1LT8A

Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
361
structure length
348
Chain Sequence
KGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKGQEVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAAQLKAHLMSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Betaine-homocysteine methyltransferase: zinc in a distorted barrel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
total genus 117
structure length 348
sequence length 361
chains with identical sequence B
ec nomenclature ec 2.1.1.5: Betaine--homocysteine S-methyltransferase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02574 S-methyl_trans Homocysteine S-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.330 Alpha Beta Alpha-Beta Barrel TIM Barrel Homocysteine-binding-like domain 1lt8A00
1Q7MA 5DMLA 1Q8JA 1Q8AA 1Q7ZA 4M3PA 5DMNA 1LT7A 3BOLA 1Q85A 1UMYA 5DMMA 4CCZA 1LT8A 1Q7QA 3BOFA
chains in the Genus database with same CATH superfamily
2CBIA 3TN5A 2XYLA 1Q5MA 1JCYA 4AD5A 3WH5A 2PF8A 1JVNA 4HHHA 4KETA 4KEMA 3C2VA 4K39A 3H2EA 4PEKA 3EBVA 1SJAA 2CKRA 4RJEA 2FFIA 4GZEA 4GVHA 3DFTA 3R79A 1E0VA 5FF7A 1KQYA 4CQDA 1RR2A 1A5CA 4F48A 4AB4A 3V3WA 1TWWA 1R7OA 4Y96A 1Q6RA 1JI1A 3AISA 2WNWA 3TA9A 4UTHA 1XJBA 1B5TA 5HAOA 1P0BA 4IGHA 1TVLA 4H8VA 3S6DA 3S3GA 3MDWA 1W56A 1OFEA 2DQWA 1US0A 2H3DA 4H19A 3OLDA 1LM1A 4JTTA 5CJNA 8XIAA 1KFCA 1YLVA 1IZKA 3NM1A 2GOKA 4IIEA 1TPDA 2J7HA 1RY0A 1XFBA 2E5CA 3WLQA 3TVAA 2X1IA 1MSSA 1RXOB 3B4YA 2R1KA 1QFEA 1TYGA 1RBOB 2WJFA 1Q2SA 4Q8TA 3KZPA 4LAOA 3VKJA 3D47A 3KCJA 3G24A 2A7NA 4AIEA 3G5EA 4AHPA 3F4CA 1MXSA 2E1WA 3SEPA 2QMJA 4UR7A 5FL0A 1DWAM 5DQPA 1GOMA 4RDZA 1J6OA 3LBCA 2NV2A 5D04C 4QITA 1PYMA 1WDSA 2C1HA 3OTRA 3N73A 3XINA 4H9UA 4IXXA 2Z28A 4M0XA 3NZQA 1MO0A 4JTEA 4DJDD 3QGKC 3M64A 1UCWA 3EA2A 2J6VA 4BA0A 5AC6A 3ECQA 3KOXA 1N82A 2PGRA 5A94A 1AJZA 1I2RA 1Z48A 4DF1A 4IQJA 4US5A 4UTFA 1GKRA 1H7WA 3V4BA 5BMWA 4CNTA 2W9MA 1NDZA 4Z17A 3L0KA 1XYCA 3AUJA 1VB9A 2QJGA 2VHLA 3JU2A 1WAUA 1UZ4A 2VO5A 3CASA 3THCA 4A29A 1BYCA 2B7QA 1BVZA 4NX0A 4PMNA 2PBOA 1V3LA 3P5ZA 1D3CA 4DIAA 2XWEA 1NP2A 3AFBA 1Z7AA 4UTMA 1EZ2A 5TNVA 4BQ5A 4NJHA 4OIFA 3TTSA 1FHVA 2WSQA 3N14A 3F2BA 2DW6A 4C6JA 3QPYA 1WX0A 3W7NA 4DYJA 4UTKA 4LT9A 4QJ1A 3WLHA 4AY8A 1OHLA 4TOQA 3UPMA 3LEPA 4IPIA 2GYIA 4H01A 3VTRA 3WQ5A 3TNOA 3C2FA 4XTIA 5CG0A 1H7XA 2H6RA 5HNRA 1W8SA 1DJQA 1ONEA 4D8ZA 4HA3A 1FRBA 4R27A 4H1ZA 1GWJA 4E3TA 2WBGA 3CHCA 1C8YA 4E0CA 3E49A 4Z0SA 2VL4A 1JYVA 4AUBA 5E0FA 1SZGA 3PB0A 4GA8A 2A5HA 3W73A 4ORIA 1WKYA 2A7PA 4B3KA 1U1HA 1EC7A 2OSWA 3UVAA 1K77A 1VFOA 4F3HA 1ME9A 1XLEA 3UT0A 4K2SA 4UQDA 1TA3A 1W1A1 2Q09A 1GQKA 1J12A 3LS9A 2VCBA 4HMDA 4HSOA 5KSWA 4L1XA 5TQLA 3BANA 2NQ5A 3EMQA 1CGVA 4ZE5A 2HMCA 3UCQA 1X1NA 4AD0A 5LIUX 2BASA 3QMTA 4NNAA 4J2PA 3WUEA 1BRLB 4ZXLA 3NPXA 4DBEA 4K8HA 1DKWA 1W1VA 3GSMA 1OC5A 4AXKA 3WDQA 4LYRA 2TSYA 2PDMA 2PPGA 3N34A 2UY5A 5TF0A 5HJLA 1IWAA 3VNJA 1ZS2A 2RFGA 3K1DA 4HPJA 3GNRA 2ACQA 3VIIA 2PDJA 5M17A 1E5NA 1J4EA 2AQWA 2XIBA 4M24A 3VKBA 3UXKA 4WXYA 1GQJA 2NSXA 2ZE0A 5D05A 3EWXA 4GUFA 4JXCA 1LBMA 3B9AA 3HB9A 4MNJA 4W86A 2XM1A 3FDGA 4N6FA 3I65A 3I10A 1JPDX 3TTOA 3W28A 3T42A 2VEKA 3TZNA 3SZ8A 1T8QA 3QKEA 4ERAA 3LQGA 2UBPC 1B54A 1G9HA 4NZFA 2Y8VA 4BEUA 5A2AA 1M9HA 3KVLA 3A4AA 1FQ0A 1SSGA 4TVCA 4LAKA 3AHZA 3GIPA 5IBXC 3K4WA 4UOQA 1CXHA 3GXTA 4NI3A 1CXFA 3ABXA 4YTQA 4X2RA 2TPSA 3RHGA 3DGBA 1VFMA 3G6LA 4U2YA 3SSJA 2QF7A 4YNGA 5AVNA 2QR6A 4XAPA 3UZJA 2ISVA 1WBJA 4IJCA 4GJ1A 2PLMA 2FMOA 4ILSA 1XIDA 4XG1A 2YDQA 2VI0A 4MKVA 4UMAA 2PE4A 3O6AA 1FWSA 4DHGA 1FOBA 3R11A 2YYTA 3CU2A 3CEUA 2GJPA 2FPTA 2VRJA 4LX4A 1A50A 3G1VA 1GTEA 1VYPX 1KC7A 3TR2A 1MFVA 1OB0A 1UASA 4DZAA 4C7GA 1K7XA 3MVTA 5G4EA 4A3QA 4ENLA 4DZIA 4HA1A 2OGYA 1GYLA 4DI9A 3AS1A 3W1PA 2J8GA 4AZCB 3GAYA 3WLRA 3PJUA 4BHYA 5DANA 2WPBA 2VUYA 5EMLA 1X1ZA 4C6BA 4ALDA 2EPKX 4LS0A 3HG4A 3SDOA 4NP7A 2QJMA 3HPFA 1UD8A 1VJIA 2VEFA 2Y7EA 4KMQA 5U7SA 5A8NA 2ZRZA 2BB0A 4M80A 4EVZA 1EBGA 1JQXA 3CTTA 4QSHA 2IXUA 3KBNA 3VPLA 2Q3OA 2ZA1A 1PWLA 1DE5A 2P53A 2ZRUA 2GFTA 2GJXA 1ODZA 4N0RA 2BLEA 3EOUA 3SSZA 6XIMA 2NX9A 1UR3M 3ZLHA 3TLLA 5I7GA 1B3ZA 2HNHA 3WNKA 2NLYA 2RJGA 3U2OA 2XJ7A 4ZSUA 4QLJA 2YCJA 2PD5A 4WJ8A 2VR2A 4DJFC 4L9XA 4H6KA 1VH7A 1EJSC 4O4VA 1Y5VA 2E28A 1OSEA 1TPWA 4L6OA 4AC7C 4PMVA 3CWOX 2W27A 1NF0A 2GSJA 1N8IA 1UWSA 3DFSA 1EQCA 2XIJA 4UQAA 3KEHA 1AJ0A 1H1ZA 1S2VA 1DIEA 4W8BA 1J0ZA 4PMUA 3QOKA 1J8VA 1NY1A 3R94A 5D9MA 3B05A 2YL8A 3B8UA 1XIIA 4IPLA 4JIRA 2VX5A 3UR7A 3P0WA 1XD1A 4DJEA 3UFYA 2POTA 4IFKA 3AIQA 3REQA 2FQIA 3MUIA 2I17A 3N04A 1GVSA 4NRRA 2V69A 3N13A 2ZX6A 2A3EA 2ZYFA 3TAOA 3V35A 4GK8A 3NYDA 3SUSA 4EP8C 1DEDA 3WF4A 4M8UA 1BTCA 1BF2A 4KWUA 4YL2A 5AOUA 3UZWA 5ABTA 4H6QA 2OZ3A 3BLFA 3C0LA 4BWLC 1MFUA 4H9XA 1NDVA 3QHNA 4JQ4A 3WQPA 2O9RA 1VBHA 2GWGA 2F38A 4K8EA 1TWIA 2X1SA 3GHRA 1N8WA 1HJWA 4FP1A 1XRTA 3OA5A 3H22A 3UGRA 2ZKMX 1L9WA 3TA6A 4W4QA 1K6AA 5M5DA 4K37A 3KDNA 1THFD 1EXPA 1Q6EA 4JYFA 1E1FA 2A3CA 3NUKA 1P0DA 4BK9A 1CXKA 3RJYA 3NPWA 3L4TA 4RV8A 4Q7NA 3RN6A 1ICPA 1Z9AA 1E55A 4GVIA 4JFTA 3L7RA 3CHEA 1OK4A 3DHUA 3MA8A 2Q3RA 1CNVA 4Y6GA 3E6EA 3H2FA 3DYPA 3JVAA 1U5JA 1DXIA 3ABSA 1FXQA 1TELA 1QI4A 2QF8A 1VFTA 1B9ZA 2XINA 3W71A 4ZO9A 4IWWA 4M19A 5HMDA 2GLKA 2GGEA 3HPSA 4Q7IA 2CETA 4ROPA 3DDMA 1Q7ZA 1CBGA 4HYVA 1VJSA 2PC8A 4CD6A 3M5XA 4EWJA 2ZADA 4MWAD 1ZJHA 4RPPA 3QM3A 2DZVA 2CZ5A 3F5LA 5LIXX 1F5ZA 1IE7C 5TIMA 2OSXA 3G8RA 4A4AA 4UNIA 2IQ0A 1SQ7A 1GPWA 1YDYA 4KGLA 4YWSA 4ZQRA 3EB2A 3W29A 2RUSA 4OV9A 5FJTA 2OSYA 3OIXA 2ALRA 1RK5A 1QU4A 3GKFA 2XVGA 2X09A 2C1IA 3H2AA 3W7IA 1AQFA 1JDEA 1W5PA 4QGCA 2BGSA 5ABHA 3VNZA 1R85A 4GX8A 5KITA 2O0TA 2HS8A 3NDOA 4RNJA 3KOFA 4GXWA 3BICA 1BTMA 3TX9A 3TE9A 3TLQA 3W84A 4DPPA 4KESA 3M4HA 1KO0A 4XB3A 1G67A 1H1NA 1D7KA 3W3OA 3NA8A 4S3CA 4JEQA 4HJFA 1FCVA 1X39A 4C6CA 1FUYA 4XISA 4IM4A 1ONWA 1R7AA 3DXIA 4PZVA 4GQBA 1JNDA 3AJ7A 3DCPA 3IRDA 3G2GA 3KX6A 1R9ZA 3VILA 3L65A 1TPUA 4E4FA 1UUOA 1HQTA 3NQGA 3W22A 1XV8A 3VDGA 1KXTA 1JFHA 5I3JA 1Q6DA 2X8RA 2C18A 5A8MA 1V3HA 1E0XA 5J04A 2CERA 2CZVA 3HQPA 4O1EA 2Q01A 3AXHA 2X2GA 1YNQA 1JCTA 2V9DA 4EF9A 4BI5A 1H0GA 4WOQA 1OJXA 3P60A 1SJBA 2QV4A 4ZFCA 3H7VA 1HL2A 5A6BA 4HK5A 4Q6JA 3WF0A 2OG9A 1OK6A 5LA1A 4YYFA 3CS2A 3THQA 1CGYA 3LBMA 2PMQA 3O0KA 5CKSA 1MQQA 3BG9A 2QQ6A 2EO7A 3QZEA 4C6NA 2W91A 2RKXA 3LHUA 2R1PA 2QNEA 4JKKA 2PTZA 3R10A 1ITQA 3ONBA 1OFAA 3CMFA 4YVPA 1XRFA 2BBFA 3LGEA 5I6SA 4TMBA 3GXMA 3WSUA 3SCSA 4GBUA 4H9ZA 4GLEA 3ARWA 2ISWA 3W25A 2F2HA 4LVFA 1SW7A 1ZU8A 4NJGA 4Y8EA 2XN2A 1PZ3A 3UCDA 1IXPA 4CN6A 1XLHA 4GKTA 3W27A 4U3CA 1AW1A 1H09A 2R24A 1D8CA 2PDLA 2Z2AA 3B8IA 3A5FA 4MDPA 5A8GA 1A0DA 3AHYA 2QEZA 4ZFMA 2FYMA 3W7JA 1TPC1 1Z32X 2DVUA 1JZ6A 1E6NA 3W7KA 5CPMA 1NF7A 4XX6A 2ZX9A 4E8GA 1UD3A 1DJXA 3ALFA 3L12A 4LBRA 1IT0A 3RIKA 3V18A 3H7UA 3W72A 4AF0B 1XIEA 4GC4A 3N3MA 4J3SA 3EB4A 3PPHA 4BR1A 3GIYA 4H2CA 3LNMA 4JX5A 4CGTA 1VCVA 4JIEA 1BF6A 3DFHA 2VFIA 3T6CA 2O4QA 2WCSA 1XLCA 1W3LA 3I68A 3W2JA 1ZBVA 4GINA 2J24A 3UJ2A 3TC3A 4RL3A 5I09A 4TMCA 1GHRA 2O9TA 2P76A 4LSBA 2ESCA 2ADAA 2QAFA 1P0EA 3MP5A 5CG7A 4LVGA 3QXBA 3N15A 5D8ZA 2NQ9A 4QP0A 1ZBCA 5CPTA 5DLCA 4HVXA 4QE4A 4LVBA 1F7BA 4GVGA 1A5UA 4MYXA 3OBEA 1C92A 1W1IE 1UH2A 1XIFA 1KM1A 1C3FA 2QKFA 2VX7A 4M5PA 3IRSA 4IMFA 3W1TA 4O4WA 5DRIA 1D7FA 1TE1A 1W9DM 3T81A 3G1SA 3UEQA 1FWFC 3UZXA 3ZJ6A 1BRLA 3F4VA 4QJ5B 3T0TA 4G9PA 3UNDA 4S39A 3TC6A 2E6AA 4CNSA 1W5NA 1KKOA 3OLGA 4RDYA 4Z1DA 3VKDA 1Q6QA 2OKTA 1H7NA 2RDXA 4AEEA 1YADA 3W88A 3AICA 5LA0A 4XZBA 1TJ1A 3AYRA 1CXIA 2H9AB 3GFXA 4HNNA 1S46A 1N7KA 3KWXA 3DEQA 2NVAA 3EX1A 2Y24A 1ONRA 1E51A 3GUWA 2CBUA 4LCSA 3VNMA 1LJYA 2XM2A 1GKPA 1EPXA 3LRMA 1CEOA 2CZFA 4LUTA 1F3WA 3QGAC 2XPKA 4H7CA 1BVWA 1M7OA 4PCNA 4RV3A 3WDRA 5CC7A 2G3NA 2PWEA 4W85A 3H2MA 2ZZ5A 1VCGA 3DHPA 1VCFA 1QDSA 1VENA 3GZAA 3WDIA 1GJPA 2X0SA 2EXOA 3TNBA 3E0VA 3ITVA 3L0NA 3BGAA 3SCVA 4EPBC 4Q8WA 2IXVA 3TONA 2CXGA 2GWNA 1HJXA 4M29A 1EA9C 2IPWA 1W3IA 4XBKA 1L6GA 4HOWA 3CXOA 4L5ZA 9RUBA 5LXXA 5AYYA 1TE6A 2ZXAA 1ITXA 2PI6A 3IJLA 4N9CA 1KRAC 2KX9A 1UKQA 4IFOA 3UWZA 4H04A 3WLPA 3WF3A 1X6LA 2J13A 2HISA 3OLEA 2E77A 3GNXA 3D6NA 4IQLA 4UQ9A 2C16A 1PHQA 2VFDA 4GMEA 5DBUA 1S1PA 4EOUA 3QY6A 4DAIA 4GJJA 3IIOA 5DBTA 4NSBA 3R7MA 2YYUA 5HUOA 1ICQA 3GDMA 5CBJA 1F74A 4Y9NA 2ZC8A 3GR4A 2NT1A 2D2HA 5HWJA 3GH7A 4WGXA 2JIEA 2ZIDA 4A3UA 1AD4A 2IKHA 1WCGA 2OJPA 4WF7A 3VINA 3W6LA 2Y61A 4ZQOA 2HPIA 3EWWA 3S9YA 2XWDA 3B0YA 5D8WA 4W87A 2RGMA 1UP3A 4AMAA 5D38A 1OX4B 1F61A 1TTPA 4JDYA 1I45A 4H00A 1PDYA 1S38A 3MWAA 5G4WA 3F5KA 3LM3A 1V02A 1P48A 4FXJA 1Z44A 1QUMA 4LC6A 4DJFD 1F3XA 2A1YA 1LZOA 3MDUA 3ATZA 3UWEA 4CEXC 2GOUA 2HBXA 5D02A 5BOFA 5F4SA 1GOQA 1UMYA 1H50A 1IR1A 3WDPP 3WLKX 1GEHA 2PSNA 3FHQA 3T0CA 3QEZA 1A5SA 1QOXA 3ZR4A 1UHVA 1POKA 1VFFA 1E9IA 5I06A 3CPGA 2RDTA 4Y8FA 4L4OA 5FF4A 1ISVA 2BODX 1SYTA 2P5NA 1IHIA 1RQHA 1GKQA 3WNNA 3ZR6A 2NQJA 1UC4A 1LBFA 3ITGA 4GHRA 3AIVA 4PH6A 1SO5A 2DJXA 4AZ7A 1UR0A 3O06A 1M53A 3TXZA 1H2JA 1CTNA 2G37A 3FGCA 1VBJA 2VZOA 3W81A 1JUKA 3KCOA 3V75A 5JIWA 5JVLA 2E3ZA 1HIZA 2WPGA 2XH0A 3L67A 1QPNA 1WP6A 3S83A 1LRTA 3D0CA 5I3HA 1UKPA 1PPIA 4OWGA 3C2EA 3QFWA 4U2ZA 5DCBA 3WH6A 3USBA 4Q8NA 4C7FA 3G8EA 4FR1A 3N4EA 4AX7A 4K36A 4NAEA 4EIVA 3JZUA 1J96A 3MBFA 3THDA 5LNSA 3OODA 1CGXA 1JZ4A 1UZ1A 2OELA 4F2UA 2J8TA 1VC4A 3AXMA 7TAAA 4RX0A 4UFIA 1RH9A 1W9VA 2VP8A 4GUHA 1XSJA 4C6PA 3F4NA 4LY4A 4M56A 3G3MA 5BU6A 5C55A 5C9XA 3B9DA 2YXOA 2QGHA 3PVFA 1K7EA 3MP4A 1IGSA 4I7VA 1Q8AA 4NZCA 1XD0A 3Q67A 1SMDA 1TJ0A 2RJHA 3VDAA 3TTEA 4DPQA 4D8LA 2VFGA 1UYQA 5G2WA 4YYCA 1H0IA 5DO8A 4Z0JA 3L2MA 5LNWA 3CQIA 3LY0A 3O8AA 4E4UA 2XN1A 3W76A 5CH9A 5HOSA 4Q4OA 3LK6A 1TV4A 4TQTA 1TV2A 2XSBA 3N2XA 1XYZA 1W5MA 2DIJA 2E8YA 2OLHA 3R8HA 2POZA 1XQLA 4G2DA 4GE8A 1R2SA 5K7JA 2BP1A 3RGTA 4E2BA 3BMXA 1VIZA 4UOJA 3WQ4A 5F1VA 2WKLA 4PUNA 3LI0A 2GQAA 5G2IA 2PTYA 1I6NA 3WL1A 2A3HA 3WK1A 1RP8A 2YZ5A 2PFHA 3N2OA 3BAYA 3MI2A 4O1AA 3VOCA 4CNNA 4MNKA 3VC6A 3CH9A 3FOKA 1FDZA 2QCDB 3TQKA 1QNPA 2ZOXA 3QYSA 3UWQA 4GI6A 2CHOA 2VDHA 1AH0A 4JTSA 3OOQA 4MNMA 3BK0A 4C1LA 1NOUA 3WQFA 3HPAA 3NVDA 3GIQA 7REQB 2VEIA 4HU4A 3CUZA 5CPQA 4JTDA 2V3GA 4LAMA 3S1UA 5A8OA 1XH0A 1C90A 3BQ6A 3TSMA 4JX6A 4XKYB 5DY3A 4DM1A 3RYSA 4LY8A 3GTFA 4ZOEA 5JIPA 1UA3A 2YL9A 2Y62A 2D73A 1J93A 3MUAA 3V5FA 3W74A 2YDAA 3DECA 3S0CA 3C8NA 4W89A 5FSDC 1H4PA 4R9OA 2RGLA 2YLAA 3UY7A 2ZWZA 1B1YA 4WHBA 3FLUA 3MWCA 2Y2WA 4DUXA 3FHAA 3W6MA 3OLIA 2DDXA 1F4HA 1VFUA 2ACSA 3NSMA 3AWOA 3NQ2A 5D9PA 3ARZA 4H41A 4M1RA 4KEUA 4QG6A 3CZJA 4L56A 1DTUA 4MB3A 4IPJA 1ODUA 1VEOA 3MSYA 1RHCA 2BVDA 2VOMA 1DIDA 3PS7A 4UFLA 1SO3A 1NJJA 2WB5A 5LZLA 4I9TA 5K9DA 3TOPA 1XFCA 3PUDA 3C6CA 2GVLA 1EOKA 3AO0A 2AAAA 4K3ZA 1F4AA 4I5XA 4H2HA 2EG7A 1TV8A 1JCLA 2EAWA 3KDOA 3O6DA 1S3HA 1US2A 1B30A 2QIWA 1A3HA 3NZ1A 3B03A 4O18A 3G1YA 3CV6A 3CZEA 4Q4QA 3P74A 3VABA 4PMDA 4UB9A 2CLHA 1YEYA 1OFPA 3NQMA 3JS3A 5BYWA 3R1ZA 3VO0A 2AAMA 4NUWA 1Q6CA 3G1RA 2QCHA 3WF1A 6ALDA 3D5HA 2PCEA 1XPGA 1NEYA 2ISDA 5HDRA 3OGSA 4NZ1A 1ME8A 4MSSA 3GY1A 3QZAA 3FS2A 1JG9A 4PUUA 4O0KA 2WJZA 3W01A 4PGLA 4AMCA 5CLTA 4E8DA 1OYCA 3QC0A 3M0HA 1JDDA 2V5DA 1OIFA 4ACYA 3QVQA 4KQNA 1NELA 4PCTA 4C1NA 3H53A 2E0PA 5BOEA 3WJYA 4HIBA 3GHTA 1QATA 4CNPA 3HGRA 3CUXA 3BAXA 3GTXA 4A8NA 1G4TA 2OYKA 1EWEA 3AZSA 1A53A 2IPGA 5DXYA 5DCEA 1Q6LA 2JIWA 3WNPA 1P6CA 1Q3NA 2C14A 4LNCA 5FEWA 3UG4A 4X63A 1EF3A 3BOXA 4EF8A 2CFFA 2NQZA 3BG5A 2NWRA 4U5IA 2W3ZA 3POCA 4IOTA 4CQ9A 4KS0A 4D71A 4KRTA 1E43A 2I16A 3KS6A 1UR9A 1Q6OA 3QFEA 4HZ8A 4XD3A 2CPUA 2F8QA 1GG1A 3CWHA 3WEZA 3H23A 1ZCOA 1E5JA 2PU0A 2Y8UA 3MHFA 3AYTA 4LJ3A 4CCDA 1WNOA 2BHZA 3VX0A 1WO2A 2XGBA 4GJIA 1OBAA 4B2DA 5KZ6A 1CZ1A 4MYAA 1XUUA 5CLWA 3H4XA 3CL6A 3T2QA 1PDZA 4DAFA 3TJLA 2R14A 1K9DA 1P43A 5BNKA 1XLKA 3UWUA 1SO6A 2I56A 3I6RA 4TU1A 4GUGA 3S5ZA 4YCOA 3PFMA 2NUWA 3RM9A 2Z6IA 4LUJA 5CQ1A 1FDYA 2V30A 2NXGA 3QRHA 5IFTA 3EGJA 3RILA 4X0NA 3ZOAA 2C1GA 3NPVA 3M0VA 4YJ5A 1OFDA 3IV3A 1TVNA 4DBSA 2NV1A 2HRWA 1JUEA 2FVKA 3WBEA 1UQYA 1WBHA 3BWWA 3GS6A 5AZ1A 1W32A 3AIRA 2YCEA 4GZ7A 2Y7FA 4E38A 2GJRA 4MUZA 4BQ4A 5C9WA 1W5OA 3TWBA 2PDXA 3NO3A 3N11A 3F4WA 3IWPA 4CUCA 2J9YA 4GFSA 3TJ4A 4UFMA 5A5WA 2OQHA 1OADA 1UH4A 2BDQA 1UW9A 1OY0A 2XISA 3LTYA 4WJXA 4AVOA 3QC3A 4RUBA 2WSKA 3MZNA 4X9SA 1FKXA 2ZWYA 3W1XA 1ZTVA 3WUGA 4QS5A 2VKZG 5AC5A 2G95A 4S2BA 2JQXA 4AIBA 1RLCL 1PB0A 3P82A 2DUXA 1DWJM 2ZDSA 3ZWSA 3N2TA 1ONXA 1RALA 3W1MA 1FKWA 1QAPA 1XKYA 5BWFA 2RDWA 2O7QA 3NOYA 1DYSA 4H9TA 4FF7A 5HK4A 4K8GA 3AIWA 5E5CA 4F0LA 2PU1A 4DBUA 3CUIA 5GQBA 4ASTA 2PZNA 1W3NA 3U9IA 3OVGA 1KCXA 4C5YA 4H8UA 1WOBA 4OBSA 2AKZA 4LU0A 4F2TA 3IJ9A 2YZRA 1S2CA 4DB7A 4IJRA 2Z0IA 1PIGA 4JX4A 3DN5A 3GZ3A 1LWIA 2NQLA 1L8NA 4C1NB 3HV9A 4TTUA 1HO4A 1OF6A 3ZR5A 4OE7A 3BE7A 3BJSA 5DN1A 2EQDA 1E1EA 2YXGA 3SRHA 2R9RA 3UBPC 3AQUA 2VVNA 2QCMA 1C9WA 1KV8A 3ATYA 4AXNA 4HCHA 5K4XA 3R0KA 1G1YA 2QXWA 4C6MA 1R46A 4FNRA 1JPKA 3SR7A 1MW2A 4EXAA 1HL9A 4YMZA 4Y9PA 1LWJA 2V38A 1ENUA 5T9BG 2E1DA 3BZGA 4B5VA 1CXLA 1ECQA 3FVDA 1JQVA 3WZ0E 4HT3A 1EB3A 3N19B 3R13A 4DYEA 4UIOA 3M41A 4IIGA 1X96A 3FJLA 2V3FA 1AZ2A 3TN4A 1Q13A 4MKNA 4NILA 3C3UA 1WB0A 2BX7A 4N7QA 3NO5A 1XCWA 4ICCX 4JHZA 4PUMA 3VIMA 1VS1A 3PY2A 2Z27A 5LXEA 5K2ZA 2B81A 3W7MA 1SZNA 3Q45A 3FN9A 2C19A 1POJA 1OFBA 1KFJA 1U30A 3FJ6A 3UESA 3CHFA 1KBLA 2ZXDA 2QGYA 2QDHA 5HNNA 1GUVA 1E9ZB 3MYPA 4QHRA 3XISA 1MZHA 1WPCA 4C90A 5IBXA 2PEVA 3DKJA 1YNYA 1XSIA 4JNMA 5JH2A 4KCTA 3PZMA 1XLAA 4GBDA 1LRQA 3MS8A 1KR0A 3JZEA 4DBDA 1K9FA 2DZBA 1V3MA 4FX7A 1P0KA 1NDYA 1OIMA 1UKSA 1I0BA 1EO7A 1E9LA 1MQRA 4C91A 2WHKA 1ADDA 1RCXB 3GFZA 3HPXA 4JYDA 3IEBA 5T26A 1PKNA 1GVYA 1R30A 4TV5A 3U4AA 3CC1A 3WJXA 3MSDA 2VOTA 1NVMA 4IJBA 4QAWA 4XK2A 1KFKA 3UJSA 2FTPA 1DQUA 1A5OC 2WM0A 3WELA 4DELA 2DIKA 1OZQA 2PP3A 4OTKA 4C6QA 5CPNA 1XP3A 1VPQA 2PZ0A 3WL0A 4C6EA 3TAKA 5EYWA 3I4EA 1EIBA 2QDDA 3E2SA 2VWTA 3YPIA 3BVJA 3KHJA 4FLOA 3WO8A 2REQB 5EGRA 1KM4A 2IPFA 3UG5A 3WLTA 4WY0A 1J11A 1MVYA 5FD0A 1UA7A 3O05A 3RRXA 3SCNA 1XUZA 2GDUA 2Z2UA 3AI0A 3TQPA 3VKCA 3N12A 1S5MA 1QNQA 1H1YA 1WZAA 5DMNA 3L4ZA 3PNZA 5GJNA 2DV0A 3E2QA 1F07A 1SW3A 5C6MA 3T1GA 4GY1A 4L1WA 4BCEA 2VGFA 1UWUA 4Z2JA 3FIGA 4B91A 2OX1A 5XIAA 3RNDA 4BY3A 3S6TA 1WUFA 2QJHA 4KWWA 3ZVHA 2XH4A 4Y90A 3CT2A 4XBJA 1KA9F 3LMYA 1YPIA 3M0MA 1I60A 4UR9A 1ITCA 1ZB5A 3FW6A 4R53A 1KKRA 1A5BA 3O0FA 4PUWA 4O19A 2I9EA 1WXJA 1H62A 3AJXA 1WDPA 4PBFA 4PCSA 2BGNE 4A05A 1U83A 4FSAA 2JFEX 1G7VA 3ANVA 3NPUA 4NU7A 1GYMA 5EFFA 3CH0A 4Z42C 2IW0A 3OZOA 2WBKA 5LIKX 4D1IA 2GUBA 3PZ9A 4MAZA 4DJED 2MNRA 3O15A 1C9DA 2VQUA 3CMJA 3QTPA 3LDVA 1NSJA 2PWGA 2VC5A 3IS4A 4BQ3A 2G3FA 4FK9A 1XXXA 1EDGA 1BWVA 1SMAA 1TQJA 3GHUA 1EO5A 4DYKA 3TQVA 1RAKA 1DWIM 1WAWA 1R9XA 4BS0A 3WYZA 2H90A 2J62A 3L66A 1QK2A 4KFOA 3P84A 5C2XA 5JMUA 1B3WA 4GQQA 1W91A 1FWCC 2A3BA 2NXIA 3H70A 2NUXA 2G3MA 1IXOA 1PUDA 3PZUA 4F9JA 3AZRA 3QN3A 3IJ7A 4JN6A 1JL8A 2BOEX 1Q4NX 5I3DA 3TW6A 3B4UA 3DGRA 3IVTA 5ABEA 2PGWA 3LB0A 2XH2A 2BWGA 1JYNA 3GW3A 2OX4A 4GY0A 1QTWA 3NQ7A 3GVWA 3ZS4A 2D24A 5I77A 2E6FA 3VMOA 3GG8A 3T40A 3PBWA 3INPA 4DJFA 3Q94A 2G50A 1FCBA 4WY0B 1DXEA 4H6RA 5FEXA 3EKZA 2FZBA 2QW5A 3G6MA 4PN2A 3VIPA 5F4XA 1EL3A 1OT1A 3GTNA 1FH8A 3NQ6A 4MM1A 3CUGA 5L9FA 4UCGA 1B57A 1TRDA 2QDGA 4FA3A 4GH1A 4IG2B 4G1NA 1UC5A 3B0PA 1OQFA 2V0TA 4LWWA 5U4NA 2BHYA 2Y4SA 3WEMA 1UOKA 3N2CA 1KTNA 4GIYA 3CO8A 3LPPA 4OVXA 3ENLA 1JGMA 1TV7A 1ITUA 1V93A 2QUNA 4PTMA 3F7JA 1E3XA 1AQMA 1V6VA 1LQ2A 2QVNA 4CN1A 4E2VA 4KEZA 3CV2A 3M0XA 1CW2A 5ECVA 5HJYA 3W24A 2YPIA 4LRTA 4LPCA 2PS2A 3W4RA 6XIAA 2WVSA 4LCRA 2WK2A 5HULA 1K8CA 1V0NA 5E09A 4N02A 1QOQA 1G0CA 4MPKA 4CEUC 3DX5A 1VAHA 5BROA 3SCOA 2PP1A 1W31A 2GJXB 2ACUA 1H51A 2DT2A 4XQ6A 3DFOA 1X6UA 4CQCA 1US3A 5G5IA 1PTAA 3VDBA 1MRQA 1J5TA 3ITOA 1KFLA 2INEA 3EYPA 4KIEA 1O6IA 3UXIA 3N18A 5DT5A 4U10A 5C9UA 2J79A 3TYUA 4IMAA 4EXQA 1BXBA 1ELSA 2R1NA 5ECUA 1O95A 3T05A 3SM0A 4JQAA 1A3WA 3STCA 3SRKA 2ABAA 1EJUC 4DJEC 2QJJA 4WLCA 2EKCA 2BXYA 5BW6A 3FXGA 5XIMA 3SQSA 2XG9A 3RAOA 4XVDA 4GRSA 1XYAA 2DIEA 5CJ5A 1GZ1A 1UOZA 4QROA 1EJRC 3SI9A 4C6IA 3MMWA 1O12A 3FXYA 1M6JA 1AH3A 1W9BM 3QGVA 2FB2A 1IXQA 3VIGA 3BTNA 3VFLA 2E6DA 3VIKA 1XGZA 4JTJA 4OU1A 1AZ1A 3K2GA 1R3RA 1E4IA 2YW3A 4NX5A 3RPTA 5C9RA 1YTEA 4KCUA 3QHOA 1FCUA 2XGZA 3LXBA 3N9SA 3ZQ9A 4AD2A 3TUUA 4AD4A 1HZYA 4GFIA 5D32A 1GG0A 2OEMA 1GQNA 4RKAA 2NSOA 3TMQA 3CUFA 3BO9A 1A47A 4FIRA 3UP8A 2VT0A 2ZZ6A 3ANUA 4HNOA 4NNBA 4DQWA 2ATSA 4Q6XA 3M0ZA 1X97A 3ARVA 3TFXA 2CLEA 4AH7A 3PZVA 2ZUUA 3OA3A 3I6TA 3P8JA 2CBVA 1C8VA 3BAIA 1G7UA 2X0HA 1AW5A 4QIUA 4JIQA 1OM0A 4FLRA 4HU8A 3LBOA 5LSMA 2HK1A 3FAWA 2VC9A 1NFGA 4ADUA 1ZZMA 4HYWA 1LF1A 3H7RA 2VD9A 4ZL1A 2ZBTA 3KL5A 2DU2A 4MWAE 3MI6A 3B8SA 1JDFA 5EMJA 4PRRA 4FB7A 2OZ0A 1QOPA 1SO4A 2GVEA 2VGBA 1TUXA 4WSJA 3BMVA 3STFA 1V0LA 3LRLA 3LPOA 5G1YA 2E4TA 2PWHA 3NGJA 5LNUA 4BQ2A 3LCXA 3T08A 3IPWA 1EEPA 2B7NA 2JGQA 4C6DA 5I07A 4MG4A 3TKFA 2CLKA 1SZEA 1AVAA 1W1YA 1Z41A 2Z2BA 2XIIA 4X9YA 4POCA 2J88A 2ZVRA 4MB5A 3AAMA 4IMCA 4QNEA 3LPGA 1OD8A 3FKRA 1BGGA 3S2MA 3SCPA 1YTDA 4BI7A 1C8XA 1TMHA 5EMKA 4HJWA 3WMLA 2VGGA 4M3PA 4OECA 5AHIA 3NGFA 5J5RA 4C6OA 2GDVA 4PR4A 3WH9A 3QLDA 2VTFA 4OBRA 2A6NA 3LCWA 3LCIA 5EY5A 3B9OA 1U1JA 3ITCA 4H6EA 4JTUA 2DEPA 4FNUA 3VGDA 3VD3A 5CSSA 3HO8A 5FJIA 2PDKA 3WLLA 2NV9A 4NY2A 2WCAA 3A3WA 4ZR8A 3GNDA 1U33A 2D0FA 2CZEA 1QPKA 4LALA 3S1WA 1WYIA 4M51A 5F2GA 4I7WA 1XGEA 2G4FA 3C0JA 5D2VA 4X0VA 3CMGA 1PV8A 5CJMA 1JDCA 2WAGA 2EPMX 5CCZA 4DVOA 4Q4PA 3SRFA 2IUZA 1UJPA 4IMEA 3W2NA 3L4VA 1DORA 2QV5A 4XAGA 2DSWA 4UTIA 3GU1A 2Z24A 2J75A 5CBIA 4Y2WA 2V5BA 4TUFA 3AXXA 2OOGA 5B7YA 3Q58A 4GWEA 1ISWA 1HFBA 2HXTA 3OW1A 5CGTA 3C4UA 2ALDA 3MCOA 1Y7VA 3PZQA 4UMBA 1K03A 4HPXA 3JW7A 3OGRA 2HVNA 3AS2A 1Z42A 4N4QA 1KBIA 3RDKA 4GGHA 2AOSA 3ZXWA 1R3YA 2GVGA 2WMIB 3NL5A 1WZMA 1V79A 1EH9A 1RVGA 4J1OA 1EFZA 2Z7KA 2YFNA 2XFFA 1BPLB 3M47A 3PPCA 5D2TA 5LNRA 2PUZA 3B04A 1SFJA 3L4WA 3W1RA 2CU0A 4F0SA 3TCSA 1R6WA 3QPEA 1UWIA 1R3QA 4GXPA 5KEZA 2ZUNA 3ARUA 2VM8A 2XZ9A 4IIFA 1XPYA 4J3ZA 4I3GA 5AYXA 2WNZA 2XH7A 1V0MA 3CYVA 2QHAA 2FZ9A 4Q22A 1MUWA 3N4AA 2QCGA 3KTSA 3IUDA 3WD1A 2HVOA 3WFLA 4ZXOA 3OO2A 5E0CA 3OEXA 3CZ8A 3ZVIA 3RRAA 1IEVA 1GOKA 3ITLA 1UPPA 4C7DA 2QMKA 1OC6A 4P2VA 3U5UA 3DAQA 1NFPA 3ZO9A 1HJSA 3Q2DA 1YX1A 1XWYA 5MHBA 4AIUA 2FTYA 1I9CB 1OCBA 5E9AA 4GXMA 2ISSA 2XHYA 4YIWA 3OG2A 4JN8A 2BY3A 1GZJA 2L5HA 3K8LA 4A8IA 4V28A 4ICNA 3IVUA 2X42A 3S5YA 1T96A 4RXFA 1UD5A 2D1ZA 1PIFA 2ZICA 3GXNA 3BSHA 4UQBA 1F2JA 4RR4A 5H1WA 4I8DA 5LYRA 4IMGA 5DELA 1PJ9A 2IPJA 3A3XA 3EDKA 4FS9A 3MVIA 4O53A 2ONEA 1PSCA 3VIOA 1M7PA 2WZEA 1CPUA 3F5JA 3U4FA 3NDZA 4IFKB 3REQB 4RPQA 1X7IA 3CTLA 4GNVA 4KRZA 2WQDA 4XKYA 3PTKA 1QNSA 4FNQA 2DSKA 2ZZ7A 2BGQA 1R2RA 3UYIA 4LGXA 3BLLA 4E3VA 1XC4A 4PMZA 1KFBA 1GVOA 4GQ0A 3NL3A 1WZKA 4WGHA 1RJRA 3OP2A 1DWGM 4QBXA 4WKAA 2V67A 5D30A 1ZFJA 3BAJA 4NVTA 2D0GA 1S1RA 4J3TA 1BWLA 4H83A 1I2OA 3QV6A 1IEIA 2V5CA 3N2MA 1V6UA 5F2IA 4XTDA 1S2WA 1MEWA 4UBPC 4I9MA 3VA8A 1UD6A 1KD0A 2PDPA 4UUIA 3R8RA 1CECA 4UFKA 5DMLA 2P1FA 3ITYA 3S9IA 3PK7A 4W7UA 1DV7A 3WBAA 3ID7A 1MMFA 1H3GA 3GWQA 3M5VA 2Z1BA 3IJQA 2A4AA 2Y70A 1KM6A 3ARPA 4WSKA 1R3VA 1YPXA 2IKIA 1QHZA 2WKGA 4HZMA 4KFNA 3W7DA 3O6YX 3WJWA 2UWFA 1OINA 1YTKA 1H5VA 1FTXA 2GDQA 4U28A 3UR5A 1SR0A 5C0QA 4O57A 5A6AA 5D09A 5IHRA 4DXVA 1VBUA 4Y9OA 3IIZA 2JF6A 3CB8A 3S5SA 4RZ5A 1Q8JA 2V63A 2QUVA 4OHQA 4D2JA 1C7TA 3PJWA 3N3TA 4WCJA 1IT7A 2X7WA 4MFDA 4O8RA 2WMIA 5AYIA 4H9VA 3SBFA 2J7BA 4ML4A 4NG3A 3PTDA 1DIOA 3B8VA 1GYNA 1XF0A 2UY4A 2Y0FA 4JL1A 3M43A 4Q3MA 1V08A 4UC5A 3LX9A 4N4PA 2INFA 4L7ZA 4JD4A 2WC4A 3DFQA 4CCZA 1Q63A 3TYEA 1NIUA 2WLYA 4MIMA 3PULA 2QPXA 3AIEA 2HXUA 2I7GA 1XIMA 5L6UA 3CQJA 4HK7A 3MCNA 4V27A 1GZGA 3N9RA 4WDXA 1MW3A 2Z7GA 3K8KA 2J25A 2HE5A 3S9ZA 2PDCA 1FWIC 3O7UA 1M3UA 2BVTA 1ICSA 1U5VA 5ABFA 5HPOA 1EYWA 3C8FA 3P81A 1DHKA 1HNYA 1UWRA 2VCCA 2X41A 2V6AA 3FA3A 1G4SA 2CBJA 3AMGA 3AS3A 1TTIA 4Z1BA 3EDDA 2J9ZA 3TR9A 3U48A 5TAOA 1EJTC 4GIAA 3VZZA 3GXPA 2ON3A 3POHA 2W62A 3KBVA 3UXDA 4ACZA 2B0MA 5SWUA 2J7GA 3QW4B 3VXGA 1CENA 3OJGA 1TPEA 4ZOBA 4OV4A 5CSUA 3BH4A 3B0UX 1UR8A 4IX0A 2WW5A 5D2WA 1U5HA 1VF8A 1G69A 1XDJA 1IT8A 3B0VC 1B3OA 1F05A 4ZB2A 3M46A 2HV5A 4ZODA 1KFEA 2WVVA 3ITXA 5EL1A 4CN4A 5E93A 4OUEA 5DRCA 3DKLA 2E5DA 4J35A 4YTRA 4TTGA 2RHGA 3RLUA 1A4MA 4XAZA 5B7ZA 2J77A 4ZOAA 1R47A 3P5YA 4B16A 3FNDA 1QNVA 3EB3A 3T0DA 1P7TA 3DH7A 4S2CA 1WZLA 1E6XM 4Q4KA 2WWDA 4KCWA 3UZZA 3BL3A 2PDHA 3GNOA 2ZQ0A 3SJNA 2F6KA 2VZUA 3WJZA 4J27A 1TX0A 3D3FA 2OXNA 5C54A 1HN1A 2O9OA 4INFA 4KT2A 1QR7A 4HN4A 3R0UA 3WLIA 4R34A 3R58A 3KOZA 1ISXA 1O5RA 1DTNA 5D2YA 2DP3A 3RLHA 2F6UA 5XINA 3TV8A 4RDVA 1XLFA 4LNYA 4S3AA 3B40A 4GG9A 2J7FA 5KINA 2V81A 4M7TA 3TYBA 2YCLA 1HKMA 1PYFA 1W3JA 4K68A 1QHPA 3T7VA 3AHVA 3ES7A 2Z1XA 2ZC1A 3N4FA 3O9NA 1ZP4A 2YL5A 3LM7A 1T99A 1UP2A 3THAA 4TXEA 2YLLA 2PTWA 4HBKA 4RE0A 3A5VA 2VFEA 2WYSA 2C6QA 5FCZA 3CBWA 3OVRA 3URNA 1GW1A 3WUFA 1MZRA 2H8XA 3UPBA 4LAZA 4CVUA 1KCLA 5HQEA 3UZYA 2VUNA 3QHMA 5HA7A 3UW6A 3WQCA 1E0UA 1EJWC 4OJYA 1EX5A 5F2LA 4NZ5A 5T9CE 2XVNA 4AAJA 4IHCA 1PBGA 3U7VA 1J0KA 1XYLA 4DBWA 3W38A 4GKLA 3P80A 1ESWA 5HANA 3PWIA 2WHLA 5A6TC 3L5MA 3DUGA 3BLPX 4M82A 1SU5A 4HPHA 4J5NA 4PMRA 1FHDA 3TN3A 3QV9A 3EEGA 1I2PA 3A64A 2DUZA 1VBRA 1YDVA 5I00A 2FGBA 5A6KA 1ZLPA 1ZP3A 3HU7A 4MDOA 3VE9A 1ZPTA 4S3BA 2OWXA 2I1OA 3NM3A 3DBNA 4DUVA 2PODA 2PF0A 1FCQA 2MANA 4UTWC 3ZJ8A 2HJPA 4S3JA 2RAGA 1OX4A 3LSBA 3W83A 1SPQA 3L5LA 2OMAA 1VHNA 1KLYA 2DZSA 3F1QA 3HGOA 2CESA 1Q6GA 4QXIA 4RZ6A 1V51A 2UY3A 3W7EA 3O16A 3HIJA 5AYZA 3WQ6A 1PTGA 4R9XA 1QRQA 1TJ2A 3IARA 2OWWA 1QW9A 1S5NA 1W1B1 3EX4A 2GQ9A 1CWYA 1LG1A 2ZFAA 1QPQA 3SN1A 5F1UA 1RQBA 1ZAHA 4ZQMA 3KOWA 4ONVA 2ZUTA 3NQ8A 5AC8A 4GCXA 2C8NA 3I6EA 2C0AA 1FY6A 3KCLA 1JXKA 2PDUA 3M0LA 2W0UA 3IVSA 3ZMRA 4ZO7A 1QNRA 4MY9A 3PANA 1UPMB 4MADA 3CV7A 3OYZA 2BNJA 4DX3A 1G5AA 2Q71A 1VLIA 2DZTA 4LBSA 3WQGA 1JZ7A 3AMKA 3HQOA 3CK5A 3UU0A 1XLBA 5A8QA 2VR4A 4HP5A 3IAQA 3CQ0A 2YKKA 2XUCA 2OT0A 1LOQA 4G6CA 5EB8A 2W61A 4LOCA 4F40A 2XVPA 4G56A 1EQPA 5TBOA 3SGUA 2ZVIA 6TAAA 2FGLA 4FI4A 1AUSL 2YCKX 4WD0A 2FZDA 3KRBA 3C0QA 1JPHA 1I2QA 4MMWA 2ANUA 3BMWA 3EX2A 1QI2A 4C6FA 4KW2A 3M5ZA 1CB7B 3PBUA 3VM5A 5IFPA 3AUOA 3DESA 2A79A 3AS0A 1TWSA 5I5RA 3QF0A 1BFNA 3TSBA 1WV2A 5HMFA 3M44A 3KRSA 3W7CA 3H2OA 2EF9A 1GGOA 4YLWA 2A0NA 1XR2A 4PBGA 4XZLX 4JTRA 1TV5A 3G1FA 2YIHA 5I24A 3EMCA 4JTQA 3URAA 3LGGA 1J01A 2Z6JA 2Q8XA 1W9PA 4A3RA 3V5CA 1I75A 3CAQA 4LS1A 3LENA 2F84A 1CXEA 2QPSA 3HZ3A 4JN7A 5G4HC 3QYQA 2R82A 4BWLA 2Y1HA 4FLQA 1FFQA 4I7UA 3MHGA 2FJUB 4P7OA 1L0PA 5I2UA 3ORWA 1VRDA 1GK8A 2VXNA 4JL2A 3PUOA 4KF1A 2JEPA 4HCLA 1YYAA 3B06A 1R38A 2JKPA 3R25A 5FAGA 3RCMA 4UXDA 3CZGA 3MO4A 1W5QA 2YFOA 4M6QA 3SCTA 2HNEA 2FB3A 2QULA 1M7XA 4QNWA 1DQWA 2ZTJA 3H26A 5J5DA 3EWZA 4DI8A 5IDZA 2G97A 1EUAA 1AL7A 4GX9A 2ASHA 1R3TA 5E0KA 1W9UA 1GVEA 3KVJA 4AZGA 3VNKA 3FYYA 2ZXQA 2OKOA 4UTLA 4LB4A 1HKVA 2ODOA 3V36A 4R3UA 3PNUA 3RITA 2WVUA 1W3HA 5F2MA 2YW4A 3Q4DA 4WDUA 1KQZA 3TWAA 9CGTA 4WKHA 5H8MA 5BXPA 1F8MA 3NIYA 1DJHA 4P8XA 4KWOA 1CX9A 5A1AA 2YJQA 3CIWA 4EE9A 3F4DA 4FNPA 5M3WA 4GVFA 4WUIA 2XDFA 5I03A 1AA1B 1JAEA 1HJVA 4QAIA 2PRHA 3SN4A 2Q6ZA 2YSWA 1S39A 4LANA 4AZBA 3BARA 5FSEC 4LF1A 3MSGA 5I3KA 2W66A 2HROA 3AHXA 2GVYA 5CZTA 1JD9A 3GDBA 3EDEA 4IH3A 3AYVA 2EBNA 1PWMA 2IQDA 2J27A 4B5WA 2D20A 3PZGA 1TQXA 1XIGA 3M0IA 1EKOA 4MWAA 1Z69A 2AGTA 3L5AA 1JCNA 1JZ2A 3ONCA 4W7VA 4MB1A 2WMFA 2JGYA 3QQ1A 3QKZA 5FI8A 4AWTA 1IYXA 4AW7A 3VC5A 4X60A 4Z08A 3AC0A 2PWFA 2FZMA 3IANA 1W2PA 3OZYA 2HTMA 1QHOA 3T07A 5I3IA 5F7UA 1QI0A 1OGGA 2FHCA 2ZA2A 4H8HA 1F3TA 4QRNA 1RCOB 1VR6A 3G22A 1ZJAA 4GNJA 1L2QA 5JBFA 2Z1SA 1ZENA 3ZFHA 5GNXA 4O54A 1Q4WA 3CIVA 3LGDA 1NU5A 4MLJA 3W75A 1GOXA 4XO7A 1OVDA 5BXRA 4KKXA 1M41A 3VDHA 4E8CA 4QE1A 3L9CA 2XIQA 3RU8X 1KW1A 1P6BA 4M7SA 1CT5A 5K3VA 2J74A 4I8YA 1FWNA 4L6DA 5I79A 4I9JA 3LCGA 4XZHA 2Q02A 4JOMA 4GZJA 1O1HA 2ABBA 3GTIA 2DORA 3OQ8A 2DH3A 5HINA 3PZTA 1PIIA 1QBBA 4O15A 1ECEA 1XC6A 3SUTA 1YMYA 4WVXA 1GEQA 1I2NA 1SFLA 3B8WA 1L6SA 3FSUA 1JFXA 2Y85A 2OEKA 5JUVA 1PZ1A 5CZJA 3VD7A 2V82A 4F4RA 1TX2A 4PEEA 4L64A 4YHGA 3ZT6A 4F2BA 1IGWA 2XIMA 1TUFA 5CZSA 4D72A 2E7FA 4ECLA 1GCYA 1DL3A 3GLCA 2VX6A 3MUXA 5CGQA 3W87A 1UB3A 4C6LA 1W2VA 2PTDA 2W63A 4JFSA 1ZAIA 1I1WA 2GZXA 3E5BA 2FFCA 4JIIX 4GY7A 2Q8LA 3O3RA 1UMLA 1M65A 2E8ZA 1CLKA 4GD0A 5AC7A 4CD8A 4IIDA 1T7LA 1PX8A 4KWVA 3AHTA 2QVHA 3TMLA 3FJNA 1DXFA 2TAAA 4WY0F 3OQEA 1X8FA 2CHNA 1PO9A 4F8XA 3VK5A 5I78A 4C65A 3QW3A 4NI8A 4ZB5A 4XSMA 2QCNA 3LHVA 2CLOA 1E4MM 5EKYA 2BSLA 2ZZ2A 4N9DA 4JHOA 3NFUA 4K1GA 4JTFA 4H4IA 3I7RA 2WZMA 2WM1A 4H8NA 3MUY1 1AMKA 4AEFA 1TA3B 3GM8A 2XSXA 2Z00A 3S1XA 2OGJA 3EXRA 3MUZ1 2TRSA 3AOFA 2OLAA 4DO4A 2QCLA 1BLIA 1UR2A 3NEHA 3GXFA 1EC9A 1J2BA 4URIA 1DJYA 1FH7A 1HT6A 4Z2IA 4NNCA 3WD4A 1BYAA 1V3KA 3ABRA 3E0IA 3LTSA 2A7RA 5H2ZA 1LTDA 2C15A 4DZ5A 2ZE3A 2HCVA 4EAYA 3IK4A 3GDTA 1H49A 4OGZA 2PGFA 4PB5A 4PE8A 3PJXA 1K6WA 3LU2A 4JTAA 3SADA 4DUWA 1HKKA 4LS2A 1T5AA 2XVLA 4TVUA 3UQNA 1TRIA 3PBVA 1FX6A 3SURA 2F2KA 2BFGA 3TK7A 1NH6A 4E2OA 3RX4A 1TMLA 1M7JA 4G7EA 1E72M 1TZ7A 3RFAA 5A6SA 2C3ZA 5CAKA 1DWHM 3WMSA 4QDWA 3C86A 2HBVA 3LLFA 3WLMA 1W1TA 5LGZA 3ARRA 1KRBC 1TVPA 2WHMA 1YIXA 4QQUA 3A23A 1E70M 3E5PA 4B92A 5EMUA 3AZTA 3NAVA 3C3NA 2LLEA 3VOIA 2GGHA 1TIMA 4FOKA 3U7BA 1LLWA 1UWTA 2WNQA 4ZENA 3MPGA 1QBAA 3E38A 3WY1A 5E6ZA 1UR4A 1GOWA 1QMLA 4LUTB 3L21A 1TPVA 5REQA 3WDHA 1JCXA 2H8ZA 3W1LA 5IXEA 1W3TA 4U4MA 2PDNA 1HUVA 1FWBC 4S3GA 3I4KA 2UY2A 4AZ5A 2C91A 3WN6A 3IGSA 3TU9A 5D33A 4IP4A 1EPVA 4NZ3A 4MUPA 3G18A 3NXLA 3HJZA 4IT1A 2Z29A 2WZIA 4HYRA 1KBBA 2PDYA 3PPFA 1EHAA 1Q66A 2PDIA 2FJKA 2FH8A 4L4LA 3QMSA 7ENLA 1VEMA 2VDIA 1QI3A 1YBQB 3ME3A 2W79A 3N25A 3SIZA 3WQVA 2VDGA 1V6XA 3KTXA 2P3EA 4WR3A 1YKWA 2VC6A 1B0IA 1XBYA 2WKJA 1UD2A 4HNUA 4XZ9A 4D6JA 3P14A 3AIBA 2XZ7A 3SQMA 2QPUA 3SECA 5HATA 4AF0A 1IWPA 2O4MA 3T9PA 1EP1A 2Y5SA 5HQMA 1JZ3A 2OZ8A 2R1MA 1CLVA 2JBMA 3MSRA 3CAKA 3FEMA 3C52A 3FA5A 4A35A 4ZCWA 3HA1A 4M6VA 5BU9A 1K7FA 1LQ0A 4LV9A 2VNCA 1RPKA 4JQ3A 1CLXA 1LUCB 1F6PA 3GVGA 2ZCGA 3BAKA 3OZMA 1YDOA 1RZMA 4UR8A 1ZY9A 2Y88A 3DFPA 5LIWX 4GQRA 3UXLA 3QSRA 4QQ3A 4QDMA 3DG7A 4ERIA 4Z1AA 1EGZA 4MLRA 3LA4A 3W2MA 2EPOA 3TN6A 3WNLA 3GBDA 2Y6ZA 4HPNA 6PTDA 3HM7A 1BYDA 3PWGA 2PAJA 3TYAA 1ZRQA 4X22A 3GHSA 4LYKA 4C60A 4NKCA 2FH6A 4TX6A 3VCCA 1NARA 4D1JA 1LP6A 4J3XA 1CDGA 4BF5A 3EWDA 3WQOA 5HXMA 3HG2A 2XVKA 1ZGDA 2RDUA 2YB1A 3V0SA 3UR2A 2DT0A 3E3HA 4LXFA 5DXXA 1L8PA 1YXCA 2D3NA 2XU2A 1ZNNA 1M01A 3FA4A 2WQPA 2V3DA 4YWIA 3TW9A 4PUDA 4HOXA 1D3GA 2PDQA 4IUOA 4NJJA 3TP4A 1K02A 2Z1VA 5D2XA 1H61A 3NR0A 2YDRA 3T2PA 3KBSA 3VOFA 5JU6A 3VAVA 5HWMA 3WDJA 3BOLA 4CU6A 4BJHA 2Z26A 3AWNA 3EPOA 1BSLA 3LLDA 2D2OA 2VEMA 3TZFA 3JUGA 1TMQA 1WUEA 4IXHA 2R1LA 4XWUA 1C91A 2GGIA 2VURA 4NYYA 2TYSA 1EX1A 4E2DA 3LHZA 4M1BA 1WKEA 4WX2A 3RG6A 3MTWA 3BUVA 4MVAA 1J10A 2WVTA 3E2VA 1Y65A 1IWBA 1NM9A 4V1XA 3SUVA 4LUYA 1B31A 3NZRA 3C5QA 1NDWA 1SFTA 1XG3A 2ZDRA 1QVBA 5E70A 3WQWA 4BEQA 5ENLA 2O55A 4QJ3B 3CL8A 5ABGA 3HQNA 2J9XA 4RE3A 4QJ4B 3SCRA 3A4JA 2CLIA 3P0XA 3TCEA 4UFJA 3R5EA 1SFSA 4XKMA 4EACA 3UWWA 1I1XA 2W6RA 1XI3A 2JALA 4AVNA 4ZEPA 1IEQA 4UTJA 2DZWA 4IQDA 4ORMA 4Q8MA 3W2KA 5FAJA 1OX5A 3VKAA 5GVJA 1Q65A 4PTXA 2PWVA 1XL9A 3GFYA 2X1UA 3SJ3A 3W2UA 4PULA 1KXQA 1XRVA 2KZHA 3I3BA 2YA1A 3S2CA 3BPWA 1LDCA 1TZZA 3KE0A 3U6WA 2DT3A 3Q37A 4NXKA 1BG9A 1OFRA 3RMJA 3SY8A 1RSCA 1ZBWA 5H6HA 4ZTXA 3K46A 3G0UA 4JTLA 1BHGA 2CYGA 1NOFA 3NQDA 4RLIA 2D3LA 3AXKA 4NT0A 4U3AA 1JDAA 5KZEA 2NX1A 5BRPA 4BI6A 3IACA 1S3TC 1QCWA 4YS1A 1VPXA 4GYFA 2EJAA 2WC7A 5D03A 3NO1A 3VNIA 3DFNA 3LG3A 4S23A 4XAYA 6REQA 4G1KA 4AWSA 3NL2A 4Q33A 3T0AA 2OWCA 1LOSA 3BGGA 3KBJA 4ZQPA 2EJ1A 3CHVA 4TO8A 3VD4A 3IK2A 4C6KA 2G5WA 1KTCA 1E6SM 2YL6A 4W8LA 3IIPA 1BYBA 3LPFA 4EK7A 3KFTA 4M6UA 8CGTA 3AU2A 2WOQA 3B0XA 4L9YA 4FHAA 4A8RA 5M2FX 1B2YA 1GVFA 2OVLA 1WOAA 3MCMA 1HKWA 3SB0A 5C70A 4IISA 7ODCA 4QLKA 3ZSSA 4PODA 3GTHA 3AROA 3MJMA 1SR9A 3D3AA 4H9YA 4XSLA 3WIJA 4JKLA 4G7FA 2I9UA 4JS3A 4A8LA 1ISZA 2P3ZA 3QV7A 1UUQA 4K7YA 3B9EA 1R9YA 1ADOA 3NZGA 2QUUA 3K4DA 3VVGA 5MF5A 1H7OA 4JY9A 2G96A 2F61A 3NZPA 3GUGA 4AYGA 1E3ZA 4J7RA 1E6PA 3MMUA 1X6NA 4S38A 4L4PA 3TJXA 1EJ7L 1ZHAA 5LNVA 1TB3A 1FWEC 1B4KA 2HK0A 4GUJA 3S1GA 1D2KA 1Z6KA 1PKYA 1BWKA 1K9TA 1S5TA 2BXVA 1Y5WA 3E0FA 2DVXA 4ROQA 2O56A 2F9RA 3CL7A 5EPDA 1HTIA 1LWHA 2FZ8A 2TMDA 1XLDA 2UV8G 3WLJA 3OBAA 2PRLA 2E40A 4FOJA 2WMKA 5DMMA 3E12A 1KV5A 4QTGA 2FVMA 2DVTA 3M0JA 1MXDA 3THUA 4S3KA 1WDQA 2RH9A 3P93A 4F9DA 1NAL1 1EBHA 4IX2A 4BFAA 2HDJA 4I5RA 4GQGA 1FWHC 3QSTA 3EDFA 4FXRA 5J8LA 4HQVA 2REQA 4DO7A 3EAUA 4AZIA 3KRZA 4IL2A 3RK8A 4HNVA 4IIBA 1D8WA 2CLPA 4O1CA 3AMDA 2P0IA 3NOEA 1E6ZA 2OU4A 4R7JA 3P6LA 1LT8A 1GW9A 3XIMA 5IOBA 1E4NA 3W00A 2E09A 2J4GA 4O13A 5D4YA 1OF8A 4W9TA 4REQA 1OYBA 1A5LC 2G3IA 4B9YA 5LKYA 1OC7A 4XD4A 1DJWA 1F9CA 4WIWA 1DE6A 3PTQA 3G0XA 2ZX5A 1GQLA 4XBSA 2CHRA 3JR2A 4XZWA 3GW0A 4PBEA 1HKIA 4S3FA 4ZBCA 4EPDC 4QE5A 3MHUA 3EOEA 4AHOA 5CC6A 1AK5A 2JF7A 3VGGA 4AZCA 1JULA 1RBAA 2WMJA 4LFYA 4PMOA 5MKGA 2X05A 1QPRA 1G4EA 2VELA 1GVIA 3G1AA 3L4YA 1V4YA 2FZNA 1DWFM 3BCDA 4GABA 4KEVA 2H3BA 2QZRA 2XIOA 3DG3A 3QR3A 1FDJA 2BTMA 4GO8A 2AL1A 3VNYA 1I0DA 2HS6A 3A4WA 2YR1A 4MY1A 1LYXA 2V3EA 2Y89A 1V6WA 2PLCA 3H4GA 4DO5A 2E68A 3STGA 1M5WA 1A0CA 4YTTA 1SJDA 4IG2A 2ZUWA 5H8UA 4Z2GA 3ZSTA 4AY1A 4IMDA 3EX3A 4Y9AA 1UZDA 2G3JA 4HU0A 5CC5A 4MTVA 4B5SA 5AC4A 4Q8QA 1O94A 5E9XA 3KBWA 1B90A 3ZIZA 1E9YB 2BY1A 5KTLA 5IRPA 3UXAA 5AHLA 2HWGA 1FWAC 4P8UA 3BV7A 3T55A 1XH1A 1KBKA 3DERA 3T44A 1DOSA 4F79A 3UVIA 3R43A 3WLOA 4A21A 2PURA 2Z1WA 3DC0A 1BEUA 3E0LA 5CPOA 1ZCCA 4D6EA 5A8PA 4UTTC 4AZ6A 5HQLA 3LHWA 3IIVA 5DMYA 3NSXA 1UR1A 4H7ZA 2ZUVA 3VZYA 4PUEA 5KMYA 1B3XA 3LV5A 3OPSA 3EZ4A 3IUIA 3PN8A 2DY3A 4TV6A 4Z1YA 4CQBA 1ZBKA 2D0HA 2OLSA 1EOMA 1AD1A 1XLGA 1L6FA 4W88A 1EGVA 3M5YA 5DX7A 3M1ZA 3KOYA 3BLOA 3CAWA 7CGTA 3TYDA 1O5XA 5GJPA 5HJXA 1A5MC 1GVQA 2GVJA 4JAWA 3K4AA 4FXFA 1GOOA 4KERA 3Q65A 3PJTA 4GI4A 1C7SA 1XHGA 3QZ6A 4P61A 1XBXA 4PTVA 4U5KA 1J6PA 1ZL1A 3KVMA 3S1VA 3U57A 1FHLA 3BSMA 3N6QA 1MUCA 1EDQA 3BCJA 4R33A 4B5NA 3QBUA 5FJOA 1O4UA 5DY2A 2QJIA 1C8QA 3IGUA 2PC4A 1TZ9A 2CC0A 3GK0A 3K8MA 3A4XA 3W23A 2VZTA 3MKKA 1OYAA 5LIYX 2HSAA 1S5VA 3GAKA 1N2VA 2EPLX 4L61A 2YDSA 4UFHA 4S3EA 3S8HA 3GNNA 5AKQA 2D2GA 3VNDA 3M07A 4LH8A 2GK1A 3WQEA 3K13A 4UTWA 3WNMA 1V8EA 3EA3A 4JHMA 1W17A 1VRXA 1F8IA 1PAMA 1Q7MA 1FWDC 3TFCA 2ZZ4A 4FXSA 4JY8A 1RQEA 1FWWA 3GR7A 1Q85A 3RX3A 1EA0A 1KXHA 4X3ZA 1V0KA 3QY7A 1DQXA 3S2LA 3UGVA 1QO5A 3VCRA 4FOUA 4UMCA 2XFRA 1TFVA 4Y7EA 1RY8A 3BLKA 1PKLA 1XYBA 2JE8A 5AECA 3BURA 5EA9A 3LMZA 5IHSA 2DH2A 4MJ2A 4DWSB 1V6TA 4V1YA 2CXEA 2BY0A 4HA4A 3LYEA 1I4NA 2BOGX 1J2WA 4W5UA 4IIHA 3L0GA 4XUGA 4NZJA 1MNSA 3VE7A 1AH4A 3DFYA 4NZ4A 4AD3A 1BQCA 4FAMA 4GIRA 1T0OA 3PAJA 1VYSX 4Z2LA 3M7SA 5EMYA 3APGA 5JBEA 3H12A 4K1WA 3KL3A 4DF0A 4MY8A 3MANA 2V2CA 2HE8A 1UROA 4D6CA 2V5JA 3L23A 5D9OA 3H6OA 3SFKA 4H3DA 2ZZ3A 5A6BD 3W70A 5BRBA 2I14A 3DI1A 2J78A 2Z1KA 3MZ2A 2YB4A 4DLMA 1ALDA 3MV11 4LW7A 3UA4A 2AL2B 1E6QM 3U3HA 4DWSC 1V3JA 4IQEA 1KGXA 4YTUA 3RUBL 1LROA 3S4TA 4N6EA 2WLZA 5CPSA 3MB9A 4IGMA 4G5DA 3W7GA 1PVNA 4P7RA 2E9LA 4B5UA 5I3GA 4L9ZA 7PTDA 3SO7A 2WVVB 4LVAA 3BV4A 1KM2A 1IR2A 4NHVA 4US6A 2OCZA 1A5NC 4NXSA 3EX6A 1RA0A 1JCMP 3CNYA 1LUCA 4PUKA 3A3HA 3GO2A 2VMFA 2OOFA 1KRMA 1P1MA 5PTDA 1H11A 1K9EA 1JUBA 3H55A 4E4PA 1BVNP 2ZXBA 1AG1O 3ARXA 1DJNA 3CYJA 3I3DA 3UETA 4PTDA 4DF2A 3DZ1A 2XN0A 3PP7A 4CCEA 3HQ1A 3MO7A 4UTUA 2OO6A 1MNZA 4JPGA 4US5D 3SAZA 3NXFA 5AVHA 1F73A 1RP9A 4PRWA 4E6MA 2NUYA 3VI2A 4IL0A 3HGJA 4O12A 4Z2HA 4PL1A 5HWNA 1EDTA 2ACRA 3OG3A 3B9NA 2A3LA 3N2BA 2VX4A 2PLKA 1IZJA 1SUXA 4GACA 1NWTA 3USZA 3U0HA 4ACZB 3WQ8A 4XZIA 2NX3A 2DGAA 1FWRA 1A0EA 2E9BA 3N29A 1YXDA 1DIKA 3PBYA 4DWDA 3N6HA 1W6TA 3H21A 1OGBA 1RBLA 3NEVA 1BQGA 3EXSA 1X1OA 2X40A 4GCAA 2NVCA 1XINA 2BVYA 3TTYA 2G4JA 1P7TB 3SGGA 3GRIA 2E6YA 4TVDA 3NQFA 4ZQCA 4CNOA 4ZB0A 3HOJA 4XV0A 1O7AA 3FVMA 4JCMA 4QR6A 1RV8A 1WXZA 1N55A 3L4UA 4NRSA 1VP5A 3ZT7A 3VUPA 3S6OA 4DZHA 2GUYA 1IEWA 3MC5A 1MWOA 3PM6A 5FACA 2EHHA 4XAFA 1WQ5A 3VIJA 2QUMA 3R12A 1JF5A 1GHSA 4Q4SA 3VDCA 3GD6A 2QJNA 4FPSA 2OODA 3A21A 2Y5JA 4MAVA 4JNYA 2WJEA 2IQTA 4GI9A 3EMZA 4PL2A 3SRDA 1EP3A 3W7PA 3PZIA 3TDFA 4LEQA 1YE4A 1Y8BA 3MKCA 4AG0A 3CIXA 4HOZA 5F4WA 4WDWA 1AQ0A 2MUCA 1MRAA 1PEZA 2YGYA 4ML9A 4MZ1A 2VQTA 4DLFA 1KNWA 2AQVA 3GXDA 1XQKA 2D69A 3V1PA 5GPRA 4H7VA 4PRTA 5BMXA 5H8PA 2CZDA 3LNPA 2PLJA 1VIWA 3CZKA 1H63A 3BAWA 2BY2A 3FYPA 3ZZ1A 2QYGA 1G01A 3UY8A 4FZIA 4F0MA 1Q45A 4O28A 2Y63A 3DHDA 4F0RA 3HPZA 1T8XA 3D46A 1EJXC 1RJPA 1CB2A 4LEFA 3EOOA 4JFUA 1MQPA 1NWRA 1K8ZA 1E56A 1WDWA 5CAHA 4KCVA 4K6AA 3P2VA 3WFAA 3LRKA 1XISA 3IGXA 2VRQA 1MW1A 5FL1A 5M1TA 4GZIA 2QT3A 2VR5A 5FF2A 3R2GA 4JTIA 1L6YA 4JTKA 3TROA 5KZMA 3LI1A 3OGVA 4CU8A 3CWNA 3URBA 4FMVA 3HFTA 5BRQA 3VGEA 4UOZA 1Q7QA 1VFLA 2FLIA 3A47A 2Z4GA 4P7NA 3NYZA 1H41A 4LAUA 2CWXA 2IMRA 4M6PA 4S1FA 3QMRA 4GYPC 4BF9A 1F76A 2SFPA 1T41A 3GDRA 3VKKA 1TPH1 4W8AA 2PCQA 2WCGA 4LC8A 2PWUA 3F2CA 4R5EA 4KBXA 1R5YA 4JTGA 4LF2A 3E96A 3OYXA 4JFWA 1GTHA 1TREA 4GC3A 4A3HA 4N42A 3WNOA 3FY1A 3AALA 3S2NA 4MJ4A 2WO5A 1JPIA 3AXIA 5C2GA 4X2PA 4JCLA 4A2SA 3H2NA 1ML1A 4HU3A 1PL9A 3RLVA 1TSIA 2QUTA 3H2CA 5JBDA 3NQCA 1R8LA 3NDYA 4NAEB 1LT7A 1XW8A 4OKDA 1FVPA 5BZAA 2ISFA 1UJQA 5RUBA 4OBTA 3LHTA 3CZLA 1AODA 1JF6A 3WMCA 1XLJA 1L2UA 5LHFA 3HMJG 1SM9A 3GB6A 3A9IA 2P10A 4FIQA 1V03A 4FNTA 1JJKA 1X98A 1CI1A 4CNUA 3HF3A 3BJTA 5KZDA 1JZ8A 4REQB 3GYCA 3CLMA 4C5ZA 3B3DA 1E71M 2I57A 4Z2KA 4A3YA 3DYOA 1QPOA 1JIBA 3HTWA 2BMBA 2E25A 2VVSA 1G6CA 2JK2A 4XUYA 1GT8A 3KAOA 3UERA 3BOFA 3VYLA 1LL7A 1NQ6A 2G8ZA 1FWGC 3GX9A 4JQ2A 3EOSA 3WLNA 4LYPA 3E0WA 2DW7A 1JI2A 3ARSA 2VCAA 4HHPA 1MDRA 1A5KC 4JTHA 3GBEA 3II1A 1R0MA 1RUSA 3VM7A 5AHMA 3LUTA 2DSUA 1F3EA 5LHEA 4MZYA 1R86A 5A6LA 1TR9A 3FGCB 2PGEA 1QJWA 4LV4A 4AD1A 1V6YA 2W92A 3U5YA 2Q8ZA 2WANA 3QQWA 3VOJA 1O66A 2J7DA 2A21A 3GU2A 1WKFA 1TPFA 1HW6A 4XO6A 4EX4A 3CJPA 4R7OA 2OFJA 1UQZA 3KWSA 3MYOA 9XIAA 3S46A 1LCOA 1TJRA 3PHAA 3WMBA 3W1NA 4NL1A 3VX1A 1PKMA 7REQA 1JCJA 4TX9A 5G2HA 3TOYA 3PPGA 5DEZA 3DIPA 4BZYA 1M04A 3HURA 1K4GA 1BXCA 1QXLA 2AMGA 2A6LA 4H9MA 4P7QA 1GNXA 4XZNX 5DCDA 1X7FA 5AHEA 1IZCA 2P8CA 1UZHA 1DJIA 2PWDA 1X38A 5AYBA 1A4LA 4I6VA 1FWJC 1XLMA 4XZMX 1G4PA 2PD9A 3W7LA 4XIMA 4CD4A 3CHDA 2HVMA 4ZO6A 4UWMA 1YBQA 1EEXA 3COTA 4HCDA 3TQ0A 3HG3A 4R88A 1O5QA 3PBMA 4B4HA 3GR8A 2PRMA 1XLLA 1B9BA 3EEZA 3E9AA 3WBWA 1O60A 1HP4A 4PC8A 3BZJA 1XYMA 3NG3A 4AWUA 2X0YA 3U2ZA 4HSNA 2D2JA 3U8GA 3W1QA 1JR1A 1KR1A 5HMEA 2DSVA 4R85A 6TIMA 4MKSA 4B90A 8RUCA 4RE2A 1M1BA 3BJFA 3PUGA 3PC0A 2NVDA 1PE1A 2ZRYA 1B3YA 4K7VA 3FV9A 4AU0A 4QCFA 2DJLA 4D8AA 1W9XA 3DC8A 2QCCA 1XIHA 7XIMA 1QT1A 1SZRA 4ZOCA 4B15A 2VGIA 3RMEA 4AIOA 4JTCA 1K4HA 3EPNA 1YXYA 4RXGA 5A2BA 4MWAB 2O9PA 1J0JA 3ZJKA 4NIRA 4E5TA 2PDWA 5C9ZA 1GOIA 1TO3A 3ABOA 2GSEA 4UNKA 1EC8A 1C29A 5GNZA 1K70A 3OVQA 3EWUA 5D37A 3C2OA 1NWSA 3PTMA 3RM8A 1LBLA 1XLIA 2QS8A 4DM2A 4B3LA 1CCWB 1OCNA 1EP2A 1DJGA 4W93A 1T6MA 1J9YA 3KVKA 3OU8A 3W82A 3UJEA 3M0KA 4DWSD 4I9AA 4MZ8A 1IXNA 4PTNA 3RCNA 2QCDA 1AW2A 2YX0A 1A80A 3KRUA 4ATLA 3RPDA 3OZPA 1JAKA 3RR1A 3F2DA 5A95A 2YCIX 3HJEA 4N9EA 1J0IA 3BW4A 3W26A 2GJLA 1EZWA 3ZWTA 4FX8A 1D9EA 4EWND 3B97A 5CC3A 1E4LA 1CGWA 3BGJA 1UD4A 1OFQA 1LL4A 3KS5A 1J0HA 3UZ5A 1H7RA 1HP5A 3PUEA 1KBJA 2DQXA 3FKKA 3PG8A 3WX7A 1BKSA 2DZXA 2B4GA 1JYXA 3B8DA 3ZVHB 2WSPA 3UJRA 1UKOA 1KGWA 1XSKA 1OT2A 4YCPA 1VJZA 1J79A 2P8BA 3FFSA 3NTYA 3CUJA 2BV9A 4J2MA 3SN0A 2D22A 3W7OA 3WH7A 1VD6A 1ZJBA 2Y5EA 3LXAA 1TJPA 1RCQA 3W85A 3V0TA 4PSPA 3FYOA 3ARTA 3UWVA 1ZQ5A 3SCQA 3CQHA 1VBGA 2CLLA 3CQKA 3KP1A 4HPGA 4HGXA 3EXTA 1PHWA 2VC7A 4NAFB 4YN5A 3H24A 3LHYA 2H9AA 4ES4A 3GU9A 4W5ZA 1JZ5A 4Q8VA 4GI8A 3AIUA 3DOPA 4PUJA 2R8WA 4TIMA 3DU0A 1R3WA 3SIMA 1BXNA 3U2CA 3ABQA 1QWGA 4WQ6A 3FJ4A 3G0SA 6ENLA 3N1AA 1B4EA 2ICSA 1OCQA 1EF2A 3BW2A 3CUHA 1FBAA 3GKAA 4ADSA 3EWCA 4MFEA 4DJDC 5AFDA 4J3UA 4RW3A 1Z3NA 3T2OA 4L65A 2F7FA 2C79A 2DZPA 3KTCA 4KWSA 3ZLFA 2KAUC 4PMQA 3GG0A 1N8FA 5AB3A 1O68A 3VD9A 1ISYA 5AZ0A 2HEJA 3IIXA 4XD5A 1SZFA 4ATDA 5LA2A 2DT1A 3OBKA 4HMEA 2X16A 2JKAA 2AQOA 4GO9A 2FIQA 1VEPA 2Y7DA 4UCFA 1VQTA 4HSHA 3QJAA 3UA3A 4EKJA 3PZNA 3P61A 1HVQA 2YBVA 1VLWA 1XCXA 1YDNA 1P0NA 2P50A 3GE7A 1XYFA 4O10A 4CKQA 1BD0A 3WH8A 4V2XA 4CVWA 1ZJIA 4WEVX 1PX3A 1FFRA 4MWAC 1MI3A 3B8TA 3VFCA 2B7OA 5FA5A 3TIMA 5KETA 3C2RA 4AYSA 4IICA 2CKSA 3T8QA 3ITTA 2I5QA 1CYGA 3TYZA 1KM5A 2WMHA 4QCEA 3ZYZA 1IIGA 4GYJA 2TODA 4IP5A 5AHFA 3SY1A 2C13A 4D9PA 1LLOA 4PA8A 3P8IA 5CPLA 3TC7A 4ADTA 3EKGA 3BQ5A 1XS2A 7TIMA 1EWDA 4CD7A 3BW3A 4J28A 3GH5A 4PB3A 5HPCA 1XICA 2WJDA 4JBRA 3I3EA 2FGZA 4F66A 3O2LA 2ZTKA 4N2YA 4I90A 2IKJA 4WXZA 3NQEA 4IP7A 4MGGA 4QFUA 4WSHA 1NFBA 4NJKA 1XCFA 4LB3A 3EWYA 4QG8A 1XGDA 4UTTA 3WK0A 1TTJA 3LCLA 1EIXA 1U1UA 3ALGA 4UZUA 4UZSA 3GDKA 4L6HA 5CSYA 1GONA 1Z8AA 3J7HA 4JFVA 2VYOA 4IF2A 5DT7A 4OQVA 1R3SA 1A3XA 5AY7A 5REQB 3WF2A 1JXJA 3PBGA 1AFSA 1DBTA 4QDPA 2FTWA 3RM4A 1YE6A 4IFRA 1XX1A 1R87A 2V5KA 1K8YA 3APYA 3NQVA 2FHBA 2F6XA 2NQHA 4XVEA 2DUAA 4PCFA 1VHCA 3E02A 4JIHA 2EG8A 3M9YA 1P1XA 3S5NA 3UWYA 2WZHA 3S47A 3UPWA 1JGIA 1KM0A 2B7PA 1RLDA 2E5BA 2Y7GA 5DF0A 5JXQA 3ARQA 1W1PA 3CB3A 4B4FA 3QLLA 1KWGA 1XDMA 3GG1A 5I02A 1Q2RA 5AHNA 1YW1A 4GNKB 2ZUMA 2B31A 3N9KA 4QISA 3EWBX 1EYEA 4FNSA 3TYCA 2CNCA 2WHJA 4ICMA 4I6KA 1BG4A 2V68A 4J4KA 1TWZA 1DHPA 2Y8KA 7A3HA 3BC9A 4AX6A 1PZ0A 2PTXA 1GORA 3STPA 1YQ2A 1DJZA 4EANA 3ABZA 4NAFA 4HMNA 1OCJA 2P0OA 3TEVA 1MDLA 3T4WA 2VFHA 3H4WA 2CLMA 1ZSXA 4HN8A 3LZ5A 1RD5A 2O92A 3PSVA 2HQAA 4DEFA 4FLSA 1HF6A 1CGUA 5T91A 1FHUA 3NWRA 2XGIA 5I0DA 4HZ7A 4YVVA 4DXKA 3AU6A 5A3HA 5CZKA 2JKEA 2FVLA 4HA0A 1XIBA 3RJXA 3WJSA 1QK0A 1G94A 4QEHA 3ICJA 4PSRA 3N6JA 4JNZA 1UIOA 1KTBA 3R8GA 3W0KA 1UKTA 3IV8A 3G1XA 3KP0A 2WZTA 1HG3A 3BLDA 3VOHA 3OVPA 2XSAA 1XG4A 1PCKA 4TX8A 1QW7A 1CGTA 1MXGA 2Z25A 1JD7A 1YHTA 1XKJA 4PMJA 1B3VA 1W8GA 3L2LA 1AMYA 4FEZA 1JRCA 4I5UA 1HKJA 5FF3A 4U31A 2PDGA 3K5XA 1UWAA 5FEZA 4B5XA 5D9NA 3W86A 5FJJA 4PYSA 5EFDA 1J18A 3DG6A 1W0MA 1XBVA 1Y0EA 5A2CA 2C0HA 4AVFA 3DHFA 3IAPA 1LL6A 1GJWA 3BG3A 3VCNA 4KH2A 3T78A 3MP3A 4WK9A 4PCPA 4NYUA 1XBZA 1JPMA 4Q8PA 3W7HA 4AWEA 2YOCA 1ME7A 2DPEA 4HK6A 2R91A 4DNHA 4ZE4A 2DZUA 1TWDA 3LQLA 4GIEA 3QR0A 5HNTA 5E1QA 1HJQA 2PA6A 1SGJA 4ZSTA 1EGMA 3WEOA 1REQA 2FKPA 2E67A 2X7VA 3VGBA 3ZT5A 1XRSA 2AMXA 3G1DA 3WD0A 3RXZA 3T8LA 2W67A 3K1GA 1L6WA 4PB4A 2WXDM 1E15A 4LBUA 3WCZA 3RX2A 3E2RA 2YBTA 3CAVA 1IEXA 1QI5A 4R7WA 4AZHA 1BGAA 4GOAA 2OQLA 4F0HA 3WFZA 3LOTA 3GVQA 2YCLB 1KWKA 1A49A 1V7YA 1XH2A 3W7RA 2VWSA 4MNLA 4JKMA 1OG6A 3GXIA 3O63A 4IGNA 4DY1A 3QY8A 4EAMA 1OG0A 3IJ6A 3OHMB 5K4ZA 4PFHA 1IV8A 4DJDA 1TIWA 5CSRA 5I3FA 1UWQA 2VJXA 4NASA 4PMYA 1JRBA 3P3BA 2VEPA 4HHMA 5EMMA 5C7VA 4XD6A 1W1ZA 4EPKA 3HN3A 2EPHA 2OQYA 2GL5A 4QX4A 4G7EB 3W07A 2PB1A 1AQHA 4YHEA 5GJMA 1W54A 5A69A 4GUIA 3EOLA 3TTQA 4ZA0A 1WDDA 2INZA 3URQA 9XIMA 1V3IA 3PG9A 5IM51 2CLFA 2FHFA 3TSDA 2VFFA 3APTA 4WRHA 4YTSA 3GVRA 2CW6A 4V33A 1S2AA 1EHNA 4C1KA 3PSWA 3I7QA 4MJZA 2VRKA 4AEOA 2QIIA 1KCZA 3UJFA 3R89A 2YXXA 3DBPA 1QW8A 3M6YA 2WWCA 4X61A 1JYWA 4HKPA 4DXXA 1LOLA 1MW0A 4HZ6A 3H8AA 5A6JA 3PR2A 2GPTA 4Q7BA 3MV01 2JEQA 1H7PA 4B2DD 4Q8OA 3A22A 3LERA 3ZJ7A 4RE4A 3RO8A 1KCKA 3HBLA 5EU9A 3LXCA 2OT1A 3VNLA 3VMNA 3W02A 3LN3A 2FPVA 3SW6A 5GNYA 3FDKA 2OZTA 3UYCA 4J9JA 4L80A 2J6XA 3TJIA 4V15A 4Q4MA 3IGHX 4LQ1A 4ATWA 2OR2A 2VEGA 3NNTA 4KPLA 1P4CA 2YBUA 1O5KA 1P6WA 4LUSB 1RJQA 3SGZA 1HX0A 4LYQA 4RZ4A 2NW0A 4D6GA 3GNPA 1UH3A 3P67A 4CD5A 5G1TA 4UQEA 3QV8A 3ERPA 2I5GA 4U33A 1S2TA 5FEPA 1GVRA 5A6MA 1RVKA 1NP0A 1R2TA 2OEJA 3SQLA 1EUNA 1FXPA 3S2JA 3CEPA 2BZNA 3OHIA 1IF2A 2W5FA 3MU7A 1UUMA 5BWAA 4GISA 3W2LA 5FF0A 2X2YA 4AC1X 5C5YA 3DENA 1BSIA 2WMGA 4FF5A 1OABA 4J3VA 2BXZA 4N9BA 1V5XA 1GJUA 2D23A 1E40A 3JRKA 4WJEA 1TKKA 4CQ8A 4BKNA 4UQCA 2OYMA 1PZ2A 3NQBA 1GQIA 3E1F1 1D3HA 1T40A 3ISIX 3QOMA 5JQ9A 3O6CA 3CPUA 1ADSA 2AL2A 1HGYA 2NT0A 4ZO8A 4IZGA 3KXQA 3FX4A 1CIUA 3HG5A 3G1HA 5HBFA 1VFSA 2J7EA 4RCXA 3GVVA 3VGFA 2J66A 1JNEA 1KLZA 4RDWA 4OOZA 4OT7A 3ANYA 1RD6A 1PX4A 6CGTA 2CCRA 1WKDA 2A2IA 2XTKA 2EEXA 5HUPA 4L4MA 4NQ1A 4HNLA 4ZZ9A 4DO6A 2X1TA 3L2IA 1E6RA 1REQB 4WOZA 3LTPA 3EPMA 4JGDA 1P5BA 1FA2A 3KL0A 4P8VA 4BF7A 1GPFA 3STEA 1EJVC 2CIPA 3IJIA 2HZGA 1HJUA 4NJIA 5DFAA 1UP0A 1OGSA 2BHUA 4FALA 1OFOA 3NSNA 3H54A 4LVDA 5CEWA 3EKLA 5C7HA 1VZWA 1FP8A 1H5YA 8A3HA 3VGHA 3QH2A 5BOOA 4QG9A 3S5OA 1VYRA 3S42A 4D6DA 2EG6A 3O07A 3SFWA 3T0BA 4D6FA 3HFYA 1PTDA 3KZSA 3GC5A 5B80A 3SUUA 3IJ8A 1QO2A 3CLWA 5FJUA 3I7SA 3UG3A 1WXYA 1E1CA 2NLIA 3GC4A 5CGMA 3KUMA 3WENA 1LRNA 3MW7A 2J8FA 4JEJA 3NCOA 4RW5A 3L4XA 2BS9A 3CGTA 2AKMA 3TXVA 4OUIA 4FO4A 1J0YA 2WNNA 2WSRA 3SCUA 3PWAA 3PFRA 3NURA 3SUWA 2PDFA 2OB3A 3M6DA 3WBYA 1KFWA 1UBSA 3WKZA 2CWNA 4AISA 4F0KA 3V1HA 1E73M 4ZTYA 2V5LA 3L68A 1F6KA 1HXJA 1DPMA 1Q6FA 2XFYA 2I5IA 3AMCA 1U22A 4RNFA 4A2RA 3VUSA 3KBMA 2E9MA 3G77A 4FX6M 3W53A 2J7CA 3V0UA 4PTWA 2AGKA 1JEZA 4JZ5A 4K38A 3GQYA 5BCAA 4YU1A 5JH1A 3RR4A 3HV8A 1WA3A