1LT9A

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9A00
2OYHA 1LWUA 1LTJA 1JY3P 2A45I 1LTJC 3BVHA 1N73B 2OYIA 2HLOA 1LWUC 3HUSA 1W2EA 3GHGA 1FZCA 1FZGA 1FZAA 1RF1A 2H43A 3HUSC 2Q9IA 1M1JB 1LT9A 1RE4A 1RF1C 2OYIC 3GHGC 1FZCC 2Z4EA 1FZFA 1RE4C 1LT9C 1RE3A 2A45H 3E1IA 1N73A 2HPCB 2FFDB 1RE3C 3H32B 2HODB 1N73C 1M1JA 1T3UA 1JY2N 1N86A 2OYHB 1M1JC 1LWUB 1LTJB 1JY3N 2OYHC 2FFDA 2HPCA 2XNXA 1FZBA 1JY2O 1RF0A 1FZEA 3H32A 3HUSB 2HODA 2OYIB 1RF1B 1FZCB 2FFDC 2A45G 1JY3O 3GHGB 1RF0C 1JY2P 1LT9B
chains in the Genus database with same CATH superfamily
1SQXG 2A45I 2NPSD 2M3BA 3M06A 4IL6H 3E7KA 1YIJP 1VQ6P 1BDDA 3W67A 1P84I 1T3UA 1S5LH 2QSIA 2OYIB 1Q7YQ 2XNDH 1KQLA 2JR8A 3IAOA 1NOHA 4B86A 1KILD 1BSNA 2BCCD 3CCUP 1LTIC 3R2PA 1KN7A 1K73Q 4DT0A 1EC5A 3H1LG 1S5LE 1IFMA 3H1ID 4PD4I 1FOSF 1SQVK 1USEA 2XV5A 4H44C 1N73B 2OYHC 2N1TC 1M7LA 3KDPB 4D6TD 3V2RA 3FGAD 1IK9A 1QEXA 3AEEC 4WWIA 3AE9C 1BGYD 3V2PA 4JQ0D 2IYPA 4WY4C 2R3CA 4BRYB 1LTJA 4LC1A 2Z5HA 3CWBG 4UB6H 5KLVG 3B5NA 1N7SA 4C7NB 1YTZI 1ZXGA 4WB4A 1FE6A 5BU5A 1YQ4C 2A45G 3P8CE 4N78D 1SLQA 1JTHB 1UIIA 4WVZA 3AE1C 3HUSA 5AVZB 2FYNC 3P7KA 2V7QJ 1Z56A 2K9YA 3UIAA 4XA4A 1R5LA 3E1IA 3TNUA 1Q81Q 4UB6E 4HYTB 2QVAA 2Y0CA 3GF7A 2W8ZA 2P67A 3BCCE 3L75J 5CCGC 3CI9A 2N9BA 2AEJA 1PGPA 1OIPA 1Q82Q 1YYCA 1KMIZ 2K9JA 1EDLA 2YIUC 1GL2D 1Y47A 3H32A 5KJ7A 3L73G 1KORA 2Q1KA 3TSIA 1PP9J 3L74E 2CPSA 4TLFA 4KT0J 4AQRD 3H1JG 1WT6A 5DJUB 2RKLA 2M0BA 2YO2A 1IO4A 1GD2E 1NTMG 2ZYGA 3ABVC 4U3FG 1NTZG 5APYA 2CPBA 2FYUG 1FZCB 2E75C 1SQPJ 1KYOH 2A06G 3PRJA 3HE4A 3P8MC 2FKWB 4K35A 3VN0A 1L0NJ 2O1KA 3AECC 3TGUG 2KUBA 2Z5IA 3HTKA 1YHQP 1SQXE 2IDBA 4I7ZB 1FZEA 2OYOA 2JJLA 1EZVI 1ZW0A 3HD7C 3MD0A 2NPSA 1GK6A 2E5TA 1KYOE 2E5YA 1ZV8A 3OAKA 4XFJA 3L75D 1JNMA 3CC7P 1GK4A 3RK3C 1KFNA 2YMYA 3A0HE 3HE5A 4JF7A 3L72G 3H1KJ 2L5GB 1USDA 3EFFK 1KILA 1T8ZA 3Q5RA 1LP1A 1H0TA 1PP9D 5AVRB 2R3SA 3H1LE 2XU6A 4Y99B 3PTZA 3USSA 3RK2C 2B9BA 1RF1B 3M0DC 2FXPA 2HFED 1SQPD 1CZQA 2KSJA 2KZJA 3SWYA 2ZT9B 1PPJD 1H89A 1M1JB 2A45H 2WPQA 2P7JA 5TISH 1JCCA 2H89C 1L0ND 2P2UA 4DJGA 1E5WA 5AVVB 1G1JA 1P84H 2IPPA 1L4AD 1RF0C 2HYNA 4Z1MH 3CWBE 4ZNCA 5APUA 5KLVE 1MV8A 2QM7A 2E42A 1IZNB 2WWWA 2AEFA 2C0WA 2K88A 1KB9I 2WSFH 5AW4B 1EZVG 1YBKA 2XNXA 1NU1G 3H1KD 1NTKE 4N6JA 1L0LJ 1P84E 1J1DB 1Y8AA 5CJ0A 4PD4H 4W7YA 4YXDC 1JMBA 5CCHD 3RK3E 3IFMA 1IFDA 4AYCA 1AV1A 1D7MA 1X8YA 3L73D 3KQGA 1OZHA 1PGJA 1BE3J 2KXPB 3VP8A 2OYHA 1EXIA 2N1TA 1E79H 1JMMA 1DH3A 2Q3IA 4EDFA 2M3EA 1DEEG 2OTJP 4PD4E 4WBAA 1LT1A 2NRGA 1GL2A 2POHA 3RL0B 3G4SP 3AE8C 4IOIH 1S5LX 1KV4A 4YTPC 3MUDC 3H1JE 3RBXA 1J1EB 2KLUA 3SWFA 1NTME 1AQ5A 1NTZE 5AVYB 1RE3C 3RL0g 3CL3D 2FYUE 2A06E 2WSSH 2E74D 3T97B 4HB1A 1LT9B 1AQTA 1NAFA 4C7RA 3FX0A 1GZLA 1L0LD 4EIJA 1IC2A 2WPVB 4OGQC 1HGVA 3ZDMA 1VQLP 1URQB 4GIFA 1W2BO 1SP4A 3WUVA 1BE3D 1QL1A 4H0LB 5CCGA 3SSUA 1YQ3C 1SQPK 4ASWA 2OYIC 1BCCG 3L72E 2QG4A 2QJYB 3CMEP 1N7SD 1SQQJ 1L0NK 1FDOA 3WUUA 4M3LA 3A0BH 5AVUB 2KYVA 4GOEA 3OJAB 2XKMA 2E76B 4HH2A 1UIXA 3CX5I 1HBWA 1N73C 3Q5PA 1YJWP 1NHLA 3GHGB 2OARA 2Q7CA 4ZKPA 1QVGO 3LIEA 3WMM0 3A0BE 1NKZB 2QJPB 4HKZH 3AE6C 1S9KD 1SQVE 1X22A 2PGDA 2GUSA 4NPDA 3CD6P 5KJ7D 3NTNA 1Q86Q 3PH0A 4C46A 3CCVP 1K8AQ 5AW8B 1EZVE 1NU1E 1ZRTD 2W27A 1IK7A 1LTJB 1HF9A 1U57A 1SQQD 2C9LY 2I1JA 2Q6QA 3B5NB 3L71J 1JO5A 1S3JA 2WPRA 1M56D 2IBZE 3KYQA 3L70G 1YTZT 3S1KA 4PV1D 1N7LA 3M0DA 1FS0E 3HUSB 2KNCA 1VQNP 3AEFC 1JY2P 1MFTA 1X9VA 3TNUB 2D2CD 1SQBG 1L0LK 3AEGC 1RE4C 3MTUE 1AA0A 1VQMP 3BASA 5CHXA 4MN4C 1JCDA 3M9HA 4IFMA 1AVYA 1RF0A 1KB9H 2WTYA 3BCCJ 1QVFO 2G3AA 2K9JB 5KLIB 3V2QA 2RMZA 2QEXP 2W83C 3CCEP 5GTIH 2B89A 1VQPP 1DD3A 3CCLP 3FWNA 3V2NA 2WSEH 1KB9E 3L74J 2HR3A 2ZXXA 3CLQA 3L71D 4I7ZC 2OQQA 3V5BA 1SFCB 1FZFA 2PFXA 1RY3A 3IN6A 5GTIE 2GA1A 3P8CD 5DJTB 1BCCE 2Q9IA 1LJ2A 2KSEA 3HTKB 3TK1A 4PJ0H 1J2JB 1SQXJ 4DZOA 2NPSB 3CCQP 4Y99C 2IX7C 1VQ5P 3BCCD 1RF1C 3HE5B 1NTKG 1VF5C 2ITAA 2ZT9C 4PJ0E 2FXMA 1KILB 1M1JC 1LP1B 3O6QA 2PRRA 2Y9YA 1H0TB 3M9BA 1SQQK 2WQYC 1JEKA 3CCRP 3CC4P 1NO4A 4H44D 2N1TD 3L74D 3AE3C 2BEZF 3H1LJ 4DCKA 2DW3A 3M91A 2O3JA 1X0TA 5M1BA 4IFFA 1NH4A 4W7ZA 4AUWA 2M5AA 2Y0EA 2I1KA 4WY4D 2QJKC 1WRGA 3BRVB 2OYIA 2JWAA 4L75A 2O01H 1HH0A 2P58A 1J1DC 1W5CE 3BRTB 5E79H 1HJBA 1A02J 1AJYA 2WITA 2MJZA 3A5TA 4UB8E 1SQXD 3SFEC 3W68A 3CWBJ 5KLVJ 2CK3H 1Y9BA 1KQFB 1JY3P 1ZLLA 3L70E 1KYOD 3CXHE 1VF5D 2LXBA 1KQGB 3GF3A 3EFGA 1N73A 3A0HH 2N9YB 2AXTH 2H8PD 5E79E 1JY2O 1PGOA 2YNYA 3CX5E 1SQBE 1GW4A 4KJMA 3RL0C 3BVHA 1LTBC 5CCGD 2WT7A 4CPGA 4BRYA 3G9RA 1N2DC 1J1EC 4I1LA 3H1LD 2OYHB 3U1AA 1U7JA 3AEAC 2J59M 3ITKA 2WSFJ 3L35A 2AXTE 3SFDC 2IBZI 1DEBA 3AEDC 3HRNA 1EDJA 2RN0A 2R44A 1GL2B 2OTLP 1JTHA 5AW9B 1LT9C 2WZ7A 1FOSE 3H1HG 3L73J 2JP3A 3D6YA 2VRSA 1LTSC 5AVQB 3A3YB 1S1CX 2YXQB 2RH0A 3H1JJ 2E75D 1NWQA 1URQC 3CWBD 5KLVD 2G8YA 1NTMJ 3MP7B 2JEEA 4U3FJ 1NTZJ 1KC8Q 1VDFA 2BEQD 2FYUJ 1PZQA 4R4MA 3C1LA 1VQOP 4H13C 4TT3H 5APTA 2QJYC 3HD7D 1SQVG 1EXJA 1VPCA 1NTKD 1CSBA 1P84D 1M90Q 3FWLA 3TGUJ 1RE4A 3AE4C 3RK3D 2OTKE 1EDIA 2B87B 2E76C 2HPCA 5KKZB 1OWAA 4NPFX 2PAJA 3AEBC 3M9QA 1VQKP 1LWUC 2YIUB 3JSVC 3GHGC 3L72J 4PD4D 1M1KQ 5AVXB 3BATA 2IBZG 3RK2D 2QJPC 4ZMDA 3R4YA 1GDTA 2JKVA 3A7OA 1JB0J 2FYZA 1SQXK 3H1JD 1VQ4P 2IFMA 1NTMD 5KTBA 1EQ7A 1X79B 5APVA 2KLVA 4U3FD 1NTZD 3I5CA 4JYCA 2FYUD 1MFZA 4H13D 3PLNA 3IF4A 2A06D 3C9IA 3E1RA 4WY4A 1FBMA 1LNQA 3KPEA 4GDOA 1U7MA 1LTJC 2NZ2A 3JCUE 3O8ZA 3TGUD 1OVVA 5TJHA 1L4AB 4OH8B 2JWDA 3S9OA 2SPZA 5AVSB 4RJTA 2FFDC 1JY3O 3QH9A 3HUSC 1NU1J 1GU5A 3L72D 1M1JA 3VOPA 1RHZB 2HODA 1OXZA 5AW1B 5BU8B 4U7JA 4RKUJ 1HVVA 5KLVK 2BCCG 1RH5B 2Z4EA 2KNCB 1H88A 3U59A 3NXSA 3N4XA 3NFQA 3VMYA 1PFIA 5KLIC 3WU2H 3CXHI 2KS1A 3H1IG 3II6A 3MHVA 3H1HE 3EQ2A 4JYBA 4D6TG 3MGNA 2KI7B 5AW3B 1SQVD 1SFCC 2I8DA 1BGYG 2KOGA 4HJGH 3WU2E 3CCJP 2E74B 3D6ZA 2AEMA 4OGQD 1G2CA 1EZVD 3L36A 1NU1D 1JY2N 4A7PA 1G1IA 2ZAEB 3HD7A 1TU3F 3D71A 1PIXA 3LW5H 2NPSC 2H43A 1ZN5A 3QWOC 1IFNA 2P1JA 1LTAC 3AE5C 1QX8A 1NTMK 1FC2C 1FDMA 1NTZK 2KIKA 1OVRA 2FYUK 3KXDA 3GG2A 1BCCJ 4BWNA 2C9NY 4YPCA 1N7SB 2WSEJ 1T2KC 1LT9A 4L74A 5APQA 3I55P 4JBZA 5C39A 1KD1Q 1OVUA 3G3ZA 2BASA 1URQA 2KK7A 2Y9ZA 3KZIH 1OMIA 4K3AA 5BVZA 5B5EE 3CCSP 1VQ8P 3O6QB 1HUCA 1IJDB 3Q5SA 3GW6A 1Q2NA 1KB9D 1SS1A 1T6AA 1FZCC 3KZIE 3H32B 2R32A 2HG5D 2M5AB 4I2LC 3FXEA 5CMZA 1HWTC 2JO1A 1LWUA 4ASVA 2QA4P 1BCCD 1T2KD 2HLOA 5AW6B 3GHGA 4BXLA 3Q3DA 1ZR2A 3L37A 4IL6E 5KAFH 3TDKA 3L75G 2WSCH 1EDKA 3GLMA 3B71A 5GTHH 4EI2A 3VMXA 1XTCC 4N3YB 5AW0B 3HE4B 2Q3EA 1ZP0C 1VQ9P 1KILE 2BCCE 3U1CA 3L70J 2IYOA 4PV1B 3S4RA 2WPSA 1PP9G 4JPZB 1ZMEC 2O01J 4GODA 5KAFE 2WVRA 3H1IE 1GL2C 4EYYQ 1NU1K 1Q90D 5GTHE 2D2CB 3MUDA 1R8EA 1SQBJ 2WT7B 3OA7A 3L71E 1PL5A 1FDIA 1AVOA 1M57D 1NAYA 1T3JA 3EWKA 4D6TE 1CI6A 2E43A 3LIDA 1A02F 1SQPG 2H7HA 3V4QA 2AXCA 1OFCX 1PPJG 1RE3A 2GM4A 1BGYE 2YXRB 1JY3N 1M8OB 2FFDA 1L0NG 3F5HA 1S72P 3B4SA 2KP8A 2LXCB 1R5SA 2W90A 1FU1A 4UB8H 5KAIH 2QE7H 4I6MC 1FZBA 2K37A 4N78E 5AW7B 1GTWA 1JOCA 3CXHH 3H1KG 1W2EA 3L70D 5KKZC 3CXHD 2Y0DA 2OGUA 1N86A 1OW7A 4O9BA 2QRXA 3CX5H 3VMZA 5KAIE 5AVWB 2FXOA 3L4FA 3CX5D 1SQBD 2FY8A 1MKMA 3RGUA 1NGMB 5B66H 3CPWO 3G71P 3D70A 1NVOA 2C0XA 2J5UA 4IFDK 2HPCB 2MKVA 2JDIH 2ZT9D 1SFCA 3P32A 2YKQA 1MZ9A 1AFOA 2GUVA 1HJ0A 1NTKJ 2V7QH 1KZUB 4RESB 1DX7A 5B66E 5CJ4A 1NKNA 2LR2A 4Y28J 2IZ0A 4H44B 1H8AA 2N1TB 4C7NA 1HGZA 1L4AC 2UWJE 1GMJA 4L76A 1IFJA 1L0LG 3TF5A 2YKPA 1KQSO 5APWA 4WY4B 3WUTA 4R4LA 1ZOYC 1NJIQ 1MUUA 3AE7C 1K9MQ 1CW5A 3L75E 1BE3G 5CCHC 3B8EB 1QL2A 3Q1MA 4H0LC 3PJSK 1QGKB 3IR9A 2FYNB 2YMKA 4OWFA 1VF5B 2PP6A 3VTPC 1PP9E 3RL0D 4L73A 4EOTA 4DOJA 2O1JA 2XZRA 2J58A 2HODB 2B88A 1K05A 4YXWH 3F89A 1PV3A 2W6JH 2W6AA 1SQPE 1PPJE 1FZCA 4LLHA 5EFWB 3SWKA 2ZVNB 3H6PA 1L0NE 2YO3A 2QJKB 3NMDA 5TISE 2P10A 2KS1B 2E74C 1PGQA 2XDJA 1LTGC 3N7NA 3VYIA 1LGHB 1URQD 3JCUH 3H1HJ 1FZGA 1SQBK 3G6EP 3A2AA 2E75B 1IFPA 3Q2YA 5APXA 4H0LD 3OW2O 5AW2B 1OW8A 3JC22 4RO0A 1JM0A 2ZFCA 1OX3A 3H1KE 2Q5UA 3M0AA 4XE5B 1SQQG 2K3RA 1G2CB 1VL2A 2H88C 2KB7P 2QIWA 1DD4A 1YITP 1HTLC 1KFMA 3TYYA 3B5NC 1N7SC 1LTTC 3HD7B 4IL6X 3CMAP 3L73E 1SQVJ 2IFNA 4QMAA 1VQ7P 3V6IA 2E76D 1GU4A 5L8RJ 3RK3B 4W80A 2ZYAA 4ZKUA 3PP5A 1RF1A 4GOFA 4U3FE 2K1AA 1BSHA 2M8RA 1IFIA 1FJKA 1K04A 1ZR4A 1RQUA 5CBNA 1BDCA 3RBZA 3TGUE 3LW5J 3RK2B 3H1HD 5K5GB 1S4XA 3CC2P 3PHLA 5KJ7C 2LKMA 2B87A 4KHXA 1L0LE 1XTGB 3GMAA 4H13B 1NTKK 2V4HA 4NPEA 3L71G 1S2EA 1WMKA 3B5ND 2FBWC 2IZ1A 1SVFA 3AE2C 3K5BA 3I56P 1QLED 1BE3E 2ZJSE 2WMMA 1FZAA 3C8VA 1YI2P 3FXDA 1FJPA 3CCMP 5CBOA 4PV1C 1KYOI 1LWUB 2W6BA 1L2PA 4GT1A 2ZVOB 2D2CC 2KZIA 3BCCG 4LGDE 1KTMA 2L91A 3KHUA 5AW5B 1OW6A 2YKOA 2IBZD 2ZXEB 1L4AA 2BCCJ 5AVTB 1FAVA 3T97A 1KILC 2QM8A 5B5EH 3H25A 2O01N 1N8RQ 1JUNA 3L74G 5APSA 4GKGA 1S9KE 5H2FH 3H1IJ 2WSCJ 1NYHA 1CI6B 1SFCD 3MZWB 1RQVA 4OVNF 4D6TJ 3V4WA 3VMAA 3VP9A 5CCHA 1YJNP 2ZYDA 3MIWA 2R5BA 1GW3A 2FFDB 1ZRTE 1BGYJ 2R5DA 1SQQE 5H2FE 1YJ9P 1DIPA 4OGQB
chains in the Genus database with same CATH topology
5AW7B 1GTWA 1VPCA 1QL1A 1CSBA 5CCGA 2A45I 1JOCA 1W2EA 2NPSD 1SQPK 2M3BA 3M06A 1RE4A 2OYIC 3RK3D 1N7SD 1T3UA 1N86A 1L0NK 4O9BA 2HPCA 3VMZA 2OYIB 4M3LA 5AVWB 5AVUB 3L4FA 2KYVA 1KQLA 1NOHA 1OWAA 1KILD 2PAJA 3M9QA 4B86A 1LTIC 1LWUC 3R2PA 3OJAB 2XKMA 3GHGC 2C0XA 4HH2A 4IFDK 2HPCB 1HBWA 1N73C 5AVXB 3BATA 1SFCA 3P32A 2YKQA 1MZ9A 3RK2D 1AFOA 1IFMA 2GUVA 1NHLA 3GHGB 2OARA 2Q7CA 4ZKPA 1FOSF 1GDTA 1SQVK 3A7OA 2FYZA 1SQXK 3LIEA 2XV5A 3WMM0 1N73B 2OYHC 1NKZB 1M7LA 2N1TC 1KZUB 3KDPB 4RESB 3V2RA 2IFMA 1DX7A 5KTBA 1EQ7A 1X79B 5APVA 1IK9A 5CJ4A 2KLVA 3I5CA 1NKNA 1S9KD 4JYCA 1MFZA 1H8AA 2N1TB 4C7NA 3V2PA 3C9IA 1HGZA 2GUSA 4WY4A 1L4AC 1FBMA 5KJ7D 4WY4C 2R3CA 3KPEA 1LTJA 3NTNA 1LTJC 4LC1A 2Z5HA 4C46A 5AW8B 3O8ZA 1IFJA 3B5NA 1N7SA 4C7NB 1YTZI 2YKPA 1L4AB 4WB4A 5APWA 4WY4B 2W27A 4OH8B 5BU5A 1LTJB 5AVSB 2FFDC 2C9LY 2A45G 1JY3O 3P8CE 4N78D 1MUUA 1SLQA 2I1JA 3B5NB 1JTHB 1CW5A 1JO5A 3HUSA 5AVZB 3P7KA 3HUSC 2WPRA 5CCHC 3B8EB 1Z56A 3UIAA 4XA4A 3KYQA 3E1IA 3TNUA 1QL2A 1GU5A 4HYTB 1M1JA 1YTZT 3IR9A 3VOPA 1N7LA 3M0DA 3HUSB 2HODA 1OXZA 1JY2P 5AW1B 5BU8B 2PP6A 1X9VA 2P67A 3VTPC 3TNUB 3RL0D 4EOTA 5CCGC 1HVVA 4DOJA 5KLVK 2O1JA 1L0LK 2Z4EA 3CI9A 1RE4C 3MTUE 2N9BA 2XZRA 2J58A 2HODB 3BASA 5CHXA 3U59A 1H88A 3NXSA 1YYCA 3N4XA 1JCDA 3NFQA 1GL2D 3M9HA 3VMYA 4IFMA 1PFIA 3H32A 1RF0A 5KJ7A 2W6AA 2WTYA 3II6A 3TSIA 2CPSA 4AQRD 1FZCA 4LLHA 3EQ2A 1WT6A 3V2QA 4JYBA 3MGNA 3H6PA 2YO2A 2YO3A 1IO4A 1GD2E 3NMDA 5AW3B 1SFCC 5APYA 3V2NA 2CPBA 1FZCB 2XDJA 2WSEH 1LTGC 2KOGA 3N7NA 3VYIA 1LGHB 1URQD 3HE4A 3CLQA 3P8MC 2FKWB 1FZGA 1SQBK 3A2AA 3VN0A 3V5BA 1SFCB 1FZFA 1G2CA 5APXA 2O1KA 3L36A 1JY2N 1RY3A 2Z5IA 5AW2B 3HTKA 1G1IA 2ZFCA 1FZEA 3HD7A 2JJLA 2Q5UA 3M0AA 3HD7C 4XE5B 3MD0A 3P8CD 1G2CB 2NPSA 1GK6A 3LW5H 2KB7P 2NPSC 2H43A 2Q9IA 1ZN5A 1ZV8A 3OAKA 3HTKB 1IFNA 2P1JA 1HTLC 1KFMA 3TK1A 1GK4A 3RK3C 1LTAC 1JNMA 3TYYA 3B5NC 1N7SC 1LTTC 1NTMK 1KFNA 3HD7B 1J2JB 2YMYA 3HE5A 4JF7A 4DZOA 1FDMA 2IFNA 1NTZK 2NPSB 1GU4A 2FYUK 2L5GB 4Y99C 1KILA 3RK3B 4W80A 2C9NY 1T8ZA 2IX7C 1N7SB 4ZKUA 3PP5A 1T2KC 1RF1A 1LT9A 5AVRB 1RF1C 3HE5B 2XU6A 4Y99B 5APQA 2M8RA 2FXMA 1KILB 1M1JC 3RK2C 1IFIA 1FJKA 3G3ZA 1RF1B 3M0DC 2BASA 3M9BA 1ZR4A 1URQA 1SQQK 2HFED 1CZQA 2KSJA 3SWYA 1NO4A 2N1TD 1H89A 5BVZA 1M1JB 3RK2B 2A45H 2WPQA 2P7JA 1HUCA 1IJDB 1JCCA 3M91A 2P2UA 1E5WA 4IFFA 5AVVB 1G1JA 1NH4A 4W7ZA 2IPPA 4AUWA 1L4AD 1RF0C 2I1KA 2HYNA 2LKMA 5KJ7C 4WY4D 4KHXA 5APUA 1MV8A 1WRGA 3BRVB 2QM7A 2OYIA 1XTGB 2E42A 1NTKK 2WWWA 1FZCC 2O01H 1HH0A 2C0WA 3B5ND 3H32B 1J1DC 2R32A 2HG5D 3BRTB 1HJBA 1A02J 4I2LC 2WSFH 2WITA 5AW4B 2MJZA 1SVFA 5CMZA 3A5TA 1HWTC 2XNXA 4N6JA 1LWUA 1J1DB 1JY3P 5CJ0A 1T2KD 2HLOA 4W7YA 5AW6B 3GHGA 1ZLLA 1FZAA 5CCHD 1ZR2A 3L37A 3IFMA 1IFDA 3EFGA 1N73A 4AYCA 2WSCH 1FJPA 1X8YA 1LWUB 2H8PD 3VMXA 3KQGA 1XTCC 2W6BA 1JY2O 4N3YB 5AW0B 3HE4B 2YNYA 3VP8A 1GW4A 2OYHA 2N1TA 3U1CA 1JMMA 4GT1A 3RL0C 3BVHA 1LTBC 1DH3A 2Q3IA 5CCGD 2WT7A 4LGDE 2WPSA 1N2DC 1J1EC 4WBAA 4I1LA 5AW5B 2YKOA 2ZXEB 1GL2A 2OYHB 2POHA 3RL0B 1GL2C 3U1AA 2J59M 1NU1K 3L35A 1L4AA 3MUDA 2WT7B 1DEBA 3OA7A 1J1EB 3HRNA 5AVTB 1FAVA 1T3JA 3T97A 1KILC 1CI6A 2E43A 2QM8A 3LIDA 1A02F 3SWFA 1JUNA 2H7HA 3V4QA 1GL2B 1JTHA 5APSA 5AW9B 1LT9C 1RE3A 4GKGA 2WZ7A 1FOSE 1AQ5A 5AVYB 1RE3C 1S9KE 3CL3D 2GM4A 1JY3N 2VRSA 1LTSC 5AVQB 2FFDA 3A3YB 1CI6B 1SFCD 1NWQA 1LT9B 1NAFA 3V4WA 1URQC 4C7RA 3VP9A 1GZLA 5CCHA 2KP8A 3MIWA 4EIJA 2JEEA 1IC2A 2R5BA 1GW3A 2FFDB 1VDFA 1HGVA 1FU1A 2R5DA 1URQB 4GIFA 4I6MC 1FZBA 4N78E 5APTA 1SP4A 3HD7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH A;  1LWU A;  1LTJ A;  1JY3 P;  2A45 I;  1LTJ C;  3BVH A;  1N73 B;  2OYI A;  2HLO A;  1LWU C;  3HUS A;  1W2E A;  3GHG A;  1FZC A;  1FZG A;  1FZA A;  1RF1 A;  2H43 A;  3HUS C;  2Q9I A;  1M1J B;  1LT9 A;  1RE4 A;  1RF1 C;  2OYI C;  3GHG C;  1FZC C;  2Z4E A;  1FZF A;  1RE4 C;  1LT9 C;  1RE3 A;  2A45 H;  3E1I A;  1N73 A;  2HPC B;  2FFD B;  1RE3 C;  3H32 B;  2HOD B;  1N73 C;  1M1J A;  1T3U A;  1JY2 N;  1N86 A;  2OYH B;  1M1J C;  1LWU B;  1LTJ B;  1JY3 N;  2OYH C;  2FFD A;  2HPC A;  2XNX A;  1FZB A;  1JY2 O;  1RF0 A;  1FZE A;  3H32 A;  3HUS B;  2HOD A;  2OYI B;  1RF1 B;  1FZC B;  2FFD C;  2A45 G;  1JY3 O;  3GHG B;  1RF0 C;  1JY2 P;  1LT9 B; 
#chains in the Genus database with same CATH topology
 1SQX G;  2A45 I;  2NPS D;  2M3B A;  3M06 A;  4IL6 H;  3E7K A;  1YIJ P;  1VQ6 P;  1BDD A;  3W67 A;  1P84 I;  1T3U A;  1S5L H;  2QSI A;  2OYI B;  1Q7Y Q;  2XND H;  1KQL A;  2JR8 A;  3IAO A;  1NOH A;  4B86 A;  1KIL D;  1BSN A;  2BCC D;  3CCU P;  1LTI C;  3R2P A;  1KN7 A;  1K73 Q;  4DT0 A;  1EC5 A;  3H1L G;  1S5L E;  1IFM A;  3H1I D;  4PD4 I;  1FOS F;  1SQV K;  1USE A;  2XV5 A;  4H44 C;  1N73 B;  2OYH C;  2N1T C;  1M7L A;  3KDP B;  4D6T D;  3V2R A;  3FGA D;  1IK9 A;  1QEX A;  3AEE C;  4WWI A;  3AE9 C;  1BGY D;  3V2P A;  4JQ0 D;  2IYP A;  4WY4 C;  2R3C A;  4BRY B;  1LTJ A;  4LC1 A;  2Z5H A;  3CWB G;  4UB6 H;  5KLV G;  3B5N A;  1N7S A;  4C7N B;  1YTZ I;  1ZXG A;  4WB4 A;  1FE6 A;  5BU5 A;  1YQ4 C;  2A45 G;  3P8C E;  4N78 D;  1SLQ A;  1JTH B;  1UII A;  4WVZ A;  3AE1 C;  3HUS A;  5AVZ B;  2FYN C;  3P7K A;  2V7Q J;  1Z56 A;  2K9Y A;  3UIA A;  4XA4 A;  1R5L A;  3E1I A;  3TNU A;  1Q81 Q;  4UB6 E;  4HYT B;  2QVA A;  2Y0C A;  3GF7 A;  2W8Z A;  2P67 A;  3BCC E;  3L75 J;  5CCG C;  3CI9 A;  2N9B A;  2AEJ A;  1PGP A;  1OIP A;  1Q82 Q;  1YYC A;  1KMI Z;  2K9J A;  1EDL A;  2YIU C;  1GL2 D;  1Y47 A;  3H32 A;  5KJ7 A;  3L73 G;  1KOR A;  2Q1K A;  3TSI A;  1PP9 J;  3L74 E;  2CPS A;  4TLF A;  4KT0 J;  4AQR D;  3H1J G;  1WT6 A;  5DJU B;  2RKL A;  2M0B A;  2YO2 A;  1IO4 A;  1GD2 E;  1NTM G;  2ZYG A;  3ABV C;  4U3F G;  1NTZ G;  5APY A;  2CPB A;  2FYU G;  1FZC B;  2E75 C;  1SQP J;  1KYO H;  2A06 G;  3PRJ A;  3HE4 A;  3P8M C;  2FKW B;  4K35 A;  3VN0 A;  1L0N J;  2O1K A;  3AEC C;  3TGU G;  2KUB A;  2Z5I A;  3HTK A;  1YHQ P;  1SQX E;  2IDB A;  4I7Z B;  1FZE A;  2OYO A;  2JJL A;  1EZV I;  1ZW0 A;  3HD7 C;  3MD0 A;  2NPS A;  1GK6 A;  2E5T A;  1KYO E;  2E5Y A;  1ZV8 A;  3OAK A;  4XFJ A;  3L75 D;  1JNM A;  3CC7 P;  1GK4 A;  3RK3 C;  1KFN A;  2YMY A;  3A0H E;  3HE5 A;  4JF7 A;  3L72 G;  3H1K J;  2L5G B;  1USD A;  3EFF K;  1KIL A;  1T8Z A;  3Q5R A;  1LP1 A;  1H0T A;  1PP9 D;  5AVR B;  2R3S A;  3H1L E;  2XU6 A;  4Y99 B;  3PTZ A;  3USS A;  3RK2 C;  2B9B A;  1RF1 B;  3M0D C;  2FXP A;  2HFE D;  1SQP D;  1CZQ A;  2KSJ A;  2KZJ A;  3SWY A;  2ZT9 B;  1PPJ D;  1H89 A;  1M1J B;  2A45 H;  2WPQ A;  2P7J A;  5TIS H;  1JCC A;  2H89 C;  1L0N D;  2P2U A;  4DJG A;  1E5W A;  5AVV B;  1G1J A;  1P84 H;  2IPP A;  1L4A D;  1RF0 C;  2HYN A;  4Z1M H;  3CWB E;  4ZNC A;  5APU A;  5KLV E;  1MV8 A;  2QM7 A;  2E42 A;  1IZN B;  2WWW A;  2AEF A;  2C0W A;  2K88 A;  1KB9 I;  2WSF H;  5AW4 B;  1EZV G;  1YBK A;  2XNX A;  1NU1 G;  3H1K D;  1NTK E;  4N6J A;  1L0L J;  1P84 E;  1J1D B;  1Y8A A;  5CJ0 A;  4PD4 H;  4W7Y A;  4YXD C;  1JMB A;  5CCH D;  3RK3 E;  3IFM A;  1IFD A;  4AYC A;  1AV1 A;  1D7M A;  1X8Y A;  3L73 D;  3KQG A;  1OZH A;  1PGJ A;  1BE3 J;  2KXP B;  3VP8 A;  2OYH A;  1EXI A;  2N1T A;  1E79 H;  1JMM A;  1DH3 A;  2Q3I A;  4EDF A;  2M3E A;  1DEE G;  2OTJ P;  4PD4 E;  4WBA A;  1LT1 A;  2NRG A;  1GL2 A;  2POH A;  3RL0 B;  3G4S P;  3AE8 C;  4IOI H;  1S5L X;  1KV4 A;  4YTP C;  3MUD C;  3H1J E;  3RBX A;  1J1E B;  2KLU A;  3SWF A;  1NTM E;  1AQ5 A;  1NTZ E;  5AVY B;  1RE3 C;  3RL0 g;  3CL3 D;  2FYU E;  2A06 E;  2WSS H;  2E74 D;  3T97 B;  4HB1 A;  1LT9 B;  1AQT A;  1NAF A;  4C7R A;  3FX0 A;  1GZL A;  1L0L D;  4EIJ A;  1IC2 A;  2WPV B;  4OGQ C;  1HGV A;  3ZDM A;  1VQL P;  1URQ B;  4GIF A;  1W2B O;  1SP4 A;  3WUV A;  1BE3 D;  1QL1 A;  4H0L B;  5CCG A;  3SSU A;  1YQ3 C;  1SQP K;  4ASW A;  2OYI C;  1BCC G;  3L72 E;  2QG4 A;  2QJY B;  3CME P;  1N7S D;  1SQQ J;  1L0N K;  1FDO A;  3WUU A;  4M3L A;  3A0B H;  5AVU B;  2KYV A;  4GOE A;  3OJA B;  2XKM A;  2E76 B;  4HH2 A;  1UIX A;  3CX5 I;  1HBW A;  1N73 C;  3Q5P A;  1YJW P;  1NHL A;  3GHG B;  2OAR A;  2Q7C A;  4ZKP A;  1QVG O;  3LIE A;  3WMM 0;  3A0B E;  1NKZ B;  2QJP B;  4HKZ H;  3AE6 C;  1S9K D;  1SQV E;  1X22 A;  2PGD A;  2GUS A;  4NPD A;  3CD6 P;  5KJ7 D;  3NTN A;  1Q86 Q;  3PH0 A;  4C46 A;  3CCV P;  1K8A Q;  5AW8 B;  1EZV E;  1NU1 E;  1ZRT D;  2W27 A;  1IK7 A;  1LTJ B;  1HF9 A;  1U57 A;  1SQQ D;  2C9L Y;  2I1J A;  2Q6Q A;  3B5N B;  3L71 J;  1JO5 A;  1S3J A;  2WPR A;  1M56 D;  2IBZ E;  3KYQ A;  3L70 G;  1YTZ T;  3S1K A;  4PV1 D;  1N7L A;  3M0D A;  1FS0 E;  3HUS B;  2KNC A;  1VQN P;  3AEF C;  1JY2 P;  1MFT A;  1X9V A;  3TNU B;  2D2C D;  1SQB G;  1L0L K;  3AEG C;  1RE4 C;  3MTU E;  1AA0 A;  1VQM P;  3BAS A;  5CHX A;  4MN4 C;  1JCD A;  3M9H A;  4IFM A;  1AVY A;  1RF0 A;  1KB9 H;  2WTY A;  3BCC J;  1QVF O;  2G3A A;  2K9J B;  5KLI B;  3V2Q A;  2RMZ A;  2QEX P;  2W83 C;  3CCE P;  5GTI H;  2B89 A;  1VQP P;  1DD3 A;  3CCL P;  3FWN A;  3V2N A;  2WSE H;  1KB9 E;  3L74 J;  2HR3 A;  2ZXX A;  3CLQ A;  3L71 D;  4I7Z C;  2OQQ A;  3V5B A;  1SFC B;  1FZF A;  2PFX A;  1RY3 A;  3IN6 A;  5GTI E;  2GA1 A;  3P8C D;  5DJT B;  1BCC E;  2Q9I A;  1LJ2 A;  2KSE A;  3HTK B;  3TK1 A;  4PJ0 H;  1J2J B;  1SQX J;  4DZO A;  2NPS B;  3CCQ P;  4Y99 C;  2IX7 C;  1VQ5 P;  3BCC D;  1RF1 C;  3HE5 B;  1NTK G;  1VF5 C;  2ITA A;  2ZT9 C;  4PJ0 E;  2FXM A;  1KIL B;  1M1J C;  1LP1 B;  3O6Q A;  2PRR A;  2Y9Y A;  1H0T B;  3M9B A;  1SQQ K;  2WQY C;  1JEK A;  3CCR P;  3CC4 P;  1NO4 A;  4H44 D;  2N1T D;  3L74 D;  3AE3 C;  2BEZ F;  3H1L J;  4DCK A;  2DW3 A;  3M91 A;  2O3J A;  1X0T A;  5M1B A;  4IFF A;  1NH4 A;  4W7Z A;  4AUW A;  2M5A A;  2Y0E A;  2I1K A;  4WY4 D;  2QJK C;  1WRG A;  3BRV B;  2OYI A;  2JWA A;  4L75 A;  2O01 H;  1HH0 A;  2P58 A;  1J1D C;  1W5C E;  3BRT B;  5E79 H;  1HJB A;  1A02 J;  1AJY A;  2WIT A;  2MJZ A;  3A5T A;  4UB8 E;  1SQX D;  3SFE C;  3W68 A;  3CWB J;  5KLV J;  2CK3 H;  1Y9B A;  1KQF B;  1JY3 P;  1ZLL A;  3L70 E;  1KYO D;  3CXH E;  1VF5 D;  2LXB A;  1KQG B;  3GF3 A;  3EFG A;  1N73 A;  3A0H H;  2N9Y B;  2AXT H;  2H8P D;  5E79 E;  1JY2 O;  1PGO A;  2YNY A;  3CX5 E;  1SQB E;  1GW4 A;  4KJM A;  3RL0 C;  3BVH A;  1LTB C;  5CCG D;  2WT7 A;  4CPG A;  4BRY A;  3G9R A;  1N2D C;  1J1E C;  4I1L A;  3H1L D;  2OYH B;  3U1A A;  1U7J A;  3AEA C;  2J59 M;  3ITK A;  2WSF J;  3L35 A;  2AXT E;  3SFD C;  2IBZ I;  1DEB A;  3AED C;  3HRN A;  1EDJ A;  2RN0 A;  2R44 A;  1GL2 B;  2OTL P;  1JTH A;  5AW9 B;  1LT9 C;  2WZ7 A;  1FOS E;  3H1H G;  3L73 J;  2JP3 A;  3D6Y A;  2VRS A;  1LTS C;  5AVQ B;  3A3Y B;  1S1C X;  2YXQ B;  2RH0 A;  3H1J J;  2E75 D;  1NWQ A;  1URQ C;  3CWB D;  5KLV D;  2G8Y A;  1NTM J;  3MP7 B;  2JEE A;  4U3F J;  1NTZ J;  1KC8 Q;  1VDF A;  2BEQ D;  2FYU J;  1PZQ A;  4R4M A;  3C1L A;  1VQO P;  4H13 C;  4TT3 H;  5APT A;  2QJY C;  3HD7 D;  1SQV G;  1EXJ A;  1VPC A;  1NTK D;  1CSB A;  1P84 D;  1M90 Q;  3FWL A;  3TGU J;  1RE4 A;  3AE4 C;  3RK3 D;  2OTK E;  1EDI A;  2B87 B;  2E76 C;  2HPC A;  5KKZ B;  1OWA A;  4NPF X;  2PAJ A;  3AEB C;  3M9Q A;  1VQK P;  1LWU C;  2YIU B;  3JSV C;  3GHG C;  3L72 J;  4PD4 D;  1M1K Q;  5AVX B;  3BAT A;  2IBZ G;  3RK2 D;  2QJP C;  4ZMD A;  3R4Y A;  1GDT A;  2JKV A;  3A7O A;  1JB0 J;  2FYZ A;  1SQX K;  3H1J D;  1VQ4 P;  2IFM A;  1NTM D;  5KTB A;  1EQ7 A;  1X79 B;  5APV A;  2KLV A;  4U3F D;  1NTZ D;  3I5C A;  4JYC A;  2FYU D;  1MFZ A;  4H13 D;  3PLN A;  3IF4 A;  2A06 D;  3C9I A;  3E1R A;  4WY4 A;  1FBM A;  1LNQ A;  3KPE A;  4GDO A;  1U7M A;  1LTJ C;  2NZ2 A;  3JCU E;  3O8Z A;  3TGU D;  1OVV A;  5TJH A;  1L4A B;  4OH8 B;  2JWD A;  3S9O A;  2SPZ A;  5AVS B;  4RJT A;  2FFD C;  1JY3 O;  3QH9 A;  3HUS C;  1NU1 J;  1GU5 A;  3L72 D;  1M1J A;  3VOP A;  1RHZ B;  2HOD A;  1OXZ A;  5AW1 B;  5BU8 B;  4U7J A;  4RKU J;  1HVV A;  5KLV K;  2BCC G;  1RH5 B;  2Z4E A;  2KNC B;  1H88 A;  3U59 A;  3NXS A;  3N4X A;  3NFQ A;  3VMY A;  1PFI A;  5KLI C;  3WU2 H;  3CXH I;  2KS1 A;  3H1I G;  3II6 A;  3MHV A;  3H1H E;  3EQ2 A;  4JYB A;  4D6T G;  3MGN A;  2KI7 B;  5AW3 B;  1SQV D;  1SFC C;  2I8D A;  1BGY G;  2KOG A;  4HJG H;  3WU2 E;  3CCJ P;  2E74 B;  3D6Z A;  2AEM A;  4OGQ D;  1G2C A;  1EZV D;  3L36 A;  1NU1 D;  1JY2 N;  4A7P A;  1G1I A;  2ZAE B;  3HD7 A;  1TU3 F;  3D71 A;  1PIX A;  3LW5 H;  2NPS C;  2H43 A;  1ZN5 A;  3QWO C;  1IFN A;  2P1J A;  1LTA C;  3AE5 C;  1QX8 A;  1NTM K;  1FC2 C;  1FDM A;  1NTZ K;  2KIK A;  1OVR A;  2FYU K;  3KXD A;  3GG2 A;  1BCC J;  4BWN A;  2C9N Y;  4YPC A;  1N7S B;  2WSE J;  1T2K C;  1LT9 A;  4L74 A;  5APQ A;  3I55 P;  4JBZ A;  5C39 A;  1KD1 Q;  1OVU A;  3G3Z A;  2BAS A;  1URQ A;  2KK7 A;  2Y9Z A;  3KZI H;  1OMI A;  4K3A A;  5BVZ A;  5B5E E;  3CCS P;  1VQ8 P;  3O6Q B;  1HUC A;  1IJD B;  3Q5S A;  3GW6 A;  1Q2N A;  1KB9 D;  1SS1 A;  1T6A A;  1FZC C;  3KZI E;  3H32 B;  2R32 A;  2HG5 D;  2M5A B;  4I2L C;  3FXE A;  5CMZ A;  1HWT C;  2JO1 A;  1LWU A;  4ASV A;  2QA4 P;  1BCC D;  1T2K D;  2HLO A;  5AW6 B;  3GHG A;  4BXL A;  3Q3D A;  1ZR2 A;  3L37 A;  4IL6 E;  5KAF H;  3TDK A;  3L75 G;  2WSC H;  1EDK A;  3GLM A;  3B71 A;  5GTH H;  4EI2 A;  3VMX A;  1XTC C;  4N3Y B;  5AW0 B;  3HE4 B;  2Q3E A;  1ZP0 C;  1VQ9 P;  1KIL E;  2BCC E;  3U1C A;  3L70 J;  2IYO A;  4PV1 B;  3S4R A;  2WPS A;  1PP9 G;  4JPZ B;  1ZME C;  2O01 J;  4GOD A;  5KAF E;  2WVR A;  3H1I E;  1GL2 C;  4EYY Q;  1NU1 K;  1Q90 D;  5GTH E;  2D2C B;  3MUD A;  1R8E A;  1SQB J;  2WT7 B;  3OA7 A;  3L71 E;  1PL5 A;  1FDI A;  1AVO A;  1M57 D;  1NAY A;  1T3J A;  3EWK A;  4D6T E;  1CI6 A;  2E43 A;  3LID A;  1A02 F;  1SQP G;  2H7H A;  3V4Q A;  2AXC A;  1OFC X;  1PPJ G;  1RE3 A;  2GM4 A;  1BGY E;  2YXR B;  1JY3 N;  1M8O B;  2FFD A;  1L0N G;  3F5H A;  1S72 P;  3B4S A;  2KP8 A;  2LXC B;  1R5S A;  2W90 A;  1FU1 A;  4UB8 H;  5KAI H;  2QE7 H;  4I6M C;  1FZB A;  2K37 A;  4N78 E;  5AW7 B;  1GTW A;  1JOC A;  3CXH H;  3H1K G;  1W2E A;  3L70 D;  5KKZ C;  3CXH D;  2Y0D A;  2OGU A;  1N86 A;  1OW7 A;  4O9B A;  2QRX A;  3CX5 H;  3VMZ A;  5KAI E;  5AVW B;  2FXO A;  3L4F A;  3CX5 D;  1SQB D;  2FY8 A;  1MKM A;  3RGU A;  1NGM B;  5B66 H;  3CPW O;  3G71 P;  3D70 A;  1NVO A;  2C0X A;  2J5U A;  4IFD K;  2HPC B;  2MKV A;  2JDI H;  2ZT9 D;  1SFC A;  3P32 A;  2YKQ A;  1MZ9 A;  1AFO A;  2GUV A;  1HJ0 A;  1NTK J;  2V7Q H;  1KZU B;  4RES B;  1DX7 A;  5B66 E;  5CJ4 A;  1NKN A;  2LR2 A;  4Y28 J;  2IZ0 A;  4H44 B;  1H8A A;  2N1T B;  4C7N A;  1HGZ A;  1L4A C;  2UWJ E;  1GMJ A;  4L76 A;  1IFJ A;  1L0L G;  3TF5 A;  2YKP A;  1KQS O;  5APW A;  4WY4 B;  3WUT A;  4R4L A;  1ZOY C;  1NJI Q;  1MUU A;  3AE7 C;  1K9M Q;  1CW5 A;  3L75 E;  1BE3 G;  5CCH C;  3B8E B;  1QL2 A;  3Q1M A;  4H0L C;  3PJS K;  1QGK B;  3IR9 A;  2FYN B;  2YMK A;  4OWF A;  1VF5 B;  2PP6 A;  3VTP C;  1PP9 E;  3RL0 D;  4L73 A;  4EOT A;  4DOJ A;  2O1J A;  2XZR A;  2J58 A;  2HOD B;  2B88 A;  1K05 A;  4YXW H;  3F89 A;  1PV3 A;  2W6J H;  2W6A A;  1SQP E;  1PPJ E;  1FZC A;  4LLH A;  5EFW B;  3SWK A;  2ZVN B;  3H6P A;  1L0N E;  2YO3 A;  2QJK B;  3NMD A;  5TIS E;  2P10 A;  2KS1 B;  2E74 C;  1PGQ A;  2XDJ A;  1LTG C;  3N7N A;  3VYI A;  1LGH B;  1URQ D;  3JCU H;  3H1H J;  1FZG A;  1SQB K;  3G6E P;  3A2A A;  2E75 B;  1IFP A;  3Q2Y A;  5APX A;  4H0L D;  3OW2 O;  5AW2 B;  1OW8 A;  3JC2 2;  4RO0 A;  1JM0 A;  2ZFC A;  1OX3 A;  3H1K E;  2Q5U A;  3M0A A;  4XE5 B;  1SQQ G;  2K3R A;  1G2C B;  1VL2 A;  2H88 C;  2KB7 P;  2QIW A;  1DD4 A;  1YIT P;  1HTL C;  1KFM A;  3TYY A;  3B5N C;  1N7S C;  1LTT C;  3HD7 B;  4IL6 X;  3CMA P;  3L73 E;  1SQV J;  2IFN A;  4QMA A;  1VQ7 P;  3V6I A;  2E76 D;  1GU4 A;  5L8R J;  3RK3 B;  4W80 A;  2ZYA A;  4ZKU A;  3PP5 A;  1RF1 A;  4GOF A;  4U3F E;  2K1A A;  1BSH A;  2M8R A;  1IFI A;  1FJK A;  1K04 A;  1ZR4 A;  1RQU A;  5CBN A;  1BDC A;  3RBZ A;  3TGU E;  3LW5 J;  3RK2 B;  3H1H D;  5K5G B;  1S4X A;  3CC2 P;  3PHL A;  5KJ7 C;  2LKM A;  2B87 A;  4KHX A;  1L0L E;  1XTG B;  3GMA A;  4H13 B;  1NTK K;  2V4H A;  4NPE A;  3L71 G;  1S2E A;  1WMK A;  3B5N D;  2FBW C;  2IZ1 A;  1SVF A;  3AE2 C;  3K5B A;  3I56 P;  1QLE D;  1BE3 E;  2ZJS E;  2WMM A;  1FZA A;  3C8V A;  1YI2 P;  3FXD A;  1FJP A;  3CCM P;  5CBO A;  4PV1 C;  1KYO I;  1LWU B;  2W6B A;  1L2P A;  4GT1 A;  2ZVO B;  2D2C C;  2KZI A;  3BCC G;  4LGD E;  1KTM A;  2L91 A;  3KHU A;  5AW5 B;  1OW6 A;  2YKO A;  2IBZ D;  2ZXE B;  1L4A A;  2BCC J;  5AVT B;  1FAV A;  3T97 A;  1KIL C;  2QM8 A;  5B5E H;  3H25 A;  2O01 N;  1N8R Q;  1JUN A;  3L74 G;  5APS A;  4GKG A;  1S9K E;  5H2F H;  3H1I J;  2WSC J;  1NYH A;  1CI6 B;  1SFC D;  3MZW B;  1RQV A;  4OVN F;  4D6T J;  3V4W A;  3VMA A;  3VP9 A;  5CCH A;  1YJN P;  2ZYD A;  3MIW A;  2R5B A;  1GW3 A;  2FFD B;  1ZRT E;  1BGY J;  2R5D A;  1SQQ E;  5H2F E;  1YJ9 P;  1DIP A;  4OGQ B; 
#chains in the Genus database with same CATH homology
 5AW7 B;  1GTW A;  1VPC A;  1QL1 A;  1CSB A;  5CCG A;  2A45 I;  1JOC A;  1W2E A;  2NPS D;  1SQP K;  2M3B A;  3M06 A;  1RE4 A;  2OYI C;  3RK3 D;  1N7S D;  1T3U A;  1N86 A;  1L0N K;  4O9B A;  2HPC A;  3VMZ A;  2OYI B;  4M3L A;  5AVW B;  5AVU B;  3L4F A;  2KYV A;  1KQL A;  1NOH A;  1OWA A;  1KIL D;  2PAJ A;  3M9Q A;  4B86 A;  1LTI C;  1LWU C;  3R2P A;  3OJA B;  2XKM A;  3GHG C;  2C0X A;  4HH2 A;  4IFD K;  2HPC B;  1HBW A;  1N73 C;  5AVX B;  3BAT A;  1SFC A;  3P32 A;  2YKQ A;  1MZ9 A;  3RK2 D;  1AFO A;  1IFM A;  2GUV A;  1NHL A;  3GHG B;  2OAR A;  2Q7C A;  4ZKP A;  1FOS F;  1GDT A;  1SQV K;  3A7O A;  2FYZ A;  1SQX K;  3LIE A;  2XV5 A;  3WMM 0;  1N73 B;  2OYH C;  1NKZ B;  1M7L A;  2N1T C;  1KZU B;  3KDP B;  4RES B;  3V2R A;  2IFM A;  1DX7 A;  5KTB A;  1EQ7 A;  1X79 B;  5APV A;  1IK9 A;  5CJ4 A;  2KLV A;  3I5C A;  1NKN A;  1S9K D;  4JYC A;  1MFZ A;  1H8A A;  2N1T B;  4C7N A;  3V2P A;  3C9I A;  1HGZ A;  2GUS A;  4WY4 A;  1L4A C;  1FBM A;  5KJ7 D;  4WY4 C;  2R3C A;  3KPE A;  1LTJ A;  3NTN A;  1LTJ C;  4LC1 A;  2Z5H A;  4C46 A;  5AW8 B;  3O8Z A;  1IFJ A;  3B5N A;  1N7S A;  4C7N B;  1YTZ I;  2YKP A;  1L4A B;  4WB4 A;  5APW A;  4WY4 B;  2W27 A;  4OH8 B;  5BU5 A;  1LTJ B;  5AVS B;  2FFD C;  2C9L Y;  2A45 G;  1JY3 O;  3P8C E;  4N78 D;  1MUU A;  1SLQ A;  2I1J A;  3B5N B;  1JTH B;  1CW5 A;  1JO5 A;  3HUS A;  5AVZ B;  3P7K A;  3HUS C;  2WPR A;  5CCH C;  3B8E B;  1Z56 A;  3UIA A;  4XA4 A;  3KYQ A;  3E1I A;  3TNU A;  1QL2 A;  1GU5 A;  4HYT B;  1M1J A;  1YTZ T;  3IR9 A;  3VOP A;  1N7L A;  3M0D A;  3HUS B;  2HOD A;  1OXZ A;  1JY2 P;  5AW1 B;  5BU8 B;  2PP6 A;  1X9V A;  2P67 A;  3VTP C;  3TNU B;  3RL0 D;  4EOT A;  5CCG C;  1HVV A;  4DOJ A;  5KLV K;  2O1J A;  1L0L K;  2Z4E A;  3CI9 A;  1RE4 C;  3MTU E;  2N9B A;  2XZR A;  2J58 A;  2HOD B;  3BAS A;  5CHX A;  3U59 A;  1H88 A;  3NXS A;  1YYC A;  3N4X A;  1JCD A;  3NFQ A;  1GL2 D;  3M9H A;  3VMY A;  4IFM A;  1PFI A;  3H32 A;  1RF0 A;  5KJ7 A;  2W6A A;  2WTY A;  3II6 A;  3TSI A;  2CPS A;  4AQR D;  1FZC A;  4LLH A;  3EQ2 A;  1WT6 A;  3V2Q A;  4JYB A;  3MGN A;  3H6P A;  2YO2 A;  2YO3 A;  1IO4 A;  1GD2 E;  3NMD A;  5AW3 B;  1SFC C;  5APY A;  3V2N A;  2CPB A;  1FZC B;  2XDJ A;  2WSE H;  1LTG C;  2KOG A;  3N7N A;  3VYI A;  1LGH B;  1URQ D;  3HE4 A;  3CLQ A;  3P8M C;  2FKW B;  1FZG A;  1SQB K;  3A2A A;  3VN0 A;  3V5B A;  1SFC B;  1FZF A;  1G2C A;  5APX A;  2O1K A;  3L36 A;  1JY2 N;  1RY3 A;  2Z5I A;  5AW2 B;  3HTK A;  1G1I A;  2ZFC A;  1FZE A;  3HD7 A;  2JJL A;  2Q5U A;  3M0A A;  3HD7 C;  4XE5 B;  3MD0 A;  3P8C D;  1G2C B;  2NPS A;  1GK6 A;  3LW5 H;  2KB7 P;  2NPS C;  2H43 A;  2Q9I A;  1ZN5 A;  1ZV8 A;  3OAK A;  3HTK B;  1IFN A;  2P1J A;  1HTL C;  1KFM A;  3TK1 A;  1GK4 A;  3RK3 C;  1LTA C;  1JNM A;  3TYY A;  3B5N C;  1N7S C;  1LTT C;  1NTM K;  1KFN A;  3HD7 B;  1J2J B;  2YMY A;  3HE5 A;  4JF7 A;  4DZO A;  1FDM A;  2IFN A;  1NTZ K;  2NPS B;  1GU4 A;  2FYU K;  2L5G B;  4Y99 C;  1KIL A;  3RK3 B;  4W80 A;  2C9N Y;  1T8Z A;  2IX7 C;  1N7S B;  4ZKU A;  3PP5 A;  1T2K C;  1RF1 A;  1LT9 A;  5AVR B;  1RF1 C;  3HE5 B;  2XU6 A;  4Y99 B;  5APQ A;  2M8R A;  2FXM A;  1KIL B;  1M1J C;  3RK2 C;  1IFI A;  1FJK A;  3G3Z A;  1RF1 B;  3M0D C;  2BAS A;  3M9B A;  1ZR4 A;  1URQ A;  1SQQ K;  2HFE D;  1CZQ A;  2KSJ A;  3SWY A;  1NO4 A;  2N1T D;  1H89 A;  5BVZ A;  1M1J B;  3RK2 B;  2A45 H;  2WPQ A;  2P7J A;  1HUC A;  1IJD B;  1JCC A;  3M91 A;  2P2U A;  1E5W A;  4IFF A;  5AVV B;  1G1J A;  1NH4 A;  4W7Z A;  2IPP A;  4AUW A;  1L4A D;  1RF0 C;  2I1K A;  2HYN A;  2LKM A;  5KJ7 C;  4WY4 D;  4KHX A;  5APU A;  1MV8 A;  1WRG A;  3BRV B;  2QM7 A;  2OYI A;  1XTG B;  2E42 A;  1NTK K;  2WWW A;  1FZC C;  2O01 H;  1HH0 A;  2C0W A;  3B5N D;  3H32 B;  1J1D C;  2R32 A;  2HG5 D;  3BRT B;  1HJB A;  1A02 J;  4I2L C;  2WSF H;  2WIT A;  5AW4 B;  2MJZ A;  1SVF A;  5CMZ A;  3A5T A;  1HWT C;  2XNX A;  4N6J A;  1LWU A;  1J1D B;  1JY3 P;  5CJ0 A;  1T2K D;  2HLO A;  4W7Y A;  5AW6 B;  3GHG A;  1ZLL A;  1FZA A;  5CCH D;  1ZR2 A;  3L37 A;  3IFM A;  1IFD A;  3EFG A;  1N73 A;  4AYC A;  2WSC H;  1FJP A;  1X8Y A;  1LWU B;  2H8P D;  3VMX A;  3KQG A;  1XTC C;  2W6B A;  1JY2 O;  4N3Y B;  5AW0 B;  3HE4 B;  2YNY A;  3VP8 A;  1GW4 A;  2OYH A;  2N1T A;  3U1C A;  1JMM A;  4GT1 A;  3RL0 C;  3BVH A;  1LTB C;  1DH3 A;  2Q3I A;  5CCG D;  2WT7 A;  4LGD E;  2WPS A;  1N2D C;  1J1E C;  4WBA A;  4I1L A;  5AW5 B;  2YKO A;  2ZXE B;  1GL2 A;  2OYH B;  2POH A;  3RL0 B;  1GL2 C;  3U1A A;  2J59 M;  1NU1 K;  3L35 A;  1L4A A;  3MUD A;  2WT7 B;  1DEB A;  3OA7 A;  1J1E B;  3HRN A;  5AVT B;  1FAV A;  1T3J A;  3T97 A;  1KIL C;  1CI6 A;  2E43 A;  2QM8 A;  3LID A;  1A02 F;  3SWF A;  1JUN A;  2H7H A;  3V4Q A;  1GL2 B;  1JTH A;  5APS A;  5AW9 B;  1LT9 C;  1RE3 A;  4GKG A;  2WZ7 A;  1FOS E;  1AQ5 A;  5AVY B;  1RE3 C;  1S9K E;  3CL3 D;  2GM4 A;  1JY3 N;  2VRS A;  1LTS C;  5AVQ B;  2FFD A;  3A3Y B;  1CI6 B;  1SFC D;  1NWQ A;  1LT9 B;  1NAF A;  3V4W A;  1URQ C;  4C7R A;  3VP9 A;  1GZL A;  5CCH A;  2KP8 A;  3MIW A;  4EIJ A;  2JEE A;  1IC2 A;  2R5B A;  1GW3 A;  2FFD B;  1VDF A;  1HGV A;  1FU1 A;  2R5D A;  1URQ B;  4GIF A;  4I6M C;  1FZB A;  4N78 E;  5APT A;  1SP4 A;  3HD7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...