1LT8A

Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
348
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKGQEVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 117
structure length 348
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt8A00
5DMNA 1LT7A 1Q8JA 3BOFA 4M3PA 1Q7MA 1Q85A 1LT8A 1Q7QA 1Q7ZA 5DMMA 5DMLA 3BOLA 4CCZA 1Q8AA 1UMYA
chains in the Genus database with same CATH superfamily
1ZS2A 3WD3A 1TPC1 2X1RA 1ZHAA 2NW0A 1KQZA 3U2OA 4O0KA 3VNZA 3MCNA 1DXEA 1VCFA 1W37A 3TOPA 1QJWA 4J3TA 4QQUA 3BQ6A 3V16A 2UV8G 1GYLA 3JW7A 4AD4A 2WWDA 1DJZA 3C8FA 1XX1A 1HZYA 1O12A 1XUUA 4C6NA 1GQLA 2OYLA 3OBEA 5C9WA 4NRRA 2WC4A 1VFLA 1OZQA 1ISYA 2BVWA 2QJMA 1BRLB 3W28A 3BQ5A 2G5WA 1R7OA 3JUGA 2WMHA 3PR2A 4G8TA 4HNCA 1SJCA 4O1DA 1OFQA 4ZMGA 1PBGA 5BXPA 4NASA 1JAEA 3LM3A 3EB2A 1R8LA 3UERA 4GI8A 5AHLA 1DWGM 3FJ4A 3DAQA 4XZMX 5K4XA 3E49A 1LWIA 3D3AA 1TPWA 2AQWA 3FOKA 2VZUA 2RJHA 3EKGA 1AH0A 2QIIA 2CBJA 5JBDA 2XN0A 1PCKA 4XWUA 4C65A 3UXLA 1R3TA 2QPXA 1S5NA 2BXZA 1FX6A 4LF2A 3NXFA 3AIVA 3N73A 4HMNA 5T26A 5HR6A 3VMNA 3VZYA 2R1MA 2Y24A 4FIRA 1VLWA 3VNKA 3IV8A 3IGUA 4U33A 2XFFA 3MW7A 2ALRA 4HYRA 4M51A 5AVNA 4RNFA 3BJFA 4GZ7A 3PWGA 4QAWA 2V5JA 1FCBA 1B57A 2G95A 5K9CA 6TAAA 4XD6A 2PPGA 1V77A 3LI1A 1UP3A 3VOCA 1EC7A 1XSKA 2UY2A 3AMGA 1VYRA 1EOKA 4LAKA 1MDRA 4MPQA 4EXQA 1OIMA 2OKOA 1RP9A 4MUPA 1AJZA 3DGBA 3W7CA 4AHOA 3STPA 3T42A 2BXVA 2XSAA 3MWCA 6PTDA 2QW5A 4B5TA 1OBAA 3TK7A 2QJIA 1P1XA 5A6SA 1EDGA 2DEPA 2X09A 1M41A 3GRIA 3TJLA 1BAGA 1FY6A 1GOWA 2J27A 1HJUA 3RYSA 2C0AA 2ZRYA 1Q6QA 3ES8A 4J2MA 1XCFA 2P5NA 3CAQA 3VI2A 1RJPA 4MNLA 2VEFA 4Q8WA 1FRBA 4Z1CA 3VKCA 4LNCA 3B8SA 1A5UA 1T40A 1VYPX 4FNSA 4RLIA 4G7EA 1UPMB 2BLEA 4WY0A 3UG4A 2F6UA 2HXUA 2W27A 5AHIA 2PI6A 3QQ0A 3NCOA 2CZEA 2PWHA 1IWPA 1G7UA 2OODA 3CHEA 4U3CA 1J6OA 2QCHA 1OM0A 1CDGA 2D20A 1PKYA 1MI3A 4MWAA 5GJPA 3H2CA 4QS6A 1R30A 1ZGDA 4NJIA 3N34A 2DT3A 3CUZA 3VD3A 3RHGA 1TA3A 4HOZA 3N9SA 3O6DA 2BHUA 3G1FA 2VC5A 3S9YA 1EKOA 3VKKA 4XVDA 5E1QA 1C8YA 3SSZA 1UW9A 1W9PA 2AOSA 5DANA 4CNOA 1EJXC 1ZALA 2VNCA 3MHFA 1N55A 5CCZA 1W1B1 4AG0A 5KETA 1W5OA 1R3SA 2YFNA 1LLOA 3KCLA 4D8LA 7REQA 8TIMA 3WLPA 1PIFA 3G22A 3R8GA 2HPMA 3QZAA 1VFUA 1F7BA 3GH4A 5JU6A 1Q5MA 3AIEA 4MZ8A 3L5MA 3B4YA 2C1IA 2FTPA 2INEA 2EF9A 3W1TA 1UR9A 4UTJA 1UD4A 3TXZA 1UWQA 5IBXA 3W07A 4GYPA 4Y9OA 1ITUA 1YTEA 4UOZA 3QR3A 3VX0A 1C91A 1BWLA 1H11A 2YLAA 1GYMA 4HHPA 2DUAA 1ZP3A 2YB4A 3HPZA 2NLYA 1TTQA 5BRPA 3ZZ1A 1G01A 3UETA 4DZHA 1OG6A 3URQA 4FLSA 2O4MA 3O7UA 4H19A 4YYCA 1AMYA 4PMVA 4P2VA 1PKLA 1WB0A 4IMCA 2WKGA 3WCZA 3WMSA 3FYYA 3WMLA 4GFSA 3QPEA 3UR5A 3OGVA 1CGXA 2VT0A 4ZO9A 2B7OA 2D24A 1F8MA 3TW6A 1Z6KA 3TAKA 2GDQA 5LIYX 2GUUA 3BL3A 3OG3A 1JXKA 3TYBA 2EEXA 1P5BA 1E6RA 3C2RA 2PLKA 4JZ5A 5JUVA 5JBFA 3CBWA 2RHGA 3OODA 3UR2A 3ZIZA 3KVMA 1KC7A 3WD4A 3LRMA 2VDHA 1BQCA 3LBOA 2D2HA 4HOXA 2WHMA 4W8BA 4ORIA 1UUQA 4B3KA 3F5KA 4B5SA 2F6KA 1HTIA 2YYTA 3M5YA 2CLOA 4X3ZA 3TSBA 2DT0A 3K8KA 1CTNA 4FR6A 4OT7A 4L1GA 6A3HA 2QULA 2OFJA 3EXSA 4QHRA 4C7DA 1ISXA 4ZGYA 3UA4A 1MUMA 2PB1A 2QS8A 1ITQA 4JCLA 4KRZA 1TPVA 3BSHA 2FDSA 4MUZA 4QDWA 3H12A 1JZ5A 3D0CA 1TX2A 5KZEA 1UWUA 4Q7NA 1U5VA 3HGJA 3TA9A 2I17A 3NL3A 4LCQA 4PMJA 1PVNA 4DWDA 3G5EA 2OELA 3EOEA 3O15A 3GNOA 1TVPA 4Q6JA 4JFWA 3NA8A 2B0MA 2AGTA 4IPIA 1JFXA 1E0WA 1QOXA 4H2CA 3S1VA 3FVDA 2Y85A 4QFUA 1PAMA 1AFSA 4E4UA 1HX0A 2D73A 1PZ1A 3W26A 2WWCA 2W91A 2XVNA 4R7WA 3NQ8A 4Q4MA 2PWGA 3VDCA 1E0XA 2ESCA 3M6YA 4Z1DA 1L6GA 2VYOA 2FJUB 2ISFA 4JDBA 5H8MA 5D2VA 5GNZA 4MG4A 4NI3A 5AY7A 2V69A 3CT2A 1R47A 2ZZ6A 1JDFA 4GOAA 1W5QA 8RUCA 5H2ZA 2YBTA 1CLXA 2X7WA 2JIWA 3KWSA 5M17A 3G1YA 3WSUA 3B9AA 4I90A 3SECA 3DECA 4F40A 1U5HA 1L0PA 4C1LA 4K8EA 3ORWA 2UY5A 1GG1A 1O94A 2G4FA 1IHIA 2ONEA 2E6YA 1W6TA 2VURA 3SCRA 2F61A 1EJTC 2PF0A 2VEIA 3I3BA 3W6LA 3TC7A 4RL3A 2VZOA 3QYSA 1E4LA 4GC3A 3P0WA 1SUXA 3PAJA 4J9JA 1DIOA 1YBQA 2QYGA 4C6KA 2HE8A 4JTEA 4LUTB 4XUGA 2R1KA 1EGVA 4H7VA 2J6XA 3C52A 1LQ0A 4ZO8A 1UZ1A 2FFIA 3VIFA 3GXPA 1FKXA 3NQVA 1E4NA 2ZX6A 1LRTA 3AIBA 4ZFMA 1YE6A 4AXNA 1Z41A 1L6WA 1BTMA 3TTSA 4ZCWA 1CGYA 4BI6A 1DWHM 1B4EA 3QGVA 4GY1A 2JIEA 1RZMA 3FAXA 3GXMA 1GKQA 4CLMA 2UWFA 2GDVA 3UJRA 1H1YA 3ABSA 1TR1A 4L4MA 3BLLA 4DIAA 3ARWA 1YHTA 2Y7DA 2VCCA 2H8ZA 2VR4A 1U22A 3LNPA 5CLWA 2ZYFA 4EF8A 5KITA 4OUIA 2PGFA 3SRFA 4QCFA 2X30A 3PP7A 1E0UA 4PTMA 4REQA 2E9MA 4HZ6A 1G5AA 3W7IA 1OFRA 4H7CA 4EVZA 1JVNA 3IVSA 4LAMA 3B9EA 5CJMA 2QUNA 3LI0A 3RO8A 3HM7A 1IZKA 5FCZA 1JRBA 2J4GA 4ZENA 1OVDA 1PKMA 4TQTA 3N12A 4P7LA 4QLJA 3RM9A 4CQDA 3UCCA 1UD5A 1RXOB 3GIQA 3WNKA 3GG7A 1WX0A 3BG5A 1JQXA 4C6MA 1MQPA 3T8QA 3U0HA 1NFGA 1KM4A 3W86A 3L68A 5I79A 4Q33A 3TROA 3PC0A 1ENUA 3WF4A 1J0ZA 2XTKA 5KZ6A 1M1BA 3IJLA 1CPUA 2PRLA 3OOQA 1JZ4A 2PDYA 4Z2LA 1V7YA 1E4IA 2LLEA 4DUOA 4XZNX 2ZC8A 3CL6A 4LVFA 4Z0SA 4E2VA 3VIMA 3VKJA 4P8XA 1NQ6A 1R5YA 4GFIA 4N4QA 3OBKA 1GZJA 1UUMA 3CQIA 4LB3A 1DBTA 3NEHA 1NARA 2D23A 4GMEA 2GFTA 4JBRA 3AWNA 1Z9AA 4NHVA 4HKPA 2QUVA 4DJDA 1P1MA 2W3ZA 3EB3A 2XWDA 2JEPA 3S47A 4FA3A 3SN1A 2VELA 4JQAA 4MWAB 2DVTA 3OIHA 2HV5A 5H91A 2J9YA 1QW8A 3ITGA 1Q6CA 1TYGA 1Q3NA 5A8NA 1TA3B 4Y6GA 2BODX 4WHBA 4F9DA 1B0IA 1LP6A 1M03A 2CESA 4FSAA 1IQ8A 2J7CA 3WH6A 4GI4A 3RCNA 3EOLA 1AQMA 4V15A 2QCGA 2WM0A 2OVLA 4LF1A 2PSNA 4O54A 2A3AA 1IGWA 1ZCOA 1AUSL 4A21A 2RH9A 3KZSA 3EOUA 2IKIA 3A6OA 4ES4A 4FALA 4AXKA 4A22A 3FJ6A 1J10A 3THAA 3EX2A 5LHEA 2EJ1A 5EMYA 4MOZA 4N42A 4H8HA 4Q4SA 4F79A 3ABQA 1BWVA 4LYRA 3ZSSA 5FOOA 4OTKA 4XTDA 2FQIA 3DI1A 4JIHA 3ZWTA 3DBPA 4C6CA 1K9EA 3FXGA 3IVTA 2HVNA 5HXMA 3A9BA 3VIPA 1AW2A 3EOSA 2OEMA 3M7SA 2NUWA 3RUBL 4L4PA 4L9XA 1P7TA 3W1UA 5REQA 3GNNA 4YTTA 3FV9A 3O0FA 2L5HA 1B3XA 4UQ9A 2PLCA 1HL8A 2NQ9A 1XGDA 5C9RA 4P7RA 4UTWC 3SAZA 1FFQA 4I3GA 4UTTC 1GQIA 4DELA 2X2YA 5IDZA 4HNUA 4NILA 1CEOA 1TRDA 4P5UA 1LUCB 4DJFA 3S0CA 2DDXA 1KXHA 5LA1A 4G9PA 3OJGA 2JGYA 4L6HA 4NNBA 3WENA 1AZ1A 5FF7A 3ZM8A 4IIBA 1GEHA 2XJ7A 3G2GA 2OU4A 1BEUA 1I8JA 1NEYA 2OZ8A 1V8EA 3M0LA 5BWAA 9RUBA 2E6DA 2QPSA 4XD3A 2X16A 4ACZA 3K13A 2PC8A 3G1VA 1FWWA 4JFSA 1F07A 4R7JA 4M6UA 1IXOA 1GGOA 3WG6A 2ZX5A 1Z32X 2EPMX 3N3TA 4FO4A 2BY0A 1CT5A 4YCPA 3QY6A 4HHHA 1IV8A 3FAWA 4IQJA 1AQFA 1EO7A 4C90A 4C6EA 1G6CA 2V6AA 1S38A 2R1NA 7PTDA 3ME3A 3I68A 1OFAA 4QX4A 5LIUX 3RN6A 3V0TA 4X0NA 4EIVA 4GO8A 4O14A 4OFCA 4Q8QA 3O06A 2FLIA 5A1AA 1PHQA 3W74A 3I65A 3UNDA 4A4AA 2MUCA 2FFCA 1B3WA 2EBNA 2YPIA 3UNTA 3ZR5A 4LCSA 3NSMA 3W25A 4HYVA 4ZQPA 4JQ2A 1JDEA 4EXAA 3AMLA 1K9FA 1KCXA 5HMEA 1SSGA 4W84A 3PG9A 3KTXA 2EHHA 4RNHA 4Y9NA 1S2AA 4DJDD 2I5GA 3FYOA 4YHEA 2DH2A 4BWLC 2D2JA 1A5NC 1YYAA 4P7OA 2GDUA 3CHVA 4WOZA 4J1OA 2XIQA 5D09A 1BKSA 4K2SA 1OX6A 4Y7EA 4ZTXA 5J04A 3AS2A 5DQPA 3LG3A 3WBAA 4MLJA 4I5UA 1AVAA 1F73A 4EX4A 4IMDA 2AMXA 3AMKA 4KBXA 3VE9A 4NZCA 1BGGA 4RV8A 5CC7A 2R24A 1EQPA 3TJ4A 2YBVA 4AIBA 3T0DA 2X7VA 4B90A 4QG9A 3E1F1 2BZNA 3CUHA 1IXQA 3CHFA 3VPLA 3PBVA 2PFHA 4L6OA 4AWSA 3SCPA 4CQCA 4ZXOA 5F2GA 3ITVA 3P3BA 4MB1A 1BFNA 4HN4A 3L0KA 1BPLB 3FDKA 4S3DA 2NX9A 1SZEA 3FN9A 4KQNA 1J5TA 1DE5A 3H4GA 4WKFA 2HBVA 1E55A 4JTHA 3AHYA 4NQ1A 1J0KA 2YCKX 3NZ1A 2HDJA 1W9BM 3S8HA 3EA1A 4EF9A 2H3BA 4NX5A 2PDJA 4LCRA 3L12A 3KBVA 3M0HA 1EFZA 1SO4A 2VGGA 1CGVA 3P82A 1XH1A 2PU0A 3RIKA 1YBQB 4BKNA 1YLVA 4HU3A 1HN1A 1WA3A 3WLMA 3VCRA 4GH3A 3B40A 5F2LA 1EZWA 2Z26A 5CZ0A 5BZAA 3GAKA 2PDMA 2PTZA 4IICA 2E5CA 2VUNA 5FIPA 2X0HA 3WJSA 1XLGA 3ABRA 3NQBA 5I3DA 1I2PA 1PZ0A 1RH9A 4NIRA 3MO7A 4LUJA 2G50A 2FPTA 3DIPA 3D47A 3V18A 3SI9A 4WDXA 5PTDA 3C6CA 4DAIA 2BX7A 4IPJA 4CD8A 5AHFA 4QP0A 3IIPA 3REQB 3M16A 3AOFA 2E25A 1QMLA 3H2FA 1TZZA 4DYJA 3QJAA 1PPIA 3SGGA 1SR0A 3RXZA 3R1ZA 1EBHA 3NQ2A 4DYKA 5TQLA 3E38A 3IUHA 1ZL1A 4S3BA 2EPOA 4ZQOA 1IIHA 1U2YA 1UZHA 4YVXA 1CXKA 4IUOA 9XIAA 1EGMA 4MVAA 4ZR8A 4D1JA 1REQB 3WKZA 1N8WA 1CW2A 3WK3A 5I7GA 1SJDA 3M0MA 4IIFA 4UCFA 3RK8A 3AXHA 1KTNA 3C3UA 2W0UA 1MZHA 2O9PA 1G9HA 4R27A 3VNIA 4HVXA 2YL5A 2IXUA 1V0NA 4RZ5A 3JS3A 4G2DA 4FP1A 1UA7A 1Q65A 3PY2A 3W7KA 3WH5A 5I3GA 2J7BA 4GD0A 4M29A 4N9EA 4C5ZA 3W01A 2HVOA 4UFLA 2R91A 1ZBWA 4F48A 2ZUSA 1UP0A 4H1ZA 5KZMA 4LTSA 2A3LA 3LXCA 1BWKA 1JD7A 3SW6A 2GGGA 1HF6A 2J7HA 3N18A 2Y8KA 1W3LA 1XUZA 1V51A 2VRQA 3TYCA 4MDPA 4DPQA 4KFNA 3FDGA 1TO3A 2FMNA 1KLYA 1QNPA 1K77A 1WKEA 3QV8A 3OHMB 1NDYA 5DY2A 3URAA 3TWAA 3UPBA 1ZCCA 5HQMA 2A7RA 1QW9A 3OLDA 5BROA 2IQ0A 1HXJA 4HMEA 3M9YA 4J35A 3W76A 1R3VA 2VFIA 5E0FA 2PTXA 1NU5A 3GHSA 1ZAJA 1MW1A 4JNYA 1CXFA 4LALA 3S5NA 1YIXA 1DPMA 2ZC1A 1NFBA 3N29A 2FZ8A 2QZRA 2FH6A 2Z2AA 1MXSA 3M0JA 3CM4A 1HGYA 5AC5A 1YX1A 4HPHA 1AJ0A 1MDLA 1R3QA 4JXCA 4O13A 2Z4GA 4Z2KA 1JYXA 4IOTA 5HNNA 4MY1A 4UQEA 4ATDA 3BCJA 1QPOA 4KRTA 3ZT7A 4FLOA 4NZ1A 1TTIA 1GOKA 3GB6A 2WNNA 4J28A 1VGAA 1TV2A 3GAYA 3RRAA 5ABTA 5LNSA 4K7VA 5REQB 5AZ1A 3VD7A 1LL7A 3ZWSA 5DY3A 3LHWA 4WIWA 2C1HA 2TODA 1VR6A 3TIMA 4DI9A 1LOQA 2VOTA 3TR9A 1Q6LA 5F4XA 1HKMA 2PP0A 5J5RA 3IIOA 4NXKA 4HPGA 3R8HA 3D6NA 3SIZA 4H6RA 2WZEA 2OSXA 4XB3A 1UA3A 4LYPA 2X1UA 2E1DA 4JEJA 3OGRA 3GU2A 3W84A 1GT8A 2ZUNA 3CAWA 3PVFA 2FB2A 4TX8A 3LERA 5AZ0A 3WUBA 4OWGA 4ACZB 2D1ZA 4M56A 3CUXA 4JTKA 3MUAA 1W3IA 3HJZA 4GUIA 3WNMA 1Q7MA 2OPJA 1JGMA 1C7SA 3HV9A 3WD0A 1UOKA 3IRSA 2J7GA 3TUUA 3B0VC 4YLWA 1OB0A 1TIWA 1VFTA 3UXDA 2P8CA 2YX0A 5FF3A 1MRQA 3W82A 1K6WA 1GQKA 3B03A 2Z6IA 1LDCA 1BVWA 1G4SA 1WDSA 1OABA 1NOFA 1XIIA 2OXNA 3LPFA 3CWNA 2ZXQA 2BOGX 1LBFA 1QO5A 3E9AA 1YPFA 3KVLA 3S4TA 3A47A 1O95A 3KBWA 1BYCA 1Q2RA 1J93A 2WMJA 4FXJA 4I8YA 1VPYA 1TZ9A 1JCMP 1K4HA 4JN8A 4LNYA 1I2QA 3SQSA 3E0LA 1XKYA 1PS9A 1UH4A 2BHZA 4GUHA 4M1BA 5LA0A 2O55A 4GQBA 4J2PA 1S46A 4C6BA 3H23A 4H9YA 5AN7A 3TWBA 1RQHA 5FF4A 3F4CA 3RR4A 1RBAA 4LRTA 3PS7A 2OWXA 3QY7A 1FDJA 1VFMA 3XINA 3DHDA 2I56A 3MO4A 3NSNA 2NXHA 3V75A 1CYGA 4HPXA 4PTWA 4KT2A 2E0PA 4LUSA 2OWWA 3BE7A 3PNUA 3GHTA 3RITA 1Y8BA 2ZRZA 1GKRA 3BAIA 2VGFA 1KFWA 1OWQA 1M3UA 1E5NA 4LANA 4GE8A 3SO7A 3MUCA 1WKDA 4TU1A 1PWMA 1XYBA 2O4QA 4IMAA 4PEKA 3DHPA 3M7WA 4W8AA 1NDWA 2XIBA 4FXRA 3LHTA 1YKWA 1KV8A 3IJDA 3GFYA 1DTUA 1SU5A 3VCNA 2BB0A 3R89A 3K8MA 3QYQA 1BG4A 4I6KA 5I0DA 4B9YA 4IUGA 1KRMA 3PBMA 1XCWA 4RX0A 3SBFA 1H62A 1W3JA 1TIMA 4NJHA 5DRCA 3Q45A 1MXGA 4A3QA 2RJGA 2XHYA 3QOMA 5CPQA 1VENA 1XC6A 3L9CA 2VL4A 5T91A 1NH6A 2OQHA 3RU6A 1HJVA 3NUKA 5LXEA 5IRPA 2QHAA 2B31A 1EJVC 3A3HA 4QG6A 3E5BA 2QMJA 3LRKA 4EOUA 3IANA 2OCZA 4WDWA 4ZOBA 1IXNA 2QUUA 5CC5A 3VDGA 4MZ1A 1QXLA 2YXOA 1D8CA 1ZFJA 3UY8A 3OU8A 4YHGA 3AYVA 3CUJA 1JCTA 4CD7A 2V2CA 2E09A 4JEQA 4JTAA 2J88A 1NF7A 1RCOB 5ABFB 3MMTA 3T07A 4JFVA 4V28A 4A29A 2XU2A 5E5CA 3PULA 3UQNA 2VWSA 1FHDA 1NTHA 2XFYA 4MB4A 2ZXDA 3KX6A 1V02A 5AVHA 3TEVA 1TPFA 4O8AA 6REQA 4IXXA 1GZGA 1L8PA 4PMNA 1M04A 3FY1A 4JYEA 4UQCA 1WUFA 3ZYZA 5DLCA 5D05A 3GDKA 2C15A 4MSSA 3C3NA 4UFIA 4MYAA 4BY3A 4O15A 2QCDB 1BF6A 3VMOA 4LC6A 2GVLA 3N2CA 2WVVB 4BZYA 3QFEA 3UJSA 2AKZA 1XLBA 4DX3A 4O18A 4ZB5A 3W7MA 5I3KA 4I9AA 1EXBA 1V08A 5CC6A 1LT8A 3E0IA 3NR0A 3K30A 1WUEA 1LOLA 3RJXA 3N9KA 1W5NA 4UC5A 1LT7A 1UD2A 3C61A 3MSYA 2X40A 2OLHA 1K7FA 3HF3A 3M64A 3BV7A 3A13A 2A7NA 1YQ2A 5RUBA 1JDAA 1WQ5A 1V6WA 4E38A 2Z0IA 4W5UA 1ZAHA 1POJA 4YMZA 4PCNA 3ALFA 4F8XA 4RV3A 3PTKA 3H7UA 1S2UA 1VPQA 4ERAA 3BSMA 2HZGA 3L66A 3I6RA 4M6VA 4EE9A 4BQ2A 2FZMA 3UZYA 1EYEA 2NT0A 4GBDA 1U1JA 1JI1A 1ZP4A 3UT0A 4WJ8A 4HIBA 3GBEA 1DWAM 3A4AA 5EB8A 1VFSA 4CCCA 2GSHA 1ONEA 4DF0A 4TTUA 3UWYA 2J6VA 2YL9A 2YFOA 5TNVA 4LAUA 4BK9A 4N9BA 4I5RA 5M03A 4IPLA 3W6YA 2Y5EA 1LRNA 3DKJA 4RKAA 3BZJA 2BGQA 3GZAA 4U3AA 5EBAA 3KOFA 4KEMA 3WDPP 4NAEB 5MF5A 5F4SA 5A69A 3NOEA 2XSBA 4L65A 3OLGA 3MC5A 5D03A 1G4EA 4XSLA 4X63A 4RZBA 5A5WA 5TAOA 1H41A 3UPMA 3ANUA 1TREA 2CXEA 2HCVA 2PD5A 1VC4A 3CC1A 3GVQA 4DAFA 3H7RA 3R0UA 1Q6GA 4NF7A 3VKDA 4UTWA 3UVAA 1XGEA 3MSRA 1BXBA 4UTTA 4PULA 1DJGA 4IJRA 1Y5WA 4NT0A 5AHNA 2V38A 3DEQA 3DFOA 1KGXA 3NPVA 3W75A 1EGZA 1FOBA 3HN3A 2XIIA 3G1RA 5HNRA 1F3TA 1NIUA 1QAPA 2BDQA 4FPSA 4HU4A 5DEZA 3S2MA 3WNPA 3E3HA 1YNYA 2HJPA 2DT1A 1TG7A 4C6IA 5DRIA 5JMUA 1TFVA 3SSJA 3QZEA 3VUSA 3T81A 2FZBA 3BAXA 4B5WA 1F5ZA 2RFGA 1QDSA 2R94A 1UR4A 4CU7A 2GJPA 4FOUA 2FPVA 1C8XA 3UVIA 1GZ1A 1UR2A 2PRMA 1CGTA 3BDKA 2PS2A 1B3OA 4A3YA 4D1IA 3UG8A 4OBRA 1R9YA 3ONBA 4UTMA 4JIPA 1W1A1 2QJNA 2AL2A 4NZJA 3W1RA 2VOMA 2A4AA 4IJCA 4ML4A 2VR2A 5CPLA 1OGGA 3GTNA 2DZAA 4GA8A 3WLKX 1LJYA 3PZTA 4RDZA 3CZEA 4K68A 1VYSX 1XXXA 1QUMA 2XPKA 2F2KA 3GC2A 4A3RA 4C60A 3WLIA 3FHAA 3MUY1 9XIMA 3TOYA 1UIPA 3C2FA 5C0QA 1DVJA 1M7JA 4RZ4A 1X6LA 5CJ5A 3EWXA 2HBXA 1SFSA 2QDHA 3AO0A 4CKQA 2WZTA 3CV6A 4DO4A 2PZ0A 3UY7A 3TV8A 4BWLA 3QSTA 1PO9A 5EYWA 4RXFA 3C56A 1KBIA 1XLCA 2V5CA 1W2PA 1KLZA 4DPPA 2WHKA 1ISZA 1CZ1A 3BLFA 4DJEC 3QEZA 1LG1A 3AS0A 4AY7A 1E3XA 5C7HA 2BY3A 2V5KA 2VRKA 4DO6A 4TXEA 4XBSA 1EPXA 3PANA 4W85A 4B4FA 2DZBA 3BAKA 4HA0A 1Z3NA 2C8NA 3AAMA 3ITOA 2E8YA 2WK2A 4WSJA 4PUMA 1PTGA 1EIXA 4QEEA 1W9UA 3KHJA 2BGNE 4Q8MA 4QJ1A 4ZA0A 5HUPA 2OOFA 2YCLA 3GY1A 3B8IA 4CQAA 1MUWA 2QCNA 1WDQA 5I00A 5DCEA 2WVUA 3UW6A 5I5RA 3HGRA 3LLDA 4PR4A 1TRIA 3C0LA 2PEVA 3OVPA 3GIPA 3P93A 1OCBA 4WR3A 3UCDA 5MKGB 2GVYA 1KFKA 1UKOA 2ZTJA 3BMVA 3CASA 4S3GA 2PDBA 1DJIA 3B06A 3V36A 5A6MA 4RR4A 2GJXA 3IK4A 1XQLA 3B04A 1NSJA 3TJIA 1FWNA 3LDVA 3M0VA 2EPLX 5GQBA 5L6UA 2P8BA 4RNJA 2DQWA 2J74A 2Y1HA 4WKHA 3WFAA 4UFJA 4O50A 4J7RA 1LG2A 4JQ4A 4WGXA 2C16A 3VC6A 3EAUA 1LBMA 3L4VA 1W5PA 1IEWA 1X7IA 3FGCA 1R3RA 1FH9A 3MZ2A 2BP1A 1E56A 4AVOA 3WUFA 3SCVA 1TE6A 3NXLA 3ABOA 2G3NA 3AWOA 2FHCA 3V7PA 1A5SA 3GE7A 5A8PA 4GUFA 4BF7A 1QCWA 4R7OA 2CZFA 2VP8A 4M0XA 1XH2A 3CLWA 4X60A 3C2EA 4FNRA 1PX8A 4OOZA 2EXOA 2XIMA 1PEZA 3RPTA 4QGCA 3NQAA 4AEOA 4WJEA 2R1LA 1E3ZA 1XDLA 3GXIA 3HO8A 3SADA 3GD6A 2BG5A 1I2NA 3EPOA 3H24A 4IISA 4QIUA 4CVWA 4CCEA 1A49A 1EDQA 2ZWZA 1PIGA 4X9SA 1GVEA 1GVIA 3KP1A 4EKJA 1EZ2A 4IXHA 3PB2A 1JFHA 4UZUA 5HJLA 3LMYA 1E70M 4Y9AA 2GOUA 1KKOA 3WZ0E 3QRHA 2YXGA 1CENA 4NAFA 4WJXA 5FSDC 2E5DA 2H9AB 3L2LA 4QLLA 1S2CA 4D6CA 3WJYA 3WQ8A 4F2BA 4FX8A 4XSMA 4C6QA 3EPMA 4HNOA 2E6FA 2DZVA 2NZLA 4L56A 2NVAA 4RE0A 2DIEA 3SCNA 3WNNA 1BVNP 4MPKA 5K2ZA 5BU9A 5A6BA 2F84A 3P8JA 4PTXA 4XKYA 1X96A 4QR6A 4Q7BA 1X1NA 3WEOA 3WLQA 2PTDA 1IT0A 3AXMA 1IIGA 1TWSA 3GLCA 5BWFA 3HQNA 2ZRWA 3P61A 3NPUA 1HKJA 1QI4A 1UC5A 4HNVA 2VQTA 4WEVX 3MMUA 2QNEA 3OZPA 2VDIA 1WOAA 3PSVA 3SCSA 4U2ZA 1O5RA 4G56A 2ZUTA 3IAPA 1YDYA 4XD5A 2CZVA 5LNVA 1TV8A 1TPB1 4G6CA 4M8UA 3S6OA 1A4MA 3GC4A 4W7UA 3TSDA 3T4CA 2Z1SA 1KFBA 3NO1A 2Q3OA 3PJWA 1F3WA 1WDRA 3LHYA 5HANA 1QWKA 4CEUC 4IGMA 1G7VA 4ZB2A 1DJQA 3N2MA 1TJ1A 2KZHA 3KDNA 4JX5A 5CPOA 5D2YA 4GIEA 3DZ1A 1QPQA 1UKSA 3KTSA 2ALDA 5HMDA 1W1TA 3WK1A 3HQPA 1UH2A 1XYMA 4X2PA 3KRZA 4H00A 3BAWA 1WBJA 4PCFA 2FVMA 2OZ3A 2F38A 2A85A 3CHDA 2H8XA 2Z1BA 1IWBA 3WEMA 1LORA 3LLXA 3M46A 4DRSA 1A3HA 1M65A 5D33A 3OB8A 4UMBA 1H7NA 2Q8ZA 5G5IA 5J5DA 1JAKA 7XIMA 1KFJA 1JCXA 2Z00A 3N4EA 2A7PA 2YB1A 2J77A 1QO2A 2HQAA 1IEVA 2RDUA 3ZLFA 2CLEA 3RX2A 2XISA 3GR8A 3LLFA 2VJXA 3CNYA 4KMQA 3UR8A 4Z1YA 5B7ZA 4S2BA 2XH0A 3P0XA 1NWUA 4LFYA 1E6NA 4CQBA 2WMKA 3NQCA 2GYIA 3M41A 1QHZA 4TMBA 1ECEA 1W2VA 3QFWA 3SJ3A 1XFCA 4GJ1A 1XM3A 3W00A 2QDEA 1F6YA 2PD9A 4GH1A 1GVFA 4LS1A 3H26A 1VP5A 3QLDA 2VI0A 3MUIA 1UH3A 1R2SA 3NQEA 1DQUA 2PZNA 3P84A 1EO5A 3LBMA 3N14A 4AX7A 2C71A 5F4WA 4DYEA 1X98A 2Y70A 3BSGA 4ZQMA 1BYAA 2CHOA 2FB3A 3MVTA 3IV3A 3NJ3A 5I78A 1JPDX 2ISVA 3LX9A 4GVGA 1LWHA 4AYSA 4IIEA 4LY8A 1HP5A 1MVYA 1IYXA 4TUFA 1IR2A 3UJFA 3IARA 2AL2B 3N2XA 3S5OA 1JPIA 1ADSA 1XW8A 1DIDA 2HVMA 4Y9MA 1JZ2A 4KWWA 3AZRA 4DY1A 2O7QA 1AZ2A 3ZMRA 1KM6A 3F4DA 4A8LA 2I1OA 3SY1A 2PE4A 4I7VA 3G24A 3RMEA 5HWMA 1F76A 4ZQNA 1BSLA 5CZTA 5A6BD 4O4WA 2C91A 5CQ1A 1NWTA 3ZLGA 2W92A 1D3HA 2TPSA 4Z0JA 4QNWA 1EBGA 1YPIA 3R6IA 1P0BA 1THFD 3CGTA 5GPRA 4RE2A 3GR4A 2CHRA 3SGZA 1J11A 3F2DA 1OY0A 3OVRA 3IVUA 4AFYA 4IPPA 3EOOA 3OYZA 3U8GA 2F7FA 1NDVA 1V3LA 2FTWA 3FKRA 2VR5A 4XZWA 1R7AA 1BD0A 2C19A 5DMYA 2HROA 3NSXA 2A21A 1J9YA 1GOMA 3BPWA 1EX1A 4DBSA 4GXMA 4KWSA 4TR9A 3I4EA 3ZQ9A 4YIWA 3OGSA 1AH4A 2CEQA 3G8EA 3LCIA 4UNKA 3VGBA 3AUJA 4YYFA 2CZ5A 2ZX8A 2OKTA 4KFOA 1D2KA 5BOEA 5FKYA 3DU0A 1E9ZB 3RPDA 3IK2A 2YCLB 1R38A 2FMOA 3HG2A 3ICJA 3UESA 1TTPA 3FEQA 4CCDA 1G67A 3W7EA 2B7QA 5CG0A 5F1UA 3QR0A 2JFEX 4QSHA 1JYVA 3W38A 3B8WA 1DWIM 3QPZA 4O0ZA 1ADOA 4RPQA 1E73M 3EDFA 4AAJA 3I3DA 3QV9A 3C2YA 1UROA 2BTMA 3EWYA 2A3HA 2WMFA 2E9BA 4PRRA 1KB3A 3KL3A 3WL0A 4ICNA 4WRHA 1CCWB 3LQGA 3W23A 4NJKA 4K6AA 4URIA 3W2LA 4C5YA 4YPJA 3U9IA 3NGFA 4KCUA 2IMRA 2HISA 1IEQA 1Z7AA 3FGCB 2CC0A 4BJHA 1KKRA 5FESA 1UB3A 4PTDA 1XJBA 2EKCA 2B7NA 2ZICA 4JTCA 4ZE5A 2PDCA 4PMZA 4IIDA 1KRCC 3PBUA 2EPNA 1UJPA 4AHQA 1GVQA 3GIYA 4J4KA 5G4HC 3KVKA 3G8RA 1Y5VA 4DO5A 3LQLA 4V1XA 7ENLA 2DZWA 4I8DA 2NT1A 5EL1A 3ZT5A 1FWSA 4JHMA 1KR1A 1GPFA 4WKAA 3W7PA 2BS9A 1LYXA 3PFMA 4ADTA 3C0QA 1L2UA 1M53A 3M0YA 2WZMA 1P6WA 2VGIA 1HVXA 3QTGA 5I06A 1ZJHA 5FEPA 3CWOX 4GX9A 4JTDA 1W54A 3RRXA 1F9CA 3NM3A 3COTA 1V3MA 1H0IA 1BHGA 3TW9A 5AC6A 3N13A 4PUWA 2TRSA 2DGAA 3NM1A 1WE5A 1UHVA 2W5FA 3QSRA 4H01A 4KWUA 5C7VA 4UTLA 4K37A 4CNNA 3PSWA 3KW3A 3L5LA 1TPEA 2PBOA 3BLDA 4Q4OA 4AU0A 3DFQA 3NPXA 3L0NA 1XPYA 1TWDA 1XLHA 1PIIA 6ENLA 4IMGA 4A6GA 1WBHA 1DOSA 2PDHA 3TNBA 3TN6A 4GLEA 3L5AA 2FPYA 1BLIA 1BF2A 1XPGA 4XKYB 3N2BA 3QXBA 5FD0A 4J5NA 2D2GA 1UBSA 4G5DA 2ACRA 1TVNA 5HA7A 1WXJA 3VD4A 1EX5A 1DXIA 2Z25A 3B4UA 1E9YB 1DJNA 3PF3A 3PWIA 3HMJG 2O9TA 1QHPA 4GJIA 1OD0A 3H8AA 1BSIA 1UWIA 2OTDA 3USZA 2QGYA 1UWRA 3WQFA 1X8FA 1S3HA 1BKHA 2GUBA 3GG1A 3B8DA 3GUGA 2E68A 1K4GA 2VEMA 3SCOA 3TN5A 3B9NA 2WCGA 2XINA 1S3TC 2XFWA 3TC6A 4IMEA 3VOIA 1FFRA 1GHSA 2CKSA 1VEMA 3OG2A 3SGUA 1TX0A 1HO4A 4QNEA 1RQBA 3AS3A 1KWGA 4JQ3A 1R3WA 4M82A 3E6EA 3WJZA 1E1CA 3N17A 1TWWA 4H6KA 3BLEA 4TX9A 4AZ6A 4PCSA 3QHMA 1LLWA 4BA0A 3HV8A 4R53A 4JIQA 2DPEA 3DENA 1Q6DA 3DI0A 3VIGA 4D6JA 2DW6A 4CEXC 1XKJA 4B3LA 1WNOA 4CD5A 1WKYA 3BAJA 1T6MA 5DFAA 2WNQA 3PNZA 3FS2A 2ABAA 1I75A 4M24A 1H1ZA 1K9DA 1QT1A 2A0NA 1C8VA 3NDYA 3CS2A 3LCWA 4KWOA 3PPFA 2QCFA 4PN2A 4PH6A 3VGEA 1VBUA 1PCWA 4R9XA 1PDZA 1XLKA 1OGSA 1PHWA 3PUEA 4DJFC 3T78A 4EPEC 5EMMA 5I3IA 3MANA 3QC3A 2J13A 3AHTA 3DC8A 4PB5A 1HW6A 4AB4A 4QE1A 3BW2A 2DZUA 2PWVA 2OJPA 5TBOA 4MZYA 3MY9A 1EP2A 5A3HA 1K8XA 3A64A 2PWFA 3QBUA 3KCJA 3BANA 3ZLHA 2OG9A 1PE1A 4F66A 4O57A 5ABGA 3QW4B 3POCA 3EEGA 3OVGA 3PK7A 2TSYA 3W7OA 2QAFA 2WSYA 1FWJC 3C0SA 1KGUA 1UWSA 2BMBA 2GPTA 3W83A 4DJEA 3O6AA 3U2ZA 3NVTA 5D04C 3FW6A 1V4YA 3KCOA 3NZGA 3NAVA 1Y0EA 2XVLA 2ZDRA 2WPBA 2VFFA 1FWCC 1DE6A 2D22A 1XLDA 5FJRA 2GWGA 4DVOA 4ACYA 3W7NA 3PJUA 3GVVA 2YCEA 4GI6A 4H8VA 4LX4A 4JKKA 3OP2A 3IJ7A 4QE5A 3LZ3A 2HS8A 4LSBA 1XSJA 1F61A 2IQDA 3MS8A 3TTQA 3R5EA 1QU4A 2CCRA 4CUCA 1QFEA 4JKMA 3CZKA 2NLIA 1NY1A 1XLIA 2PDQA 1E71M 2BOEX 4WXZA 1JD9A 4NRSA 3M0KA 3GUWA 4GY7A 2TYSA 3RLHA 4JHZA 1FP9A 4KCWA 4P61A 3VD9A 1XIDA 2PODA 5D30A 4KERA 3FEMA 3QKZA 4WCJA 1I1WA 3MI3A 4IFOA 4LUTA 3Q37A 5I77A 2ZIDA 2J7FA 4B2DD 4KW2A 4XO7A 1ITXA 4KEVA 3YPIA 2ZX9A 3N2TA 4WK9A 3QKEA 4RNIA 5CSYA 1DYSA 1TUXA 1WXZA 2XN2A 3OZYA 1H7XA 1K7EA 5DXYA 3WQPA 1UD6A 1H5VA 2ZVRA 5LIWX 2ODOA 3GBDA 2QQ6A 4R5EA 4GRSA 4HSOA 3QV6A 1KBLA 3AU2A 3WH9A 1SJBA 3CTLA 1KRBC 1RY8A 5C5YA 3B05A 4I5XA 4HPNA 2PUZA 4Y8FA 3PZGA 4AVNA 4US5D 1QRQA 4M5PA 3STFA 5AYXA 4FI4A 4FXFA 4EWND 4PB4A 3VMPA 3UG3A 4S3AA 3M43A 4QQ3A 3R0DA 1DIKA 3CZLA 1QI2A 1HIZA 3MI2A 1EHNA 4CD6A 3ARZA 2YA2A 2XH2A 2WOQA 5ABHA 4J3SA 5HBFA 1JZ3A 2DZTA 4LVAA 4B92A 1QNRA 4PMXA 3JZUA 3M0ZA 4GACA 1XIFA 1U33A 2CWNA 2GJLA 4PMQA 3EGJA 3GWQA 5DO8A 4ZQCA 3GH5A 2HNHA 1VRDA 2OO6A 2Z1WA 3PBGA 3IUDA 2PDPA 4DEFA 4AUBA 1IT8A 8XIAA 3DESA 1R2TA 2H3DA 4Y90A 2O0TA 4QDPA 4TIMA 3S42A 5T9BG 2QCLA 4LH8A 5GJMA 2J8FA 4Z2HA 5CZSA 1E6XM 1SSDA 1XI3A 4K3ZA 5JBEA 3IJIA 4MNMA 5G1MA 2WVTA 3QZ6A 3WF0A 4M81A 4KH2A 1LBLA 2X8RA 1W8SA 4QS5A 3W85A 2KAUC 3GHUA 3QVQA 4NKCA 4XX6A 1C7TA 4MAVA 1RK5A 3W0KA 2W66A 3A3XA 1OC6A 1TELA 1XGZA 2NUYA 2YA1A 1XIBA 2NXIA 4DJED 4HU0A 5CKSA 3XISA 3E5PA 1KV5A 5AOUA 2PWEA 6XIAA 2QEZA 1HKKA 1XC4A 1D3GA 2VEGA 4CQ8A 3WY1A 2GGHA 4Z2IA 1I6NA 4F0MA 2I9UA 2AAMA 1FQ0A 1B3YA 4US6A 3UWEA 3W9ZA 3F03K 1IE7C 5I3FA 1FHVA 1H60A 3QMTA 4H9MA 4ICCX 3E12A 3SQMA 1UD3A 1NDZA 3FHQA 3GR7A 3H22A 2Q71A 4DXXA 4AMCA 5A6AA 2DZXA 1SZNA 2AKMA 3MCMA 2VO5A 4TV5A 2ZRUA 1LL4A 3ZOAA 4ASTA 1J0JA 4LC8A 1WP6A 5F2IA 1F05A 3T40A 1J2WA 3SIMA 4C7GA 3W37A 1H63A 5A6JA 3EMQA 3VKAA 2BOFX 1JF5A 4DWSB 1HT6A 1RBLA 5C8BB 3S9ZA 4IFRA 3L23A 1BQGA 3ARXA 1TV7A 4Q4PA 1JDDA 3PPGA 1PKNA 1OSEA 4EP8C 3BGAA 4J3VA 3PJTA 4YTRA 2E4TA 3C8NA 4W7VA 3JR2A 4AISA 2ADAA 2YSWA 1GJUA 3BGGA 4IP7A 3T2QA 2Y7GA 4ZO7A 1VCVA 3SJNA 1TUFA 4DNHA 5IM51 3DFSA 1LUCA 1GCYA 3TAOA 3JU2A 3TKFA 2OYMA 1WAUA 2EJAA 3G1SA 1LF1A 3UYCA 5G4EA 3O8AA 4JNZA 4NX0A 1UMLA 4PE8A 4OU1A 3H70A 1DORA 1XDMA 4JYFA 4NJGA 1YDOA 4GVHA 4BFAA 3IS4A 4RW3A 3AROA 3EKLA 4AY8A 3KOWA 1ICPA 1E1CB 1LZOA 3T1GA 2BHYA 4AH7A 3VABA 5LSMA 1CXLA 2VZVA 4AZHA 2HNEA 3I10A 2UY3A 3F4WA 3LNMA 3WMBA 3THCA 1KFEA 3TQPA 4MKSA 2QLYA 3R7MA 1GOXA 5E0CA 4IZGA 1HKWA 4PBFA 4DN1A 4JTTA 3IJ6A 1I0DA 3M1ZA 4W8LA 2WNWA 2VEPA 3GM8A 4DM1A 4Y96A 3W2UA 1OHLA 3MYOA 3OQEA 3AALA 4Q8OA 4PFMA 1SPQA 2OZTA 4O0QA 4ZTYA 1PTDA 3ALGA 2CLFA 5I24A 3L4UA 3GNRA 1AL7A 4PMYA 4MFDA 2G41A 1IZJA 3P5ZA 3VIHA 2X0YA 1FWTA 4LAZA 1L2QA 4HA3A 3VOHA 1RCQA 3CXOA 1YW1A 4AEEA 2A6LA 4ATWA 4PTVA 4E8DA 4IPNB 4RE4A 2QKFA 1VBHA 3FSTA 4MWAD 1DXFA 1JPHA 3TYUA 1UP2A 4O1EA 3A9IA 3W1QA 3TQKA 1GVRA 1FWDC 2BVDA 1CNVA 1IT7A 3CZJA 1S1RA 4WLCA 4MY9A 4HCLA 2ZXBA 4AX6A 2CYGA 2PURA 1AA1B 2QJJA 3B97A 4CGTA 2YZ5A 2HS6A 4AD1A 3TN3A 3CZGA 4UTUA 1OD8A 2VX4A 3AJXA 2JF7A 2AL1A 2FVLA 4B5VA 4UQBA 3VVGA 2PRHA 3MJYA 1FXPA 1ZNNA 2J25A 2A79A 1J79A 3N9RA 1Q2SA 3S5YA 1LQ2A 3TCSA 5BW6A 4JAWA 3TVAA 3ABXA 1G1YA 1E40A 3EXRA 4S23A 3UJ2A 1QPNA 3W24A 2CLHA 1XLEA 2DORA 4S39A 2J7DA 4W9TA 4WQ6A 2VHLA 4GK8A 4ZE4A 1XYFA 3RR1A 5AC4A 3MHUA 3HG3A 1G4PA 3R2GA 4YTUA 1VKFA 4LB4A 4NU7A 3QC0A 4H4IA 1I9CB 3QMRA 1NP2A 2VMFA 2WSRA 3T8LA 4O52A 1KR0A 2NSXA 1DL3A 1NOWA 3GNPA 4Q8NA 3VYLA 4NI8A 4O16A 1XD0A 3TYDA 3CL7A 1G69A 3LGEA 3ITYA 2WKJA 4QEHA 4GVFA 3OQ8A 3WUEA 4F0HA 4H9UA 1TV3A 2GLKA 2XGBA 4RUBA 5EFDA 3ZJ7A 4M6PA 5CPSA 2XGIA 1V6XA 3LHVA 2OLAA 4MKNA 2ZWYA 2P3EA 4QISA 3UR7A 3PUOA 2G3FA 1B3VA 1UJQA 3AXIA 1V5XA 3UJEA 2C79A 3PN8A 3OTRA 4R3UA 3L21A 2DSKA 1BYBA 2YDQA 3VX1A 2WBKA 3T44A 1RHCA 2R8WA 4O1FA 4RW5A 5DCBA 3REQA 3ISIX 1JR1A 1ODZA 3VO0A 3HPSA 3IGHX 1WPCA 1NWRA 2FZ9A 4E0CA 3BOXA 1E72M 3WLJA 4JIRA 3W2JA 1FBAA 5AB3A 3MA8A 3G3DA 1RY0A 4ERGA 6XIMA 3W88A 2MANA 2REQB 2IXVA 3NQ7A 3HZ3A 3MKVA 2PDLA 3BMWA 4H04A 4FNQA 1REQA 4BQ3A 2DFAA 1NQKA 4OVXA 3R43A 5HDRA 3LENA 1QBAA 3LOTA 3DG3A 1XIEA 3U5YA 1QK2A 4GQGA 4PYSA 4HSNA 2ZUWA 4ML9A 1R46A 4JTRA 2GK1B 2BNJA 4AY1A 5G2IA 4UNLA 3VCCA 4CVUA 7TIMA 3RX4A 3NDZA 1A5KC 4O8RA 1A0DA 4KGJA 3NL6A 1CBGA 4XAPA 4X0VA 2F8QA 4YTQA 1SMAA 2WZIA 3P81A 1MEIA 3W53A 5HPOA 2QCCA 1P48A 3U2EA 1LLZA 5DT5A 3VM7A 4XVEA 1TWZA 4N4PA 1O7AA 1TE1A 4S3EA 4Z08A 1EJSC 4B9ZA 2DZPA 4D6FA 1T7LA 3FXYA 1MW0A 2WKLA 1H7PA 4ADSA 1HL9A 3S46A 3CQ0A 2V3FA 3U6WA 4HPJA 3A4JA 2VFDA 1SQ7A 2B81A 4AMAA 2VCAA 5EKYA 5CAKA 2E77A 2GOKA 3KTCA 4RZ6A 2GZXA 3O16A 4KWVA 1RVKA 1L9WA 5BU6A 1OFDA 3BV4A 5DT7A 3TN4A 4P8VA 2IKHA 1XICA 1S2TA 1U83A 3BOFA 3PG8A 1QWGA 1YPXA 2V9DA 4UZSA 1P0KA 4LBRA 1KXQA 4OOUA 2VDGA 5E70A 4IIHA 1I2OA 2QGHA 5CAHA 1H50A 2GWNA 4HNNA 2XWEA 3U7VA 4ZEPA 4F2UA 3C86A 3D5HA 5AC7A 3LXBA 4ZQRA 3I3EA 2QV5A 5EMJA 3NVDA 5HWJA 1VPXA 3TMLA 3UXAA 5I3HA 3PTQA 4QITA 1AD1A 4TVDA 4O11A 2PDWA 2WM1A 2GGIA 3HU7A 4LBUA 4FK9A 1GOIA 1WXYA 3BURA 5HJXA 3EX3A 3EWUA 5TIMA 2XN1A 1E0VA 2PLMA 1FWHC 3M0IA 1XV8A 1NVMA 3POHA 3N3MA 1OK4A 2XGZA 1JUBA 3ITTA 4YCOA 5I02A 3CB3A 3AS1A 3HGOA 5D8ZA 1ADDA 4A3HA 3OA5A 3WNOA 1EQCA 3ZXWA 1GQJA 1ICSA 3L67A 1XBVA 3QV7A 4J3XA 1P0DA 4XAYA 2YCJA 4AVFA 1EPVA 1HJXA 3GZ3A 3VILA 1XFBA 4JY8A 3R12A 2R14A 3O3RA 4WZHA 3AZSA 2PDKA 1TQJA 1E4MM 3NZQA 4H41A 4KCVA 3GFXA 5HJYA 1J2BA 1JUEA 5E93A 1PUDA 3WLNA 2EAWA 4OUEA 5H8UA 2VQUA 3GDTA 5TF0A 3RM4A 3UCQA 1W8GA 1W3HA 1X7FA 3EZ4A 4D8ZA 3V1HA 3RJYA 1F74A 3UWWA 4M19A 4GI9A 2V3EA 2JEQA 2P1FA 1PZ2A 2EG8A 1R9XA 3G1XA 3LB0A 1RD6A 1FVPA 2YKKA 4XIMA 1XRSA 5G4WA 3QOKA 2VEKA 3DFHA 1DP0A 4Q3MA 2V3GA 3KAOA 1GUVA 1QW7A 2GGEA 3ZS4A 1BXCA 1ZJAA 2VWTA 4PUEA 5HMFA 4WUIA 5DMMA 3K4AA 4F0LA 1YTDA 3A21A 5D2TA 4B5NA 3C4UA 3LYEA 5GNXA 4HNTA 1FWEC 3W71A 3QF0A 2RDTA 2PLJA 4N9CA 1UR8A 4B5XA 3AISA 1ZQ5A 4GZEA 1ONWA 3ELFA 3VGDA 4GX8A 4UB9A 5HNUA 2V81A 4W86A 1XRVA 4Y9PA 4HK7A 3A12A 3CQJA 2ZZ4A 2FYMA 3KM8A 1US2A 2P76A 4X2RA 1XLLA 4DM2A 1C90A 3BVJA 4XISA 1EEXA 2W63A 1V79A 2FGBA 2XYLA 3MU7A 3H2MA 3TFCA 3OO2A 1MYRA 1EL3A 4G1KA 3PB0A 2NQ5A 3N6JA 4HTBA 2P0OA 2WYSA 4TTGA 3NNTA 4GG9A 2QVNA 4CNPA 3MBFA 3O6CA 2JKAA 5XIMA 4WXYA 4GABA 1FWBC 3W87A 5G1TA 5J8LA 2OSYA 5IFPA 5B80A 1RALA 1TTJA 4F9JA 4IGNA 1VBRA 5BMWA 1VB9A 3G18A 3W7DA 3FFSA 4K7YA 1OK6A 2Q8XA 3CB8A 3TR2A 5KMYA 2R1PA 4C6PA 2E67A 4GXPA 2NQHA 1DTNA 1RSCA 7A3HA 2QUMA 1H7OA 1OT2A 4A05A 3GU9A 1NOUA 1JCJA 4W7WA 4QBXA 4DZIA 3UP8A 1F2JA 4QSFA 1B5TA 4NNAA 5EA9A 2ZUVA 1C3FA 3QH2A 1ISWA 4E3TA 1VFFA 2NWRA 4DZ5A 5ABFA 2GSEA 4YWSA 1Q85A 1M7OA 4B3ZA 1MQQA 4DUXA 3CH0A 3WN6A 3BG9A 2Z1XA 4DJFD 1I45A 4FB7A 2DP3A 4U10A 3HPXA 5AHMA 1JG9A 4EPKA 5F7UA 3KRUA 2CWXA 2YDAA 3LY0A 3VTRA 2WSKA 4D6DA 3CO4A 4XZHA 4PMRA 1KM0A 4IP5A 3KE0A 3PHAA 4FLRA 1OX4A 4GIRA 1E1FA 1KTCA 2CBVA 3MB9A 3WDHA 3THQA 4PA8A 4S2CA 1M9HA 2UZ9A 4AWEA 1X6NA 1GWJA 4Z2GA 5HPCA 3LN3A 1D7KA 2QCDA 2WMIA 2VC6A 2B7PA 1ODUA 2WVVA 3WQEA 4U4MA 4Q22A 5EU9A 2VZTA 3W1PA 4AQLA 4HTYA 3VK5A 4U5KA 3KOZA 1HO1A 3KBNA 3B0PA 3R79A 5HUOA 4GUJA 2A1YA 2NQJA 2MNRA 1V0KA 3UGVA 1W1IE 1V3HA 4DBEA 2JALA 5I2UA 1CX9A 3B8TA 1AK5A 1BYDA 3TNOA 3JVAA 2CZDA 4MJ4A 1TPUA 3ZFHA 2QPUA 4D6HA 4A3UA 3L0GA 4MWAE 4QJ4B 1AODA 2CLMA 2J47A 2XIOA 4H9VA 1S5VA 1SGJA 5C70A 1EJ7L 4Q6XA 1D3CA 3EDKA 3VDHA 4Y8EA 4LW7A 1SMDA 3T9PA 4RPPA 1BTCA 4K1GA 4MADA 2OR2A 3MT1A 4D6EA 4WDUA 2WO5A 2Y5SA 3M07A 2CFFA 4DLFA 3NG3A 1O5XA 4PMOA 2ZFAA 1D8WA 4FZIA 4OV4A 1GNXA 1YDNA 3FCPA 3QM3A 1R9ZA 4M6QA 4S3CA 1KBBA 1AQHA 1N8FA 2WNZA 1T5AA 3NEVA 3E96A 3GKAA 1KBKA 2FGLA 5E6ZA 4WVXA 2WXDM 2GJNA 1G4TA 3C5QA 1Y65A 3MHGA 2Y61A 3EKZA 4KEUA 3F7JA 2ZZ3A 3MDUA 3AYTA 4ZOAA 5DCDA 3AIWA 4NAEA 1JZ8A 2JF6A 2PGWA 4LT9A 2G96A 1J96A 2FHFA 1W9XA 5ECUA 3AHXA 1ZAIA 3KP0A 3KL5A 4UNIA 3TX9A 2INZA 2BVYA 2WW5A 3UYIA 1E5JA 2YCIX 1A5MC 5FL1A 1VEOA 3CV7A 3H21A 4NZ3A 1HJWA 2YL6A 3M5XA 2Z24A 1EC8A 4HT3A 2Q6ZA 3MVIA 3S9IA 2W4XA 2GQ9A 3UWVA 3GXTA 4QJ5B 2EGZA 3N6QA 3VIIA 4POCA 1ICQA 3LPGA 3JRKA 3RF9A 1FH7A 5E9XA 4J3UA 2V5BA 4PEEA 1ZY9A 5A8MA 2JQXA 1UWAA 2NXGA 2QMKA 1KCKA 3C2OA 1I60A 1YDVA 4FEZA 4H9XA 2EG6A 3UBPC 1NWSA 4KRUA 2X0SA 1VIWA 1XLFA 1K1DA 2FTYA 4FNPA 5JH2A 5LYRA 5FAJA 3VXGA 1FDYA 1M5WA 1CXEA 3BC9A 2J9XA 4I9MA 1YTKA 3G6MA 1XBXA 1PDYA 2DUZA 3PZOA 3PUGA 1SO6A 4RDYA 2PDXA 1T96A 2DUXA 3H7VA 4Z2JA 5JIPA 4L4LA 2DH3A 5CJNA 5DBTA 3NL2A 1O5KA 5C2GA 2V5LA 1NJJA 1Q4NX 4LUYA 4F3HA 3BMXA 4AF0B 1KW1A 1K8ZA 4UTKA 3W7LA 3TTEA 1KNWA 2D3LA 2HE5A 3RCMA 4BR1A 2I7GA 5TD4A 2IUZA 4GINA 1MSSA 4PODA 1PWLA 3IEBA 3F2BA 4XAGA 1I1XA 3UA3A 4S1FA 4UR8A 4XZBA 1VLIA 2XH7A 2P10A 4UUIA 2ZVIA 3T4WA 3CIXA 3I6TA 2OMAA 2Q8LA 1FWAC 5FEWA 3BLOA 4GPNA 3G0XA 2PTWA 4R33A 2J8TA 2VKZG 1CI1A 3ZVIA 2Y2WA 4JOMA 4K8GA 2GUYA 3V5CA 4LJ3A 4MAZA 4HA1A 3TLQA 3BUVA 5A2AA 1ZBCA 1QPKA 3KWXA 1E9LA 4L6DA 4YL2A 4ZBCA 4Q4RA 3RFAA 3BWWA 3PZVA 2YYUA 1EC9A 2R82A 5D9OA 3ARRA 3LPPA 1SZFA 1DHKA 2A2IA 1R87A 3LD5A 1A80A 3GW3A 3WBWA 3LCLA 4JTIA 4UTFA 5I23A 3LTPA 4D9PA 1OFPA 3APYA 4OZOA 3DX5A 2OOGA 4XD4A 3N1AA 3VNLA 3GDRA 1HQTA 4GYFA 4OJYA 1EP3A 1ONXA 1SW3A 1GKPA 4M7TA 4NXSA 1C9WA 3VM5A 3QGAC 1HJSA 3PZMA 3GHRA 4HK6A 4IF2A 3PZUA 3UWQA 4XZ9A 2OB3A 3CL8A 5MKGA 1H4PA 4GJJA 1FH8A 4F0SA 3CMFA 4FF5A 3VDBA 2DIKA 2ZCGA 2EG7A 3PZIA 3SCWA 1NP0A 5FL0A 2JBMA 3Q65A 4OHQA 4W89A 2F2HA 1K6AA 5A6TC 3CHCA 3DYOA 4IG2A 5FF2A 4U28A 3SN4A 3N25A 3OPSA 1RVGA 1TJ2A 2NUXA 3JZEA 2IPJA 4IFKA 3BLPX 2CIPA 3IUIA 2YIHA 1BVZA 2CITA 4CQ9A 3HPAA 1T99A 1R0MA 1JF6A 3UFYA 4IQLA 4IMFA 5A6KA 4Q8VA 3CPUA 3LTYA 5C6MA 3Q4DA 2V63A 3EX4A 2Y88A 3OW1A 1WYIA 3P80A 3L2MA 2ATSA 1WO2A 3CV1A 3EWBX 2XUCA 1CECA 5IHRA 3W02A 5F2MA 1AH3A 3N4AA 2R9RA 2PDFA 2GVGA 4X61A 1AD4A 2ZZ2A 2VC7A 4LQ1A 2XG9A 3O9NA 4ROQA 4IM4A 2NVCA 5EMUA 3OZMA 3M5VA 3GG0A 1VFOA 5CXPA 2A3CA 1VHNA 1XR2A 1QNQA 3V3WA 1H0GA 3FNDA 4WDTA 1F4HA 3TC3A 4QXIA 3A4WA 1RK6A 2CLKA 2G97A 2X41A 4QDMA 4DF2A 1VBGA 3ARSA 1W3KA 1RJQA 3HG5A 2NV2A 3QHOA 4CNTA 3VU2A 4OE7A 1OX4B 4GCAA 4RE3A 3H2NA 5CPTA 2DV0A 2WPGA 2UY4A 3TLLA 4GQ0A 4LEQA 4V27A 2V82A 3NGJA 5HMSA 4DLMA 2XIJA 4DUVA 2H9AA 4YNGA 1XF0A 2OO0A 4E4FA 2WMIB 3OYXA 5AYBA 4XAZA 3FA3A 1RPKA 3MQTA 4NP7A 4L9YA 3J7HA 4W4QA 5K4ZA 2V68A 2PP1A 3FKKA 3E2QA 4TVUA 3P5YA 1J6PA 4DB7A 3BH4A 5CGTA 3KOYA 1W1YA 3GQYA 1EF2A 3XIMA 5FJUA 1C29A 3CMGA 3QHNA 2ISDA 1J01A 3NQFA 3MBDA 3GYCA 3V5FA 1QOQA 5C71A 1XLAA 3V1PA 3SRKA 2O9OA 2ZA2A 4CCZA 3IPWA 3R4IA 4DXKA 3EYPA 4C6FA 4HA4A 1MZRA 1OYCA 4MB5A 5A2CA 1ZLPA 1EHAA 1GVYA 1H3GA 3CEPA 1T8QA 3Q2DA 1PYFA 3A24A 3T0AA 1JYNA 3K1GA 1SZGA 1ZU8A 3RCYA 1M7PA 4NSBA 2ZKMX 4RJEA 5C54A 4H9ZA 1UD8A 3DG6A 1Z48A 1VRXA 4Z42C 3WEZA 4RCXA 1M7XA 1RLDA 2DVUA 3MSGA 1UKQA 3WQDA 3TW7A 4DXVA 3QMSA 2FHBA 4I9TA 4UOQA 2HSAA 3KEHA 1P6BA 3WBYA 1KM2A 2G3IA 3W27A 4DWSC 4MKVA 4B91A 3HMCA 3F4VA 5LKYA 1H2JA 3IRDA 3DXIA 4HJFA 3SFWA 4EK7A 4K1WA 4JN7A 2I5QA 1JJKA 4HCHA 2HTMA 4AD5A 2WJZA 4GKTA 3KUMA 1KTBA 4AD0A 3CPGA 4H6EA 4JICA 1KCLA 2VX6A 3WDRA 2GQ3A 5AKQA 4E2DA 5A95A 5JQ9A 4FOKA 4WY0F 5KSWA 4MIMA 3FYPA 1OG0A 3OA3A 3TZFA 4N6EA 5HQEA 3B8UA 1UUOA 2PMQA 3GVRA 2ZUUA 4PSPA 4HHLA 1U5JA 2Z28A 3ARTA 3WBEA 5FJJA 2I57A 3GVWA 4TOQA 4JNMA 5JIWA 3TQ0A 1SW0A 1JCNA 4KIRA 5D2XA 4Q4KA 3W7QA 3WJXA 2INFA 2ZX7A 4L9ZA 1W31A 1RPXA 2J9ZA 1CLVA 1XINA 1EF3A 2EPKX 3UWUA 3E0FA 3KBSA 4GBUA 2VX5A 3KS5A 4G7FA 1MUCA 1QNOA 4D71A 2WBGA 1XDJA 2OWCA 2YA0A 4FNTA 4L61A 3MZNA 3OHIA 5CH9A 3DFPA 3CYJA 2WC7A 3HFTA 1JL8A 3WQVA 2QDDA 4WSHA 4FOJA 3TU9A 3W7GA 2H90A 3NZPA 1S1PA 1ALDA 4J27A 3SDOA 5HQLA 3CU2A 2W62A 1KRAC 3RLUA 2VX7A 3BK0A 3AFBA 3S6DA 1O68A 1V6TA 1Z69A 3U5UA 4JL1A 3Q58A 1V0LA 4FX6M 4NZFA 3A23A 3WDJA 2O56A 1L8NA 2Y8UA 1RA0A 1LWJA 2E28A 4G7EB 2WLYA 1O5QA 4WY0B 3K1DA 2V2DA 3I7RA 3HBLA 5GJNA 1MO0A 5FI8A 6ALDA 4Q8PA 4S3FA 5D9PA 1OCNA 2EQDA 2D0FA 3LRLA 2FZDA 5K9XA 3E0WA 3SRHA 3H2OA 1UR0A 1RUSA 5HR7A 3LMZA 3DG7A 5XIAA 2ASHA 4BI7A 1PV8A 1G94A 1US3A 3USBA 3L65A 3DCPA 2FKPA 4PBEA 5HOSA 3AXKA 4R85A 2CHNA 4GYKA 1DJWA 3S3GA 2WQDA 1OC7A 4UFKA 3M4HA 5G2WA 2C13A 3WUGA 4IQDA 4DBUA 1XH0A 2JE8A 4QG8A 2PF8A 1HKVA 1UIOA 1JQVA 3H55A 3STEA 1GJWA 3EWZA 4FNUA 4YU1A 4IH3A 1I4NA 7REQB 2ANUA 1SW7A 1YMYA 2FIQA 5LHFA 3KBJA 3GXFA 1XLJA 5SWUA 1TJ0A 2QJGA 3K2GA 1HNYA 4N9DA 4ROPA 1DJXA 2PCEA 2XM2A 2Y5JA 1DHPA 4AIOA 3OIXA 1Q13A 3QQWA 4O10A 2IW0A 1RP8A 5CBJA 3AIRA 1RA5A 2W6RA 4JTUA 3EDDA 3CT7A 3MI6A 2NQZA 3N4FA 3L4XA 2I14A 4N2YA 1B30A 4R9OA 3BJSA 1JIBA 4F0KA 4CN1A 3T6CA 2FGZA 1DJHA 3SEPA 4H8UA 2YW4A 1X8CA 1WDWA 1W9VA 2D2OA 4ICMA 3B0XA 3S2JA 5BXTA 1YXCA 5I3JA 1FA2A 3N19B 4AHPA 4FX7A 4N02A 3EDEA 5FEXA 4H2HA 3K8LA 1GVSA 5BOFA 2OX1A 3VC5A 1GTEA 3F4NA 3OLIA 3ARYA 4EXBA 1VEPA 1DQXA 3MV11 3CTTA 1E51A 1C93A 4IG2B 3WLRA 2DIJA 1ITCA 4AZCA 5IFTA 1W3TA 3TFXA 4PRWA 3N15A 2WVSA 2PBGA 1B4KA 1W1VA 4IIGA 2PGEA 4IFKB 3E74A 3MUZ1 3EB4A 3HJEA 3SCUA 2OEJA 3QGKC 4GZIA 1UR1A 1AW1A 3W4RA 1X6UA 3S1GA 4NYUA 3FK4A 3T0CA 3LGDA 1B90A 3W1MA 2C3ZA 1XIHA 1VH7A 1PX3A 2BGSA 4GNJA 3T55A 1UC4A 3UZJA 1KM1A 1A50A 3BG3A 3AI0A 1H1NA 4BEUA 2DT2A 4RXGA 5DN1A 4QROA 3AHZA 3DYPA 4FS9A 3MKKA 3CWHA 2PDUA 3RPMA 1WV2A 5EY5A 1P0NA 1TV4A 1MFVA 2QDGA 2RGLA 1TVLA 2C1GA 4QAIA 3S5SA 3WD2A 4AEFA 4V1YA 3LXAA 1PSCA 4ZSTA 3IIXA 2VRJA 1Q6FA 4U5IA 1DJYA 4JL2A 4RK8A 3ITLA 3G0SA 1YE4A 4CD4A 2BY1A 4C1NA 2EO7A 3LCFA 1B3ZA 2J24A 1K8YA 1TCDA 1AJ2A 4U2YA 1R2RA 4AW7A 4IQEA 5LGZA 5D4YA 3T7VA 2CBIA 4P8UA 2X05A 1YEYA 1E6QM 5E0KA 3DOPA 2VUYA 2Y4SA 3PJXA 2WJDA 1UZ4A 1IEIA 1S39A 4JDYA 3UU0A 4DBDA 2HXTA 2NX1A 3KL0A 3AC0A 3CV2A 3TYZA 3W72A 2YDSA 3WJWA 1WDPA 2ZA3A 1ECQA 5U4NA 1DQWA 1HFBA 3EA3A 4MB3A 4Z1BA 4LY4A 1OF8A 2OX4A 1DV7A 5AFDA 4NNCA 4PGLA 1V03A 2G3MA 1R85A 3PFRA 3C2VA 3VE7A 1XRFA 4A8RA 3SM0A 1K8CA 4L7ZA 4AIUA 3TDFA 1JEZA 2Y0FA 1UQZA 2BWGA 3S1UA 4LU0A 3W1AA 1OQFA 4XTIA 4A2RA 3VGGA 2ZOXA 2OGJA 3CQHA 4XZLX 2YOCA 3CH9A 4JX6A 1GG0A 1QOPA 5FACA 4HMCA 4W88A 2CERA 3UF9A 5LIKX 4ORMA 3CK5A 3FVMA 2YXXA 3SURA 3FX4A 4JYDA 1P43A 2OQLA 3A4XA 3U48A 1KQYA 2Z2BA 2P88A 5D9NA 3HQOA 3B3DA 3CLMA 2A3BA 3HGSA 1CGUA 1KBJA 3TXVA 5A8QA 1PX4A 1PJ9A 3M47A 1V6YA 4LV9A 4GUGA 3QTPA 2YL8A 3PBWA 2I9EA 3LGGA 1SFJA 4HBKA 1AL8A 1OJXA 4ONVA 4AIEA 3KVJA 1JCLA 5CG7A 4YVVA 4C6JA 3FLUA 4UMAA 3WQWA 1OEPA 4UXDA 1FHUA 3ID7A 5GVJA 3AHVA 4C7FA 1J0YA 4OECA 3B9OA 4O53A 4B4HA 2BXYA 3KFTA 1VBJA 1O1HA 3BZGA 3GKFA 4UQDA 1TMLA 4D2JA 4L5ZA 1OFEA 3NWRA 4J40A 1P6CA 1WZAA 3H6OA 4O19A 1QI3A 2QJHA 4FMVA 4O1CA 5IOBA 4MJMA 3EPNA 4REQB 5D37A 1JPKA 4AD2A 1VAHA 4W93A 1XYCA 1EOMA 3KLLA 3CPRA 2P53A 1QPRA 1GW1A 2E5BA 4NG3A 3UD6A 1MXDA 1W1ZA 1GJPA 1TJRA 1ZPTA 1XBYA 4L80A 3MTWA 3L7RA 4Q8TA 3LU2A 2EPHA 4IT1A 1XIGA 2IPFA 1XG4A 1VIZA 1XHGA 3MV01 3IIZA 3F1QA 1V3KA 3P7YA 2NSOA 5EMKA 3GG8A 3KXQA 1IZCA 1MFUA 4CNSA 2CLLA 2J79A 3ARQA 4S38A 5D38A 1ZBVA 1CXHA 1XYAA 3SUSA 1IGSA 2BY2A 2WMGA 2CXGA 4CNUA 4F0RA 1N82A 4S3KA 4Q4QA 5DX7A 1Q6OA 2F9RA 1Q45A 3WMCA 1WZMA 3LCHA 1ML1A 2XVPA 4YVPA 3ARVA 1GPWA 3ZJ6A 2PWUA 3BOLA 4IWWA 4A8NA 2Q01A 5FA5A 4B15A 3BW3A 3RAOA 4LVDA 5CPNA 4HU8A 3QQ1A 1EA0A 3FA5A 5E6YA 3KRSA 3GX9A 1KXVA 2ZZ1A 5BRBA 3N6HA 1N7KA 2QVHA 1J18A 1TMHA 1ZJBA 1HP4A 2VC9A 3K5XA 5LA2A 2AQVA 1KA9F 4FXSA 5D32A 4XUYA 4E2OA 1Q7QA 2Z2UA 4WGHA 5BCAA 4PL2A 8CGTA 4PFHA 3LUTA 2PDNA 3WL1A 3URBA 3LHUA 4E8CA 4I7WA 5H6HA 3EEZA 1KWKA 1F6KA 3O2LA 4BCEA 2GSJA 3DN5A 4UCGA 3U3HA 2VFEA 4JY9A 4AZ5A 4XIAA 1TV5A 2AAAA 1VHCA 3SB0A 2WANA 1HL2A 3DHUA 1QASA 3GTXA 5FJTA 3EBVA 1KM3A 3HOJA 4IJBA 3PPHA 4GQRA 2Y89A 2A5HA 2VD9A 3VNYA 3MPGA 4KPLA 4M80A 4ZL1A 4P7QA 3OLEA 3HPFA 4KETA 3SRDA 4E2BA 4I6VA 1TCMA 3N2OA 2QV4A 1TJPA 4WOQA 3BLIA 4JIEA 4W87A 4XQ6A 2W79A 1A53A 2Y7EA 3TE9A 3LSBA 4UR9A 1C9DA 1P7TB 4LYQA 3AMCA 3B8VA 1JCYA 2OGYA 1O60A 4B5UA 1JI2A 2C14A 3P74A 3DFNA 4K39A 3T09A 1R86A 3IAQA 1XCXA 1VS1A 2ON3A 2YR1A 3VZZA 5DXXA 4ATLA 4AWUA 2E7FA 2FH8A 4L64A 1UBPC 4OBTA 2ZUMA 1GW9A 2C0HA 4H7ZA 5HWNA 2GQAA 1RCXB 6TIMA 3RO6A 3W22A 4MGGA 4MTVA 1K03A 4IGHA 1AQ0A 1K70A 3GU1A 3S5ZA 4E6MA 1V02E 1J0IA 3B9DA 3BTNA 3H2AA 3WF1A 4AZCB 1OGBA 3WK2A 2NX3A 4FF7A 1FKWA 2PC4A 4RDVA 5CBIA 1VJIA 1S5WA 2J7EA 4INFA 5M5DA 2Z1KA 3EMZA 5I03A 3PZ9A 5A6LA 1R6WA 1GK8A 1FP8A 1MW2A 3HURA 1LROA 3SFKA 1ISVA 3DC0A 4XKMA 4HN8A 1NF0A 3W6MA 4QTGA 4GISA 4ERIA 4DBWA 1Q7ZA 4DF1A 2C6QA 2VD8A 3W2KA 2D69A 3CZ8A 4PUNA 4C6LA 4JTFA 4JCMA 5AECA 4EPBC 5B7YA 5CSRA 1VQTA 4ZVJA 3UZ5A 5H8PA 4Z17A 1OYBA 3WQOA 4AWTA 4ZSUA 4OGZA 1QNSA 1XG3A 2TAAA 2VXNA 2PWDA 3BO9A 1H51A 3S2NA 3SN0A 3PTMA 3TTYA 1L6FA 2YJQA 3AYRA 1KXTA 3FSUA 5CZJA 3W1NA 2A3EA 3S2CA 2QT3A 1X97A 1WDDA 4YTSA 4ADUA 4C1NB 4S3JA 2G8ZA 3BICA 3S6TA 1W32A 5C55A 4NY2A 3E02A 1XQKA 4M7SA 3APTA 2FVKA 4TO8A 5D8WA 1XS2A 5FJOA 1U1HA 4NL1A 1SR9A 1I2RA 3EX1A 3EWWA 3P8IA 3KDOA 2WCSA 5LNWA 3MKCA 3SCTA 4DWSA 3UZXA 3TYAA 3NQMA 4KEZA 2Z7GA 1YXDA 1Z89A 3UZWA 3WQ5A 1B9BA 2X1SA 1DWFM 1MWOA 1FWFC 1FUYA 1OC5A 2V3DA 1KM5A 3MDWA 4O28A 1DIEA 1CGWA 4LGXA 2B4GA 3F2CA 2YBUA 4Q32A 1UPPA 1AMKA 1XP3A 5GNYA 4UR7A 5BXSA 1EA9C 2X1TA 1XYLA 4AZBA 2NVDA 3QR1A 1ZZMA 2I5IA 3CUGA 3NFUA 4Q8UA 1OX5A 3ANVA 1MRAA 3STGA 4YXGA 3MP3A 2ZTKA 3PM6A 4I7UA 3DBNA 1CB2A 1K02A 3CEUA 3U2CA 4GY0A 3U4FA 4F2TA 1O6IA 2FDMA 5ABEA 3WDIA 1FCUA 4P8WA 2JKPA 2BBFA 4HNLA 4UTIA 4BEQA 2GVJA 4JGDA 1JRCA 3P67A 3PPCA 3W2NA 2CPUA 5CPMA 2GJRA 3NO3A 1C92A 1H61A 3LSCA 4GXWA 3W7RA 1QHOA 1J0HA 2VZSA 3SCQA 2HEJA 1L6YA 3VZXA 2ZZ7A 3VNJA 4EAMA 1E6ZA 1OIFA 4H9TA 1P0EA 1FWIC 3G1HA 1SVDA 2HMCA 2G4JA 4LVBA 3WK0A 4GWEA 4O1BA 3ZJKA 3WFZA 2RUSA 3M44A 1TMQA 3S1WA 3VIJA 2BASA 4FLQA 3VIKA 2ISSA 1GONA 3BW4A 1EUAA 3BCFA 3RX3A 4HYWA 3AIQA 4X9YA 1B2YA 3GFZA 3P62A 3R10A 2HK1A 2WJFA 5DBUA 3GXDA 3GTIA 4QE4A 4XBJA 3LS9A 3W1XA 1B9ZA 4PUKA 2GL5A 4LXFA 1S2VA 4V2XA 1VD6A 3NQGA 1PL9A 5CBBA 4MF4A 1SO5A 4PRTA 5IXEA 3URNA 3TQVA 3H4XA 1E43A 1GORA 2PP3A 3RM8A 3EMCA 3VD5A 4AD3A 5KZDA 3ZVHA 4MHBA 2QF8A 3BGJA 4H8NA 2GVEA 2VTFA 1B31A 4IHCA 4BHYA 1EJUC 1VZWA 4C91A 3R13A 5DELA 3LHZA 4K38A 3W7HA 3HA1A 4MJ2A 4DZAA 2WHJA 4JR5A 3ZR6A 3NTYA 3PWAA 2CBUA 2VFHA 3TCEA 2WB5A 5C9UA 1CWYA 3SZ8A 3V35A 4UFMA 3LK6A 3V4BA 4HGXA 4IX2A 3MMWA 5CZKA 1EB3A 3O6YX 4W5ZA 3ZJ8A 5BRQA 3S2LA 4UTHA 2Y7FA 3O63A 1UYQA 4MLRA 2GQ8A 3GDMA 2SFPA 3SUVA 2Q09A 4FR1A 2XZ9A 2P0IA 4M3PA 1MNSA 1E1EA 1LM1A 4BI5A 4GNKB 3DUGA 1BGAA 1LOSA 4DWSD 3WELA 2DQXA 2ZQ0A 4AC7C 4HK5A 1FXQA 1M68A 2V0TA 3GYEA 5I09A 4X22A 3WFLA 3DYMA 4LS0A 1KFCA 2DY3A 3GNDA 4HOWA 1M01A 4I9JA 3T2PA 3GVGA 3L2IA 1H7RA 3AU6A 1Z44A 4IL0A 5LGXA 3UEQA 2VENA 1DEDA 4TX6A 5DMLA 1X1OA 1Q63A 3NYDA 1CLKA 2ZDSA 3KRBA 3DDMA 1OCJA 4QM1A 4LPCA 5CLTA 4DUWA 3VUPA 4UQAA 1ZJIA 3DH7A 4AYGA 1PZ3A 1H7WA 5F1VA 3VGFA 1Q4WA 3V0SA 1Z8AA 3WLOA 1LQAA 3DFYA 2ZRXA 4MM1A 3W2MA 3AIUA 3N04A 5FEZA 2J75A 1TR9A 4EPDC 2W61A 4E5TA 2C7FA 2P50A 2QXWA 4GC4A 4OBSA 2DW7A 5FJIA 2CNCA 5D2WA 2BFGA 1N2VA 1SJAA 1PTAA 4LOCA 1XD1A 3WDQA 4ZODA 2ABBA 3VOJA 3TSMA 2WV8A 3KS6A 4E8GA 4RDWA 3GNXA 4C6DA 3TMQA 3M0XA 3WBXA 4ZO6A 1RJRA 1A3XA 2XZ7A 3IGSA 3S83A 3AXXA 3G1AA 1OZMA 5DMNA 3II1A 5G1YA 1X38A 5T9CE 2REQA 4GGBA 9CGTA 5M1TA 1VJZA 2ZBTA 3GSMA 1IXPA 4KCTA 2PDIA 3L4YA 5CSSA 2IPGA 1Y5XA 3SUTA 2VVSA 4AC1X 5CGQA 2VCBA 3KBMA 1TKKA 3U7BA 3FJLA 2J8GA 2ATMA 4ZOCA 2TMDA 4D6GA 1WOBA 4F4RA 3VNMA 3RDKA 5D02A 3EXTA 1ESWA 3B0UX 2GK1A 2W9MA 2PU1A 3VAVA 5L9FA 3MCOA 4V33A 5MHBA 1ZUAX 1MW3A 4KS0A 3I7SA 4PL1A 3A5FA 3WQ4A 4OV9A 4XG1A 2UBPC 3FJNA 1ZENA 1JZ7A 4WSKA 3QY8A 5CSUA 3OVQA 3D46A 2VVNA 1L6SA 3AJ7A 5EMLA 4JFTA 1FTXA 3AQUA 3MYPA 4EAYA 4UOJA 3V5OA 2OSWA 2ACSA 2XH4A 4PUUA 5C9ZA 4DHGA 4R88A 1OT1A 2RAGA 4GNVA 1E15A 3INPA 4HP5A 2QAPA 1V6UA 4O1AA 1Y7VA 4O4VA 1EIBA 1JGIA 3AICA 3S1XA 3VA8A 4TVCA 1RV8A 2D3NA 1N8IA 1K9TA 5M3WA 3VOGA 4NZ5A 5C9XA 2HWGA 4PBGA 2E40A 3RG6A 5KINA 4Q7IA 3W70A 2IQTA 2J62A 2Z1VA 2ZE3A 4LUSB 3EDJA 3CO8A 3UG5A 1ME7A 2OYKA 5JVLA 2AQOA 1SZRA 4ENLA 2Z29A 1UR3M 2IS7A 4AZIA 1BG9A 4N0RA 1A47A 1TZ7A 3THUA 2YZRA 1A5OC 4TMCA 1IF2A 4IL2A 4BF5A 1A5AA 2WC3A 3BJTA 5CGMA 2D0GA 1M6JA 2PTYA 1J4EA 2X42A 2OT0A 3F5LA 3WQCA 2A6NA 2QF7A 4NYYA 1UZDA 1JUKA 3ARUA 4BF9A 3VFCA 3E2VA 5FAGA 3VINA 2E8ZA 3Q94A 4O17A 2YGYA 3LZ5A 3GTFA 3G6LA 3NL5A 2E9LA 3WH8A 3CAVA 3ABZA 3KZPA 3CQKA 1DWJM 4HMDA 4GHRA 3BLKA 1CIUA 1I0BA 1HGWA 2Y8VA 1ELSA 3MWAA 1IR1A 3MSDA 1V3IA 1F4AA 2X2GA 3CIWA 1O1ZA 3T2OA 4GKLA 3ATYA 1GYNA 3AZTA 5CEWA 2OZ0A 1FWRA 2ACUA 2JK2A 1J8VA 1YRRA 4JN6A 1XLMA 3DFTA 3T0BA 4E4PA 2IKGA 2CETA 2YW3A 3RLVA 4PCPA 1A5LC 2V30A 1ZRQA 1VJSA 3PZQA 3IJ8A 1Q8JA 5U7SA 3UXIA 4L1XA 4OKDA 3WLTA 2G0WA 3T08A 4ECLA 2WHLA 3SQLA 1UKTA 1UCWA 4PTNA 1XWYA 3I6EA 4GGHA 2QCMA 5C2CA 1Q66A 1YADA 2G37A 6REQB 3LM7A 1K3UA 4YN5A 4KKXA 4YWIA 4HZ7A 2CLIA 3P2VA 3LCXA 3W81A 1T41A 1JULA 4J3ZA 5AYZA 3P6LA 7CGTA 1FDZA 5C2XA 1JYWA 1D9EA 5A94A 4EWJA 4AZGA 5BXRA 4K8HA 1UQYA 1LTDA 5H1WA 1D7FA 3CAKA 1XIJA 2EKGA 3L4WA 3QN3A 4BQ5A 1S2WA 1U1UA 1MEWA 2RDWA 4KF1A 3SY5A 3M6DA 8A3HA 2PCQA 4G1NA 4QLKA 3EWDA 4JTLA 2RDXA 3R8RA 4MWAC 1JNDA 1ME8A 4Y2WA 3UWZA 1PB0A 1O4UA 1EUNA 1P4CA 2Q02A 1V3JA 4H3DA 2CW6A 3B0YA 3TZNA 2OT1A 1H5YA 1XISA 4JIIX 1RBOB 1EXPA 5AYIA 4A35A 2XDFA 2BVTA 4M1RA 1UASA 5DF0A 2O9RA 4P7NA 1JPMA 1IWAA 3IIVA 1W5MA 3TTOA 1QTWA 1HUVA 4PZVA 4KGLA 3NZRA 4E3VA 2C18A 3ZVHB 5ECVA 3ARPA 2QUTA 4MYXA 2POTA 4JD4A 3R25A 4PSRA 1Q6EA 4MMWA 3WF2A 1X39A 1MEHA 5A8OA 2O7SA 3SR7A 4NJJA 5LXXA 2R6OA 1EJWC 3A3WA 4N7QA 1UG6A 4BS0A 1YXYA 5IBXC 1T8XA 3R94A 4GYPC 4HZMA 1PXGA 5FSEC 5HNTA 2QCEA 3ITCA 3RGTA 1UOZA 4K36A 1AG1O 1TWIA 2IPWA 4ZOEA 1F6PA 3NURA 4HQVA 1O66A 1SYTA 2FZNA 5M2FX 3E2SA 3ONCA 1W1PA 4KESA 3MP4A 5EPDA 5K7JA 1OF6A 2YDRA 3G1DA 3O1NA 1WAWA 1HVQA 3W29A 1LRQA 5CC3A 2DSWA 2WCAA 5HINA 3CUFA 4UFHA 3ES7A 2ACQA 3CJPA 4ZB0A 1J5SA 2YLLA 1RQEA 1E6PA 4XZIA 2DSVA 2DJXA 2WZHA 4LBSA 4N6FA 4JTSA 4XV0A 4GYJA 4HZ8A 2ZE0A 3QW3A 1Z42A 1W3NA 1FWGC 2ZXAA 1TPDA 2P3ZA 3Q67A 4QJ3B 3AMDA 1VCGA 1SFLA 4GO9A 3E2RA 3NO5A 2JKEA 1ZBKA 5JH1A 2XFRA 5ENLA 2G3JA 2GGJA 3GDLA 2DSZA 2Y63A 4D72A 1QK0A 4JFUA 1Q8AA 3W3OA 3NQDA 1V0MA 3KHDA 3D3FA 1EJRC 3IGXA 3GXNA 2O92A 2KX9A 1FCVA 2WQPA 4JKLA 5HK4A 5IHSA 2IKJA 4HJWA 1KFLA 1G0CA 3L4TA 1TPH1 3A5VA 4UBPC 4JQ1A 3WH7A 4QCEA 1W9DM 4JTGA 4D8AA 3WYZA 3LV5A 4LEFA 4JHOA 3GS6A 1CXIA 2NV9A 1XL9A 3FIGA 4UMCA 4PUDA 2OEKA 1XRTA 4LYKA 4C6OA 4CU8A