8 A;  5C39 A;  1NTK G;  1NTM J;  1PV3 A;  3HE5 B;  4PJ0 E;  5AW0 B;  4EIJ A;  1YI2 P;  1FZC C;  3KZI H;  1A02 F;  1IZN B;  3GLM A;  3TDK A;  1OMI A;  3E1I A;  5KAI H;  3CX5 E;  2A45 I;  1U57 A;  3PRJ A;  3OW2 O;  1ZP0 C;  4K3A A;  1FS0 E;  1RQV A;  1X22 A;  2H88 C;  2OAR A;  3L4F A;  3GG2 A;  1RF1 B;  3H1I D;  4IL6 E;  2WWW A;  5CBO A;  3H1H G;  1TU3 F;  5AVQ B;  2OYI B;  1JO5 A;  2ZJS E;  2A45 H;  3A0B E;  1P84 I;  3L71 G;  2C9N Y;  4XFJ A;  1QVF O;  3H1L D;  3H32 B;  2KZJ A;  1DEE G;  2VRS A;  1IFP A;  3AEE C;  3MD0 A;  1PP9 J;  2M3E A;  1U7M A;  2FYZ A;  3E7K A;  3OAK A;  5KLV D;  3L72 E;  2JKV A;  1QX8 A;  1FZE A;  3F5H A;  3BRV B;  3L75 D;  3M0A A;  5KJ7 C;  2ZT9 D;  2C0X A;  3R2P A;  1FZG A;  1SQB D;  2Q7C A;  5CHX A;  1CSB A;  3H1I G;  4A7P A;  5E79 H;  2A45 G;  4I2L C;  2WVR A;  4RJT A;  1VPC A;  1NU1 J;  3L72 J;  4JBZ A;  5H2F H;  2IZ0 A;  2P58 A;  4PV1 D;  1NJI Q;  1J2J B;  2HLO A;  1Q90 D;  3L70 D;  3CWB J;  1ZXG A;  3LID A;  1Q7Y Q;  1GK6 A;  1M56 D;  4JYB A;  1FZA A;  1NU1 E;  1OWA A;  2O01 H;  5AW3 B;  1EQ7 A;  3L73 E;  4ASW A;  2KNC A;  1L0L J;  4N6J A;  4JQ0 D;  2ZYG A;  3CI9 A;  2WPR A;  3QWO C;  5AW2 B;  5AW9 B;  1BE3 G;  4BXL A;  2KXP B;  3IN6 A;  2WTY A;  1T2K C;  3RK2 B;  1ZME C;  1NWQ A;  2K1A A;  1P84 D;  4HJG H;  4LC1 A;  1RF0 A;  1OVV A;  5KLI C;  3B5N C;  4YPC A;  2XKM A;  1PFI A;  2R5B A;  2IPP A;  3E1R A;  3H1K G;  2E43 A;  3BAS A;  1PGJ A;  3AEA C;  3CX5 I;  3FGA D;  3VMZ A;  1W2B O;  1GTW A;  1NAY A;  4IFD K;  1FC2 C;  2KSJ A;  5APS A;  1L4A A;  4U7J A;  1SQV G;  2IDB A;  1KV4 A;  3SWY A;  1FAV A;  1GL2 C;  2H7H A;  3L70 E;  1AQ5 A;  2HG5 D;  3O6Q B;  1VQK P;  1KFM A;  1Q86 Q;  3CC4 P;  1IFD A;  4H0L C;  5KLV J;  1MKM A;  3RGU A;  1VQ7 P;  3TGU D;  1L0L G;  1YBK A;  2K9J B;  2R3S A;  1L0L K;  2LKM A;  4UB6 E;  1N73 B;  1AJY A;  1USE A;  1JY3 O;  1EC5 A;  2XND H;  2V7Q H;  3B5N B;  2WT7 A;  1JMM A;  2KNC B;  2WPV B;  1URQ C;  3VMA A;  3TGU E;  3RK2 C;  1VF5 D;  3CXH E;  4K35 A;  4NPD A;  4NPF X;  3TK1 A;  1GZL A;  5CBN A;  3D6Y A;  1KFN A;  4C46 A;  2QRX A;  1YQ3 C;  1SFC A;  1L0L E;  4Y99 C;  5APU A;  5KLV E;  3D71 A;  4N78 E;  3V4Q A;  1GL2 B;  1Y8A A;  3H32 A;  3JCU E;  3L74 D;  5AVZ B;  3WU2 E;  3D6Z A;  3M9H A;  1KC8 Q;  1MFT A;  5BU5 A;  1K04 A;  1CZQ A;  4BRY B;  2XZR A;  4D6T G;  3GMA A;  2YMK A;  3LW5 J;  3RK3 D;  1XTC C;  1BGY G;  2YKQ A;  5H2F E;  1GD2 E;  3I5C A;  5DJT B;  1GL2 D;  5AVY B;  1NTM D;  1NO4 A;  2QG4 A;  3CX5 D;  3OA7 A;  2G3A A;  3AE9 C;  2H43 A;  1JY3 N;  2FXM A;  3II6 A;  3WUT A;  1W5C E;  3IAO A;  2GM4 A;  2AXT E;  1PGQ A;  4H44 C;  1VQ9 P;  2HYN A;  1FZC A;  1EDL A;  2AEJ A;  3V2N A;  1QLE D;  3HE4 B;  1JNM A;  2E76 B;  3AED C;  1NTK E;  1PP9 D;  5AVT B;  3PJS K;  3U59 A;  2B89 A;  1X0T A;  2E75 C;  2P1J A;  1S4X A;  2POH A;  2R5D A;  5TIS E;  1OX3 A;  2P2U A;  4D6T J;  1GK4 A;  1KYO I;  3NMD A;  2BAS A;  1DIP A;  2B87 B;  1J1D C;  3HD7 D;  1DX7 A;  1KTM A;  2ZYA A;  3WUV A;  3A3Y B;  1NTK J;  2YMY A;  3H1H E;  2KK7 A;  3R4Y A;  2N1T D;  2OTL P;  5AW8 B;  1GW4 A;  3HE5 A;  2W6J H;  1GMJ A;  2WSE J;  4AUW A;  5CMZ A;  1HGZ A;  5CCG D;  5GTH E;  1QEX A;  1AVO A;  1NTM K;  4ZKU A;  1YTZ I;  3RL0 D;  1HJB A;  1BSN A;  3VMY A;  1JY3 P;  3S4R A;  1SQP G;  2Q3I A;  2IZ1 A;  3FWN A;  4PD4 I;  1NU1 K;  3CCE P;  4H44 D;  1BDD A;  5CCH A;  1HF9 A;  4UB6 H;  3PP5 A;  2KYV A;  3HD7 C;  2OYI A;  1X9V A;  2A06 E;  2RKL A;  1L2P A;  1ZR4 A;  5AVU B;  2WIT A;  1M1J C;  2W6B A;  2OQQ A;  2NPS D;  2Q9I A;  2OGU A;  1SS1 A;  4GKG A;  2IFM A;  1PL5 A;  1OVU A;  1ZRT E;  4GOD A;  5M1B A;  5CCH C;  2FY8 A;  3Q2Y A;  2HR3 A;  1OZH A;  1NTK K;  1L0N G;  3BCC J;  4H13 C;  1IO4 A;  4W7Z A;  4H0L D;  4I7Z B;  2JDI H;  5AVS B;  1L0L D;  4DJG A;  2ZFC A;  4RES B;  4U3F G;  1AQT A;  1Q2N A;  1SQP J;  5L8R J;  2Y9Y A;  4IFM A;  1IFJ A;  2KLU A;  2WSF J;  1KYO D;  4PD4 H;  2WZ7 A;  1VQ5 P;  1RE3 C;  5AW6 B;  3TNU A;  4PV1 B;  2WT7 B;  4BRY A;  2FKW B;  2C9L Y;  1G1J A;  1SQQ E;  2JP3 A;  2RMZ A;  2BCC G;  2V7Q J;  1N86 A;  3L72 G;  2V4H A;  5DJU B;  3I56 P;  1KQL A;  1NKZ B;  2KOG A;  3VP8 A;  3VN0 A;  3A2A A;  2AEF A;  5APT A;  4DZO A;  1H8A A;  4PD4 D;  3H1I E;  2ITA A;  2HOD A;  5KLV K;  2GUS A;  3AEG C;  2NPS C;  3V2Q A;  1EXJ A;  3F89 A;  1SQX E;  2OYI C;  4JYC A;  3KZI E;  1SVF A;  1BCC J;  2QIW A;  2B9B A;  5K5G B;  5B66 E;  3CX5 H;  2HOD B;  1VL2 A;  3H1L E;  2NPS A;  1SQV J;  2R3C A;  1LTJ A;  3GF3 A;  5AVW B;  3A0H E;  1SQX G;  2M5A B;  2QJY B;  3U1C A;  3BAT A;  4N3Y B;  2LXC B;  4IL6 X;  1JMB A;  1KOR A;  2ZVN B;  2P10 A;  1PP9 G;  2D2C B;  2GA1 A;  2IBZ D;  3H1K J;  3L74 E;  1NKN A;  3LIE A;  1Z56 A;  2MKV A;  1VDF A;  4UB8 H;  3HE4 A;  1RHZ B;  1CW5 A;  3FX0 A;  3G6E P;  1Q82 Q;  2R32 A;  2FBW C;  2XNX A;  1FOS E;  4AYC A;  3L37 A;  5B5E E;  1SQB G;  1R5S A;  3GHG C;  4IOI H;  1JCC A;  1USD A;  2L5G B;  2QJY C;  2WSC H;  4WY4 D;  1LTS C;  2I1K A;  2LR2 A;  1U7J A;  2KS1 A;  3S1K A;  2KSE A;  5E79 E;  3Q5P A;  3USS A;  4GOE A;  3L75 E;  1X79 B;  1K73 Q;  1SFC B;  2FXP A;  1LWU B;  1SQB E;  1CI6 A;  1T2K D;  1SQX J;  2QVA A;  2FXO A;  4N78 D;  2FFD C;  2R44 A;  2FYN C;  1E79 H;  5APW A;  3SWK A;  2D2C C;  4DCK A;  2L91 A;  3AE1 C;  3P8C D;  4H0L B;  2H89 C;  5AW4 B;  1YJN P;  3RK3 E;  1IK7 A;  1H88 A;  4OVN F;  2IFN A;  3AE8 C;  5KAF E;  1VQ8 P;  3G3Z A;  3FXD A;  1NAF A;  1FDI A;  2A06 G;  1KIL C;  1ZOY C;  2M0B A;  4KHX A;  3AEF C;  2E5T A;  3CXH I;  3L74 J;  1YQ4 C;  2FYN B;  2IBZ I;  4WBA A;  2IX7 C;  1IFN A;  3AEC C;  2M3B A;  1W2E A;  2J5U A;  3L73 D;  1KN7 A;  1GU5 A;  5BVZ A;  1JM0 A;  3O6Q A;  1N2D C;  4TT3 H;  3WMM 0;  1M8O B;  5AVX B;  1BCC D;  3B8E B;  1JTH A;  2FFD A;  1VF5 C;  1FU1 A;  4C7N A;  3RK2 D;  2XDJ A;  1KB9 H;  4HB1 A;  3EQ2 A;  4HYT B;  3CCM P;  5AVV B;  2ZYD A;  4WY4 A;  1FBM A;  1LTB C;  2N1T A;  4I6M C;  1P84 E;  3TNU B;  1ZV8 A;  2ZAE B;  3L72 D;  3OJA B;  1EDI A;  1S5L E;  1SQQ G;  2BCC J;  2QM7 A;  3N7N A;  4Z1M H;  5BU8 B;  2Y0E A;  1YJ9 P;  1HWT C;  1VQL P;  2XV5 A;  1NU1 G;  5APQ A;  1JOC A;  3L71 D;  1QL1 A;  3H1L G;  4GIF A;  4C7R A;  1VQO P;  1WMK A;  1N7S A;  1YJW P;  4LGD E;  1T3U A;  1LT9 C;  5KAI E;  2E5Y A;  1L4A D;  3P32 A;  1M90 Q;  1URQ A;  3CC7 P;  3V2R A;  4ZMD A;  1KIL E;  2Z5H A;  1M1K Q;  4GT1 A;  3L74 G;  1J1D B;  5B5E H;  1NOH A;  3B5N D;  2JWD A;  1KQS O;  1ZR2 A;  3UIA A;  3VMX A;  1GDT A;  1NTM E;  1OIP A;  1QL2 A;  2JEE A;  1KYO H;  2FYU D;  2KLV A;  3CXH D;  1HVV A;  1K05 A;  1J1E C;  1PPJ D;  2N1T C;  3A0B H;  4HKZ H;  3S9O A;  1LJ2 A;  4C7N B;  3CCR P;  2WSF H;  2KZI A;  3H1J G;  3Q3D A;  1YIT P;  2J58 A;  2PFX A;  2YNY A;  2M5A A;  2PP6 A;  4NPE A;  3B4S A;  1L4A C;  2Z5I A;  3HRN A;  3IF4 A;  3HTK B;  1NYH A;  4O9B A;  1AVY A;  4OGQ B;  5APV A;  2RH0 A;  1PZQ A;  3RK3 B;  3L71 E;  3PHL A;  4Y28 J;  3EWK A;  4U3F J;  3L70 J;  3NTN A;  4I1L A;  1DH3 A;  2O01 J;  4BWN A;  3SFE C;  1HUC A;  3IR9 A;  2QA4 P;  3BCC D;  1KB9 I;  2KS1 B;  1Q81 Q;  1VQ6 P;  1YIJ P;  5KLV G;  1FZC B;  5TIS H;  1OW7 A;  1RF1 A;  2O01 N;  3L75 G;  3AE3 C;  2HFE D;  1J1E B;  1E5W A;  4EDF A;  2E74 D;  1CI6 B;  1NH4 A;  1N7S D;  3H1K D;  3MTU E;  4WWI A;  1QVG O;  3TYY A;  3L35 A;  1URQ D;  3M91 A;  3MUD C;  5AW7 B;  1RF1 C;  3PLN A;  4YXD C;  3B5N A;  3WUU A;  3RL0 C;  1T8Z A;  2I8D A;  3FXE A;  4DOJ A;  3M9B A;  5GTH H;  1R5L A;  2E74 B;  4WVZ A;  4Y99 B;  3HD7 B;  5KKZ C;  1FE6 A;  2CPB A;  1M1J A;  3L70 G;  3HTK A;  1JTH B;  3QH9 A;  2FFD B;  1LTT C;  1QGK B;  3AE4 C;  2O1J A;  1KIL A;  1LWU C;  3AE7 C;  1FOS F;  1LTI C;  1IC2 A;  4EOT A;  4WY4 C;  1N7S C;  1SQX K;  5EFW B;  2E42 A;  3I55 P;  2O3J A;  4YXW H;  3C1L A;  1YHQ P;  2E76 D;  2PGD A;  2W6A A;  1M1J B;  4H13 B;  4L76 A;  2K3R A;  2OTJ P;  1ZN5 A;  1LT1 A;  2K88 A;  4U3F E;  2Q5U A;  4M3L A;  3KPE A;  4GDO A;  4ASV A;  2YIU B;  1S5L X;  1X8Y A;  2N9Y B;  2Q3E A;  2RN0 A;  3K5B A;  3MUD A;  3CC2 P;  3CCU P;  1KB9 D;  3CWB E;  4WY4 B;  3CCJ P;  1RE4 A;  3HUS A;  3KQG A;  1EZV G;  3MGN A;  3IFM A;  1S2E A;  3AE6 C;  1SLQ A;  1GU4 A;  2E76 C;  3CWB D;  3CXH H;  4D6T E;  3GHG A;  3H25 A;  2FYU E;  2ZXX A;  1LWU A;  1NTM G;  3L73 J;  1IFM A;  2BEZ F;  3RL0 B;  1R8E A;  1S72 P;  1H89 A;  1G2C B;  4KJM A;  1JUN A;  3RBZ A;  2BCC D;  3EFG A;  1PIX A;  2KP8 A;  1ZW0 A;  3P8C E;  2FYU G;  3EFF K;  1PPJ G;  3AE2 C;  1FJK A;  2QJP C;  1LTJ C;  3H1J D;  3MP7 B;  3U1A A;  5GTI E;  3BVH A;  2W83 C;  2YO3 A;  1OVR A;  3AE5 C;  3SFD C;  2K9J A;  1KQF B;  1L0N E;  2ZVO B;  1AV1 A;  2QSI A;  2YXR B;  5B66 H;  1G1I A;  1NVO A;  1IJD B;  2B88 A;  1S1C X;  2WPS A;  4MN4 C;  4D6T D;  2Y0C A;  2WPQ A;  3A0H H;  3GHG B;  1BGY D;  3D70 A;  3O8Z A;  1JCD A;  2G8Y A;  1S9K D;  3CPW O;  1NTZ G;  1L0N J;  3BCC G;  4PJ0 H;  2N1T B;  3TGU J;  1LTG C;  4I7Z C;  3VOP A;  1RY3 A;  3C8V A;  3W68 A;  4CPG A;  2OYH C;  1LTJ B;  1DEB A;  1OW8 A;  2FYU J;  1FDM A;  1YTZ T;  1SQP E;  2YIU C;  2J59 M;  1JY2 P;  2W8Z A;  3JSV C;  1N7L A;  3LW5 H;  2B87 A;  3G71 P;  1H0T B;  3CME P;  3VYI A;  4JPZ B;  4XE5 B;  3Q1M A;  4IL6 H;  1BDC A;  2YKP A;  3RK3 C;  5AW1 B;  1SQQ J;  1PGO A;  1MFZ A;  4L74 A;  1NTZ D;  2QE7 H;  3CMA P;  1BE3 D;  4PV1 C;  1FDO A;  1IK9 A;  2ZXE B;  3NFQ A;  4H13 D;  5APX A;  1ZLL A;  2OTK E;  3G9R A;  3M0D C;  2YO2 A;  2ZT9 C;  1S5L H;  3T97 A;  4ZNC A;  3H1H J;  5KLI B;  1JB0 J;  3PTZ A;  1BSH A;  1L0N K;  1JY2 O;  1LGH B;  1SFC D;  3P8M C;  4YTP C;  5KTB A;  2QJK C;  1SQV D;  3MHV A;  3MIW A;  3T97 B;  1VQP P;  3KYQ A;  3HUS C;  1Y47 A;  1HGV A;  3P7K A;  4XA4 A;  1FZF A;  1AFO A;  2PRR A;  1EDK A;  2JWA A;  2HPC B;  1S3J A;  1SQP D;  1VF5 B;  2QM8 A;  1OW6 A;  4L75 A;  1JY2 N;  1H0T A;  2NZ2 A;  3N4X A;  3CD6 P;  2MJZ A;  1Y9B A;  1GW3 A;  1KYO E;  1DD3 A;  1SQQ K;  2KI7 B;  4HH2 A;  1EZV D;  1AA0 A;  1KMI Z;  1NGM B;  3L36 A;  4RO0 A;  1DD4 A;  1HJ0 A;  1SQP K;  2KB7 P;  4WB4 A;  1BCC G;  3M9Q A;  3RL0 g;  3CWB G;  3ZDM A;  4AQR D;  1NTZ K;  1XTG B;  3GF7 A;  5GTI H;  1IFI A;  1EZV E;  4L73 A;  3CCQ P;  3CCV P;  1NHL A;  3PH0 A;  1KD1 Q;  2XU6 A;  1L0N D;  3SSU A;  1M7L A;  1EDJ A;  2GUV A;  1BGY J;  2WSC J;  1BCC E;  4W80 A;  3VP9 A;  4IFF A;  4U3F D;  3A5T A;  3Q5R A;  2KIK A;  1SQX D;  3H1L J;  3V4W A;  3TF5 A;  3L75 J;  1KZU B;  1SQV E;  5KJ7 A;  1KQG B;  2IBZ G;  1SQB J;  1K9M Q;  1WT6 A;  5CCH D;  3ABV C;  1SP4 A;  2AEM A;  3HD7 A;  3TSI A;  3G4S P;  2OYH B;  2AXT H;  2BEQ D;  3C9I A;  4H44 B;  1KIL B;  1SQV K;  2N9B A;  3B71 A;  3H1J E;  3AEB C;  4EI2 A;  3MZW B;  1VQ4 P;  1T6A A;  3GW6 A;  3BCC E;  2IBZ E;  3BRT B;  4RKU J;  1NTZ J;  2YXQ B;  3M06 A;  1UII A;  3H1H D;  1EXI A;  3CCL P;  1PGP A;  2NRG A;  1UIX A;  1WRG A;  1LNQ A; 
#chains in the Genus database with same CATH homology
 1FC2 C;  2KUB A;  2K3R A;  1LT1 A;  4GOF A;  4ASV A;  3RGU A;  4IOI H;  2SPZ A;  2LR2 A;  3S1K A;  1U7J A;  1EC5 A;  4GOE A;  4K35 A;  4NPD A;  4NPF X;  5CBN A;  2QRX A;  2UWJ E;  4KJM A;  2QVA A;  2R44 A;  1LP1 A;  1ZW0 A;  1MFT A;  2WMM A;  2LXB A;  3FXD A;  5DJT B;  2M0B A;  1OVR A;  1LP1 B;  1EDL A;  1NVO A;  1JM0 A;  2B88 A;  4MN4 C;  2Q1K A;  2B89 A;  1X0T A;  4HB1 A;  4CPG A;  4EYY Q;  2ZAE B;  4ZNC A;  1H0T B;  2B87 B;  1EDI A;  5C39 A;  1BDC A;  2OTK E;  4ZMD A;  4K3A A;  1BDD A;  2JWD A;  5CBO A;  2RKL A;  4HKZ H;  2KZI A;  2KZJ A;  3MHV A;  1DEE G;  1SS1 A;  4GOD A;  2M5A A;  1Y47 A;  1OVU A;  4NPE A;  1U7M A;  1EDK A;  1S3J A;  2HR3 A;  1H0T A;  2KI7 B;  1Q2N A;  3ZDM A;  4JBZ A;  2KS1 B;  2P58 A;  3PH0 A;  1ZXG A;  5DJU B;  1EDJ A;  4WWI A;  2KIK A;  4ASW A;  3QWO C;  4BXL A;  2I8D A;  3FXE A;  4HJG H;  5K5G B;  1OVV A;  3MZW B;  5EFW B;  2M5A B;  2B87 A;  2LXC B;  1JMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...