1LT1A

Sliding helix induced change of coordination geometry in a model di-mn(ii) protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQGIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sliding helix and change of coordination geometry in a model di-MnII protein
pubmed doi rcsb
molecule tags De novo protein
molecule keywords L13G-DF1
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1lt1A00
1MFTA 4KJMA 4CPGA 4ZMDA 3FXEA 1SS1A 4IOIH 1NVOA 1ZW0A 1LP1A 4NPFX 3RGUA 4HJGH 5C39A 4ASVA 5DJTB 2B87A 2M0BA 4BXLA 5EFWB 3PH0A 1EDLA 2HR3A 2LXBA 3ZDMA 2JWDA 5CBOA 1EC5A 4GOFA 1ZXGA 2B87B 1EDIA 2LR2A 4JBZA 2KIKA 4GODA 4EYYQ 1EDKA 4NPEA 2QVAA 1OVVA 2RKLA 4HB1A 4MN4C 4HKZH 4NPDA 1OVRA 1Y47A 2I8DA 1X0TA 2B88A 1DEEG 2KS1B 4GOEA 2OTKE 2LXCB 2Q1KA 1Q2NA 4K3AA 4ZNCA 1OVUA 1FC2C 2KZJA 2KUBA 1JM0A 1LT1A 2R44A 2WMMA 2QRXA 1U7JA 4WWIA 2K3RA 1H0TA 2P58A 1EDJA 3QWOC 3MHVA 1H0TB 4ASWA 1S3JA 5K5GB 1BDCA 5DJUB 2B89A 2M5AB 2UWJE 3S1KA 2M5AA 1LP1B 1BDDA 2ZAEB 4K35A 1U7MA 1JMBA 2KZIA 3FXDA 2SPZA 5CBNA 2KI7B 3MZWB
chains in the Genus database with same CATH superfamily
3AEGC 4H44C 2C9LY 2WPQA 5TJHA 5TISE 1OW8A 5AW7B 5CCGA 1E79H 3FXEA 4IOIH 2KNCA 1RF0A 2N1TD 1OIPA 5AW2B 1NU1D 2VRSA 3L72E 1SQBE 3OJAB 5AW6B 3SWKA 1DEBA 5KLVJ 3U1CA 2OGUA 4IL6X 2O1JA 2O1KA 4Z1MH 3H1JD 1A02F 1HBWA 1RHZB 1T3JA 2HLOA 1GZLA 1LP1A 2POHA 3GMAA 3WUTA 2K9JB 5CCHC 2OYIC 1QVGO 2O3JA 1W2EA 1R8EA 2FYZA 1VQ9P 1M1JA 3LW5H 2Q3EA 5AW0B 3V4QA 4W7ZA 2QJKC 1L0LE 1XTCC 1G1IA 2N1TC 2Y0DA 2G3AA 3GG2A 5KAIE 1AVYA 4L73A 4D6TJ 5B5EH 2GUSA 2BCCG 3CLQA 1BCCJ 2QE7H 3CWBD 1S72P 4LGDE 5DJTB 1M1JC 1SQPK 1NH4A 2WT7B 1LTTC 2BCCJ 2W90A 2P67A 2ZVNB 1NWQA 3CWBG 3HTKB 4YXWH 4N6JA 1JY2O 1KB9H 1KZUB 1FJKA 1NHLA 2HR3A 2WSCJ 1FZCC 2J58A 1VQ6P 1KFMA 3WMM0 1SQVE 1FOSE 1VQOP 1MFZA 2K88A 3OAKA 5CBOA 1T6AA 2XDJA 3OA7A 1VQMP 2CPSA 2GM4A 3ITKA 1LTSC 3HD7A 1VF5B 2H8PD 1CSBA 2W8ZA 2WWWA 2YMKA 1LTJA 2HYNA 3M0DC 3TSIA 3L71D 5KLVG 5APQA 2HPCB 1M1JB 2LR2A 2P1JA 3L71E 2QJPC 5AVYB 1URQB 4C7RA 3OW2O 1VQLP 1DIPA 1X79B 2JKVA 2YNYA 3AE3C 3L37A 5KLVD 1GTWA 4EYYQ 1PGPA 1IO4A 1QL1A 1P84H 3MD0A 1L0LK 1M56D 3CCVP 1SQPD 1NGMB 3MUDA 5KKZB 2V7QJ 1OFCX 1SQPE 2ZT9D 4W80A 3G6EP 3Q5RA 1BE3G 1SQBJ 1VF5C 2WSCH 3FWNA 5B5EE 5KAIH 1CI6B 4HYTB 1ZR2A 1KYOI 1OZHA 2AEFA 3Q3DA 4EI2A 1QVFO 3HE5B 3AE9C 1OVRA 1Y47A 2ZT9B 1KTMA 3W68A 1BE3D 3MP7B 1BSNA 2CPBA 1BGYG 1KN7A 3JC22 3F5HA 1L0LJ 2LXCB 3CCSP 2OQQA 2R5BA 3WU2H 1LWUA 2WITA 3MIWA 1NTKD 4N3YB 2WT7A 5GTIH 1TU3F 5KLIB 2Y0CA 1FC2C 1LTIC 4I7ZB 1SQXK 1BGYD 2GUVA 1YJWP 3SSUA 1OWAA 2GA1A 3H1KJ 3PP5A 4AYCA 1HF9A 1FDIA 1KQSO 2WMMA 1NTME 4EDFA 2A45H 1S4XA 3P32A 1BCCG 1LWUC 4IL6H 1GMJA 4H13B 1U7JA 3K5BA 4D6TG 2FYNC 1DD4A 1PP9E 1KILA 1GL2A 1QGKB 1EQ7A 2WSEH 3MZWB 4I2LC 1HGZA 1M57D 1PP9D 3L70G 3P8MC 5AW5B 3KPEA 1SQVJ 2FYUG 1YHQP 2ZYDA 2OARA 1NTZD 3QWOC 1SQQD 4RJTA 3H1IG 1Q7YQ 1JY3P 3CXHH 3L4FA 4QMAA 3MHVA 3RL0D 3O6QB 4ASWA 3L73E 1GL2C 2KSJA 3S4RA 3EFFK 4H44D 1BDCA 1GDTA 1Q90D 5DJUB 3H1ID 3A0HH 1P84E 3L71J 2B89A 2I1KA 2UWJE 3IFMA 3H1IE 3S1KA 1W2BO 3H1HJ 4UB6H 1HUCA 2FYUJ 1H8AA 3HD7D 1J1EB 3H1LG 1KILE 2MJZA 3L70J 4WY4D 2ZAEB 1CZQA 3A0BE 3H1KD 4YTPC 4A7PA 1KILD 1JMMA 3L75D 1S5LE 3O6QA 4N78E 2KZIA 1GK4A 1GL2D 2KS1A 3KXDA 3V2PA 5AW3B 2P7JA 1YI2P 4L74A 3H1LD 3AE2C 2WQYC 3H1KG 3NTNA 5CMZA 3VP9A 1YTZT 3MTUE 1S2EA 4B86A 1M8OB 3JCUE 1SFCC 1PPJG 5APYA 5AVRB 1YJ9P 3FWLA 1UIXA 3HD7C 1GL2B 3CCUP 1T3UA 2FBWC 4BRYB 1JB0J 1LTAC 1LTJC 1KILC 4ZMDA 4KT0J 2O01N 3AE4C 2C9NY 1IC2A 1RF1C 1HWTC 1Z56A 1BGYJ 3RK3C 2NPSB 3EFGA 3QH9A 2IPPA 5APUA 5M1BA 1OXZA 3VN0A 2M8RA 1JOCA 1S1CX 2FYNB 4L76A 2KB7P 4WY4C 1LT9A 5AVQB 1PFIA 1IFIA 2RH0A 5H2FH 5BU8B 1DD3A 5KAFH 1L0LD 2HODB 2I1JA 1SQQK 2Y9YA 4I6MC 4JYBA 1KMIZ 1QLED 3RGUA 1RF1A 1FZBA 2DW3A 2C0WA 3H32A 3L36A 1ZR4A 2QSIA 5C39A 1YBKA 4JQ0D 3IAOA 1Y9BA 3HE5A 4ASVA 1VQNP 3II6A 1GW3A 2B87A 3FX0A 1KQFB 5CCGD 3Q5PA 1VQ7P 1NTZG 1EXJA 3WU2E 1AQ5A 4BXLA 3T97B 3I56P 2BASA 2R3SA 1SQPJ 1LTBC 2IBZI 4AUWA 1USEA 1LGHB 3GHGA 1L4AD 1S5LH 3G3ZA 1NTKK 3WUUA 3AE5C 1SQVK 2E74B 2WZ7A 1AVOA 4YPCA 2P10A 2YIUB 3JSVC 2CK3H 3PJSK 3CX5H 4BRYA 1PV3A 4GOFA 4H13C 1JY3O 1GU5A 4GIFA 1SQXJ 2BEZF 2YO2A 3B5NB 1OW6A 3BRTB 2QEXP 1EZVG 2ZYGA 4RO0A 4U3FD 2QJYC 1IK7A 5E79E 3S9OA 4U3FE 3CWBE 1IZNB 5GTHH 3TNUB 2FYUK 1OW7A 1LNQA 2A45G 5AW4B 5CJ0A 1K04A 3CMAP 4WB4A 1NAYA 1P84I 2E75C 2OYIB 2OTLP 3CX5D 1UIIA 2KK7A 4WVZA 1KQGB 1RY3A 2D2CD 3Q5SA 5CCHD 2E76D 4MN4C 3B4SA 4NPDA 1WMKA 1BCCE 1HGVA 1PIXA 1SQBK 2B88A 1DEEG 2E74D 2IFNA 1URQC 2QJPB 3JCUH 2E75D 1RQVA 3M9QA 4LC1A 2XU6A 1PZQA 2E76B 2OTKE 3B5NA 1HTLC 2L91A 4GOEA 1VPCA 2N1TA 3D71A 5AW8B 1L0NJ 1IK9A 1J1DC 2K9JA 1WT6A 2JWAA 3BCCG 4O9BA 3SWYA 4H0LC 3CCJP 1BSHA 4XE5B 1S5LX 1YTZI 2NRGA 4RESB 2JO1A 2R44A 3RK3B 3CXHD 4PJ0H 3U59A 1LJ2A 3RBXA 5KTBA 3CD6P 1J1EC 2WPSA 3TGUJ 1AJYA 2K37A 1N2DC 3B5NC 4W7YA 2OYHA 1FZCB 2Q9IA 1ZOYC 2H88C 4GDOA 2K3RA 3VYIA 1GK6A 1OX3A 1BE3E 2QM8A 1RQUA 2A06D 1KYOE 1PL5A 1W5CE 2A06E 1EZVD 4U3FG 3CXHI 1N73C 1X9VA 2PAJA 1EZVE 5K5GB 5AVXB 1NU1E 3L72D 1SQBD 1KB9D 2A06G 4U3FJ 2M5AB 4PD4E 3H1JE 1YQ3C 1KB9E 1NOHA 3M0AA 2QIWA 2HFED 2NZ2A 3VMAA 3AEAC 2QG4A 2IYPA 3L75E 2YKPA 4JYCA 2AXTE 3PLNA 4L75A 4WBAA 3EQ2A 1GU4A 2AEJA 1ZRTE 3AEBC 5AVVB 3CCQP 1L4AA 1HJBA 1S9KD 3A0HE 1ZRTD 2SPZA 2V4HA 4BWNA 1JUNA 2H89C 2N1TB 1AQTA 1NU1G 2KI7B 1NTZE 3M9HA 1JM0A 1L0NK 3L74G 4KJMA 3CC2P 3C1LA 2KYVA 3M0DA 4PV1B 3HE4A 3H1JJ 2WSFJ 3KQGA 5KAFE 4R4MA 1SS1A 3R2PA 1VQ8P 2YXQB 3L73D 1IFMA 1L0NG 4H0LB 2KOGA 1KORA 3L75J 3VMYA 1Y8AA 3Q2YA 1Q86Q 2W6JH 3E1IA 4EOTA 2YKOA 4GKGA 4DZOA 1H89A 1FZCA 3CPWO 4DOJA 2NPSD 3L73G 1JEKA 1SQVD 2FFDB 1IFDA 1QX8A 2W6BA 3IF4A 2XV5A 4XA4A 4ZKUA 1YQ4C 3N4XA 5AVWB 2Z4EA 4UB8H 1PGOA 3CC4P 3CX5I 1G2CA 4HJGH 2IDBA 3H1LE 2IYOA 2K1AA 1SQQJ 2XNDH 1N73B 2R32A 3A3YB 1JO5A 2AEMA 1H88A 1Q82Q 3KZIH 3SFEC 2M0BA 3LW5J 1PPJE 1YYCA 4PJ0E 2C0XA 4D6TE 2PP6A 1M90Q 1D7MA 1VQKP 1SVFA 1FU1A 1X22A 1L4AB 2OYHC 2WSEJ 1N7SC 1EDLA 4JPZB 1IJDB 3VP8A 4IFDK 2LXBA 4UB8E 4LLHA 3SFDC 3ZDMA 2RMZA 3L70E 4EIJA 1SQXG 1PP9G 2RN0A 3L70D 1ZP0C 3LIEA 1N73A 3Q1MA 3LIDA 1GD2E 2JP3A 1EC5A 2IBZE 1KB9I 2Q7CA 2ZJSE 1SFCB 3N7NA 5AVZB 1K9MQ 2IBZD 1ZXGA 2BEQD 2QM7A 2B87B 4DT0A 1VDFA 1EZVI 5B66E 1K73Q 2W6AA 3VMZA 4C7NB 1SQPG 3L35A 4M3LA 3V6IA 3GLMA 3L74J 2KIKA 2ZXEB 3ABVC 4JF7A 1FJPA 2P2UA 2ZVOB 1HH0A 3HUSA 1BGYE 1NTZJ 2HODA 2W27A 1IFJA 4H13D 1J1DB 2O01H 4PD4H 4XFJA 5KLIC 3CCLP 1FZAA 2V7QH 1N7LA 4NPEA 2D2CB 4Y99C 5B66H 2G8YA 2AXTH 4OH8B 4HB1A 2WSFH 2KSEA 3CMEP 3B5ND 4IFFA 1FDMA 3HUSC 3AEFC 4HKZH 5CCGC 1NKNA 1FS0E 2QJYB 2H7HA 3L74E 1FDOA 3AEEC 2WPVB 3TF5A 1FAVA 1L4AC 5APTA 5AVTB 5CJ4A 2IZ0A 2XNXA 1JNMA 1NTZK 3G9RA 3H6PA 3HD7B 4K3AA 4U7JA 5CHXA 1OVUA 1LTGC 1N86A 5APWA 2ZXXA 3VMXA 4C46A 5KLVE 1VQPP 1G2CB 2FXMA 1LT1A 1NTMJ 2E74C 3VOPA 3CCEP 1NTKG 2AXCA 3CX5E 3H1KE 3M9BA 3HTKA 2QRXA 3RK3D 3TGUG 4N78D 1MUUA 1SQQG 3V2NA 1T2KD 1VQ4P 3RK3E 2ITAA 3B8EB 2FXPA 3RL0B 1CW5A 1M7LA 3TK1A 1SQXD 3RBZA 5KJ7A 2QA4P 1BCCD 2XZRA 1SFCA 1NU1K 2P58A 3AE8C 3I5CA 2IZ1A 4D6TD 5GTIE 3TGUD 3TGUE 1MV8A 4OGQB 2ZYAA 3L73J 3L71G 5TISH 4RKUJ 3AE6C 3E7KA 1FBMA 1T2KC 5AW1B 1KILB 2E5TA 3L75G 2HG5D 3V2QA 5KKZC 1JTHB 4R4LA 1FZFA 1R5SA 3A5TA 1JTHA 3IR9A 1LP1B 3H1IJ 1KQLA 4K35A 3A7OA 1NTMD 2IFMA 3GHGC 2L5GB 3M06A 1AA0A 1NU1J 1N7SA 2R3CA 1G1JA 3CL3D 5AVSB 1NKZB 3G4SP 4TLFA 1NTKJ 2QJKB 1NTMG 2E76C 5KLVK 1RE4C 5CBNA 4AQRD 3FGAD 1XTGB 5E79H 1MFTA 1JCDA 3NXSA 1K05A 4CPGA 2FY8A 1NTMK 4H0LD 1A02J 1AFOA 3USSA 2KP8A 1VQ5P 2JDIH 4DCKA 3H32B 4KHXA 3D70A 5AVUB 1NVOA 1M1KQ 3BASA 1L0LG 2OYHB 1ZW0A 3MUDC 1Q81Q 2E5YA 2YXRB 4NPFX 1LT9B 3TNUA 4HH2A 3KZIE 1N8RQ 1EXIA 2OYOA 2Z5HA 3HE4B 2Y0EA 3AEDC 4Y99B 2WSSH 2NPSA 2H43A 1KYOH 2IX7C 2YIUC 1BE3J 1S9KE 1E5WA 4OGQC 3AECC 1VF5D 1X8YA 3E1RA 2KXPB 2FYUE 3PTZA 3V4WA 3NMDA 2FYUD 2Z5IA 5H2FE 1K8AQ 5APVA 1DH3A 2PRRA 3BVHA 3BCCJ 5EFWB 1URQD 4YXDC 1IFNA 3A2AA 1DX7A 3TYYA 3PH0A 3W67A 1MZ9A 1LT9C 3U1AA 2LKMA 1JY2P 3T97A 2JWDA 1R5LA 1VL2A 2FKWB 1NJIQ 3HRNA 4IL6E 2M3BA 1RE3A 1SFCD 4C7NA 1PP9J 1QEXA 4DJGA 2OYIA 1J2JB 2W83C 1N7SD 1JY2N 3RL0C 1HJ0A 5KJ7C 2JJLA 2ZT9C 1EDIA 4GT1A 3M91A 1RH5B 3PRJA 2FXOA 2M3EA 3O8ZA 4JBZA 3RL0g 1NAFA 3AE1C 3CWBJ 2JR8A 2B9BA 1NTKE 1PPJD 2NPSC 2WPRA 4Y28J 5L8RJ 1N7SB 1KC8Q 3CC7P 1OMIA 4GODA 1RE3C 1ZN5A 1SLQA 1FE6A 1U57A 2E42A 2E43A 3AE7C 1KV4A 5BU5A 3F89A 1EDKA 3H1HD 3R4YA 1YIJP 2QVAA 1OVVA 2RKLA 1YJNP 2PGDA 3H1HE 3IN6A 2OTJP 3D6ZA 5AW9B 1SP4A 2JEEA 3BATA 3GHGB 3H1LJ 3RK2B 3H1HG 2KNCB 2N9YB 4I1LA 3EWKA 1PGQA 3L74D 1ZMEC 3KHUA 3I55P 2I8DA 1X0TA 2Y9ZA 1SQQE 2KS1B 3PHLA 2YO3A 1KYOD 1RE4A 3CI9A 3TDKA 1L0ND 1L2PA 3RK2D 3GW6A 3CCRP 1FZEA 3GF7A 1L0NE 1GW4A 1T8ZA 2Q1KA 3H25A 1Q2NA 4H44B 3H1JG 3P7KA 4ZNCA 1FZGA 2FFDA 1P84D 2KZJA 1SQVG 4PD4D 2KUBA 2KLVA 1RF1B 1KD1Q 2A45I 2MKVA 3BCCE 3RK2C 4IFMA 3BCCD 4WWIA 1USDA 3UIAA 2PFXA 2Q3IA 1NYHA 3B71A 4WY4B 2WTYA 2FFDC 4OWFA 3VTPC 2BCCD 2ZFCA 1YITP 1ZLLA 4OVNF 2Q5UA 1QL2A 2BCCE 4ZKPA 3L72G 2K9YA 3GF3A 3V5BA 1EDJA 1H0TA 3V2RA 1URQA 3D6YA 3A0BH 2HPCA 1IFPA 3WUVA 1H0TB 5KJ7D 5GTHE 4PV1C 1S3JA 4I7ZC 1LTJB 1JCCA 2E75B 1AV1A 1KFNA 2J59M 2KLUA 2R5DA 4PD4I 4WY4A 5CCHA 2D2CC 3MGNA 1WRGA 3KYQA 3SWFA 2O01J 3CCMP 2M5AA 2XKMA 3NFQA 1NO4A 1LWUB 1MKMA 2WVRA 1BDDA 2YKQA 3C9IA 3CXHE 3C8VA 1SQBG 3HUSB 3L72J 3P8CD 5BVZA 1U7MA 1JMBA 1PGJA 2IBZG 3P8CE 1ZV8A 2Q6QA 5APSA 4PV1D 1FOSF 3BRVB 2J5UA 3G71P 3FXDA 4UB6E 1RF0C 2N9BA 1JY3N 5APXA 1SQXE 4OGQD 4TT3H 1CI6A 3KDPB 2YMYA 1HVVA
chains in the Genus database with same CATH topology
1MFTA 4KJMA 4CPGA 4ZMDA 3FXEA 1SS1A 4IOIH 1NVOA 1ZW0A 1LP1A 4NPFX 3RGUA 4HJGH 5C39A 4ASVA 5DJTB 2B87A 2M0BA 4BXLA 5EFWB 3PH0A 1EDLA 2HR3A 2LXBA 3ZDMA 2JWDA 5CBOA 1EC5A 4GOFA 1ZXGA 2B87B 1EDIA 2LR2A 4JBZA 2KIKA 4GODA 4EYYQ 1EDKA 4NPEA 2QVAA 1OVVA 2RKLA 4HB1A 4MN4C 4HKZH 4NPDA 1OVRA 1Y47A 2I8DA 1X0TA 2B88A 1DEEG 2KS1B 4GOEA 2OTKE 2LXCB 2Q1KA 1Q2NA 4K3AA 4ZNCA 1OVUA 1FC2C 2KZJA 2KUBA 1JM0A 1LT1A 2R44A 2WMMA 2QRXA 1U7JA 4WWIA 2K3RA 1H0TA 2P58A 1EDJA 3QWOC 3MHVA 1H0TB 4ASWA 1S3JA 5K5GB 1BDCA 5DJUB 2B89A 2M5AB 2UWJE 3S1KA 2M5AA 1LP1B 1BDDA 2ZAEB 4K35A 1U7MA 1JMBA 2KZIA 3FXDA 2SPZA 5CBNA 2KI7B 3MZWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFT A;  4KJM A;  4CPG A;  4ZMD A;  3FXE A;  1SS1 A;  4IOI H;  1NVO A;  1ZW0 A;  1LP1 A;  4NPF X;  3RGU A;  4HJG H;  5C39 A;  4ASV A;  5DJT B;  2B87 A;  2M0B A;  4BXL A;  5EFW B;  3PH0 A;  1EDL A;  2HR3 A;  2LXB A;  3ZDM A;  2JWD A;  5CBO A;  1EC5 A;  4GOF A;  1ZXG A;  2B87 B;  1EDI A;  2LR2 A;  4JBZ A;  2KIK A;  4GOD A;  4EYY Q;  1EDK A;  4NPE A;  2QVA A;  1OVV A;  2RKL A;  4HB1 A;  4MN4 C;  4HKZ H;  4NPD A;  1OVR A;  1Y47 A;  2I8D A;  1X0T A;  2B88 A;  1DEE G;  2KS1 B;  4GOE A;  2OTK E;  2LXC B;  2Q1K A;  1Q2N A;  4K3A A;  4ZNC A;  1OVU A;  1FC2 C;  2KZJ A;  2KUB A;  1JM0 A;  1LT1 A;  2R44 A;  2WMM A;  2QRX A;  1U7J A;  4WWI A;  2K3R A;  1H0T A;  2P58 A;  1EDJ A;  3QWO C;  3MHV A;  1H0T B;  4ASW A;  1S3J A;  5K5G B;  1BDC A;  5DJU B;  2B89 A;  2M5A B;  2UWJ E;  3S1K A;  2M5A A;  1LP1 B;  1BDD A;  2ZAE B;  4K35 A;  1U7M A;  1JMB A;  2KZI A;  3FXD A;  2SPZ A;  5CBN A;  2KI7 B;  3MZW B; 
#chains in the Genus database with same CATH topology
 3AEG C;  4H44 C;  2C9L Y;  2WPQ A;  5TJH A;  5TIS E;  1OW8 A;  5AW7 B;  5CCG A;  1E79 H;  3FXE A;  4IOI H;  2KNC A;  1RF0 A;  2N1T D;  1OIP A;  5AW2 B;  1NU1 D;  2VRS A;  3L72 E;  1SQB E;  3OJA B;  5AW6 B;  3SWK A;  1DEB A;  5KLV J;  3U1C A;  2OGU A;  4IL6 X;  2O1J A;  2O1K A;  4Z1M H;  3H1J D;  1A02 F;  1HBW A;  1RHZ B;  1T3J A;  2HLO A;  1GZL A;  1LP1 A;  2POH A;  3GMA A;  3WUT A;  2K9J B;  5CCH C;  2OYI C;  1QVG O;  2O3J A;  1W2E A;  1R8E A;  2FYZ A;  1VQ9 P;  1M1J A;  3LW5 H;  2Q3E A;  5AW0 B;  3V4Q A;  4W7Z A;  2QJK C;  1L0L E;  1XTC C;  1G1I A;  2N1T C;  2Y0D A;  2G3A A;  3GG2 A;  5KAI E;  1AVY A;  4L73 A;  4D6T J;  5B5E H;  2GUS A;  2BCC G;  3CLQ A;  1BCC J;  2QE7 H;  3CWB D;  1S72 P;  4LGD E;  5DJT B;  1M1J C;  1SQP K;  1NH4 A;  2WT7 B;  1LTT C;  2BCC J;  2W90 A;  2P67 A;  2ZVN B;  1NWQ A;  3CWB G;  3HTK B;  4YXW H;  4N6J A;  1JY2 O;  1KB9 H;  1KZU B;  1FJK A;  1NHL A;  2HR3 A;  2WSC J;  1FZC C;  2J58 A;  1VQ6 P;  1KFM A;  3WMM 0;  1SQV E;  1FOS E;  1VQO P;  1MFZ A;  2K88 A;  3OAK A;  5CBO A;  1T6A A;  2XDJ A;  3OA7 A;  1VQM P;  2CPS A;  2GM4 A;  3ITK A;  1LTS C;  3HD7 A;  1VF5 B;  2H8P D;  1CSB A;  2W8Z A;  2WWW A;  2YMK A;  1LTJ A;  2HYN A;  3M0D C;  3TSI A;  3L71 D;  5KLV G;  5APQ A;  2HPC B;  1M1J B;  2LR2 A;  2P1J A;  3L71 E;  2QJP C;  5AVY B;  1URQ B;  4C7R A;  3OW2 O;  1VQL P;  1DIP A;  1X79 B;  2JKV A;  2YNY A;  3AE3 C;  3L37 A;  5KLV D;  1GTW A;  4EYY Q;  1PGP A;  1IO4 A;  1QL1 A;  1P84 H;  3MD0 A;  1L0L K;  1M56 D;  3CCV P;  1SQP D;  1NGM B;  3MUD A;  5KKZ B;  2V7Q J;  1OFC X;  1SQP E;  2ZT9 D;  4W80 A;  3G6E P;  3Q5R A;  1BE3 G;  1SQB J;  1VF5 C;  2WSC H;  3FWN A;  5B5E E;  5KAI H;  1CI6 B;  4HYT B;  1ZR2 A;  1KYO I;  1OZH A;  2AEF A;  3Q3D A;  4EI2 A;  1QVF O;  3HE5 B;  3AE9 C;  1OVR A;  1Y47 A;  2ZT9 B;  1KTM A;  3W68 A;  1BE3 D;  3MP7 B;  1BSN A;  2CPB A;  1BGY G;  1KN7 A;  3JC2 2;  3F5H A;  1L0L J;  2LXC B;  3CCS P;  2OQQ A;  2R5B A;  3WU2 H;  1LWU A;  2WIT A;  3MIW A;  1NTK D;  4N3Y B;  2WT7 A;  5GTI H;  1TU3 F;  5KLI B;  2Y0C A;  1FC2 C;  1LTI C;  4I7Z B;  1SQX K;  1BGY D;  2GUV A;  1YJW P;  3SSU A;  1OWA A;  2GA1 A;  3H1K J;  3PP5 A;  4AYC A;  1HF9 A;  1FDI A;  1KQS O;  2WMM A;  1NTM E;  4EDF A;  2A45 H;  1S4X A;  3P32 A;  1BCC G;  1LWU C;  4IL6 H;  1GMJ A;  4H13 B;  1U7J A;  3K5B A;  4D6T G;  2FYN C;  1DD4 A;  1PP9 E;  1KIL A;  1GL2 A;  1QGK B;  1EQ7 A;  2WSE H;  3MZW B;  4I2L C;  1HGZ A;  1M57 D;  1PP9 D;  3L70 G;  3P8M C;  5AW5 B;  3KPE A;  1SQV J;  2FYU G;  1YHQ P;  2ZYD A;  2OAR A;  1NTZ D;  3QWO C;  1SQQ D;  4RJT A;  3H1I G;  1Q7Y Q;  1JY3 P;  3CXH H;  3L4F A;  4QMA A;  3MHV A;  3RL0 D;  3O6Q B;  4ASW A;  3L73 E;  1GL2 C;  2KSJ A;  3S4R A;  3EFF K;  4H44 D;  1BDC A;  1GDT A;  1Q90 D;  5DJU B;  3H1I D;  3A0H H;  1P84 E;  3L71 J;  2B89 A;  2I1K A;  2UWJ E;  3IFM A;  3H1I E;  3S1K A;  1W2B O;  3H1H J;  4UB6 H;  1HUC A;  2FYU J;  1H8A A;  3HD7 D;  1J1E B;  3H1L G;  1KIL E;  2MJZ A;  3L70 J;  4WY4 D;  2ZAE B;  1CZQ A;  3A0B E;  3H1K D;  4YTP C;  4A7P A;  1KIL D;  1JMM A;  3L75 D;  1S5L E;  3O6Q A;  4N78 E;  2KZI A;  1GK4 A;  1GL2 D;  2KS1 A;  3KXD A;  3V2P A;  5AW3 B;  2P7J A;  1YI2 P;  4L74 A;  3H1L D;  3AE2 C;  2WQY C;  3H1K G;  3NTN A;  5CMZ A;  3VP9 A;  1YTZ T;  3MTU E;  1S2E A;  4B86 A;  1M8O B;  3JCU E;  1SFC C;  1PPJ G;  5APY A;  5AVR B;  1YJ9 P;  3FWL A;  1UIX A;  3HD7 C;  1GL2 B;  3CCU P;  1T3U A;  2FBW C;  4BRY B;  1JB0 J;  1LTA C;  1LTJ C;  1KIL C;  4ZMD A;  4KT0 J;  2O01 N;  3AE4 C;  2C9N Y;  1IC2 A;  1RF1 C;  1HWT C;  1Z56 A;  1BGY J;  3RK3 C;  2NPS B;  3EFG A;  3QH9 A;  2IPP A;  5APU A;  5M1B A;  1OXZ A;  3VN0 A;  2M8R A;  1JOC A;  1S1C X;  2FYN B;  4L76 A;  2KB7 P;  4WY4 C;  1LT9 A;  5AVQ B;  1PFI A;  1IFI A;  2RH0 A;  5H2F H;  5BU8 B;  1DD3 A;  5KAF H;  1L0L D;  2HOD B;  2I1J A;  1SQQ K;  2Y9Y A;  4I6M C;  4JYB A;  1KMI Z;  1QLE D;  3RGU A;  1RF1 A;  1FZB A;  2DW3 A;  2C0W A;  3H32 A;  3L36 A;  1ZR4 A;  2QSI A;  5C39 A;  1YBK A;  4JQ0 D;  3IAO A;  1Y9B A;  3HE5 A;  4ASV A;  1VQN P;  3II6 A;  1GW3 A;  2B87 A;  3FX0 A;  1KQF B;  5CCG D;  3Q5P A;  1VQ7 P;  1NTZ G;  1EXJ A;  3WU2 E;  1AQ5 A;  4BXL A;  3T97 B;  3I56 P;  2BAS A;  2R3S A;  1SQP J;  1LTB C;  2IBZ I;  4AUW A;  1USE A;  1LGH B;  3GHG A;  1L4A D;  1S5L H;  3G3Z A;  1NTK K;  3WUU A;  3AE5 C;  1SQV K;  2E74 B;  2WZ7 A;  1AVO A;  4YPC A;  2P10 A;  2YIU B;  3JSV C;  2CK3 H;  3PJS K;  3CX5 H;  4BRY A;  1PV3 A;  4GOF A;  4H13 C;  1JY3 O;  1GU5 A;  4GIF A;  1SQX J;  2BEZ F;  2YO2 A;  3B5N B;  1OW6 A;  3BRT B;  2QEX P;  1EZV G;  2ZYG A;  4RO0 A;  4U3F D;  2QJY C;  1IK7 A;  5E79 E;  3S9O A;  4U3F E;  3CWB E;  1IZN B;  5GTH H;  3TNU B;  2FYU K;  1OW7 A;  1LNQ A;  2A45 G;  5AW4 B;  5CJ0 A;  1K04 A;  3CMA P;  4WB4 A;  1NAY A;  1P84 I;  2E75 C;  2OYI B;  2OTL P;  3CX5 D;  1UII A;  2KK7 A;  4WVZ A;  1KQG B;  1RY3 A;  2D2C D;  3Q5S A;  5CCH D;  2E76 D;  4MN4 C;  3B4S A;  4NPD A;  1WMK A;  1BCC E;  1HGV A;  1PIX A;  1SQB K;  2B88 A;  1DEE G;  2E74 D;  2IFN A;  1URQ C;  2QJP B;  3JCU H;  2E75 D;  1RQV A;  3M9Q A;  4LC1 A;  2XU6 A;  1PZQ A;  2E76 B;  2OTK E;  3B5N A;  1HTL C;  2L91 A;  4GOE A;  1VPC A;  2N1T A;  3D71 A;  5AW8 B;  1L0N J;  1IK9 A;  1J1D C;  2K9J A;  1WT6 A;  2JWA A;  3BCC G;  4O9B A;  3SWY A;  4H0L C;  3CCJ P;  1BSH A;  4XE5 B;  1S5L X;  1YTZ I;  2NRG A;  4RES B;  2JO1 A;  2R44 A;  3RK3 B;  3CXH D;  4PJ0 H;  3U59 A;  1LJ2 A;  3RBX A;  5KTB A;  3CD6 P;  1J1E C;  2WPS A;  3TGU J;  1AJY A;  2K37 A;  1N2D C;  3B5N C;  4W7Y A;  2OYH A;  1FZC B;  2Q9I A;  1ZOY C;  2H88 C;  4GDO A;  2K3R A;  3VYI A;  1GK6 A;  1OX3 A;  1BE3 E;  2QM8 A;  1RQU A;  2A06 D;  1KYO E;  1PL5 A;  1W5C E;  2A06 E;  1EZV D;  4U3F G;  3CXH I;  1N73 C;  1X9V A;  2PAJ A;  1EZV E;  5K5G B;  5AVX B;  1NU1 E;  3L72 D;  1SQB D;  1KB9 D;  2A06 G;  4U3F J;  2M5A B;  4PD4 E;  3H1J E;  1YQ3 C;  1KB9 E;  1NOH A;  3M0A A;  2QIW A;  2HFE D;  2NZ2 A;  3VMA A;  3AEA C;  2QG4 A;  2IYP A;  3L75 E;  2YKP A;  4JYC A;  2AXT E;  3PLN A;  4L75 A;  4WBA A;  3EQ2 A;  1GU4 A;  2AEJ A;  1ZRT E;  3AEB C;  5AVV B;  3CCQ P;  1L4A A;  1HJB A;  1S9K D;  3A0H E;  1ZRT D;  2SPZ A;  2V4H A;  4BWN A;  1JUN A;  2H89 C;  2N1T B;  1AQT A;  1NU1 G;  2KI7 B;  1NTZ E;  3M9H A;  1JM0 A;  1L0N K;  3L74 G;  4KJM A;  3CC2 P;  3C1L A;  2KYV A;  3M0D A;  4PV1 B;  3HE4 A;  3H1J J;  2WSF J;  3KQG A;  5KAF E;  4R4M A;  1SS1 A;  3R2P A;  1VQ8 P;  2YXQ B;  3L73 D;  1IFM A;  1L0N G;  4H0L B;  2KOG A;  1KOR A;  3L75 J;  3VMY A;  1Y8A A;  3Q2Y A;  1Q86 Q;  2W6J H;  3E1I A;  4EOT A;  2YKO A;  4GKG A;  4DZO A;  1H89 A;  1FZC A;  3CPW O;  4DOJ A;  2NPS D;  3L73 G;  1JEK A;  1SQV D;  2FFD B;  1IFD A;  1QX8 A;  2W6B A;  3IF4 A;  2XV5 A;  4XA4 A;  4ZKU A;  1YQ4 C;  3N4X A;  5AVW B;  2Z4E A;  4UB8 H;  1PGO A;  3CC4 P;  3CX5 I;  1G2C A;  4HJG H;  2IDB A;  3H1L E;  2IYO A;  2K1A A;  1SQQ J;  2XND H;  1N73 B;  2R32 A;  3A3Y B;  1JO5 A;  2AEM A;  1H88 A;  1Q82 Q;  3KZI H;  3SFE C;  2M0B A;  3LW5 J;  1PPJ E;  1YYC A;  4PJ0 E;  2C0X A;  4D6T E;  2PP6 A;  1M90 Q;  1D7M A;  1VQK P;  1SVF A;  1FU1 A;  1X22 A;  1L4A B;  2OYH C;  2WSE J;  1N7S C;  1EDL A;  4JPZ B;  1IJD B;  3VP8 A;  4IFD K;  2LXB A;  4UB8 E;  4LLH A;  3SFD C;  3ZDM A;  2RMZ A;  3L70 E;  4EIJ A;  1SQX G;  1PP9 G;  2RN0 A;  3L70 D;  1ZP0 C;  3LIE A;  1N73 A;  3Q1M A;  3LID A;  1GD2 E;  2JP3 A;  1EC5 A;  2IBZ E;  1KB9 I;  2Q7C A;  2ZJS E;  1SFC B;  3N7N A;  5AVZ B;  1K9M Q;  2IBZ D;  1ZXG A;  2BEQ D;  2QM7 A;  2B87 B;  4DT0 A;  1VDF A;  1EZV I;  5B66 E;  1K73 Q;  2W6A A;  3VMZ A;  4C7N B;  1SQP G;  3L35 A;  4M3L A;  3V6I A;  3GLM A;  3L74 J;  2KIK A;  2ZXE B;  3ABV C;  4JF7 A;  1FJP A;  2P2U A;  2ZVO B;  1HH0 A;  3HUS A;  1BGY E;  1NTZ J;  2HOD A;  2W27 A;  1IFJ A;  4H13 D;  1J1D B;  2O01 H;  4PD4 H;  4XFJ A;  5KLI C;  3CCL P;  1FZA A;  2V7Q H;  1N7L A;  4NPE A;  2D2C B;  4Y99 C;  5B66 H;  2G8Y A;  2AXT H;  4OH8 B;  4HB1 A;  2WSF H;  2KSE A;  3CME P;  3B5N D;  4IFF A;  1FDM A;  3HUS C;  3AEF C;  4HKZ H;  5CCG C;  1NKN A;  1FS0 E;  2QJY B;  2H7H A;  3L74 E;  1FDO A;  3AEE C;  2WPV B;  3TF5 A;  1FAV A;  1L4A C;  5APT A;  5AVT B;  5CJ4 A;  2IZ0 A;  2XNX A;  1JNM A;  1NTZ K;  3G9R A;  3H6P A;  3HD7 B;  4K3A A;  4U7J A;  5CHX A;  1OVU A;  1LTG C;  1N86 A;  5APW A;  2ZXX A;  3VMX A;  4C46 A;  5KLV E;  1VQP P;  1G2C B;  2FXM A;  1LT1 A;  1NTM J;  2E74 C;  3VOP A;  3CCE P;  1NTK G;  2AXC A;  3CX5 E;  3H1K E;  3M9B A;  3HTK A;  2QRX A;  3RK3 D;  3TGU G;  4N78 D;  1MUU A;  1SQQ G;  3V2N A;  1T2K D;  1VQ4 P;  3RK3 E;  2ITA A;  3B8E B;  2FXP A;  3RL0 B;  1CW5 A;  1M7L A;  3TK1 A;  1SQX D;  3RBZ A;  5KJ7 A;  2QA4 P;  1BCC D;  2XZR A;  1SFC A;  1NU1 K;  2P58 A;  3AE8 C;  3I5C A;  2IZ1 A;  4D6T D;  5GTI E;  3TGU D;  3TGU E;  1MV8 A;  4OGQ B;  2ZYA A;  3L73 J;  3L71 G;  5TIS H;  4RKU J;  3AE6 C;  3E7K A;  1FBM A;  1T2K C;  5AW1 B;  1KIL B;  2E5T A;  3L75 G;  2HG5 D;  3V2Q A;  5KKZ C;  1JTH B;  4R4L A;  1FZF A;  1R5S A;  3A5T A;  1JTH A;  3IR9 A;  1LP1 B;  3H1I J;  1KQL A;  4K35 A;  3A7O A;  1NTM D;  2IFM A;  3GHG C;  2L5G B;  3M06 A;  1AA0 A;  1NU1 J;  1N7S A;  2R3C A;  1G1J A;  3CL3 D;  5AVS B;  1NKZ B;  3G4S P;  4TLF A;  1NTK J;  2QJK B;  1NTM G;  2E76 C;  5KLV K;  1RE4 C;  5CBN A;  4AQR D;  3FGA D;  1XTG B;  5E79 H;  1MFT A;  1JCD A;  3NXS A;  1K05 A;  4CPG A;  2FY8 A;  1NTM K;  4H0L D;  1A02 J;  1AFO A;  3USS A;  2KP8 A;  1VQ5 P;  2JDI H;  4DCK A;  3H32 B;  4KHX A;  3D70 A;  5AVU B;  1NVO A;  1M1K Q;  3BAS A;  1L0L G;  2OYH B;  1ZW0 A;  3MUD C;  1Q81 Q;  2E5Y A;  2YXR B;  4NPF X;  1LT9 B;  3TNU A;  4HH2 A;  3KZI E;  1N8R Q;  1EXI A;  2OYO A;  2Z5H A;  3HE4 B;  2Y0E A;  3AED C;  4Y99 B;  2WSS H;  2NPS A;  2H43 A;  1KYO H;  2IX7 C;  2YIU C;  1BE3 J;  1S9K E;  1E5W A;  4OGQ C;  3AEC C;  1VF5 D;  1X8Y A;  3E1R A;  2KXP B;  2FYU E;  3PTZ A;  3V4W A;  3NMD A;  2FYU D;  2Z5I A;  5H2F E;  1K8A Q;  5APV A;  1DH3 A;  2PRR A;  3BVH A;  3BCC J;  5EFW B;  1URQ D;  4YXD C;  1IFN A;  3A2A A;  1DX7 A;  3TYY A;  3PH0 A;  3W67 A;  1MZ9 A;  1LT9 C;  3U1A A;  2LKM A;  1JY2 P;  3T97 A;  2JWD A;  1R5L A;  1VL2 A;  2FKW B;  1NJI Q;  3HRN A;  4IL6 E;  2M3B A;  1RE3 A;  1SFC D;  4C7N A;  1PP9 J;  1QEX A;  4DJG A;  2OYI A;  1J2J B;  2W83 C;  1N7S D;  1JY2 N;  3RL0 C;  1HJ0 A;  5KJ7 C;  2JJL A;  2ZT9 C;  1EDI A;  4GT1 A;  3M91 A;  1RH5 B;  3PRJ A;  2FXO A;  2M3E A;  3O8Z A;  4JBZ A;  3RL0 g;  1NAF A;  3AE1 C;  3CWB J;  2JR8 A;  2B9B A;  1NTK E;  1PPJ D;  2NPS C;  2WPR A;  4Y28 J;  5L8R J;  1N7S B;  1KC8 Q;  3CC7 P;  1OMI A;  4GOD A;  1RE3 C;  1ZN5 A;  1SLQ A;  1FE6 A;  1U57 A;  2E42 A;  2E43 A;  3AE7 C;  1KV4 A;  5BU5 A;  3F89 A;  1EDK A;  3H1H D;  3R4Y A;  1YIJ P;  2QVA A;  1OVV A;  2RKL A;  1YJN P;  2PGD A;  3H1H E;  3IN6 A;  2OTJ P;  3D6Z A;  5AW9 B;  1SP4 A;  2JEE A;  3BAT A;  3GHG B;  3H1L J;  3RK2 B;  3H1H G;  2KNC B;  2N9Y B;  4I1L A;  3EWK A;  1PGQ A;  3L74 D;  1ZME C;  3KHU A;  3I55 P;  2I8D A;  1X0T A;  2Y9Z A;  1SQQ E;  2KS1 B;  3PHL A;  2YO3 A;  1KYO D;  1RE4 A;  3CI9 A;  3TDK A;  1L0N D;  1L2P A;  3RK2 D;  3GW6 A;  3CCR P;  1FZE A;  3GF7 A;  1L0N E;  1GW4 A;  1T8Z A;  2Q1K A;  3H25 A;  1Q2N A;  4H44 B;  3H1J G;  3P7K A;  4ZNC A;  1FZG A;  2FFD A;  1P84 D;  2KZJ A;  1SQV G;  4PD4 D;  2KUB A;  2KLV A;  1RF1 B;  1KD1 Q;  2A45 I;  2MKV A;  3BCC E;  3RK2 C;  4IFM A;  3BCC D;  4WWI A;  1USD A;  3UIA A;  2PFX A;  2Q3I A;  1NYH A;  3B71 A;  4WY4 B;  2WTY A;  2FFD C;  4OWF A;  3VTP C;  2BCC D;  2ZFC A;  1YIT P;  1ZLL A;  4OVN F;  2Q5U A;  1QL2 A;  2BCC E;  4ZKP A;  3L72 G;  2K9Y A;  3GF3 A;  3V5B A;  1EDJ A;  1H0T A;  3V2R A;  1URQ A;  3D6Y A;  3A0B H;  2HPC A;  1IFP A;  3WUV A;  1H0T B;  5KJ7 D;  5GTH E;  4PV1 C;  1S3J A;  4I7Z C;  1LTJ B;  1JCC A;  2E75 B;  1AV1 A;  1KFN A;  2J59 M;  2KLU A;  2R5D A;  4PD4 I;  4WY4 A;  5CCH A;  2D2C C;  3MGN A;  1WRG A;  3KYQ A;  3SWF A;  2O01 J;  3CCM P;  2M5A A;  2XKM A;  3NFQ A;  1NO4 A;  1LWU B;  1MKM A;  2WVR A;  1BDD A;  2YKQ A;  3C9I A;  3CXH E;  3C8V A;  1SQB G;  3HUS B;  3L72 J;  3P8C D;  5BVZ A;  1U7M A;  1JMB A;  1PGJ A;  2IBZ G;  3P8C E;  1ZV8 A;  2Q6Q A;  5APS A;  4PV1 D;  1FOS F;  3BRV B;  2J5U A;  3G71 P;  3FXD A;  4UB6 E;  1RF0 C;  2N9B A;  1JY3 N;  5APX A;  1SQX E;  4OGQ D;  4TT3 H;  1CI6 A;  3KDP B;  2YMY A;  1HVV A; 
#chains in the Genus database with same CATH homology
 1MFT A;  4KJM A;  4CPG A;  4ZMD A;  3FXE A;  1SS1 A;  4IOI H;  1NVO A;  1ZW0 A;  1LP1 A;  4NPF X;  3RGU A;  4HJG H;  5C39 A;  4ASV A;  5DJT B;  2B87 A;  2M0B A;  4BXL A;  5EFW B;  3PH0 A;  1EDL A;  2HR3 A;  2LXB A;  3ZDM A;  2JWD A;  5CBO A;  1EC5 A;  4GOF A;  1ZXG A;  2B87 B;  1EDI A;  2LR2 A;  4JBZ A;  2KIK A;  4GOD A;  4EYY Q;  1EDK A;  4NPE A;  2QVA A;  1OVV A;  2RKL A;  4HB1 A;  4MN4 C;  4HKZ H;  4NPD A;  1OVR A;  1Y47 A;  2I8D A;  1X0T A;  2B88 A;  1DEE G;  2KS1 B;  4GOE A;  2OTK E;  2LXC B;  2Q1K A;  1Q2N A;  4K3A A;  4ZNC A;  1OVU A;  1FC2 C;  2KZJ A;  2KUB A;  1JM0 A;  1LT1 A;  2R44 A;  2WMM A;  2QRX A;  1U7J A;  4WWI A;  2K3R A;  1H0T A;  2P58 A;  1EDJ A;  3QWO C;  3MHV A;  1H0T B;  4ASW A;  1S3J A;  5K5G B;  1BDC A;  5DJU B;  2B89 A;  2M5A B;  2UWJ E;  3S1K A;  2M5A A;  1LP1 B;  1BDD A;  2ZAE B;  4K35 A;  1U7M A;  1JMB A;  2KZI A;  3FXD A;  2SPZ A;  5CBN A;  2KI7 B;  3MZW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...