1LT8A

Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
348
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKGQEVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
total genus 117
structure length 348
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt8A00
4CCZA 1LT7A 3BOLA 5DMNA 1Q8JA 1UMYA 1Q7MA 4M3PA 5DMLA 5DMMA 3BOFA 1Q8AA 1Q7ZA 1Q7QA 1LT8A 1Q85A
chains in the Genus database with same CATH superfamily
2PDPA 4A3HA 3EX6A 4TIMA 4GQRA 4H1ZA 4AC1X 2PB1A 4OUIA 2VWTA 5BYWA 5FIPA 4BCEA 4H7CA 4LALA 1VD6A 2AQVA 4UOZA 4XB3A 1WDQA 2R1MA 2BNJA 4EXQA 5I7GA 1A5NC 1KV5A 1BQCA 2G4JA 4AIOA 3DYOA 3WCZA 3DYMA 1AL8A 4XSLA 4L4LA 1XPGA 4L4OA 3WX7A 1ALDA 1BQGA 4LNCA 2P8CA 2I1OA 2PLCA 4HYRA 2VO5A 3W22A 5IDIA 3H22A 1EJSC 5A1AA 3H2MA 3FX4A 5AC6A 4J3ZA 2C19A 1EHAA 3Q67A 5FJPA 2A6LA 2PDFA 4Z0JA 4F0SA 3KDOA 4GFSA 3VM7A 2NXIA 3IJIA 1E55A 4CQDA 3IK4A 3OJGA 5CPMA 1KFWA 3BZJA 5RUBA 2V3EA 1KCXA 3D6NA 4GVIA 1DXIA 3T0BA 1L0PA 1OGBA 1KGWA 1PX4A 3AICA 2DVTA 2Z1VA 5JIPA 2CERA 2H3BA 4GRSA 4RJEA 2WLYA 3ZS4A 1RCXB 1NIUA 4LAOA 4PTXA 3T2QA 3KZSA 3Q58A 3MVIA 5C70A 2H6RA 4DBEA 1XIDA 4MMWA 5EB8A 1GT8A 1GOWA 4TX9A 4RDVA 5I6SA 4KEZA 2DT2A 2WC3A 1WKYA 7TIMA 1H2JA 4NZCA 3PBGA 3W1XA 1HJSA 4LXFA 1P0BA 3KX6A 4TMBA 4KETA 4HHMA 2WAGA 4O11A 4E8CA 1D9EA 4QAIA 1M04A 3NFUA 3O0FA 3EXSA 1SW3A 1KXTA 5HJYA 3AHVA 1PDZA 4X0VA 4ICNA 1IT0A 3T0AA 1RP8A 4Q4KA 1LLOA 2OOFA 1VEOA 3APYA 4HSOA 1E0XA 3WELA 1QNSA 3FA4A 4W8AA 4N9CA 3JU2A 3RPDA 1EGZA 3A5FA 1XM3A 1Y7VA 4HA3A 3TYCA 1PZ0A 3WD0A 1RLDA 1PWLA 2XH4A 3GHUA 3TFXA 4YTSA 3WLOA 3DFSA 2E7FA 3AU6A 2BFGA 2YCKX 2IPGA 1IXNA 3GDKA 3PZUA 3DFNA 1L6GA 4HD5A 3NDOA 1R7OA 1JZ2A 1LWHA 3AWOA 4JNYA 4F2UA 1M6JA 3W37A 3EPNA 1Z7AA 3V5OA 1AQ0A 3EAUA 1JZ3A 5DCBA 3TKFA 1ZCCA 4FNRA 3E9AA 4X2PA 3LGGA 5GNYA 3WUGA 1FDJA 2PGRA 3P81A 1A5UA 5BXPA 3UP8A 4PMJA 2D20A 5EBUA 4GUHA 4I7VA 3I65A 4U2ZA 2O92A 3VKDA 5H2ZA 5BU9A 3VO0A 5GJPA 3F5LA 1JCMP 1IEQA 4FLQA 4JFWA 1TCMA 4O1FA 3TZNA 2VQTA 3S5ZA 1ZTVA 1LL6A 1GHRA 4UQ9A 4YWSA 3LCGA 3CV1A 2B7PA 4FF7A 1VFSA 1FXQA 2X7WA 3IIZA 3G77A 2JEQA 4XAFA 4O18A 4Q6XA 1AL7A 4ORMA 4V33A 4H6RA 2GSEA 4LYRA 3PC0A 2QJIA 2WNNA 1OCJA 1W9PA 3A5VA 1LUCA 2FTPA 3BGJA 1TWWA 4O12A 3T8LA 3WK2A 1EC8A 3ZR4A 1TQXA 2J8GA 3CIXA 2YLLA 3B8WA 1OF8A 3W23A 3QZAA 2I5GA 5IFTA 3ZOAA 3NYDA 3WQEA 1SO5A 3ZM8A 3N9RA 2A5HA 1FTXA 4E38A 3B0XA 2YA1A 1I45A 4UTMA 5LA0A 3OHIA 2IQTA 1XLLA 1YHTA 1TZ9A 1HZYA 1E40A 2QCGA 3LBCA 4GFIA 3SUSA 3EB2A 3QRHA 1H7WA 4DUXA 2DIJA 3G24A 2ZX6A 1JAEA 1JCXA 2WWDA 1TVLA 3EOLA 1G1YA 4Q7NA 1OBAA 4O1AA 1TPVA 4C6FA 1XLKA 1K70A 1PS9A 4D6GA 3PPGA 1XKYA 5FAGA 3GTXA 2FZMA 4LUTB 4UBPC 4CN4A 4ZE4A 4JIIX 4BF7A 1H60A 4RLIA 1R38A 3N11A 5HXMA 2EG6A 2V3GA 1XLIA 5EMKA 1PHWA 2ATSA 4UTTA 4D2JA 2J7EA 4ROQA 1CLKA 1KTNA 1OZQA 1JUKA 4JTJA 2Q8LA 2E3ZA 1P4CA 3PBUA 4KRTA 2PDUA 3T2OA 3B8UA 5LNVA 4JN6A 5I3GA 3N2OA 3ZWTA 1F3WA 3RX4A 2VEIA 3RMJA 1K8CA 1BYAA 2QUNA 3CO4A 1BFNA 3V0SA 3NQEA 2PP0A 2OTDA 1EJTC 3QPEA 4AMAA 3GDMA 4AC7C 4QE5A 3L65A 1UZ4A 2GGIA 3GU1A 2KAUC 2PGEA 2CEQA 4JOMA 4H4IA 2IMRA 1VENA 4BQ2A 3D3AA 2JQXA 3C5QA 3C6CA 4FX7A 1VYRA 5DO8A 3FK4A 2J78A 4AWUA 6PTDA 4WK9A 3GDRA 2HMCA 5AHMA 1QOQA 3SY1A 2YGYA 4DZ5A 1LP6A 3C0LA 4N02A 2ZX8A 5JBEA 2F8QA 2MNRA 1IE7C 1NDZA 3F2CA 1XV8A 1WDPA 1POJA 3GW0A 1DJQA 1VRXA 1E5NA 2DU2A 3CUJA 2QCFA 5JBFA 3AUJA 1ZU8A 5KMYA 1HO4A 4FOUA 4F9DA 3RG6A 5AOUA 4ZOBA 3OLIA 3R13A 3F1QA 2B7OA 2Z29A 4Q22A 3BOFA 3L2LA 5KETA 4AHOA 3W7CA 4GCXA 5CPQA 1H1NA 4AVNA 3VD4A 1GOMA 3CT2A 2CCRA 4GACA 3GFXA 2Z2AA 4ZO6A 1HVXA 5HQLA 1TSIA 3RLUA 1GOXA 4CCDA 1LORA 2Z1XA 3SJ3A 3PJUA 3AYTA 9XIAA 3RRXA 1GORA 1ML1A 2BOEX 3USZA 2EO7A 4N6FA 1B3OA 3W73A 4KF1A 1FDZA 1UA7A 1UKOA 3EWDA 3NUKA 5K9DA 3QYQA 1J93A 3LHZA 2HVMA 2BXVA 7PTDA 2PRHA 2BV9A 2QLYA 2B31A 2GGHA 1T96A 1VFFA 3ANUA 7ODCA 3LQLA 4JYEA 3RU8X 2EPMX 4HNOA 1R8LA 4AUBA 5LHFA 1QHZA 2RH9A 4E0CA 1LWIA 3FV9A 2BVYA 2Q71A 3WMLA 4C60A 4EXBA 4B15A 3VX1A 1VH7A 4DYKA 1WQ5A 1EDQA 3PHAA 3TWBA 3KP1A 2RDUA 4W8BA 3LK6A 2ACSA 1TPDA 4IICA 3B4YA 3KRZA 1FFRA 3NGJA 1GTHA 4AIBA 3N6HA 1THFD 5GJNA 4G1KA 5KZ6A 2WQDA 3W25A 1NAL1 1QOPA 4INFA 2ZRVA 1UKSA 4Z42C 4I7WA 3KLKA 1RK5A 5HWJA 4L6DA 3OGSA 1DJXA 4O19A 1J11A 5JIWA 4FNPA 4FALA 3MHUA 3OOQA 5M5DA 1EJ7L 1HNYA 3CAVA 1V77A 1LG1A 1JUBA 1OABA 2YA2A 5LHEA 3R43A 5GQBA 3KBMA 2IUZA 1E43A 4J9JA 3ZXWA 4MG4A 3AXKA 1XGZA 2UY3A 3K2GA 3L4XA 3S6DA 3W7EA 4JQ2A 3W1RA 1S5NA 3WBAA 2OZ0A 2EPKX 5C54A 2UY4A 3GR8A 3RGTA 3ZT5A 3TN6A 2R91A 2D3NA 3PZQA 1J0ZA 2TYSA 1UD6A 2I14A 2ZUMA 3OG2A 3TC7A 3UPMA 2IPWA 1ZP4A 3VNJA 3PWAA 2J7CA 2ZKMX 3CV6A 3VM5A 3NQMA 2X41A 1S2WA 1XPYA 3VD7A 3P60A 3CMJA 1VLIA 2GL5A 2ZTJA 4Y9MA 2AL2B 4BI7A 3N73A 2FGZA 2VNCA 4L1GA 4DBWA 1SZEA 4V1YA 1PAMA 3NXLA 1GOKA 4KIEA 4NQ1A 1J12A 3VPLA 1UR2A 4XD5A 1JVNA 1WDSA 4O13A 1ELSA 3KRUA 2CWXA 2P88A 1Z89A 2OO6A 1N8FA 2V5DA 4E4PA 2XM2A 1HW6A 1WZKA 4HOXA 5ABTA 1SFLA 4MPQA 2A7RA 3WDPP 1JF6A 3K8MA 3CB8A 3NIYA 4I3GA 3Q65A 3IK2A 2IW0A 3R58A 1OFQA 1CDGA 4HA1A 1W37A 3MCOA 4B2DD 4E2DA 4LVDA 4WDWA 4QXIA 4X0NA 1Q4NX 2NQJA 1B2YA 1W32A 1H63A 3LLFA 4XVEA 3SO7A 3M0XA 3W81A 4F0LA 4I6KA 4XVDA 4HN4A 1YMYA 1CXFA 3STFA 5AYZA 4GIRA 2ZUSA 3A9IA 3TYEA 4ENLA 1G5AA 1TJPA 3S42A 3GM8A 3UT0A 1RAKA 3FIGA 3ONBA 3VI2A 3AYVA 4LSBA 2VGFA 4UR8A 1F8IA 1MRQA 3TYBA 3IJ7A 4IH3A 1V02E 3AISA 5HATA 3W2UA 4H9ZA 3MUIA 1XIFA 3H21A 4Y9PA 1TCDA 1B3YA 3BH4A 2VYOA 3KHJA 2XFWA 1KCZA 5I77A 4ASTA 2PZ0A 1K8YA 2E25A 4C5YA 3TUUA 4UTHA 1BAGA 2BHZA 1BRLA 1HKJA 1UWRA 3P84A 1V6WA 1BPLB 1TMLA 1OX4B 1H4PA 2DT0A 2WW5A 3W7MA 3TX9A 4ORIA 1Q6FA 1XYMA 3LZ5A 1HKMA 4AWTA 4FK9A 3P7YA 1AODA 3W70A 2GUUA 1DE5A 1MZHA 4RPQA 2UZ9A 4HQVA 4WXZA 3U6WA 3ZJ8A 4JPGA 1IIHA 3DBNA 4PUKA 3ABOA 4IM4A 4YTTA 4CD8A 4GUIA 2KX9A 3B9OA 5C6MA 3M0JA 4L7ZA 4TV5A 1PZ1A 4U3CA 2CLHA 2F6XA 3RCMA 3D47A 4NJGA 1EH9A 4LY4A 4GIYA 2PP1A 3T8QA 2Y8VA 4QS5A 4B4HA 2W0UA 1AW5A 2XN2A 3NL3A 4PA8A 4QGCA 1N8IA 5LZLA 3VOIA 5FI8A 1QAPA 3WLNA 3PSVA 3QTGA 3C3UA 2YIHA 4FXFA 5BW6A 1R0MA 3INPA 4GABA 4K8EA 3ZJ6A 1JZ7A 1PIIA 1UWQA 3P14A 4AF0B 1HO1A 3L4UA 1J01A 4AH7A 3UD6A 3KDNA 3Q45A 5GNZA 3SSJA 1N8WA 1XG4A 7A3HA 4HNCA 3C2EA 1Z42A 4B91A 3GYCA 2J75A 1OT2A 1JDCA 5TNVA 3CYJA 1VHNA 3G8RA 3R7MA 2WYSA 2JKPA 3AMDA 4K7YA 4JCLA 5J5RA 1KRMA 1QNQA 2ZRUA 4W88A 1WCGA 1JUEA 5C71A 2WPBA 4JYDA 4U33A 4XZ9A 3LLXA 1QBBA 4AZ5A 2CXGA 4H9TA 4M7TA 4DQWA 1P48A 2WM0A 2BHUA 4YVXA 4OVXA 1CTNA 3R0UA 3VX0A 2RHGA 3QC3A 4RDWA 4FEZA 1Q66A 2WVUA 4DWSB 4CU6A 1DQUA 1WOBA 3WF3A 1S5WA 1JG9A 2Z00A 3T08A 3GU2A 5FSDC 3AHXA 3WENA 3HMJG 4WOQA 1NQKA 1UC4A 2JF7A 4YYCA 1GJWA 1A5MC 1PX8A 3HA1A 4WDXA 2PRLA 1K1DA 4GYPA 3MDWA 2R24A 2X1RA 3FVDA 1ZFJA 4GCAA 2NQ5A 4E8GA 2ISSA 3U7BA 1NWRA 3VXGA 1LRNA 1TE1A 3B05A 3I6RA 1TV8A 2YCLB 3HF3A 3S1GA 5HPOA 3QLLA 5EKYA 3PBWA 1NQ6A 2NUXA 4L80A 4RNJA 3MSYA 2WZMA 1XIIA 1QHOA 5CXPA 3MJMA 2DZWA 4EP8C 4O50A 1L6FA 2FFIA 1O68A 3IIOA 1GOIA 4JKLA 4KW2A 5CEWA 4M80A 4Q4RA 1A47A 2GJLA 1MQPA 1E6ZA 3CZGA 3NTYA 1ZALA 1L6WA 1KCKA 5J04A 4HPHA 3UETA 4XZMX 3WLHA 3KTSA 1W54A 1MWOA 3M0MA 5DY2A 4CNSA 3PM6A 3WLMA 1Q6QA 2QCLA 5AHLA 2OU4A 3PG9A 3W7QA 3NQ2A 3FJNA 4IG2A 4C6LA 4EANA 2NW0A 1X7IA 1QFEA 1KFLA 1ZL1A 2QCEA 2XFFA 1W8GA 4AIEA 5T91A 2QW5A 4ZQOA 2TODA 3W7HA 2O9RA 3URQA 5CCZA 2HS6A 4KPLA 3WG6A 5CG7A 4HNUA 3EWZA 4EWJA 4RE3A 3AIEA 3W1NA 4NNCA 1UW9A 1B3VA 1RVGA 3KLLA 1PJ9A 4IQDA 5HOSA 1BWVA 1GYNA 2XVLA 1ZZMA 2QCCA 5FF2A 2VR5A 3H2OA 4ZBCA 1DWGM 4CU7A 1B54A 2YXGA 1RD6A 2BDQA 1AW2A 3OGVA 4PCFA 3UGRA 2NVDA 4PMRA 2QF7A 2EQDA 1EC9A 4QDMA 1FOBA 4UFMA 4DM1A 4A35A 2CU0A 1J4EA 1ME8A 2EXOA 2G50A 5DBUA 3HG2A 2VENA 5E0FA 3GNXA 4D6DA 3E49A 1MRAA 5C9XA 4LPCA 1RQEA 3BAJA 2QDHA 5E0KA 5ABFA 2VEKA 2E5DA 1O5XA 1XW8A 3DENA 4OBSA 2Y89A 2WSPA 3AO0A 1EO5A 4O53A 4D6FA 4ZOAA 3D46A 4GBUA 3IRSA 4DRSA 3ABZA 4HNTA 3NPXA 4X9YA 3A3XA 2BY3A 2QJJA 1YNYA 4WD0A 2CHNA 4R5EA 1TPH1 2Z24A 4QISA 4J40A 4L5ZA 1F61A 4B5SA 2JGYA 4IIHA 1Q3NA 1NTHA 1XISA 2I17A 4M6PA 4OJYA 3WUEA 2VT0A 5CPTA 4GISA 2POTA 1PVNA 5H8UA 2OMAA 3W1PA 3BG5A 1D2KA 2ZFAA 1FKWA 2XPKA 2PD5A 3MSGA 3L67A 1ISZA 2O55A 2AGTA 4K39A 5XINA 1F3XA 3VDAA 1QPQA 4LV4A 3ZJ7A 1EGVA 4E4FA 1Q6DA 2CPUA 4FIQA 3W53A 2WB5A 3ZT7A 2C3ZA 2YDQA 3IACA 3ARVA 3GIPA 5FF7A 2QPXA 1TPC1 3GZ3A 4MWAB 1BYDA 4QJ5B 1R6WA 1RBLA 4P8WA 3O07A 3UZYA 2J62A 3A21A 3W2MA 3KBSA 3A64A 3WQDA 3EWCA 2QCMA 3MU7A 3DG6A 4KFOA 4ALDA 4PB5A 3R10A 3RLHA 4QJ3B 5FJTA 1L9WA 1RD5A 3QGAC 4GIEA 1WNOA 3VKAA 2Z28A 2ZOXA 3SEPA 3W88A 4EPDC 4WLCA 2YPIA 3C0SA 3B8VA 1YADA 1UBPC 1AUSL 1BVNP 4LJ3A 4PSRA 4UOJA 2PP3A 3TONA 3LXCA 4HU4A 1XQKA 2NZLA 4PUMA 3AXMA 3PTDA 1JR1A 4G9PA 3MW7A 4JN7A 1J0JA 3GRIA 4C5ZA 1TV3A 2YJQA 2GVLA 4YL2A 4DEFA 1UC5A 3K8KA 1EXBA 1VRDA 2VUNA 7REQB 3HIJA 3QOKA 4FSAA 1VR6A 1A5BA 4GE8A 4J5NA 4BJHA 1MFVA 3ITGA 3UF9A 4RZ4A 3M0ZA 5IOBA 1NOFA 1J18A 2A7NA 4AD5A 2Q3OA 3FW6A 1FP8A 3HTWA 1I60A 3WK3A 3W2KA 4TXEA 1U1JA 1QW8A 4NUWA 4DJDD 3LOTA 3HB9A 3KZPA 1ZAJA 4DLFA 4JCMA 3W7LA 4PCPA 1VBHA 3NYZA 5HULA 3WNKA 2ISVA 2PWGA 4MNJA 4V27A 2W6RA 1Q2RA 2PDGA 1MEWA 2GDVA 4JS3A 4JFVA 2Z25A 1SSGA 2OEJA 3TA9A 1AH4A 3CV7A 4QP0A 1K3UA 3NZGA 4M24A 3LHWA 3IGUA 1OC6A 3WUBA 1QI2A 1JCLA 3NDYA 1V7YA 1HQTA 4WKAA 1X6UA 4NJJA 2DZVA 3LSCA 4C7FA 1GK8A 1YXCA 1XCFA 2VGGA 3WDRA 4P7NA 1EA9C 1G01A 3CBWA 1EOMA 4B5NA 3T1GA 2GQ3A 2CNCA 3RCNA 3PB2A 1GYLA 2WMFA 4LYQA 1TV5A 5BWFA 1PSCA 3O1NA 2V81A 1W8SA 3EWUA 5H91A 2ON3A 1MUWA 3GNPA 1UR3M 4A2SA 3ZSSA 1JCYA 3GNDA 1OSEA 1HKKA 1JAKA 1CI1A 1ZB5A 3EKZA 4GC3A 2DY3A 4F9JA 4CQ8A 2BB0A 1YW1A 2ZA1A 1KBIA 1R9ZA 3LHVA 3LQGA 1RA5A 1P5BA 2Y2WA 5EMUA 3CUIA 2CC0A 1CIUA 1YE6A 2RGLA 4NYYA 2YB1A 1XLDA 2OELA 3GBDA 3MV01 4H9XA 4CVUA 2XDFA 2EG8A 2WNQA 3HQOA 3TJXA 3NURA 2VD8A 3OYZA 1MYRA 1U1UA 4JTEA 3V4BA 1M3UA 1XYAA 2KZHA 2HRWA 1T7LA 3NQCA 2HK1A 1PKNA 3OZMA 3OA5A 1KM1A 4QCEA 4XD4A 1FUYA 2ZWYA 3XIMA 3A3WA 4YHGA 3CZ8A 3CUZA 4QSFA 5DFAA 1HF6A 3MUCA 2ZZ3A 3IS4A 4H7VA 1EYWA 5I5RA 4DF1A 3ZZ1A 3D0CA 2GWNA 2W27A 1QHPA 3C2VA 3W02A 5CBBA 4GZ7A 3VNIA 2CFFA 2C1IA 3MI6A 3AHTA 5HR6A 3E02A 2OGYA 4AEEA 3SCVA 4XWUA 1XBXA 1DHKA 3GC4A 4PBGA 3EBVA 4LEQA 3UWWA 4MVAA 2WCSA 3DHFA 5BU6A 3GYEA 2PDIA 3ITVA 3L9CA 1F6PA 3ZQ9A 3ES8A 1BEUA 1L8PA 1VPYA 4O28A 1YDYA 4JL2A 3LMYA 1TR1A 2HVNA 1GZGA 4UQEA 1VZWA 2VOTA 3I3BA 3L4YA 2Z26A 4D9PA 4B3KA 4QG6A 1D3HA 1KQYA 2OWXA 3U2ZA 4K7VA 1JF5A 3BANA 1WAUA 2J47A 2JEPA 5FEPA 1H7NA 2X09A 3WH8A 2YCIX 3BLEA 2G95A 4AXNA 2EGZA 3NQDA 1PV8A 3TC3A 4DBDA 4IT1A 1WKFA 1E1CA 2NLIA 1EX5A 4ZXLA 3LRMA 5D2XA 1OD0A 3DG3A 1EF2A 4PTNA 2FVLA 3UCQA 1KM6A 2DSZA 2OO0A 5FD0A 1E71M 2E5BA 3SFKA 1S2UA 3SN1A 3GD6A 4NP7A 3QVQA 3LSBA 1S5VA 3AZTA 1NY1A 4YLWA 3K46A 5K9CA 1NFPA 3PNZA 4S3BA 4FOKA 4A8NA 4DUVA 4NKCA 4ZEPA 3LM3A 3SIMA 3F2DA 3SGZA 1ONWA 5G5IA 5DBTA 4HHHA 3ZO9A 4HTBA 3W7PA 4XZLX 5ABHA 1C3FA 3LRKA 3VGBA 4N4PA 4J28A 2OVLA 5DMYA 3N29A 1CXIA 4MOZA 2O7QA 3U8GA 4QTGA 3TAKA 4FNQA 3GH4A 3V7PA 1ICSA 4GJ1A 3I3EA 2X42A 1SJAA 4ERGA 3NZQA 2D1ZA 2J9YA 2HROA 2BX7A 2FDMA 3IUDA 1I0BA 3THUA 1J6OA 3VFCA 3PY2A 4W4QA 3QKZA 3R0DA 5ABGA 5ABFB 1EPXA 4NX5A 5HUPA 5A2AA 1Z41A 1XDJA 5LXXA 3GXFA 4JHOA 3GFYA 1EX1A 1F6YA 2AOSA 5LIXX 5HWMA 4HYVA 5GVJA 3EMCA 3R0KA 1O5QA 2G3FA 2Y1HA 3AIWA 3KWXA 4HPNA 1KM0A 1KLZA 1KO0A 1HJWA 1W2PA 5TF0A 1W3HA 3JRKA 1VIWA 1T6MA 3SGUA 3FYOA 2PF0A 3NSMA 3EZ4A 1DWJM 4M19A 3BL3A 2FGLA 2GQ8A 1DJHA 3FJLA 1NDWA 1XL9A 3ARSA 2L5HA 2DGAA 1FWDC 3V75A 1C8VA 2PUZA 2I9UA 1TV4A 3CZEA 4EVZA 4IFKB 3LTPA 1FQ0A 3EWXA 4JHZA 2VMFA 3THDA 5D9PA 2DORA 3BSHA 3UYIA 4ES4A 5J5DA 4TV6A 4GGBA 4WEVX 4MWAD 1S46A 4JYFA 3WQ5A 3VIOA 1MXSA 5HNNA 3SCSA 1K6AA 4IF2A 4WCJA 1X6NA 3QR0A 1CB2A 3W83A 3IJDA 1IWBA 3M47A 1S5TA 4L1XA 5AC4A 4AFYA 1GVRA 3JZEA 1E4NA 3G1YA 4X61A 1QATA 3G2GA 3EXRA 1VFTA 3WJSA 4GIAA 4FI4A 3KBVA 1NJJA 3P0XA 3TK7A 2B7NA 1SJDA 3RCYA 3AAMA 3GLCA 4CD6A 1EA0A 2J7GA 2A7PA 4KWVA 4G5DA 6XIMA 3ZVIA 1Y5XA 4KGJA 3L2IA 1ITXA 4MLRA 3N2TA 1UG6A 2WQPA 4NU7A 3UR2A 4JTSA 3SM0A 4MNLA 2Y5JA 3LX9A 1TX2A 3IGXA 3O3RA 1RQBA 3EMQA 4O8AA 3OLDA 1P6CA 3UWVA 2A85A 3P80A 1A5OC 5LIYX 3CAWA 4UQBA 3GUWA 1KM5A 1TRDA 5EA9A 3ZWSA 3APTA 2V6AA 2V5KA 5TBOA 3W1MA 1UWIA 3URAA 1UZ1A 2QT3A 4URIA 3GDBA 3TSDA 3EX1A 4LAUA 4DWSA 1S5MA 1XICA 4JL1A 1EXPA 4RW5A 3SAZA 3WD1A 1Y5WA 4Q6JA 4WY0B 3OPSA 3GG8A 1J2WA 1C8YA 3CQIA 3IWPA 3RM8A 4WSKA 2F61A 5D30A 2OX1A 4WGHA 5HR7A 4LCRA 2BODX 1DE6A 4B5WA 4JBRA 3GY1A 4NZ1A 4MLJA 4FB7A 4IWWA 4QX4A 1SR9A 4H8HA 4XBKA 4P8UA 3R8RA 3W2LA 3AHYA 3N4EA 1MMFA 4YTRA 3T55A 3UBPC 1FY6A 3RX3A 2PDYA 3GX9A 2Z7KA 4DJEA 1OG6A 4LUSB 4LVFA 3GXMA 4RW3A 4ONVA 3I7QA 1JEZA 3CT7A 3VKKA 2R82A 4IZGA 1TX0A 2CESA 1M41A 1W1TA 3T2PA 1CGVA 1P43A 1M65A 3WQPA 1KTCA 1E9LA 1RUSA 2OZ8A 4QNWA 1O12A 4ZO9A 3STGA 2BHYA 1W1VA 1E0VA 1E9YB 1F7BA 4GJJA 2GVYA 1I8JA 3SCRA 4JAWA 3TSBA 2DQWA 3LD5A 1YYAA 2EEXA 1OYBA 3UZXA 1XGEA 5G4HC 1I9CB 3QMTA 2XGBA 3KP0A 5F2IA 3C61A 2AQOA 1DWFM 1AQFA 2QXWA 2XFRA 4GMEA 4A05A 3GSMA 3I68A 1LOLA 4O4WA 5D05A 4GXWA 1OX5A 4IIDA 3CLMA 2ABAA 4GJIA 1UH2A 1AJ2A 3DN5A 4QS6A 1G9HA 1IZCA 1XQLA 1IF2A 3S8HA 3VYLA 4BZYA 1XIGA 3W7KA 3OVQA 5ABEA 2VEMA 1A5KC 3KUMA 2RFGA 1RJQA 1X1OA 4LS2A 2QDGA 4E8DA 2PWFA 2EPNA 1W0MA 5DELA 3L66A 2QPSA 4TU1A 2F2KA 1REQB 3HQPA 4PMVA 4C6JA 4OOUA 3TFCA 2XH2A 2VWSA 1M53A 3ALGA 3E12A 1CWYA 3AMLA 4R33A 2YL9A 1DJIA 4JTLA 3FKRA 3N2MA 3PZOA 3CAKA 3FEQA 2NV2A 3MSRA 3NQ6A 1X1NA 3NAVA 1GWJA 5D2YA 5TIMA 2P8BA 2ZICA 3R5EA 4DF0A 1C93A 3BV4A 3NOEA 1NF7A 3ABRA 2VRJA 3WDIA 2D0FA 3PWGA 2B4GA 2E9BA 4GKTA 2CLPA 1KBJA 4Y9AA 2E67A 5CJMA 1MI3A 1QO2A 3SJNA 3BO9A 3JW7A 4J2PA 2F9RA 2FJKA 5E1QA 3GTNA 4KERA 1JDEA 4QDWA 4NL1A 5K7JA 4I9TA 4KWOA 1MW1A 2GGJA 1RQHA 3KTXA 5DMLA 1UR8A 4OBRA 4HKPA 2EF9A 1N7KA 1ODZA 1LUCB 1AH3A 2PMQA 2P0IA 2DH2A 3OLEA 3OGRA 3VKJA 5CJNA 2YBVA 1R3RA 1H7OA 2NX1A 1CPUA 5EFDA 3P3BA 4Q8TA 2VR4A 3E0IA 1JIBA 2XIMA 3S1XA 1B4KA 4BA0A 1ME7A 4A3RA 3MWCA 1G4EA 2EG7A 4WF7A 2OYLA 3WJXA 1TVPA 4EXAA 4DJFA 2CZFA 2HDJA 3SURA 3ZLHA 1B30A 2P3ZA 3MP3A 5HAOA 4LNYA 1QRQA 2NV9A 1CGXA 2O9OA 1F05A 3H54A 4ILSA 3QN3A 4J27A 1LM1A 1XC6A 4POCA 4WRHA 3W38A 2XU2A 2E40A 2YW4A 3VCRA 1SZNA 3T40A 3AFBA 4YWIA 1Z32X 1IT8A 5A94A 1MO0A 4AAJA 2QJHA 1PEZA 3ZLGA 4PB4A 1DHPA 3ATZA 3TQ0A 3T78A 2PGFA 3QEZA 2X0YA 4O1CA 4B5TA 3PAOA 2DIEA 4UR9A 5C8BB 4JNZA 2ZUWA 3BLOA 3U4AA 4HMDA 2GQ9A 1QI4A 3M64A 3W2NA 1ECEA 2O7SA 3AWNA 3MKKA 4H7ZA 1Q7MA 2P76A 3G1FA 3SY5A 5CPNA 3S9ZA 1G4TA 1H11A 3P62A 1OIFA 1UUOA 5I0DA 5XIMA 1SFSA 1Z9AA 1U5JA 3AIRA 1YPFA 5AC5A 3M5XA 1ADOA 4I8YA 4S3JA 3WH9A 1CW2A 3UVIA 4H04A 4YNGA 4IIEA 3T4WA 5JUVA 4PBFA 5FEWA 1ZUAX 1YNPA 1DPMA 1K77A 2OJPA 4Y9NA 4H6EA 3MT1A 2VC6A 4DM2A 1IZKA 2GLKA 1BF2A 5M3WA 2YB4A 2DZBA 5KTLA 1T0OA 3CEUA 4KESA 4CCCA 4Z0SA 3PNUA 5U7SA 2BLEA 1GEQA 3E0LA 2FMOA 2NLYA 4GLEA 3DFQA 2A2IA 3UW6A 1LRTA 1Q6CA 4D71A 2BGQA 3RR1A 1R2TA 4ADTA 2WHMA 1NFBA 4LF2A 4PCNA 1XFCA 5D2TA 1EP1A 1XINA 2XFYA 4MKNA 3QQ0A 2RDTA 2X1SA 3WLIA 5D8WA 1UR1A 3HURA 4HZ7A 5FF4A 3W6MA 1H1ZA 4W87A 3UJSA 3ITOA 3NM3A 4DO6A 3W1TA 1W3KA 3IIVA 1YKWA 3ERPA 3QV9A 5A6MA 1QBAA 1DKWA 3F2BA 2V30A 3S2MA 3FYYA 3RILA 5D09A 2PDKA 1VBRA 3OO2A 2D23A 4QJ4B 2BY2A 1Z6KA 2G3JA 4MB1A 1EDGA 1C90A 3E96A 3CNYA 1IWPA 5E9AA 1LZOA 3CTLA 2ZC1A 3TV8A 4ZA0A 1UKPA 1XCXA 3L5AA 3SRKA 1BGGA 5DMMA 1EJRC 3TVAA 3OBEA 4UFIA 1ZS2A 3UQNA 1GZJA 1QI5A 1OD8A 3GQYA 3OVGA 1PUDA 2ZXQA 5I2UA 3KOYA 2GZXA 3F4NA 3K8LA 4C1LA 3LY0A 1PKYA 2OQHA 3CWNA 6A3HA 3UZWA 5I03A 1S1PA 2G0WA 4K6AA 2YXOA 3LMZA 4LAKA 1KWGA 2YLAA 1FWBC 4IHCA 1PWMA 4RR4A 1AMYA 1E6RA 2DZUA 3H2FA 1PL9A 4H6QA 1XUZA 2WANA 1LQ0A 5DEZA 1ISWA 3D5HA 2ANUA 4JEJA 1K8XA 4BK9A 3N3MA 1OM0A 2F84A 4MAZA 1EP2A 5DF0A 1F73A 3O6YX 5HQEA 3OZOA 3NQGA 3LXAA 3P0WA 2XUCA 3W01A 4B5UA 1UBSA 3N19B 1YQ2A 4YVVA 2WHJA 1VCVA 4KMQA 3RR4A 1GKPA 3MYOA 5CAKA 2QNEA 3H7VA 4R7OA 1WP6A 1NVMA 3VOGA 3SCTA 3SCWA 1OZMA 3N13A 2D73A 5LIUX 4FIRA 3TQPA 1EIXA 4XV0A 3BARA 1VJZA 3T6CA 2F6UA 3UXAA 3W6YA 1EHNA 1J5TA 2Z0IA 3IJLA 3PZ9A 5D37A 3UERA 3MCMA 2LLEA 1WXJA 2G3IA 2XYLA 3GW3A 3ABSA 2Y70A 1V3HA 2V9DA 4XZIA 4UTWC 3RF9A 1VJIA 1I6NA 4CEUC 3H8AA 1VC4A 2NV1A 2J8FA 2P50A 5PTDA 3TR9A 3DECA 1V3IA 2J77A 2CLEA 3SUVA 1UPPA 1P7TB 4W84A 3A13A 1KWKA 1P0DA 3MHGA 2JGQA 2XWEA 1JDDA 3OIXA 4MUPA 3HZ3A 2J7FA 5DLCA 1GVIA 4HPGA 1GOOA 4QITA 1F3EA 4HU0A 4Z2IA 5BRBA 3YPIA 3HFYA 1XYZA 2FDSA 2BY0A 3OVRA 1E5JA 2VGBA 4HZMA 3L0NA 4ZQCA 3UZJA 4BQ3A 2FZ8A 4IIFA 1B3XA 1LTDA 2Z7GA 5A6BD 1FHLA 3KL5A 3B0VC 4AY1A 1POKA 1K7EA 2Y5SA 2I57A 3E0VA 3G1AA 1JZ8A 4WSHA 5CZTA 2BXYA 1WBJA 1GVYA 3UNTA 5HDRA 3PVFA 2X0SA 3IVTA 2V3DA 3MBDA 1GQKA 1OX6A 4D1IA 3NVDA 2DT3A 2UBPC 4ZE5A 2XWDA 3F5JA 1WKEA 1B3WA 4PEEA 4CCZA 3EPOA 3BG9A 1V3MA 4DZHA 3WLPA 4Z2GA 3SFWA 3OP2A 3TYZA 4NNBA 5BXTA 1GPFA 4QNEA 2QJGA 1US2A 4HJWA 4HA4A 1X97A 3VGEA 5EGRA 3P93A 5EMJA 3AMKA 5FJUA 7REQA 5F1VA 4EIVA 2A3BA 1JNDA 1TJ0A 1ZGDA 2YFNA 3EEGA 3BQ5A 3NXFA 1DJZA 1E9IA 4GY0A 4F0HA 1XJBA 4GNVA 1BYCA 1MXGA 2YBTA 5MKGA 3CHFA 3G1RA 5FCZA 5CPOA 3TROA 4LBSA 1QXLA 2PI6A 1PX3A 3L21A 1PXGA 2GPTA 3ABXA 3RRAA 4OGZA 3VOJA 4IMCA 1S3TC 2DUAA 3DUGA 3KCJA 1W5PA 3HJZA 2WMJA 1K7FA 3NL6A 4HZ6A 3S46A 1W6TA 2GSJA 4KFPA 4Q4MA 3UY7A 4XKYA 2WZEA 2CBVA 3OZPA 3N4FA 4FXRA 4CQ9A 4H41A 2W9MA 4JX5A 4HHPA 3H55A 1FWSA 3ABQA 1A80A 3BQ6A 3R1ZA 1F9CA 1NF0A 3LCIA 4C6MA 3MUZ1 4QG8A 1Q6RA 1UP0A 1KV8A 4REQA 1KC7A 4PB3A 3RFAA 2OB3A 5G2IA 1XG3A 1YDVA 5EYWA 4I90A 3U4FA 4L9ZA 2ZXAA 3W72A 3CS2A 1XUUA 2BASA 2YL5A 1ESWA 3H6OA 4FHAA 2D24A 3WYZA 2ZYFA 4XD6A 1R3TA 5D9MA 4UTTC 1OK4A 2QF8A 1I4NA 2WPGA 1HJVA 4E4UA 4DLMA 4F0MA 3WD3A 3ZR5A 2WV8A 2VX4A 1SZFA 2WJEA 4IP5A 4LANA 3VTRA 5LGZA 4Z08A 3NEHA 2WHLA 3QHNA 3VDCA 5I24A 2NQHA 2QDEA 3WF2A 1Q85A 4LAMA 1RBAA 1E56A 3H2NA 3GVGA 1V6XA 3GG0A 4MFDA 2D2HA 3O2LA 3WJWA 5I06A 5TAOA 1ISXA 3LTSA 3T0TA 1C7TA 3VDHA 4GZEA 3B9DA 3E5BA 4U28A 3EPMA 3I7RA 4AHPA 3H4GA 1RP9A 5D38A 3T7VA 1O6IA 4JNMA 3M0IA 3SR7A 4EAMA 3A24A 4E5TA 1V3JA 3CWOX 1P6BA 1MVYA 3OHMB 4HZ8A 4HVXA 1H3GA 4X3ZA 3FY1A 3OBKA 1EJXC 3RU6A 4GVGA 3NNTA 4US5A 4R34A 1FFQA 3FAWA 4QFUA 2X1UA 3M1ZA 5D2VA 3T07A 4GI9A 4UTFA 2FZNA 4K36A 3TQVA 4PSPA 1WAWA 1FWAC 1V0NA 3W7IA 4BF5A 3FJ4A 2VFEA 4LOCA 2J9XA 3DFTA 2ICSA 3VAVA 5FKYA 1IWAA 4JX4A 5I02A 1MZRA 4F40A 3K1DA 3TEVA 4G2DA 2VVSA 2JBMA 2YBUA 3CL6A 5BMXA 2BTMA 3EDFA 4GYPC 4K2SA 3VNMA 1Q6OA 3L68A 1XSKA 2H8ZA 3G3MA 3PN8A 3UZZA 4IMDA 1HUVA 2HCVA 3LHYA 3LN3A 3KBJA 1L6YA 4AEFA 3PG8A 2XVPA 2PDHA 1HKWA 2D0HA 5AHFA 1EWEA 4R7JA 3O6AA 3WBEA 1UZHA 4FR1A 3ANYA 4CUCA 5FL1A 5I00A 2WM1A 3UZ5A 5CZ0A 4M0XA 1JXKA 1NDVA 4DAIA 1NARA 3GG1A 2W3ZA 1XIJA 4Q8WA 5JXQA 4NAEB 2FPTA 4YIWA 1G69A 1O94A 1SUXA 1EWDA 4AD4A 4NJHA 2YXXA 5FAJA 4RDYA 2FZBA 2VM8A 2ABBA 3WF1A 1O66A 1TUFA 4H9UA 1R7AA 4QRNA 1OJXA 2RJGA 1MW0A 4RZ6A 1IQ8A 1B5TA 3L0GA 3R79A 1VLWA 4US6A 1X8CA 3CQ0A 1ODUA 4LW7A 4LVBA 4GVHA 1EBGA 1GKRA 1DOSA 4H00A 4IXHA 3GUGA 3GIYA 3MP5A 4AZ7A 3E2RA 5BROA 4BQ5A 4J4KA 3DG7A 3ANVA 3IGHX 4GQQA 2VX6A 4IGHA 1K9DA 4MY1A 4IJRA 4IG2B 3TJ4A 4NHVA 4U3AA 4S38A 3DHPA 4BF9A 2VEFA 1XYCA 1XGDA 2C8NA 3LBMA 3N9KA 3TMLA 4DHGA 1Z3NA 2BGNE 1XYBA 4GH1A 4LWWA 4XZNX 1H7RA 3NL2A 5AVHA 3DX5A 4A6GA 2D22A 4FXJA 1H1YA 3RO6A 1I1XA 3UWUA 1LF1A 2HNHA 3HQ1A 3UXDA 4HTYA 4LC6A 1GJUA 1FVPA 1LROA 3O8AA 1UJPA 2JKAA 1YTEA 2WVTA 3TYDA 4TR9A 4ZCWA 1H5YA 4TOQA 3DC0A 3UCDA 5TD4A 1DWHM 4DBUA 3MO7A 9XIMA 3I4KA 4JFUA 5EMLA 1ZBVA 1GHSA 4ACYA 2WK2A 3ZR6A 5CSRA 1Q45A 4Z1DA 3TTOA 4AX7A 4E2OA 4NJKA 1NU5A 3TTQA 1K02A 2C0HA 4F0RA 4MY8A 1AVAA 4H9VA 2ALRA 5HANA 4ZQMA 2AAMA 5T9CE 1A53A 3B8IA 1ZAIA 4K37A 5BMWA 1KXHA 3PPCA 1EZ2A 2ODOA 3KM8A 5ECUA 2Z1BA 3TWAA 1FDYA 3F03K 4CN6A 2Q02A 2ZRYA 2F7FA 2WKGA 2FPVA 2CKRA 3S2LA 4IGSA 4O16A 4PMYA 4XX6A 5AVNA 2E6FA 2R14A 3WLTA 4GX9A 1OFBA 1SR0A 1H7XA 2A3EA 1FWIC 1K7XA 1SYTA 1X98A 1TPB1 4HPJA 3TTEA 1EOKA 3CTTA 1OINA 3FEMA 1KW1A 4DAFA 2QEZA 4I5RA 5CLWA 2BGSA 4NXKA 1F07A 4RZBA 1TTJA 4ICMA 1B57A 2Y8KA 1YLVA 4IP7A 2VHLA 3W86A 4A3QA 3E1F1 3QGKC 4KRUA 1PTGA 3EB4A 3ES7A 4DJDA 2QUTA 3BURA 1IZJA 1V8EA 4JX6A 1HTIA 3VNZA 1IEXA 2ADAA 3VIJA 1QMLA 4QR6A 3QLDA 3G0UA 4MHBA 2WSRA 3MMUA 1RALA 1QK0A 1TTIA 3MTWA 4GK8A 3VA8A 4AB4A 4RNIA 5I3JA 2YW3A 4KKXA 2YCEA 2PBGA 1T99A 4P8VA 5HMFA 1KFEA 2JE8A 4AIUA 2V2HA 4D6CA 3IARA 4PR4A 2R94A 1EIBA 3NEVA 3UR5A 3W7GA 3F4WA 4JTGA 2J7BA 3TW7A 1JDFA 4J35A 2CLIA 5A69A 5BRPA 4XG1A 1HVQA 3TCSA 4ZB5A 2WO5A 4UR7A 3NJ3A 4DYJA 4NVTA 3TLQA 4ZO7A 2HTMA 3L23A 3C52A 4XAGA 1T8QA 3R25A 4RZ5A 2VFFA 2R9RA 1BRLB 2IXVA 1GVQA 2ZX9A 3FSTA 2CBJA 5DCEA 4GC4A 3HGSA 2EKGA 1VBJA 3C86A 2RUSA 1IGWA 1HL9A 3RJXA 3WLRA 1LBLA 4H3DA 3FJ6A 1D8CA 5LNRA 2V63A 2E0PA 4WKHA 4WY0A 2ATMA 3BUVA 4J3TA 4QG9A 1CZ1A 3ME3A 3FXGA 3TN3A 4IMEA 2H3DA 2Z2BA 3GU9A 4MDOA 4B92A 1J0IA 1KR1A 4HCHA 1QW7A 3EX3A 2J4GA 1T8XA 1IGSA 1GYMA 3CH9A 4LCQA 2FZ9A 2WSYA 1SPQA 3RHGA 1W9BM 3TW6A 1A3XA 3WK1A 4ERIA 3WNNA 2PURA 1TVNA 1KBBA 4UFJA 3B8DA 3EXTA 3TTSA 4W5UA 3BVJA 4UXDA 3MVTA 1HJXA 3FN9A 3MANA 1ZJAA 3ITYA 4R9OA 2WZIA 5G2HA 4NRSA 4UMBA 3B9AA 2PDBA 3U2CA 3WLLA 5BCAA 1TPEA 2YX0A 2OG9A 4DVOA 1TQJA 3U2OA 2HPIA 4FP1A 1OC5A 2AGKA 2XVGA 2DH3A 2YDSA 3MWAA 1ITCA 1F4AA 5FA5A 3RM9A 4NAFB 2V5LA 3CUGA 1E4MM 2WC4A 1P6WA 1L2QA 2WHKA 4PMXA 1LLZA 2WNZA 3QKEA 4HB7A 1WXYA 2NQLA 4HOWA 1QPOA 1I75A 1CX9A 3TOYA 2A1YA 2EPOA 4AWSA 1VF8A 4PTWA 1B0IA 3E0WA 5C7HA 1R9XA 2HISA 4TUFA 2INEA 3SRDA 3T4CA 4QCFA 3XISA 1TIMA 4FMVA 4JTCA 3N17A 3BCFA 1O7AA 2ZCGA 3M44A 5AZ0A 4CNNA 2C91A 1X6LA 4G7EB 3UG3A 3G1VA 5AHNA 2QYGA 1AFSA 1XIEA 1UCWA 1EBHA 1UOKA 5KZDA 5MHBA 4DYEA 4DO4A 4AEOA 4I8DA 4NZFA 3WF0A 2HJPA 4NAFA 2HQAA 3QOMA 4A29A 2PWVA 1J8VA 3UVAA 2FPYA 3UXLA 4WJXA 1VQTA 1W2VA 3S3GA 2X16A 1O5RA 4UB9A 3ITTA 3EOEA 5I79A 4FAMA 5D2WA 2VELA 3TSMA 1NWTA 2OWCA 1JQVA 2XVKA 3JR2A 4BWLA 3P67A 1FKXA 2IQDA 4IP4A 1UB3A 1NM9A 4ZB0A 1K8ZA 3MZ2A 4WOZA 4P61A 1EUNA 2PCQA 1WBHA 3IJ9A 4KWUA 4UTUA 4I5XA 3EDKA 5M1TA 1VPQA 1HG3A 1S2TA 4XBJA 1PIFA 2QCNA 2QMJA 4MB4A 4AXKA 3UA4A 2OKOA 4AISA 4DXKA 5CSYA 4HK7A 1OT1A 4CNUA 3AIUA 3EKGA 3Q2DA 4CNOA 5A8QA 2ISDA 1BWKA 2PDQA 3W71A 2VCBA 1W5MA 3WQGA 1XIMA 3W2JA 2BXZA 4GZIA 1UQYA 2MANA 4N6EA 2G4FA 1MQQA 3HQNA 2QS8A 2ZXBA 4ZGYA 4A3UA 1VP5A 5A6SA 3NQBA 2VRKA 4FZIA 2V2CA 4R88A 1HXJA 4GQGA 1W1B1 3CK5A 3VUPA 1SO4A 2CHRA 4DZIA 1KFJA 3UR8A 4B16A 1LRQA 3BAYA 3TIMA 2ZADA 3HU7A 3GK0A 3VDBA 1VAHA 4WSJA 2FH8A 2YDAA 3WIJA 1WZAA 4M1BA 4MDPA 3AXXA 4FX8A 3LUTA 3U2EA 3BLDA 1UR9A 1LT7A 2J7HA 1ZLPA 4NXSA 4GVFA 4ZSUA 3H26A 3QW3A 4C6PA 3G0XA 3QY7A 3WUFA 1G7VA 5HQMA 4YMZA 1Z69A 4DY1A 4YCPA 4PMDA 5LIKX 1XLFA 4AG0A 3S9IA 3KBNA 1M5WA 1E73M 1P0KA 2WMHA 1UJQA 1W9DM 1KGUA 3GKFA 1QW9A 2Y62A 4S23A 2AL1A 3DAQA 3PWIA 3ZSTA 1DJYA 2GJXB 1RV8A 3WNPA 1E72M 1K9TA 3OYXA 1W3IA 1XRTA 1W3LA 4UFHA 3VC6A 4BI5A 3DHUA 1AK5A 3ZLFA 4MKVA 2AL2A 2Z27A 5LKYA 4S3KA 4PUEA 3KCOA 3CUFA 1S39A 2XGZA 3VIMA 3A23A 2VX7A 2GDQA 4IMFA 2HNEA 2YA0A 3G1XA 3VINA 1XBYA 5FOOA 3MY9A 2DIKA 3PZMA 1Q7QA 1PO9A 1HKVA 5BXSA 3R12A 1FWJC 2CLLA 1ZNNA 1JD7A 2SFPA 4UNIA 2HSAA 2DVUA 4GI8A 3CZLA 5A2CA 4PCTA 3LG3A 3TDFA 2PZNA 1E3ZA 2Q8XA 2W79A 2OQLA 3RMEA 1IXOA 1Q6GA 4W7UA 3EX4A 5B7YA 1DIEA 1C9WA 4X22A 4LUIA 2ASHA 3IVSA 6XIAA 3HGJA 1E9ZB 2QJNA 4KT2A 3RX2A 1E15A 3DGBA 2I5IA 3CM4A 3A4WA 2G96A 3JZUA 2HXUA 3L0KA 5KZMA 5FJJA 2VX5A 3M5ZA 1OFEA 3M9YA 1B3ZA 4ZO8A 3PUEA 1JFXA 4S2BA 5CC7A 2V5JA 5H8PA 1ISVA 2X8RA 3U7VA 1XDLA 4W8LA 3WMSA 5CGMA 4U4MA 1OQFA 4AU0A 3UWYA 1XLEA 5IRPA 1ISYA 1OGSA 4LB4A 3R11A 1W1YA 4PMQA 3MUXA 5DT7A 2NT1A 3QW4B 3QMSA 2NT0A 2BOGX 1X1ZA 4DB7A 4PE8A 3RM4A 1TJ2A 1XD1A 1T40A 2O9PA 1SSDA 4Q4OA 2H9AA 3QC0A 3QBUA 3SSZA 3HG3A 3UCCA 3C0JA 4IFOA 5D02A 1Y0EA 3M16A 2VDHA 3P74A 4ERAA 4UTJA 4Z1BA 1H0IA 3LEPA 3MI3A 2WJFA 3LV5A 4JQAA 3P5YA 4EOUA 2V5CA 2FLIA 1TMHA 2Y8UA 3P2VA 2ZWZA 2FHBA 2CETA 5FF0A 4JTRA 3DESA 4ZTXA 2VC7A 4ZL1A 3HM7A 3K4DA 4D6EA 3NQ8A 1VCFA 5DX7A 1F6KA 3W27A 2XISA 4JIPA 2VDIA 4Z2HA 4KWSA 3S9YA 5CGTA 3WLKX 4JTKA 1KKRA 2ZDRA 4CLMA 1GCYA 3EDEA 3VMNA 3HBLA 4O0KA 4BEUA 5LYRA 1RLCL 4D8AA 3MKCA 3PZIA 2VFHA 1XC4A 3BOLA 1F8MA 1VGAA 3N12A 4UFKA 5CPSA 1DIOA 3QF0A 2Y24A 4DJEC 4DWSC 1Q63A 1W1A1 2NX3A 2ZX7A 2NUWA 3NOYA 5D9NA 3N9SA 1EFZA 5A8NA 3NO5A 3B8TA 1UWAA 1QCWA 1XLJA 2RJHA 3CC1A 4MWAC 2AMGA 1ZRQA 3OQ8A 3ARWA 4LCSA 4QQ3A 2QUMA 3MDUA 5I3FA 5K4XA 1FCQA 3S5SA 1UWTA 1R85A 4XZBA 3MP4A 2OZTA 1PBGA 5FESA 3W28A 2CZVA 3G6MA 3UNDA 2OYMA 3SUWA 2VZUA 2XSXA 1R46A 3KOXA 2EJAA 4UIOA 1QNRA 4RCXA 4LRTA 1HGWA 1E70M 3GH5A 3TW9A 2QAPA 4NYUA 2BVTA 4RX0A 3NQFA 4BFAA 3MO4A 3G5EA 2W62A 4O15A 2EHHA 1MUCA 4M81A 3BLKA 1UD4A 1XFBA 2BS9A 4W93A 3PUGA 1KGXA 4XAZA 2DZAA 4NASA 4ML4A 1U83A 1IIGA 1GKQA 3CQKA 1G7UA 1EC7A 1A0CA 1ADDA 3QR3A 1V51A 1XD0A 3M5VA 4Y8FA 4EPKA 3VC5A 3BAKA 4GYFA 4HSHA 5BOOA 4I5UA 1Q6EA 4JIHA 3IJQA 1HP5A 2AKZA 1FX6A 3WLJA 4P2VA 4I9MA 3WKZA 4MZ1A 2VJXA 4YTUA 4HA0A 1US3A 4NNAA 1LOSA 2Y7DA 3AZSA 5CZSA 1KM3A 1PPIA 2PTWA 3GWQA 4EKJA 2Z1WA 4DUOA 3E38A 2DVXA 3CQJA 1D3GA 3B0YA 1XKJA 1WDWA 1P7TA 1SO3A 4IIBA 2V5BA 3PSWA 1JPHA 3HG5A 4FS9A 3WJYA 3VMOA 3LPGA 1GUVA 3RPMA 3WQ4A 1UKTA 1YTDA 3EX2A 3H7UA 3SDOA 4BQ4A 1RJRA 2Z1KA 1A5AA 1XCWA 1H51A 4JY9A 4IX0A 1VFHA 1AMKA 4M8UA 1E0WA 2NWSA 1O1ZA 5K3VA 3FCPA 1RCOB 4DF2A 3BC9A 4IQEA 4E3VA 1XBVA 2XSAA 2P10A 3S2CA 3E2VA 4GY1A 4LYKA 2CLFA 3TXZA 3C0QA 1BXBA 3VGHA 3WQFA 5FEXA 3VZXA 5AZ1A 3AS0A 1NOUA 4O52A 3VK5A 3ISIX 2GJPA 4AYSA 5CSUA 2XINA 5CZJA 3G0SA 3SCPA 1M9HA 3H70A 3UESA 5DXYA 1XLAA 4W9TA 2GYIA 1KRCC 4HP5A 1O4UA 3VIPA 2PEVA 2E8YA 4R53A 4KCTA 4S1FA 3H53A 1EUAA 1OB0A 4MTVA 3A22A 3TYUA 3SBFA 4MM1A 1TKKA 2VGIA 3R6IA 4ZXOA 3TZFA 3VIIA 3SQLA 3O16A 2DUZA 3WO8A 3GVQA 4B3LA 1W5OA 3O63A 4OTKA 2WVVB 4GYKA 1YXYA 1R5YA 1EQPA 4REQB 1IR2A 5F4WA 4GWEA 1XH0A 4FNSA 1S3HA 1CNVA 3VVGA 3AS2A 4ZOEA 2B81A 3CWHA 3UJRA 1QJWA 1C92A 3MPGA 2VKZG 1TRIA 3VABA 1OCQA 2P3EA 2FVKA 2X2YA 4RPPA 1JYNA 1SQ7A 2WWCA 1KD0A 3CL7A 3E74A 1FCBA 3E6EA 4L61A 4ADSA 2DPEA 1JNEA 3O05A 2ZVRA 3WH5A 1BVZA 1YPIA 1VYPX 2FQIA 3NQAA 2VR2A 2PLMA 2C71A 4FLSA 4F2BA 3VE9A 4HU8A 1OC7A 4D1JA 2Z6IA 1QASA 1F4HA 3BGGA 1MSSA 1M7JA 4MGGA 2DZPA 2A3LA 4C6EA 1B90A 2R8WA 2VTFA 5LXEA 3GB6A 4HGXA 1C7SA 2IKHA 4KH2A 3VIFA 5IHSA 4B90A 3KS5A 3E2QA 3ID7A 4RKAA 5CQ1A 3CL8A 5IXEA 1GQLA 1XHGA 2DQXA 3W75A 5HWNA 3PJTA 3W87A 3BAWA 1FBAA 1MEHA 5HJXA 3M7WA 4WGXA 1F3TA 2HE8A 3RN6A 1ZBCA 1UD8A 4FPSA 3BJSA 3CAQA 4R7WA 3WQCA 2QV4A 1MQRA 1GVEA 3N4AA 5EBAA 3ARZA 1IYXA 2O4MA 4NILA 1KFBA 4XIMA 1GVFA 4LV9A 5A95A 1J0KA 3QY6A 4JD4A 2DW6A 1ZP3A 2I9EA 3KS6A 1M1BA 4KCUA 1QUMA 1ADSA 5DQPA 3BPWA 1O1HA 2PTYA 1W1ZA 3O6DA 4TTUA 4Q8OA 3E3HA 3BMWA 1B1YA 4L4MA 2ESCA 4IQJA 2NUYA 1VB9A 4CQAA 3W4RA 3P6LA 4FOJA 4TVUA 4G6CA 2RDXA 4BY3A 1CEOA 3PBMA 2CZEA 1WX0A 1E4LA 2GGEA 3H12A 2Y85A 1TUXA 2X0HA 2J13A 4CD7A 5FJIA 5E93A 1HT6A 3SN0A 4EAYA 3GS6A 3LGEA 5BNKA 3JVAA 3P61A 5D33A 4M7SA 3WH6A 3VOFA 3E5PA 4HHLA 3B0UX 4MF4A 8CGTA 5C9RA 3AMGA 3BICA 3BZGA 3UPBA 1EP3A 3WNMA 3TR2A 5BXRA 3APGA 3L7RA 3HO8A 5FACA 1TO3A 4CD4A 1CLXA 3W84A 5F2GA 1J9YA 1FCUA 3ARUA 4ZENA 1XIHA 4WHBA 3ELFA 1MNZA 5DXXA 2R1PA 2ZQ0A 4NRRA 2VL4A 1QOXA 4NF7A 2GJXA 1ITUA 1VFOA 5AC7A 1K4HA 3AZRA 1A5SA 3TU9A 3LZ3A 1FWCC 4XIAA 4NJIA 5M2FX 4A4AA 4DI8A 2W66A 2QIWA 5CC5A 1A3HA 2O0TA 4I9AA 1MDLA 1R9YA 3K4AA 4DBSA 3EOSA 3B0PA 4Q8VA 2GSHA 2EAWA 3Q94A 1W3NA 4F3HA 2OSXA 2DEPA 5I3HA 2W4XA 3QR1A 5F4SA 3WBXA 2B0MA 2IKJA 1X7FA 3BDKA 3H2AA 3W7OA 3AS1A 3LERA 4PZVA 4A22A 1RH9A 4YS1A 2YCJA 5BOFA 2P53A 3LGDA 2E6AA 4NG3A 5FJRA 4ZZ9A 1GVOA 3MZNA 4YHEA 3VNDA 3QM3A 2PC8A 4HNLA 5KITA 2D2GA 4L6HA 4LGXA 1J5SA 1D3CA 2CIPA 1ZPTA 3GIQA 3FHAA 4PTMA 5A6AA 5JH2A 2A21A 2QJMA 4P8XA 2XSBA 5I07A 4UQAA 3ARTA 5BOEA 4BKNA 4HK6A 3WBYA 1SJBA 4XTIA 1E1CB 4LUJA 4L65A 4IISA 3TP4A 3II1A 3QPYA 2A3CA 2VCCA 4A2RA 3C2FA 2IPJA 1OGGA 1BG9A 4KEUA 2PDWA 3VFLA 4D72A 4NAEA 5A8OA 2G97A 1Z48A 2QGYA 1H62A 5EY5A 3BMVA 4QIUA 5EMMA 3TNOA 4H8UA 2DSKA 1Q13A 3CPUA 3OBAA 2ZZ1A 3Q37A 3QY8A 5C2XA 2VD9A 1S2VA 2H9AB 2BP1A 2VP8A 1M7XA 3OEXA 3KRSA 1UWSA 4XKMA 5A8MA 3W3OA 1FP9A 3MV11 1C8XA 3C4UA 3NGFA 3IV8A 1DJWA 4J3UA 4ECLA 4PEKA 4E2BA 1W31A 3GE7A 5AB3A 2GVEA 1D7FA 3WK0A 4ACZB 3HOJA 1UOZA 3HV9A 1YXDA 4BS0A 1ZHAA 1CBGA 1V02A 2WSKA 4F2TA 4X9SA 3L12A 4F8XA 4NZ4A 3DHDA 1W17A 1FCVA 4LAZA 3VDGA 2D69A 1C29A 3KTCA 3OB8A 3CMGA 1WUEA 3M6YA 3AROA 3M46A 4ZQNA 3SY8A 2DT1A 3WDQA 3COTA 2HS8A 3E0FA 4LF1A 3PPFA 1TWZA 1PKLA 2WNWA 2OLSA 4HNVA 1M68A 4M3PA 3ZFHA 3BMXA 4D8ZA 4M6UA 1YE4A 3QQ1A 2AKMA 2GVJA 3OIHA 5I3IA 1CGYA 2REQA 3MC5A 3NSNA 2CITA 2HV5A 3BSGA 2FMNA 1KRAC 1ZJBA 4TX8A 1QK2A 4GY7A 3VGGA 2X7VA 1OEPA 3OZYA 2XIIA 4AF0A 2J74A 3KL0A 4NX0A 4B9YA 2OX4A 1N82A 2WKLA 3SI9A 4IFRA 3LHUA 2XIBA 1SW7A 1E0UA 5CPLA 2X1TA 2ACUA 3LYEA 4OBTA 4UOQA 5HA7A 4AVOA 2VZTA 2E8ZA 3TQKA 1ZBWA 3POHA 5AC8A 1KFCA 3PP7A 1ITQA 2FJUB 1V6VA 3UPWA 4C6QA 5AHEA 4GO8A 4JKMA 4KCVA 3URNA 1YBQB 1GW1A 3SCNA 1UIPA 4IJBA 3WDHA 4UMAA 4EX4A 1TWDA 2HZGA 2PA6A 2C16A 4QJ1A 5HK4A 5TQLA 2QVHA 5CZKA 4BR1A 5A5WA 1D7KA 3USBA 1U22A 3A6OA 9CGTA 1L6SA 1JCJA 2ZRWA 4O54A 4Y6GA 3V16A 3DYPA 1AQHA 1TELA 3M41A 3ARQA 1CCWB 4K1GA 5I23A 3T05A 3LM7A 3ATYA 4DX3A 3MS8A 3NPVA 3K1GA 1RHCA 1V03A 3BJTA 4LS0A 5BRQA 3GVWA 3GVVA 2BG5A 2AQWA 4IPNB 3CV2A 3GTFA 1NDYA 1RCQA 1OYCA 4QE4A 5G1MA 1VFLA 4JR5A 1OHLA 4WR3A 5L9FA 3SW6A 3WNLA 4KGLA 4Y90A 5D03A 4RK8A 4UC5A 1P1XA 3G6LA 3GKAA 1M01A 1RZMA 4PMOA 3P8IA 1I2OA 2XIJA 3KVJA 2Y61A 3N3TA 4I9JA 2Y88A 4H01A 2D2JA 4JHMA 3KW3A 1REQA 4KFNA 4JIEA 3V18A 4BHYA 5DRCA 4CU8A 2W67A 4O57A 2ZRXA 2OGJA 2OXNA 4CVWA 1ZENA 1R3VA 1W9VA 1V4YA 4XK2A 1D8WA 4UNKA 4YYFA 4IJCA 3S5YA 3XINA 1CT5A 3MJYA 1RA0A 4Q33A 3LHTA 3T81A 2VZSA 1B4EA 4PTVA 5G2WA 3V35A 1LLWA 2Z4GA 1UMYA 5AYYA 2REQB 3MB9A 1EPVA 4OUEA 2PPGA 4M56A 2E28A 3WF4A 3TNBA 5C9WA 1KXVA 4C6KA 3F4CA 2OT0A 1W9XA 2JKEA 3BCDA 5EFFA 3QMRA 4JQ4A 5G1YA 3LXBA 2YCLA 1PDYA 4XUGA 2OT1A 4CCEA 3WEMA 2QQ6A 2JFEX 3QSRA 3NQVA 3RK8A 2C1GA 3BLPX 4XQ6A 4ADUA 4QQUA 3PB0A 3SCQA 3DERA 3FGCA 3GXDA 2HVOA 1FHDA 1KFKA 4XZHA 1KBLA 2VFGA 3FDGA 1DORA 4BI6A 3PBVA 4Z2JA 4H8VA 3A47A 2OCZA 3ENLA 2FTWA 4U5KA 2BY1A 1TZZA 3NZPA 1J10A 5DANA 4O14A 3PK7A 3CQHA 4Y96A 3B3DA 2X1IA 4ACZA 2GFTA 1S2AA 3U5YA 2ZIDA 1R3SA 3AJ7A 5CH9A 5GPRA 1NP2A 4RE0A 4B3ZA 4UQCA 1ONEA 4HK5A 7CGTA 3WEZA 5CBJA 5C9UA 1R3QA 4PMZA 2NQZA 2F6KA 1E6XM 1GG0A 5FF3A 1EJVC 4O1DA 1ZSXA 2CHOA 3PUDA 1XSJA 1YPXA 1OWQA 1UD3A 2OLHA 5B7ZA 1UZDA 3KBWA 5IHRA 3FNDA 4GNKB 1JDAA 5AYIA 3RLVA 3H7RA 3IUIA 1DBTA 2NX9A 2VC9A 3C2RA 5HPCA 3N18A 3DFHA 3GTHA 5JBDA 4J7RA 1WDRA 4QM1A 2XZ9A 2Q01A 1G0CA 2PU0A 1SJCA 1WXZA 2ZA3A 3LNMA 3PULA 5HINA 2XVNA 4RV3A 4MZ8A 3NO1A 4MWAE 5CAHA 3ARYA 3MMWA 1EF3A 2ALDA 2V38A 3Q4DA 3KCLA 4IIGA 3QYSA 4LEFA 4Y2WA 1Q2SA 2UV8G 4M29A 4V15A 5FJOA 1ENUA 3UJ2A 3R4IA 2IQ0A 2ZBTA 3L4WA 5GJMA 1YNQA 3NCOA 1EZWA 3SRHA 1UA3A 2ZC8A 2HEJA 4W86A 3W1UA 1V6TA 4DPQA 4JXCA 3CYVA 2ZZ4A 4JTIA 1IXQA 4JY8A 1B9ZA 3LENA 1FWEC 3TN5A 2C6QA 4JTFA 2IKGA 4M1RA 1VS1A 2R1NA 3PBYA 2J66A 1JYWA 3REQA 4QE1A 3OG3A 2PDMA 3OVPA 1X39A 3C2OA 4PL1A 3WQ8A 4LVAA 1TPUA 5EL1A 3R2GA 2BSLA 4L64A 3IAPA 4O1BA 1K9FA 2E68A 3C2YA 4L1WA 1QI3A 1BF6A 5HNTA 1IEVA 3KXQA 2P5NA 3KVMA 1JPMA 3MUY1 4UMCA 3ITXA 2VVNA 3VD5A 5SWUA 4ATLA 5I3KA 1CGUA 4IXXA 4GBDA 2FFCA 4ATDA 4S3FA 4C91A 3UXIA 3DBPA 4C6DA 4DXVA 1UASA 4N9EA 2PLKA 3ITLA 2V82A 3R8GA 5IBXC 2O4QA 4CN1A 4PFMA 2DUXA 1T41A 3GR7A 4OIFA 8RUCA 2A79A 3QV8A 3G3DA 1QNPA 1VJSA 3DC8A 2QV5A 3AYRA 3D3FA 4GXMA 2PDNA 3BXWA 3R8HA 1XIBA 2Z1SA 3GHSA 1R3YA 4E2VA 2OFJA 4JTUA 3VKBA 5REQA 4PRTA 2PC4A 3FA3A 1RY8A 1UH3A 2PFHA 2QPUA 1CXHA 2FVMA 1BXNA 1GTEA 4DWDA 3T42A 1VIZA 2ZZ2A 3WFAA 3S0CA 3NM1A 2QUVA 1JL8A 3WFZA 5C2CA 1NH6A 3S5NA 2GUBA 4UQDA 1BHGA 4CQBA 2F38A 1WDDA 3RXZA 6REQB 4WZHA 1KQZA 1AH0A 1HL2A 1TA3A 3S47A 1IXPA 4NI8A 3S2JA 3DFYA 5CC3A 1XI3A 4MJ2A 2C15A 3LV6A 4KEMA 4C1KA 4CQCA 1Q65A 3I4EA 1BGAA 2NWRA 3AS3A 1GVSA 4MJZA 3O9NA 4O17A 3RDKA 5A6BA 3FGCB 2NQ9A 3S6TA 4HSNA 1XYFA 1TWSA 4W7VA 1PKMA 1SFTA 4AZIA 1AD4A 4F0KA 3GAYA 2W92A 1Q8AA 2HE5A 2DDXA 3UWEA 3E2SA 3WY1A 4BWLC 4AD1A 2WBKA 4XBSA 2E09A 1N2VA 3SUUA 2ZRZA 1I1WA 2FKPA 4ROPA 1UWUA 4ZODA 1C9DA 3PFMA 1Q6LA 3M5YA 2BOFX 4PBEA 3SIZA 3UA3A 4GNJA 4LY8A 1HJUA 1GW9A 3IRDA 4AY8A 4AVFA 4F66A 2CXEA 1U5HA 3BW4A 2WKJA 1E1FA 3THCA 4A3YA 2PLJA 1GGOA 3AIQA 5FEZA 3QZEA 4JIRA 4YTQA 4PH6A 3VGDA 4QAWA 3PJWA 3TH6A 1IR1A 6CGTA 1OFRA 2R6OA 3BCJA 3FYPA 3JUGA 4EF8A 3THAA 3WL1A 4PTDA 2RDWA 3H4WA 3K5XA 1IT7A 2V69A 4WJ8A 4GI4A 3UJFA 1BXCA 3BLIA 2XH0A 2DJXA 4O1EA 3BG3A 4OU1A 4V1XA 3RLGA 2PAJA 2IKIA 3M0YA 3CU2A 3LPPA 3MI2A 3NPWA 5A6KA 4Z2KA 1LYXA 1NEYA 3TYAA 2YOCA 4D8LA 3AOFA 3T9PA 1LJYA 3QGVA 1PCKA 3UG5A 5C9ZA 3CIWA 1M7OA 3IAQA 3BLFA 1MDRA 4RNHA 4ZTYA 4Y8EA 4KWWA 1JZ4A 3AU2A 4H9YA 3B40A 2DW7A 1RXOB 3I3DA 2TAAA 1EO7A 2WZHA 4J3VA 1J0YA 4L6OA 1WV2A 2FIQA 3EOUA 4RE2A 1UUQA 3SCOA 4IUGA 3FLUA 4RNFA 3A4AA 3K13A 4MFEA 4UZUA 1B9BA 4C6BA 3DZ1A 3VUSA 4PUDA 2BVDA 5EMYA 3C8FA 3FFSA 2AAAA 1KKOA 4W7WA 2VEPA 4AD2A 5K2ZA 2NXHA 4KBXA 2FB3A 1R30A 4OZOA 3CGTA 1H5VA 3WSUA 2G5WA 1KNWA 1RBOB 3CHDA 4IOTA 3ZVHB 1UR0A 3U3HA 3TA6A 2MUCA 4UTLA 3VIGA 3OLGA 1KRBC 3N6QA 4AD3A 1HL8A 2GVGA 2FZDA 4K3ZA 1JRBA 2INZA 8TIMA 2WLZA 4PFHA 4UUIA 2OWWA 3LB0A 1U1HA 4MUZA 3L4TA 4KQNA 3EGJA 4JTTA 4J3SA 3GXNA 3SUTA 3NL5A 4GX8A 2E1WA 1R47A 4J3WA 1G94A 3N1AA 5F1UA 1LBFA 4GG9A 3UR7A 4RUBA 1DL3A 4WY0F 2JF6A 2CYGA 4CD5A 3A3HA 4PUJA 3DFOA 3PUOA 2QULA 3KOWA 1XLMA 3FHQA 4L9YA 4EPEC 3WLSA 4NSBA 1IEWA 3CXOA 3CH0A 2GQAA 2Y63A 5C7VA 4LS1A 4US5D 5AY7A 2R1LA 3ZVHA 4P7LA 3SADA 3F4DA 4PYSA 3VD3A 4H19A 1OVDA 3PS7A 3ECQA 4WXYA 4PRWA 3U5UA 5KZEA 2VXNA 2WOQA 4GPNA 2HWGA 2V3FA 2TMDA 5IFPA 3PZGA 1OF6A 4CNPA 4KS0A 5G4WA 4F4RA 3PAJA 1SO6A 3PF3A 4Q8NA 5EPDA 3IANA 3UEQA 2OR2A 3EYPA 1LQ2A 3FOKA 3M0VA 4B9ZA 5AKQA 3L5LA 3LI0A 3N15A 2CKSA 1KXQA 3BE7A 1TPWA 3IGSA 4N9DA 1TJRA 2ZVIA 4OE7A 2XJ7A 3NA8A 1BTMA 3HMCA 1JI2A 2J24A 1TE6A 3BSMA 3BWWA 3G22A 4EK7A 3J7HA 4S3DA 1H09A 3KE0A 4AZHA 3REQB 2PWUA 2EBNA 2JIEA 3KOFA 1XXXA 4OOZA 1E6PA 3EA1A 1F5ZA 3LCWA 1LQAA 5HMSA 4MZYA 1BKHA 1J96A 1QT1A 4L9XA 2O9TA 3VNYA 1TMQA 3OA3A 4WKFA 1SM9A 5DT5A 2W5FA 4Q8UA 1NWSA 1XS2A 5IDZA 1QNVA 1W5QA 3W7DA 4HMNA 2PCEA 3HPSA 4PGLA 1UP3A 3OODA 5HMEA 1ECQA 1E51A 2WVSA 3MKVA 4DJDC 1HX0A 1W1PA 2C13A 4ML9A 2D0GA 4K8HA 4FA3A 2X2GA 5E0CA 2C14A 5DY3A 3SRFA 4UCFA 4XKYB 3WJZA 3N34A 3T44A 1LOQA 2PODA 3QXBA 5M17A 4QLLA 3GDLA 3BV7A 2CLOA 1PZ2A 2V67A 2A0NA 3TAOA 2ZDSA 2Z2UA 2QCHA 4KIRA 3EMZA 2QDDA 2J88A 4IPPA 3UWQA 4XISA 2GJNA 5CKSA 4QDPA 4R3UA 1UQZA 5D8ZA 2PS2A 2E5CA 5FSEC 3L5MA 3NDZA 1EYEA 5XIAA 4UCGA 1A0EA 1OK6A 1EL3A 1OADA 1TREA 3CUHA 2WJDA 5D32A 5CBIA 2OZ3A 3JS3A 3G8EA 5LNSA 3PTMA 5FL0A 5IBXA 3EEZA 4GQ0A 4LQ1A 4O10A 3TJLA 3S83A 2OPJA 4ZFMA 2GWGA 4G7EA 3MBFA 4CGTA 1O5KA 3S1WA 1DXFA 1Q7ZA 3WQOA 2GK1B 4JTAA 3DFPA 1S1RA 4B5XA 1V0MA 1XLGA 2XIOA 1TWIA 4WUIA 2PTZA 3MUAA 5F2LA 2DZSA 1PB0A 4GUJA 4Q4QA 3N04A 1RVKA 1UROA 2XGIA 3O06A 4Q3MA 2ACQA 1FWFC 3B9NA 2IS7A 5A2BA 2XHYA 4PC8A 2QKFA 2HBVA 3WQVA 1AZ2A 2CZDA 1QPNA 2J9ZA 1OFDA 3O7UA 3V5FA 2B7QA 2ZX5A 2W91A 1JGMA 5A8GA 3PANA 5A3HA 3VKCA 1FWNA 3GDTA 3THQA 3C56A 3UJEA 1WO2A 3OQEA 4QLJA 3HPAA 2ZUTA 4EACA 4NZ5A 1AA1B 1VHCA 3WNOA 4P7QA 4ZR8A 1J79A 3VE7A 5GNXA 6REQA 4DJFD 1ICPA 3VMPA 3M6DA 3V1PA 4LVGA 4X2RA 4Q4PA 1HFBA 1QDSA 1QWKA 3KHDA 2XN0A 3W26A 1BKSA 4N9BA 1RJPA 3L4ZA 4MAVA 4M6QA 4HNNA 5C5YA 3AALA 3SCUA 1R2RA 1V0KA 4CEXC 3KVLA 1BG4A 3N2BA 2OKTA 1AZ1A 1JPIA 4JFTA 1DWAM 4OFCA 5B80A 1BTCA 3H23A 4IMGA 3U57A 4V2XA 1TYGA 5CJ5A 4UWMA 4Z1YA 1KM4A 1ZY9A 1GONA 1WA3A 3S2NA 5CC6A 4IQLA 3GXPA 4IL0A 3U0HA 5H6HA 4P7RA 3CPRA 2QMKA 2QUUA 3CZKA 4E6MA 2QZRA 3VCNA 4MYXA 3VNLA 2PD9A 1LDCA 2XIQA 2EPLX 1OFAA 3B03A 2VQUA 3TXVA 3DKJA 1DEDA 2WMIA 3VU2A 1XH1A 2I5QA 3V0TA 3PZTA 1DQXA 1K6WA 4C90A 4FNUA 1K03A 1DJGA 1LCOA 2DP3A 3WH7A 4AZBA 1NOWA 3UU0A 4U31A 2GUYA 3PTQA 1QU4A 2QHAA 3LPOA 4J3XA 1KM2A 4DO5A 2Q3RA 1WOAA 3B9EA 4LBRA 4RE4A 1A5CA 4C6OA 1DYSA 4PUUA 3LCHA 4GUGA 1RPXA 3W6LA 2GGGA 1MNSA 1SGJA 1R2SA 3EDDA 2QR6A 4XZWA 3WQ6A 1VEPA 2Z6JA 4GA8A 2G8ZA 1YDNA 4PL2A 4DNHA 2PGWA 3A4JA 3IIPA 3H4XA 1KLYA 4E3TA 3ONCA 3WFLA 3PZVA 2VCAA 2JIWA 5MF5A 4JKKA 2X30A 5JH1A 5DCDA 3PZNA 1UKQA 4R9XA 5E09A 3AIBA 3CUXA 1RK6A 4FF5A 3AJXA 2FB2A 3TLLA 2FHCA 1UHVA 2GDUA 1N55A 4JIQA 1EGMA 4WX2A 1QNOA 4Y9OA 1MFUA 2ZZ6A 3T0DA 1ME9A 3ORWA 3TOPA 4OKDA 1JCTA 2CBUA 5K9XA 1JYVA 1SFJA 5E9XA 4Z1AA 1BSIA 1VPXA 1A4MA 2HPMA 2C79A 3DU0A 3FKKA 2E1DA 2YKKA 4AWEA 3MSDA 2Q8ZA 5AYBA 3CLWA 5J8LA 3IVUA 3W00A 1O95A 1VKFA 2YL8A 3CIVA 2GOKA 1RSCA 2WBGA 2UY5A 4AZCB 1R3WA 4A21A 3C3NA 3W29A 1JD9A 4U10A 1XBZA 3GNRA 4C65A 2Y7FA 1YTKA 5A6JA 5HMDA 1V6UA 1L8NA 2A3HA 3DH7A 4MB5A 1BVWA 1F76A 1XDMA 4MB3A 3VIHA 1HN1A 1E0TA 3SQSA 4S3EA 4F79A 4RDZA 3M0LA 3BJFA 3B04A 4D6HA 1ZAHA 2XZ7A 3LCFA 4IL2A 4ZQPA 1XLHA 1CGWA 1UD5A 1ZCOA 1V93A 3VNKA 3LBOA 2ISFA 4H2CA 2ACRA 1CLVA 3V5CA 4C7DA 3QSTA 8XIMA 4XAPA 4A8LA 2YR1A 5CSSA 3HJEA 1VBGA 3EKLA 3BLLA 2QAFA 3NSXA 4B4FA 4PRRA 4D6IA 2E4TA 4O0QA 2YZRA 3BTNA 1DIKA 4AZCA 3AMCA 3V3WA 1YIXA 1QWGA 3EOOA 2VURA 4X60A 3MQTA 2CBIA 1WPCA 1DIDA 4JN8A 1QPRA 4K8GA 4Q7BA 3V0UA 3HFTA 3W1AA 1BLIA 2C1HA 3HPZA 4Y7EA 1DWIM 3KOZA 4EF9A 4AY7A 1W3TA 3NZ1A 4LFYA 1OX4A 4MKSA 2EJ1A 1P0NA 4LC8A 4AX6A 1U5VA 2E9LA 4LUTA 3CHCA 3RIKA 3DIPA 4DIAA 5ECVA 1IHIA 5F2MA 4F48A 3URBA 5H8MA 2HXTA 5C0QA 3M4HA 3S4TA 1VFMA 1GQIA 5LNUA 4IMAA 4UNLA 1SU5A 4JTQA 4H83A 5LNWA 5BWAA 3MYPA 1JZ5A 3HPXA 4JQ1A 1MUMA 2Q6ZA 3UG8A 2R1KA 1ICQA 3FA5A 2IPFA 1I0DA 1NSJA 4WDTA 3NO3A 1VFUA 4R85A 2P1FA 6TAAA 2JK2A 7ENLA 3LNPA 2VUYA 1PYFA 3PJXA 2WVVA 4XSMA 3KWSA 4OWGA 5JQ9A 2CLKA 2FGBA 2Q09A 4AHQA 2DSVA 2C18A 4DXXA 3TE9A 3QZ6A 5KSWA 6ALDA 3RITA 4GD0A 4OQVA 4X63A 4MPKA 3NPUA 4PUNA 4HU3A 2GOUA 5HBFA 3KRBA 5CGQA 4JFSA 4TVDA 1AW1A 1NP0A 2VFDA 5E6ZA 1KTBA 2HBXA 4O8RA 1B31A 4I7UA 1HIZA 4XD3A 1YBQA 4S2CA 2DZTA 5T8GA 1H49A 1FWRA 1DV7A 4WVXA 3PR2A 4JGDA 1W91A 3GFZA 3AI0A 3WBWA 2HK0A 2YL6A 2UWFA 2XH7A 1LT8A 4Q8MA 1JFHA 2YFOA 1SVDA 4HT3A 5D04C 4HPXA 1OY0A 3SQMA 2NXGA 1FHVA 3F7JA 1BWLA 2WSQA 4C6NA 1LL7A 2PWHA 1TR9A 4ZB2A 4K68A 3GR4A 2F2HA 5H1WA 2PU1A 3CPGA 2ONEA 1A49A 1EKOA 2PDCA 2OEKA 3QV6A 5A6LA 1CXLA 1PTDA 1JXJA 4WDUA 5IM51 3HGRA 2BZNA 2E77A 4PN2A 3GHRA 4IGNA 4G56A 4DJFC 3STEA 1UIOA 4YVPA 3CHVA 2OQYA 1MXDA 3VIKA 1JPKA 2OOGA 4N4QA 4S3CA 3EWBX 5A6TC 4C6CA 3LRLA 3BGAA 2PBOA 4HMCA 4I6VA 4ZSTA 5DRIA 3QQWA 1C91A 3W24A 3TCEA 1E1EA 4XTDA 1FXPA 3A4XA 2BWGA 4N2YA 3EWYA 1H61A 3WD2A 4HMEA 5T9BG 3KVKA 1QO5A 2Y5EA 4HBKA 3OU8A 2W61A 3TJIA 1W5NA 2J25A 4FXSA 4MIMA 2YZ5A 5LSMA 5CLTA 2ISWA 1US0A 2CWNA 1WYIA 4GUFA 4GQBA 3S1UA 1H50A 3GBEA 2PTXA 1S2CA 2X05A 4IGMA 4P5UA 3O0KA 4J1OA 4L4PA 3L4VA 3H2CA 4A8RA 3GC5A 3SN4A 1Z8AA 3W7NA 4TO8A 1A4LA 2ZZ7A 5EU9A 2NSXA 4DELA 4PODA 1UPMB 3G1SA 4JTDA 4ICCX 1JQXA 4L56A 5CG0A 2WXDM 4Q8QA 3GH7A 4W89A 4MSSA 4TQTA 5D4YA 1XH2A 3GVRA 2VRQA 3LLDA 3G1DA 3WMBA 1GZ1A 4ZFCA 3WL0A 1W9UA 3N14A 1JGIA 1FHUA 4XO6A 4PULA 5LIWX 4HIBA 1HKIA 5JMUA 3VCCA 1GG1A 3B06A 4DN1A 1FH7A 2E6YA 4LT9A 3LCLA 4DO7A 1OYAA 5HNUA 3ARPA 3EB3A 4IPLA 2YYUA 4PMNA 2D3LA 3IPWA 2VFIA 3VOCA 1ZBKA 4AZ6A 1JZ6A 3CJPA 1ONXA 4C1NA 3RYSA 2V0TA 2ZUNA 5MKGB 1JCNA 4MY9A 2G41A 1ZJIA 2BBFA 3R94A 1XYLA 5M03A 2RAGA 4TMCA 3NR0A 2POZA 3IV3A 1PIGA 2UY2A 4FR6A 4HJFA 3N6JA 3W9ZA 2BVWA 3F5KA 2A4AA 1ONRA 1YX1A 3UXKA 1OG0A 1AG1O 5T26A 3W74A 1E3XA 3ARXA 1TZ7A 2DSWA 3FDKA 1X38A 2WCAA 4QROA 4PCSA 3PFRA 3WN6A 1XX1A 1LWJA 2PDJA 3ZIZA 3TMQA 3TC6A 1X8FA 3OTRA 4DWSD 2G3NA 4FO4A 3LCXA 2FH6A 4FLOA 3RJYA 2H90A 4LX4A 4Z1CA 2CZ5A 4GINA 4LRSA 1J6PA 1TTPA 3G1HA 1J0HA 1V7AA 1QR7A 3CMFA 3SB0A 4RL3A 4QSHA 5LA1A 4LBUA 1SMDA 4Z17A 3RO8A 2PTDA 4NY2A 4U5IA 2D2OA 5KINA 4MJMA 4UTWA 2TSYA 3V1HA 1FA2A 4D6JA 1G4PA 4FLRA 1JYXA 1EEXA 2NVCA 1NWUA 3BAXA 2I7GA 2VZVA 3CASA 2PDLA 4AYGA 1LBMA 4Q32A 1BSLA 1EB3A 2GJRA 5HUOA 3UY8A 2J8TA 1UUMA 3N25A 4P7OA 4H2HA 2XM1A 3KFTA 1Q4WA 3HG4A 4ZMGA 3HV8A 4GZJA 4W5ZA 3QHMA 5C2GA 1Y65A 3CB3A 3LA4A 2ZXDA 4UZSA 1TPFA 3CHEA 2YDRA 1DXEA 1DTNA 1VEMA 3EDJA 4C7GA 3GTIA 1QTWA 1FWTA 3LU2A 4B2DA 3W7JA 3R89A 3M0KA 1LG2A 5AN7A 2V8ZA 3GG7A 1P1MA 1M7PA 5I78A 2CW6A 3H2EA 1GNXA 4CKQA 1EDTA 3AC0A 2PE4A 1XLBA 1GEHA 1PTAA 2DJLA 4Z2LA 1SMAA 2ZUVA 1SZRA 4AQLA 3W7RA 3B8SA 4GHRA 4G7FA 4GYJA 1RY0A 3RNDA 3HGOA 2O56A 2C7FA 3DKLA 3K30A 7TAAA 4Q4SA 1AJZA 1KBKA 2XG9A 5G4EA 3BAIA 4A8IA 1FWGC 1GPWA 3QFWA 4MNMA 4B5VA 2Y7EA 3UFYA 4ZVJA 1DQWA 4PUWA 3P8JA 2GK1A 2PWEA 1PCWA 3POCA 1UYQA 1DTUA 4LTSA 1OFOA 1C8QA 4GGHA 5E5CA 3GC2A 2I16A 3W1QA 4QEHA 4QLKA 1DP0A 4GKLA 1P0EA 2OSYA 4RXGA 2V2DA 1T5AA 1R86A 2ZE0A 3L2MA 4C6IA 1AJ0A 4MYAA 4HOZA 1EQCA 4DNMA 1OIMA 1XP3A 4S3GA 2VZOA 3M0HA 2WMGA 1I2QA 1V08A 3DCPA 3EA2A 1JJKA 1G6CA 5LGXA 1XSIA 1EJWC 1KB3A 4OT7A 1A3WA 5F7UA 3N2CA 4NZ3A 3F4VA 4U2YA 1Q5MA 3PPHA 4IX2A 4LH8A 5E70A 2QCDA 1GQJA 4H8NA 4NI3A 5JVLA 2A6NA 2G37A 4OV4A 4G8TA 5E6YA 5DN1A 8A3HA 9RUBA 3SECA 1UD2A