1LT9A

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9A00
1JY2P 1N73A 2A45H 2Z4EA 2HPCB 2OYIB 1FZCB 2HODB 1LWUC 1JY2N 1LTJC 1LT9B 2XNXA 1N73C 1N86A 1RE3A 1RF1B 1T3UA 2A45G 3HUSB 2OYIC 3BVHA 1RE4A 1JY2O 1W2EA 3H32B 1FZCA 1FZAA 1RE3C 3GHGB 1JY3O 3GHGA 2OYIA 2HPCA 2Q9IA 1RF1C 2OYHC 2HLOA 1LWUA 1M1JB 1JY3P 3H32A 1RF1A 2H43A 1FZFA 3GHGC 2FFDB 1FZBA 2OYHA 2A45I 1LT9A 1FZEA 3HUSC 2OYHB 2FFDA 1RF0A 1FZCC 1M1JC 1RE4C 1FZGA 3E1IA 1JY3N 2HODA 1LWUB 1LTJB 1LT9C 3HUSA 2FFDC 1N73B 1M1JA 1LTJA 1RF0C
chains in the Genus database with same CATH superfamily
1SQPK 3G6EP 1YBKA 3CCEP 4C7NA 1G1JA 2MJZA 5AVSB 2IFMA 3VMYA 2L91A 3L70E 2KNCA 2WTYA 2FYNC 1OMIA 1LGHB 3SWKA 2AXTE 3L70J 5CJ0A 4OGQC 1J1EC 4HH2A 3MHVA 1T2KC 1L0LG 4WBAA 2QE7H 5AW9B 1YJ9P 3A2AA 4D6TJ 2KLVA 3B4SA 2A06D 3V4QA 3D70A 2AEMA 3C9IA 1RF1C 2AEJA 1GZLA 3FWNA 1YTZI 1ZR4A 1VL2A 3WUVA 1SQQJ 2YMYA 1FOSE 3NFQA 1YITP 1VF5C 5TISH 3L73J 1QL1A 1X9VA 1SQPD 3L71J 2FYUE 1KC8Q 1EXIA 2N1TA 1EDLA 2E76B 1BGYD 1PV3A 1N73B 3SFDC 1RE4A 3L72E 3LIDA 1NKZB 1RF0C 2YKPA 2QSIA 1L0NK 3JSVC 1NAYA 3H1IG 1FDMA 2HFED 3B5NB 3GW6A 2IBZI 2E5TA 1EC5A 1LTJC 1NTMD 3HD7B 3JC22 3T97B 1BGYG 2IZ1A 3EFGA 4AYCA 2IDBA 5AVTB 3TGUD 2WITA 3PP5A 1NTKK 3H1IE 3H32B 1L0LK 1MFTA 3MTUE 1EDJA 1FZAA 1RH5B 1KQGB 3VP8A 1KYOD 3HE4B 1J1EB 4H13B 1LTSC 1FJPA 2WZ7A 5TJHA 2KYVA 3AECC 1JY3P 1FDIA 3EWKA 1S5LX 1KILD 4N78E 2FFDB 2KP8A 1SQPE 3RL0D 1IO4A 2K9JA 2V4HA 1M56D 3C8VA 2G3AA 2NZ2A 2O1KA 1RE4C 1IFMA 3L72D 1DH3A 3L37A 3FGAD 1YI2P 2XU6A 1AFOA 2OGUA 1SQXD 1IFJA 1HBWA 4D6TG 2KSEA 3KYQA 3MP7B 2IX7C 3TK1A 4BRYB 3VMXA 1KILC 3CWBG 3M91A 1BCCJ 1SQQK 2M0BA 4KJMA 1FOSF 2XNXA 1PPJD 1EQ7A 1LTIC 4NPEA 1N73C 1ZN5A 2K9JB 3H1KJ 2W8ZA 1OW6A 1XTGB 4NPFX 3V6IA 3EFFK 2OYIC 1VQOP 1EXJA 1VQKP 1WT6A 2XNDH 4I2LC 3L75J 1KQLA 4M3LA 1HJ0A 2W6AA 4L76A 1BE3J 1KILE 1SFCB 3H1JD 2P10A 3BRTB 1AA0A 1LT1A 3AE2C 3TNUA 2E76C 3CX5D 4PD4H 1JCDA 1FZFA 2K3RA 1X22A 1RF1A 1KYOI 2OYHB 5APXA 2FYUJ 1ZXGA 4JBZA 2RKLA 3G9RA 2K1AA 1USDA 3AEEC 3AEDC 1NU1K 2BASA 3CWBE 3W67A 5APTA 4LGDE 1IFDA 1OWAA 1UIIA 5KLVE 1PGQA 5M1BA 1N73A 1NTZJ 3VTPC 1AVYA 1URQB 1KB9E 3FXEA 3MGNA 3CMEP 2FYZA 3SWYA 1JMBA 3Q2YA 5TISE 1SQVG 1BCCG 3KDPB 2JO1A 3H1HG 1SQBD 5CMZA 3RBXA 2I8DA 1WRGA 3RK2B 1NAFA 1RQVA 2QJPC 3ZDMA 3IF4A 3M0AA 4LLHA 5CCGA 1U57A 3R4YA 1JY3O 5B5EE 4OGQD 2HPCA 3L73G 1FS0E 3KZIE 1JMMA 3AE7C 3G71P 1ZW0A 1SQVD 3CXHH 3A5TA 4EOTA 1NYHA 2D2CB 3GF3A 4IFDK 3IN6A 2QA4P 3Q1MA 1S9KD 1LP1A 1ZRTD 1RF0A 3N4XA 1QL2A 3H1KG 5KLVG 1EZVE 3I56P 3CCJP 2OARA 3ITKA 3CL3D 1L4AC 1S4XA 1SQPG 2H89C 3MD0A 3CPWO 2W27A 2GM4A 1NTMK 1K9MQ 1CW5A 4PV1C 1DX7A 3OA7A 3CCVP 1CI6A 2XKMA 4YXDC 3CD6P 3A7OA 1L4AB 2GA1A 1PP9G 2N9YB 1H0TA 2WSFJ 2J59M 1NTZG 1QGKB 5AVXB 4DCKA 4N3YB 3AE1C 2W83C 3A0BH 4L75A 2R32A 1HGZA 1OW8A 2P58A 5AW8B 1JTHA 2RMZA 2XZRA 1FZCA 1SQQE 1GL2A 2RN0A 2P7JA 4CPGA 4OGQB 1LJ2A 3H1HE 2YMKA 2Q3IA 3M9BA 4HB1A 4WY4D 1NU1E 3L71G 4XE5B 2Q7CA 3RK2C 4DJGA 1PL5A 3R2PA 1BDDA 1L2PA 2Z5IA 1HWTC 4D6TE 5AVWB 3D6ZA 1GTWA 4H44C 1JUNA 1L4AA 3CX5I 4U3FG 2Q5UA 3CCQP 5KLIB 5APWA 3OAKA 1MZ9A 1SQVJ 5DJTB 3A0BE 2N1TD 4C46A 3N7NA 1YQ3C 1LTJA 1N7SB 4H44D 4W80A 4K3AA 5AW7B 1FZCB 3BCCG 3KZIH 4H0LB 4L73A 3RBZA 4U3FD 5GTIE 3CCMP 3KHUA 3D71A 1NTKJ 1OVVA 4WWIA 3H1ID 1UIXA 2YIUB 5CBNA 1Y9BA 1OFCX 1YIJP 1VQ6P 1A02F 2R3SA 3NXSA 1NO4A 3I55P 2NPSD 2K37A 4RO0A 2E74D 1AV1A 3O6QA 1TU3F 4JQ0D 5AW4B 1R5LA 2FXMA 5C39A 3AEAC 1BE3G 3H32A 2C9NY 2C9LY 4JYCA 3NMDA 3TSIA 3AE8C 2IYPA 5AW1B 3U1CA 3USSA 3MIWA 1J1DB 1QX8A 5DJUB 1CSBA 3MUDA 4XFJA 5KJ7A 1BE3D 2OTLP 3FXDA 2KIKA 1KB9I 1PP9D 2LXBA 2KZIA 4Y99C 1QLED 1NTZE 4DOJA 1VQMP 3H1LG 5CCHC 2R5BA 2B87B 2Z4EA 2HPCB 1SQXG 4WY4A 1OW7A 3II6A 1VQPP 2CPBA 2E75B 3SSUA 3H1IJ 2KI7B 3Q3DA 4ASWA 4BXLA 2YO2A 1KTMA 2N9BA 4U3FJ 3H6PA 1FE6A 2YKOA 3U59A 1R8EA 3L35A 5AVVB 1L0NG 1GU5A 1HTLC 4ASVA 5BVZA 2IZ0A 2FFDC 3CMAP 2WPRA 5AW5B 2ZVOB 4EDFA 3FX0A 3M0DC 3L72J 1IC2A 3CXHE 4U7JA 4EI2A 5KKZB 4I1LA 1NOHA 3L75E 1U7MA 1W2BO 3PTZA 3L36A 5KJ7C 3H1JG 3L73E 1SQXE 2N1TC 1JEKA 1PP9E 2ZXEB 1LTJB 1N7SA 3RK3D 3P8MC 1PP9J 2WSEH 2YIUC 1BCCE 1SFCA 2B88A 3M06A 1FBMA 1VQLP 2MKVA 2A45H 2E76D 3Q5PA 1Q82Q 1J1DC 3MZWB 5APSA 3RK2D 1SQXK 1A02J 1SQVK 5AW2B 2RH0A 3TGUJ 2LR2A 1P84D 3GF7A 1NVOA 2I1KA 2GUSA 1BDCA 1W2EA 4GIFA 2W6JH 3H1JJ 4YPCA 3S9OA 1ZR2A 3HE5A 3B8EB 1DIPA 2ZT9B 2ITAA 3CXHD 4GT1A 3CX5E 1GL2B 1PPJG 2WPQA 1U7JA 3PH0A 5AVZB 3W68A 3Q5RA 1SS1A 2QJPB 2V7QJ 4R4MA 3L73D 2QJKC 4HKZH 3V2QA 5H2FE 2O1JA 1N7SC 2QIWA 1NTKD 3BCCE 1FZCC 1KILB 1L4AD 5AW6B 2O01N 2K88A 2CPSA 2HODA 3RK3E 1BCCD 4GODA 5APYA 3HUSA 1MKMA 1JNMA 3K5BA 2E43A 4JYBA 4YTPC 3CC2P 1IZNB 2E74B 1KB9H 1E5WA 1IFNA 3HE4A 3HRNA 1CZQA 1NHLA 3SWFA 1YYCA 2PRRA 4NPDA 3L4FA 1DD4A 1PGPA 1GW3A 1NU1G 3L71E 4PV1B 5APUA 2FY8A 3B5NA 1LTTC 3HD7A 4R4LA 3M9HA 2ZYAA 2JWAA 3GHGB 4JF7A 3VMAA 4WVZA 2NPSA 2ZT9D 5GTHH 2P2UA 5AVUB 3VOPA 5AVQB 2OTKE 1GU4A 2N1TB 1H88A 1GK4A 1KYOH 2IFNA 3CXHI 3GHGC 1EZVD 1VQ7P 2FYUD 2QG4A 2VRSA 1SQBG 2YKQA 3HUSC 1Q2NA 2OYOA 2K9YA 2LXCB 3L74G 4H13C 4Y99B 3S1KA 3SFEC 3V4WA 5K5GB 1FZGA 5APQA 1LWUB 1DEBA 1VQNP 1AQTA 1VF5D 4H13D 1GW4A 2ZJSE 4L74A 2POHA 3FWLA 1EZVG 1USEA 1BGYE 1KMIZ 1S1CX 2J58A 2NPSB 2YXQB 2ZYDA 3IFMA 3WU2H 3AE6C 2P1JA 3TGUE 1K73Q 2PFXA 3L71D 2FKWB 3BRVB 4BWNA 3RL0g 1S5LE 2ZT9C 3CCRP 2KOGA 4YXWH 1SQQD 5E79E 2KNCB 5BU5A 3OW2O 2BCCG 3CCLP 3TNUB 2QJKB 2Y9YA 3S4RA 2HLOA 2Q1KA 3O6QB 2YO3A 3H25A 1KYOE 3L74E 3VYIA 1SQQG 1SQBJ 2KLUA 3GG2A 3PHLA 2GUVA 3V5BA 1Y47A 3GMAA 4OH8B 1IFPA 1SQBK 1SFCC 1SLQA 3CI9A 1BE3E 3H1LE 5CCGC 2J5UA 2QRXA 4LC1A 2ZFCA 2JDIH 1RQUA 3P8CE 4PJ0E 5CCGD 1LT9C 3UIAA 1NTZD 3EQ2A 1YHQP 2C0WA 1VQ8P 1KN7A 1N7SD 4U3FE 3WUTA 1FDOA 1P84I 3RL0C 2ZXXA 1L0LE 2QJYC 2ZYGA 1M8OB 3E7KA 1LWUC 5CJ4A 1N7LA 1M1KQ 1MV8A 1T3UA 2DW3A 1H89A 1NTMJ 2IBZD 2XV5A 1URQC 2W90A 2QEXP 2WT7B 3H1JE 2KZJA 5KAFE 1VQ4P 3AE5C 2HR3A 3VN0A 3L75D 2Y9ZA 1EDIA 2M8RA 4I6MC 3H1LD 2WVRA 4GDOA 5AVYB 4ZNCA 4EYYQ 1K8AQ 3CC7P 4DT0A 3H1KD 2A45I 1LT9A 4GOFA 3RK3C 2QVAA 5E79H 3U1AA 4RESB 4ZKPA 1H0TB 1RY3A 1GL2C 3C1LA 1HH0A 4O9BA 1Q7YQ 4RJTA 3L70G 1IK9A 1CI6B 1L0LD 1M57D 1M7LA 2M5AA 3AEGC 3CWBJ 1N2DC 2PP6A 2JWDA 4OVNF 1SQXJ 1WMKA 3CC4P 4UB6E 2OYIB 1HF9A 1G1IA 2AEFA 2KSJA 1X8YA 1HVVA 2IBZE 2PGDA 2Y0CA 4KHXA 4Z1MH 3D6YA 1JO5A 3L70D 1BSNA 4XA4A 2A45G 2JJLA 5B66H 2QJYB 3VP9A 5B66E 1FC2C 3LIEA 2FXOA 1X0TA 2R3CA 5B5EH 1T2KD 1RE3C 4DZOA 3M9QA 1T8ZA 1SQBE 3CX5H 1T3JA 3GHGA 1EZVI 1SQVE 3L74J 5AW3B 2M5AB 2BCCE 2FYUK 4I7ZB 5KAIE 5GTIH 2A06E 3TDKA 5KKZC 3H1KE 4GKGA 4K35A 1ZRTE 2ZAEB 5CCHD 1ZLLA 1N8RQ 1BSHA 2OYHA 1KQFB 1OVRA 2B9BA 3AE4C 5KTBA 2W6BA 1VQ5P 1QEXA 3TGUG 1L0ND 2XDJA 2WWWA 4UB8E 2BEQD 1S3JA 1NTKG 1IK7A 1EDKA 1PGOA 2KK7A 2R5DA 3HUSB 4C7NB 3RK3B 1BGYJ 5AVRB 2BCCJ 2G8YA 1P84H 1KILA 3I5CA 4IFFA 3Q5SA 1PZQA 2HODB 1SQPJ 2Y0DA 4W7YA 5BU8B 3P7KA 3CCSP 2E75D 1RF1B 2A06G 3PRJA 2E74C 4AQRD 3MUDC 2C0XA 2NPSC 2D2CD 2KXPB 1K05A 4KT0J 3B5ND 3HD7D 2KUBA 4IL6H 3H1HD 2BCCD 3A0HH 3CLQA 1NU1D 1J2JB 2FBWC 2O01J 1KD1Q 2KS1A 5GTHE 2YNYA 4D6TD 1M90Q 3HE5B 1Q81Q 2HG5D 2WQYC 2O3JA 1NTKE 1OX3A 2R44A 2H43A 2NRGA 1FZBA 3IR9A 1L0NE 1NTZK 4ZKUA 3BATA 4B86A 3RL0B 1NGMB 2AXTH 3IAOA 2KB7P 3KXDA 3TF5A 2LKMA 5CBOA 3F89A 4EIJA 2IYOA 2BEZF 3LW5H 2KS1B 2JEEA 3A0HE 3NTNA 5KJ7D 1NTMG 3V2NA 3WU2E 5KAIH 3PLNA 2ZVNB 2WSFH 1PFIA 4N6JA 1OZHA 3AE3C 1FAVA 1SVFA 3AEFC 1K04A 1JTHB 1LP1B 2FXPA 1KORA 3A3YB 4IOIH 4WY4C 3WMM0 2E5YA 2HYNA 3QH9A 1PPJE 1NTME 3BCCJ 3PJSK 3BVHA 5KLVJ 4WB4A 3GLMA 2FYNB 2Z5HA 2O01H 2UWJE 4UB8H 1W5CE 1LTGC 2E75C 4HYTB 4JPZB 1LTBC 2WSCJ 3CCUP 3JCUE 1LWUA 1NKNA 5KLIC 3QWOC 3M0DA 2OQQA 3HTKB 2M3BA 1OVUA 3KQGA 4PD4I 3P32A 3L72G 1QVFO 2CK3H 2WMMA 1HUCA 1URQA 4N78D 4Y28J 1YJWP 2B87A 5EFWB 4PD4D 1ZMEC 4H0LC 2H7HA 1ZP0C 4TLFA 4H0LD 2JR8A 1AJYA 2QM8A 2SPZA 4HJGH 1G2CB 1M1JA 3AEBC 2WSCH 1VF5B 2H8PD 2WPVB 1GD2E 3G3ZA 5KLVD 5L8RJ 1LT9B 2B89A 1S5LH 3RGUA 2WSSH 3F5HA 1DEEG 2JKVA 1X79B 3ABVC 3HTKA 3O8ZA 1KFMA 2Q3EA 1Q86Q 2L5GB 4TT3H 3VMZA 4GOEA 4WY4B 5CHXA 1NWQA 1KFNA 3L74D 4RKUJ 2OYIA 2Q9IA 2OYHC 2IPPA 3JCUH 3WUUA 1OXZA 1G2CA 1M1JB 2Q6QA 3V2PA 3OJAB 2M3EA 1SP4A 1R5SA 1H8AA 1Z56A 1LNQA 2I1JA 2JP3A 4PD4E 1JOCA 3P8CD 1FZEA 3B71A 4I7ZC 1E79H 4OWFA 4PJ0H 2OTJP 4IL6E 1M1JC 1VPCA 1FJKA 1T6AA 1DD3A 1D7MA 3E1IA 3G4SP 1S9KE 1GL2D 3E1RA 1HJBA 4W7ZA 3BASA 4H44B 1GDTA 2V7QH 3CWBD 1JY2P 1NU1J 1AVOA 1L0LJ 3V2RA 3H1HJ 3KPEA 2WT7A 1P84E 1FU1A 1JY2N 1MFZA 4IFMA 4A7PA 1NJIQ 1KQSO 1VQ9P 1KV4A 1N86A 1GMJA 1JB0J 1KB9D 1RE3A 2P67A 2E42A 1YQ4C 1YTZT 3H1LJ 1Q90D 1JY2O 1PIXA 1URQD 1MUUA 1VDFA 2D2CC 1HGVA 1XTCC 1LTAC 3B5NC 3HD7C 3LW5J 4QMAA 4BRYA 4ZMDA 2WPSA 2H88C 1RHZB 1IFIA 5APVA 1JCCA 2QM7A 2YXRB 2PAJA 1JM0A 1NH4A 1ZOYC 2AXCA 1L0NJ 4MN4C 2FYUG 2WSEJ 3BCCD 5H2FH 5CCHA 3AE9C 4PV1D 3T97A 5KLVK 1Y8AA 5AW0B 1S72P 1KZUB 1PGJA 2FFDA 1ZV8A 1IJDB 1S2EA 1JY3N 1GK6A 1OIPA 3TYYA 4IL6X 1QVGO 1YJNP 4C7RA 4AUWA 1AQ5A 2Y0EA 1SFCD 5KAFH 4UB6H 2IBZG 3L75G
chains in the Genus database with same CATH topology
1SQPK 4C7NA 1G1JA 2MJZA 5AVSB 2IFMA 2WTYA 1LGHB 5CJ0A 1J1EC 4HH2A 1T2KC 4WBAA 5AW9B 3A2AA 2KLVA 3V4QA 3C9IA 1RF1C 1GZLA 1YTZI 1ZR4A 2YMYA 1FOSE 3NFQA 1QL1A 1X9VA 2N1TA 1N73B 1RE4A 3LIDA 1NKZB 1RF0C 2YKPA 1L0NK 1FDMA 2HFED 3B5NB 3HD7B 1LTJC 3EFGA 4AYCA 5AVTB 2WITA 3PP5A 1NTKK 3H32B 1L0LK 3MTUE 1FZAA 3VP8A 3HE4B 1J1EB 1FJPA 1LTSC 2WZ7A 2KYVA 1JY3P 4N78E 1KILD 2FFDB 2KP8A 3RL0D 1IO4A 2O1KA 1RE4C 1IFMA 1DH3A 3L37A 1HBWA 2XU6A 1AFOA 1IFJA 3KYQA 3TK1A 2IX7C 3VMXA 1KILC 1FOSF 3M91A 1SQQK 2XNXA 1EQ7A 1LTIC 1N73C 1ZN5A 1XTGB 2OYIC 1WT6A 4I2LC 1KQLA 4M3LA 2W6AA 1SFCB 3BRTB 3TNUA 1FZFA 1JCDA 2OYHB 5APXA 1NU1K 2BASA 5APTA 4LGDE 1IFDA 1OWAA 1N73A 3VTPC 1URQB 3MGNA 2FYZA 3SWYA 3KDPB 5CMZA 3RK2B 1WRGA 1NAFA 4LLHA 3M0AA 5CCGA 1JY3O 2HPCA 1JMMA 4EOTA 3A5TA 4IFDK 1S9KD 1RF0A 3N4XA 1QL2A 2OARA 3CL3D 1L4AC 3MD0A 2W27A 2GM4A 1NTMK 1CW5A 1DX7A 3OA7A 1CI6A 2XKMA 3A7OA 1L4AB 2J59M 5AVXB 4N3YB 2R32A 1HGZA 5AW8B 1JTHA 2XZRA 1FZCA 1GL2A 2P7JA 2Q3IA 3M9BA 4WY4D 4XE5B 2Q7CA 3RK2C 3R2PA 2Z5IA 1JUNA 5AVWB 1GTWA 1L4AA 2Q5UA 5APWA 3OAKA 1MZ9A 2N1TD 4C46A 3N7NA 1LTJA 1N7SB 4W80A 5AW7B 1FZCB 1A02F 3NXSA 1NO4A 2NPSD 5AW4B 2FXMA 3H32A 2C9NY 2C9LY 4JYCA 3NMDA 3TSIA 5AW1B 3U1CA 3MIWA 1J1DB 1CSBA 3MUDA 5KJ7A 1HWTC 4Y99C 4DOJA 2Z4EA 2HPCB 5CCHC 2R5BA 4WY4A 3II6A 2CPBA 2YO2A 2N9BA 3H6PA 3U59A 2YKOA 3L35A 5AVVB 1HTLC 5BVZA 2WPRA 5AW5B 3M0DC 1IC2A 4I1LA 1NOHA 3L36A 5KJ7C 2N1TC 2ZXEB 1LTJB 1N7SA 3RK3D 3P8MC 2WSEH 3M06A 1SFCA 1FBMA 2A45H 1J1DC 5APSA 3RK2D 1SQXK 1A02J 1SQVK 5AW2B 2I1KA 2GUSA 1W2EA 4GIFA 1ZR2A 3HE5A 3B8EB 4GT1A 1GL2B 2WPQA 5AVZB 3V2QA 2O1JA 1N7SC 1FZCC 1KILB 1L4AD 5AW6B 2CPSA 2HODA 5APYA 3HUSA 1JNMA 2E43A 4JYBA 1E5WA 1IFNA 3HE4A 3HRNA 1CZQA 1NHLA 3SWFA 1YYCA 3L4FA 1GW3A 5APUA 3B5NA 1LTTC 3HD7A 3M9HA 3GHGB 4JF7A 2NPSA 2P2UA 5AVUB 3VOPA 5AVQB 1GU4A 2N1TB 1H88A 1GK4A 2IFNA 3GHGC 2VRSA 3HUSC 2YKQA 4Y99B 3VMYA 3V4WA 1FZGA 5APQA 1LWUB 1DEBA 1GW4A 2POHA 2J58A 3IFMA 2NPSB 2P1JA 2FKWB 3BRVB 2KOGA 5BU5A 3TNUB 2HLOA 2YO3A 3VYIA 2GUVA 3V5BA 4OH8B 1SQBK 1SFCC 1SLQA 3CI9A 5CCGC 4LC1A 2ZFCA 3P8CE 5CCGD 1LT9C 3UIAA 3EQ2A 2C0WA 1N7SD 3RL0C 1LWUC 5CJ4A 1N7LA 1MV8A 1T3UA 1H89A 2XV5A 1URQC 2WT7B 3VN0A 2M8RA 4I6MC 5AVYB 2A45I 1LT9A 3U1AA 3RK3C 4ZKPA 4RESB 1RY3A 1GL2C 4O9BA 1HH0A 1IK9A 1CI6B 1M7LA 1GU5A 1N2DC 2PP6A 2OYIB 1G1IA 2KSJA 1X8YA 1HVVA 4KHXA 1JO5A 4XA4A 2A45G 2JJLA 3VP9A 3LIEA 2R3CA 1T2KD 1RE3C 4DZOA 3M9QA 1T8ZA 3GHGA 1T3JA 5AW3B 2FYUK 4GKGA 5CCHD 1ZLLA 2OYHA 5KTBA 2W6BA 2XDJA 2WWWA 2FFDC 4C7NB 2R5DA 3HUSB 3RK3B 5AVRB 1KILA 3I5CA 4IFFA 2HODB 4W7YA 5BU8B 3P7KA 1RF1B 4AQRD 2C0XA 2NPSC 3B5ND 3HD7D 3CLQA 1J2JB 2YNYA 3HE5B 2HG5D 2H43A 1FZBA 3IR9A 4ZKUA 1NTZK 3BATA 4B86A 3RL0B 2KB7P 2LKMA 4EIJA 3LW5H 3NTNA 2JEEA 5KJ7D 3V2NA 2WSFH 1PFIA 4N6JA 1FAVA 1SVFA 1JTHB 4WY4C 3WMM0 3A3YB 2HYNA 3BVHA 4WB4A 2Z5HA 2O01H 1LTGC 4HYTB 1LTBC 1LWUA 1NKNA 3M0DA 3HTKB 2M3BA 3KQGA 3P32A 1HUCA 1URQA 4N78D 2H7HA 2QM8A 1G2CB 1M1JA 2WSCH 2H8PD 1GD2E 3G3ZA 1LT9B 1X79B 3HTKA 3O8ZA 1KFMA 2L5GB 3VMZA 4WY4B 5CHXA 1NWQA 1KFNA 2OYIA 2Q9IA 2OYHC 2IPPA 1OXZA 1G2CA 1M1JB 3V2PA 3OJAB 1SP4A 1H8AA 1Z56A 2I1JA 1JOCA 3P8CD 1FZEA 1M1JC 1VPCA 1FJKA 3E1IA 1S9KE 1GL2D 1HJBA 4W7ZA 3BASA 1GDTA 1JY2P 3V2RA 3KPEA 2WT7A 1FU1A 1JY2N 1MFZA 4IFMA 1N86A 1RE3A 2P67A 2E42A 1YTZT 1URQD 1JY2O 3B5NC 3HD7C 1VDFA 1MUUA 1HGVA 1XTCC 1LTAC 2WPSA 1IFIA 5APVA 1JCCA 2QM7A 2PAJA 1NH4A 1RF1A 5CCHA 5KLVK 3T97A 5AW0B 1KZUB 2FFDA 1ZV8A 1IJDB 3TYYA 1JY3N 1GK6A 4AUWA 1AQ5A 4C7RA 1SFCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 P;  1N73 A;  2A45 H;  2Z4E A;  2HPC B;  2OYI B;  1FZC B;  2HOD B;  1LWU C;  1JY2 N;  1LTJ C;  1LT9 B;  2XNX A;  1N73 C;  1N86 A;  1RE3 A;  1RF1 B;  1T3U A;  2A45 G;  3HUS B;  2OYI C;  3BVH A;  1RE4 A;  1JY2 O;  1W2E A;  3H32 B;  1FZC A;  1FZA A;  1RE3 C;  3GHG B;  1JY3 O;  3GHG A;  2OYI A;  2HPC A;  2Q9I A;  1RF1 C;  2OYH C;  2HLO A;  1LWU A;  1M1J B;  1JY3 P;  3H32 A;  1RF1 A;  2H43 A;  1FZF A;  3GHG C;  2FFD B;  1FZB A;  2OYH A;  2A45 I;  1LT9 A;  1FZE A;  3HUS C;  2OYH B;  2FFD A;  1RF0 A;  1FZC C;  1M1J C;  1RE4 C;  1FZG A;  3E1I A;  1JY3 N;  2HOD A;  1LWU B;  1LTJ B;  1LT9 C;  3HUS A;  2FFD C;  1N73 B;  1M1J A;  1LTJ A;  1RF0 C; 
#chains in the Genus database with same CATH topology
 1SQP K;  3G6E P;  1YBK A;  3CCE P;  4C7N A;  1G1J A;  2MJZ A;  5AVS B;  2IFM A;  3VMY A;  2L91 A;  3L70 E;  2KNC A;  2WTY A;  2FYN C;  1OMI A;  1LGH B;  3SWK A;  2AXT E;  3L70 J;  5CJ0 A;  4OGQ C;  1J1E C;  4HH2 A;  3MHV A;  1T2K C;  1L0L G;  4WBA A;  2QE7 H;  5AW9 B;  1YJ9 P;  3A2A A;  4D6T J;  2KLV A;  3B4S A;  2A06 D;  3V4Q A;  3D70 A;  2AEM A;  3C9I A;  1RF1 C;  2AEJ A;  1GZL A;  3FWN A;  1YTZ I;  1ZR4 A;  1VL2 A;  3WUV A;  1SQQ J;  2YMY A;  1FOS E;  3NFQ A;  1YIT P;  1VF5 C;  5TIS H;  3L73 J;  1QL1 A;  1X9V A;  1SQP D;  3L71 J;  2FYU E;  1KC8 Q;  1EXI A;  2N1T A;  1EDL A;  2E76 B;  1BGY D;  1PV3 A;  1N73 B;  3SFD C;  1RE4 A;  3L72 E;  3LID A;  1NKZ B;  1RF0 C;  2YKP A;  2QSI A;  1L0N K;  3JSV C;  1NAY A;  3H1I G;  1FDM A;  2HFE D;  3B5N B;  3GW6 A;  2IBZ I;  2E5T A;  1EC5 A;  1LTJ C;  1NTM D;  3HD7 B;  3JC2 2;  3T97 B;  1BGY G;  2IZ1 A;  3EFG A;  4AYC A;  2IDB A;  5AVT B;  3TGU D;  2WIT A;  3PP5 A;  1NTK K;  3H1I E;  3H32 B;  1L0L K;  1MFT A;  3MTU E;  1EDJ A;  1FZA A;  1RH5 B;  1KQG B;  3VP8 A;  1KYO D;  3HE4 B;  1J1E B;  4H13 B;  1LTS C;  1FJP A;  2WZ7 A;  5TJH A;  2KYV A;  3AEC C;  1JY3 P;  1FDI A;  3EWK A;  1S5L X;  1KIL D;  4N78 E;  2FFD B;  2KP8 A;  1SQP E;  3RL0 D;  1IO4 A;  2K9J A;  2V4H A;  1M56 D;  3C8V A;  2G3A A;  2NZ2 A;  2O1K A;  1RE4 C;  1IFM A;  3L72 D;  1DH3 A;  3L37 A;  3FGA D;  1YI2 P;  2XU6 A;  1AFO A;  2OGU A;  1SQX D;  1IFJ A;  1HBW A;  4D6T G;  2KSE A;  3KYQ A;  3MP7 B;  2IX7 C;  3TK1 A;  4BRY B;  3VMX A;  1KIL C;  3CWB G;  3M91 A;  1BCC J;  1SQQ K;  2M0B A;  4KJM A;  1FOS F;  2XNX A;  1PPJ D;  1EQ7 A;  1LTI C;  4NPE A;  1N73 C;  1ZN5 A;  2K9J B;  3H1K J;  2W8Z A;  1OW6 A;  1XTG B;  4NPF X;  3V6I A;  3EFF K;  2OYI C;  1VQO P;  1EXJ A;  1VQK P;  1WT6 A;  2XND H;  4I2L C;  3L75 J;  1KQL A;  4M3L A;  1HJ0 A;  2W6A A;  4L76 A;  1BE3 J;  1KIL E;  1SFC B;  3H1J D;  2P10 A;  3BRT B;  1AA0 A;  1LT1 A;  3AE2 C;  3TNU A;  2E76 C;  3CX5 D;  4PD4 H;  1JCD A;  1FZF A;  2K3R A;  1X22 A;  1RF1 A;  1KYO I;  2OYH B;  5APX A;  2FYU J;  1ZXG A;  4JBZ A;  2RKL A;  3G9R A;  2K1A A;  1USD A;  3AEE C;  3AED C;  1NU1 K;  2BAS A;  3CWB E;  3W67 A;  5APT A;  4LGD E;  1IFD A;  1OWA A;  1UII A;  5KLV E;  1PGQ A;  5M1B A;  1N73 A;  1NTZ J;  3VTP C;  1AVY A;  1URQ B;  1KB9 E;  3FXE A;  3MGN A;  3CME P;  2FYZ A;  3SWY A;  1JMB A;  3Q2Y A;  5TIS E;  1SQV G;  1BCC G;  3KDP B;  2JO1 A;  3H1H G;  1SQB D;  5CMZ A;  3RBX A;  2I8D A;  1WRG A;  3RK2 B;  1NAF A;  1RQV A;  2QJP C;  3ZDM A;  3IF4 A;  3M0A A;  4LLH A;  5CCG A;  1U57 A;  3R4Y A;  1JY3 O;  5B5E E;  4OGQ D;  2HPC A;  3L73 G;  1FS0 E;  3KZI E;  1JMM A;  3AE7 C;  3G71 P;  1ZW0 A;  1SQV D;  3CXH H;  3A5T A;  4EOT A;  1NYH A;  2D2C B;  3GF3 A;  4IFD K;  3IN6 A;  2QA4 P;  3Q1M A;  1S9K D;  1LP1 A;  1ZRT D;  1RF0 A;  3N4X A;  1QL2 A;  3H1K G;  5KLV G;  1EZV E;  3I56 P;  3CCJ P;  2OAR A;  3ITK A;  3CL3 D;  1L4A C;  1S4X A;  1SQP G;  2H89 C;  3MD0 A;  3CPW O;  2W27 A;  2GM4 A;  1NTM K;  1K9M Q;  1CW5 A;  4PV1 C;  1DX7 A;  3OA7 A;  3CCV P;  1CI6 A;  2XKM A;  4YXD C;  3CD6 P;  3A7O A;  1L4A B;  2GA1 A;  1PP9 G;  2N9Y B;  1H0T A;  2WSF J;  2J59 M;  1NTZ G;  1QGK B;  5AVX B;  4DCK A;  4N3Y B;  3AE1 C;  2W83 C;  3A0B H;  4L75 A;  2R32 A;  1HGZ A;  1OW8 A;  2P58 A;  5AW8 B;  1JTH A;  2RMZ A;  2XZR A;  1FZC A;  1SQQ E;  1GL2 A;  2RN0 A;  2P7J A;  4CPG A;  4OGQ B;  1LJ2 A;  3H1H E;  2YMK A;  2Q3I A;  3M9B A;  4HB1 A;  4WY4 D;  1NU1 E;  3L71 G;  4XE5 B;  2Q7C A;  3RK2 C;  4DJG A;  1PL5 A;  3R2P A;  1BDD A;  1L2P A;  2Z5I A;  1HWT C;  4D6T E;  5AVW B;  3D6Z A;  1GTW A;  4H44 C;  1JUN A;  1L4A A;  3CX5 I;  4U3F G;  2Q5U A;  3CCQ P;  5KLI B;  5APW A;  3OAK A;  1MZ9 A;  1SQV J;  5DJT B;  3A0B E;  2N1T D;  4C46 A;  3N7N A;  1YQ3 C;  1LTJ A;  1N7S B;  4H44 D;  4W80 A;  4K3A A;  5AW7 B;  1FZC B;  3BCC G;  3KZI H;  4H0L B;  4L73 A;  3RBZ A;  4U3F D;  5GTI E;  3CCM P;  3KHU A;  3D71 A;  1NTK J;  1OVV A;  4WWI A;  3H1I D;  1UIX A;  2YIU B;  5CBN A;  1Y9B A;  1OFC X;  1YIJ P;  1VQ6 P;  1A02 F;  2R3S A;  3NXS A;  1NO4 A;  3I55 P;  2NPS D;  2K37 A;  4RO0 A;  2E74 D;  1AV1 A;  3O6Q A;  1TU3 F;  4JQ0 D;  5AW4 B;  1R5L A;  2FXM A;  5C39 A;  3AEA C;  1BE3 G;  3H32 A;  2C9N Y;  2C9L Y;  4JYC A;  3NMD A;  3TSI A;  3AE8 C;  2IYP A;  5AW1 B;  3U1C A;  3USS A;  3MIW A;  1J1D B;  1QX8 A;  5DJU B;  1CSB A;  3MUD A;  4XFJ A;  5KJ7 A;  1BE3 D;  2OTL P;  3FXD A;  2KIK A;  1KB9 I;  1PP9 D;  2LXB A;  2KZI A;  4Y99 C;  1QLE D;  1NTZ E;  4DOJ A;  1VQM P;  3H1L G;  5CCH C;  2R5B A;  2B87 B;  2Z4E A;  2HPC B;  1SQX G;  4WY4 A;  1OW7 A;  3II6 A;  1VQP P;  2CPB A;  2E75 B;  3SSU A;  3H1I J;  2KI7 B;  3Q3D A;  4ASW A;  4BXL A;  2YO2 A;  1KTM A;  2N9B A;  4U3F J;  3H6P A;  1FE6 A;  2YKO A;  3U59 A;  1R8E A;  3L35 A;  5AVV B;  1L0N G;  1GU5 A;  1HTL C;  4ASV A;  5BVZ A;  2IZ0 A;  2FFD C;  3CMA P;  2WPR A;  5AW5 B;  2ZVO B;  4EDF A;  3FX0 A;  3M0D C;  3L72 J;  1IC2 A;  3CXH E;  4U7J A;  4EI2 A;  5KKZ B;  4I1L A;  1NOH A;  3L75 E;  1U7M A;  1W2B O;  3PTZ A;  3L36 A;  5KJ7 C;  3H1J G;  3L73 E;  1SQX E;  2N1T C;  1JEK A;  1PP9 E;  2ZXE B;  1LTJ B;  1N7S A;  3RK3 D;  3P8M C;  1PP9 J;  2WSE H;  2YIU C;  1BCC E;  1SFC A;  2B88 A;  3M06 A;  1FBM A;  1VQL P;  2MKV A;  2A45 H;  2E76 D;  3Q5P A;  1Q82 Q;  1J1D C;  3MZW B;  5APS A;  3RK2 D;  1SQX K;  1A02 J;  1SQV K;  5AW2 B;  2RH0 A;  3TGU J;  2LR2 A;  1P84 D;  3GF7 A;  1NVO A;  2I1K A;  2GUS A;  1BDC A;  1W2E A;  4GIF A;  2W6J H;  3H1J J;  4YPC A;  3S9O A;  1ZR2 A;  3HE5 A;  3B8E B;  1DIP A;  2ZT9 B;  2ITA A;  3CXH D;  4GT1 A;  3CX5 E;  1GL2 B;  1PPJ G;  2WPQ A;  1U7J A;  3PH0 A;  5AVZ B;  3W68 A;  3Q5R A;  1SS1 A;  2QJP B;  2V7Q J;  4R4M A;  3L73 D;  2QJK C;  4HKZ H;  3V2Q A;  5H2F E;  2O1J A;  1N7S C;  2QIW A;  1NTK D;  3BCC E;  1FZC C;  1KIL B;  1L4A D;  5AW6 B;  2O01 N;  2K88 A;  2CPS A;  2HOD A;  3RK3 E;  1BCC D;  4GOD A;  5APY A;  3HUS A;  1MKM A;  1JNM A;  3K5B A;  2E43 A;  4JYB A;  4YTP C;  3CC2 P;  1IZN B;  2E74 B;  1KB9 H;  1E5W A;  1IFN A;  3HE4 A;  3HRN A;  1CZQ A;  1NHL A;  3SWF A;  1YYC A;  2PRR A;  4NPD A;  3L4F A;  1DD4 A;  1PGP A;  1GW3 A;  1NU1 G;  3L71 E;  4PV1 B;  5APU A;  2FY8 A;  3B5N A;  1LTT C;  3HD7 A;  4R4L A;  3M9H A;  2ZYA A;  2JWA A;  3GHG B;  4JF7 A;  3VMA A;  4WVZ A;  2NPS A;  2ZT9 D;  5GTH H;  2P2U A;  5AVU B;  3VOP A;  5AVQ B;  2OTK E;  1GU4 A;  2N1T B;  1H88 A;  1GK4 A;  1KYO H;  2IFN A;  3CXH I;  3GHG C;  1EZV D;  1VQ7 P;  2FYU D;  2QG4 A;  2VRS A;  1SQB G;  2YKQ A;  3HUS C;  1Q2N A;  2OYO A;  2K9Y A;  2LXC B;  3L74 G;  4H13 C;  4Y99 B;  3S1K A;  3SFE C;  3V4W A;  5K5G B;  1FZG A;  5APQ A;  1LWU B;  1DEB A;  1VQN P;  1AQT A;  1VF5 D;  4H13 D;  1GW4 A;  2ZJS E;  4L74 A;  2POH A;  3FWL A;  1EZV G;  1USE A;  1BGY E;  1KMI Z;  1S1C X;  2J58 A;  2NPS B;  2YXQ B;  2ZYD A;  3IFM A;  3WU2 H;  3AE6 C;  2P1J A;  3TGU E;  1K73 Q;  2PFX A;  3L71 D;  2FKW B;  3BRV B;  4BWN A;  3RL0 g;  1S5L E;  2ZT9 C;  3CCR P;  2KOG A;  4YXW H;  1SQQ D;  5E79 E;  2KNC B;  5BU5 A;  3OW2 O;  2BCC G;  3CCL P;  3TNU B;  2QJK B;  2Y9Y A;  3S4R A;  2HLO A;  2Q1K A;  3O6Q B;  2YO3 A;  3H25 A;  1KYO E;  3L74 E;  3VYI A;  1SQQ G;  1SQB J;  2KLU A;  3GG2 A;  3PHL A;  2GUV A;  3V5B A;  1Y47 A;  3GMA A;  4OH8 B;  1IFP A;  1SQB K;  1SFC C;  1SLQ A;  3CI9 A;  1BE3 E;  3H1L E;  5CCG C;  2J5U A;  2QRX A;  4LC1 A;  2ZFC A;  2JDI H;  1RQU A;  3P8C E;  4PJ0 E;  5CCG D;  1LT9 C;  3UIA A;  1NTZ D;  3EQ2 A;  1YHQ P;  2C0W A;  1VQ8 P;  1KN7 A;  1N7S D;  4U3F E;  3WUT A;  1FDO A;  1P84 I;  3RL0 C;  2ZXX A;  1L0L E;  2QJY C;  2ZYG A;  1M8O B;  3E7K A;  1LWU C;  5CJ4 A;  1N7L A;  1M1K Q;  1MV8 A;  1T3U A;  2DW3 A;  1H89 A;  1NTM J;  2IBZ D;  2XV5 A;  1URQ C;  2W90 A;  2QEX P;  2WT7 B;  3H1J E;  2KZJ A;  5KAF E;  1VQ4 P;  3AE5 C;  2HR3 A;  3VN0 A;  3L75 D;  2Y9Z A;  1EDI A;  2M8R A;  4I6M C;  3H1L D;  2WVR A;  4GDO A;  5AVY B;  4ZNC A;  4EYY Q;  1K8A Q;  3CC7 P;  4DT0 A;  3H1K D;  2A45 I;  1LT9 A;  4GOF A;  3RK3 C;  2QVA A;  5E79 H;  3U1A A;  4RES B;  4ZKP A;  1H0T B;  1RY3 A;  1GL2 C;  3C1L A;  1HH0 A;  4O9B A;  1Q7Y Q;  4RJT A;  3L70 G;  1IK9 A;  1CI6 B;  1L0L D;  1M57 D;  1M7L A;  2M5A A;  3AEG C;  3CWB J;  1N2D C;  2PP6 A;  2JWD A;  4OVN F;  1SQX J;  1WMK A;  3CC4 P;  4UB6 E;  2OYI B;  1HF9 A;  1G1I A;  2AEF A;  2KSJ A;  1X8Y A;  1HVV A;  2IBZ E;  2PGD A;  2Y0C A;  4KHX A;  4Z1M H;  3D6Y A;  1JO5 A;  3L70 D;  1BSN A;  4XA4 A;  2A45 G;  2JJL A;  5B66 H;  2QJY B;  3VP9 A;  5B66 E;  1FC2 C;  3LIE A;  2FXO A;  1X0T A;  2R3C A;  5B5E H;  1T2K D;  1RE3 C;  4DZO A;  3M9Q A;  1T8Z A;  1SQB E;  3CX5 H;  1T3J A;  3GHG A;  1EZV I;  1SQV E;  3L74 J;  5AW3 B;  2M5A B;  2BCC E;  2FYU K;  4I7Z B;  5KAI E;  5GTI H;  2A06 E;  3TDK A;  5KKZ C;  3H1K E;  4GKG A;  4K35 A;  1ZRT E;  2ZAE B;  5CCH D;  1ZLL A;  1N8R Q;  1BSH A;  2OYH A;  1KQF B;  1OVR A;  2B9B A;  3AE4 C;  5KTB A;  2W6B A;  1VQ5 P;  1QEX A;  3TGU G;  1L0N D;  2XDJ A;  2WWW A;  4UB8 E;  2BEQ D;  1S3J A;  1NTK G;  1IK7 A;  1EDK A;  1PGO A;  2KK7 A;  2R5D A;  3HUS B;  4C7N B;  3RK3 B;  1BGY J;  5AVR B;  2BCC J;  2G8Y A;  1P84 H;  1KIL A;  3I5C A;  4IFF A;  3Q5S A;  1PZQ A;  2HOD B;  1SQP J;  2Y0D A;  4W7Y A;  5BU8 B;  3P7K A;  3CCS P;  2E75 D;  1RF1 B;  2A06 G;  3PRJ A;  2E74 C;  4AQR D;  3MUD C;  2C0X A;  2NPS C;  2D2C D;  2KXP B;  1K05 A;  4KT0 J;  3B5N D;  3HD7 D;  2KUB A;  4IL6 H;  3H1H D;  2BCC D;  3A0H H;  3CLQ A;  1NU1 D;  1J2J B;  2FBW C;  2O01 J;  1KD1 Q;  2KS1 A;  5GTH E;  2YNY A;  4D6T D;  1M90 Q;  3HE5 B;  1Q81 Q;  2HG5 D;  2WQY C;  2O3J A;  1NTK E;  1OX3 A;  2R44 A;  2H43 A;  2NRG A;  1FZB A;  3IR9 A;  1L0N E;  1NTZ K;  4ZKU A;  3BAT A;  4B86 A;  3RL0 B;  1NGM B;  2AXT H;  3IAO A;  2KB7 P;  3KXD A;  3TF5 A;  2LKM A;  5CBO A;  3F89 A;  4EIJ A;  2IYO A;  2BEZ F;  3LW5 H;  2KS1 B;  2JEE A;  3A0H E;  3NTN A;  5KJ7 D;  1NTM G;  3V2N A;  3WU2 E;  5KAI H;  3PLN A;  2ZVN B;  2WSF H;  1PFI A;  4N6J A;  1OZH A;  3AE3 C;  1FAV A;  1SVF A;  3AEF C;  1K04 A;  1JTH B;  1LP1 B;  2FXP A;  1KOR A;  3A3Y B;  4IOI H;  4WY4 C;  3WMM 0;  2E5Y A;  2HYN A;  3QH9 A;  1PPJ E;  1NTM E;  3BCC J;  3PJS K;  3BVH A;  5KLV J;  4WB4 A;  3GLM A;  2FYN B;  2Z5H A;  2O01 H;  2UWJ E;  4UB8 H;  1W5C E;  1LTG C;  2E75 C;  4HYT B;  4JPZ B;  1LTB C;  2WSC J;  3CCU P;  3JCU E;  1LWU A;  1NKN A;  5KLI C;  3QWO C;  3M0D A;  2OQQ A;  3HTK B;  2M3B A;  1OVU A;  3KQG A;  4PD4 I;  3P32 A;  3L72 G;  1QVF O;  2CK3 H;  2WMM A;  1HUC A;  1URQ A;  4N78 D;  4Y28 J;  1YJW P;  2B87 A;  5EFW B;  4PD4 D;  1ZME C;  4H0L C;  2H7H A;  1ZP0 C;  4TLF A;  4H0L D;  2JR8 A;  1AJY A;  2QM8 A;  2SPZ A;  4HJG H;  1G2C B;  1M1J A;  3AEB C;  2WSC H;  1VF5 B;  2H8P D;  2WPV B;  1GD2 E;  3G3Z A;  5KLV D;  5L8R J;  1LT9 B;  2B89 A;  1S5L H;  3RGU A;  2WSS H;  3F5H A;  1DEE G;  2JKV A;  1X79 B;  3ABV C;  3HTK A;  3O8Z A;  1KFM A;  2Q3E A;  1Q86 Q;  2L5G B;  4TT3 H;  3VMZ A;  4GOE A;  4WY4 B;  5CHX A;  1NWQ A;  1KFN A;  3L74 D;  4RKU J;  2OYI A;  2Q9I A;  2OYH C;  2IPP A;  3JCU H;  3WUU A;  1OXZ A;  1G2C A;  1M1J B;  2Q6Q A;  3V2P A;  3OJA B;  2M3E A;  1SP4 A;  1R5S A;  1H8A A;  1Z56 A;  1LNQ A;  2I1J A;  2JP3 A;  4PD4 E;  1JOC A;  3P8C D;  1FZE A;  3B71 A;  4I7Z C;  1E79 H;  4OWF A;  4PJ0 H;  2OTJ P;  4IL6 E;  1M1J C;  1VPC A;  1FJK A;  1T6A A;  1DD3 A;  1D7M A;  3E1I A;  3G4S P;  1S9K E;  1GL2 D;  3E1R A;  1HJB A;  4W7Z A;  3BAS A;  4H44 B;  1GDT A;  2V7Q H;  3CWB D;  1JY2 P;  1NU1 J;  1AVO A;  1L0L J;  3V2R A;  3H1H J;  3KPE A;  2WT7 A;  1P84 E;  1FU1 A;  1JY2 N;  1MFZ A;  4IFM A;  4A7P A;  1NJI Q;  1KQS O;  1VQ9 P;  1KV4 A;  1N86 A;  1GMJ A;  1JB0 J;  1KB9 D;  1RE3 A;  2P67 A;  2E42 A;  1YQ4 C;  1YTZ T;  3H1L J;  1Q90 D;  1JY2 O;  1PIX A;  1URQ D;  1MUU A;  1VDF A;  2D2C C;  1HGV A;  1XTC C;  1LTA C;  3B5N C;  3HD7 C;  3LW5 J;  4QMA A;  4BRY A;  4ZMD A;  2WPS A;  2H88 C;  1RHZ B;  1IFI A;  5APV A;  1JCC A;  2QM7 A;  2YXR B;  2PAJ A;  1JM0 A;  1NH4 A;  1ZOY C;  2AXC A;  1L0N J;  4MN4 C;  2FYU G;  2WSE J;  3BCC D;  5H2F H;  5CCH A;  3AE9 C;  4PV1 D;  3T97 A;  5KLV K;  1Y8A A;  5AW0 B;  1S72 P;  1KZU B;  1PGJ A;  2FFD A;  1ZV8 A;  1IJD B;  1S2E A;  1JY3 N;  1GK6 A;  1OIP A;  3TYY A;  4IL6 X;  1QVG O;  1YJN P;  4C7R A;  4AUW A;  1AQ5 A;  2Y0E A;  1SFC D;  5KAF H;  4UB6 H;  2IBZ G;  3L75 G; 
#chains in the Genus database with same CATH homology
 1SQP K;  4C7N A;  1G1J A;  2MJZ A;  5AVS B;  2IFM A;  2WTY A;  1LGH B;  5CJ0 A;  1J1E C;  4HH2 A;  1T2K C;  4WBA A;  5AW9 B;  3A2A A;  2KLV A;  3V4Q A;  3C9I A;  1RF1 C;  1GZL A;  1YTZ I;  1ZR4 A;  2YMY A;  1FOS E;  3NFQ A;  1QL1 A;  1X9V A;  2N1T A;  1N73 B;  1RE4 A;  3LID A;  1NKZ B;  1RF0 C;  2YKP A;  1L0N K;  1FDM A;  2HFE D;  3B5N B;  3HD7 B;  1LTJ C;  3EFG A;  4AYC A;  5AVT B;  2WIT A;  3PP5 A;  1NTK K;  3H32 B;  1L0L K;  3MTU E;  1FZA A;  3VP8 A;  3HE4 B;  1J1E B;  1FJP A;  1LTS C;  2WZ7 A;  2KYV A;  1JY3 P;  4N78 E;  1KIL D;  2FFD B;  2KP8 A;  3RL0 D;  1IO4 A;  2O1K A;  1RE4 C;  1IFM A;  1DH3 A;  3L37 A;  1HBW A;  2XU6 A;  1AFO A;  1IFJ A;  3KYQ A;  3TK1 A;  2IX7 C;  3VMX A;  1KIL C;  1FOS F;  3M91 A;  1SQQ K;  2XNX A;  1EQ7 A;  1LTI C;  1N73 C;  1ZN5 A;  1XTG B;  2OYI C;  1WT6 A;  4I2L C;  1KQL A;  4M3L A;  2W6A A;  1SFC B;  3BRT B;  3TNU A;  1FZF A;  1JCD A;  2OYH B;  5APX A;  1NU1 K;  2BAS A;  5APT A;  4LGD E;  1IFD A;  1OWA A;  1N73 A;  3VTP C;  1URQ B;  3MGN A;  2FYZ A;  3SWY A;  3KDP B;  5CMZ A;  3RK2 B;  1WRG A;  1NAF A;  4LLH A;  3M0A A;  5CCG A;  1JY3 O;  2HPC A;  1JMM A;  4EOT A;  3A5T A;  4IFD K;  1S9K D;  1RF0 A;  3N4X A;  1QL2 A;  2OAR A;  3CL3 D;  1L4A C;  3MD0 A;  2W27 A;  2GM4 A;  1NTM K;  1CW5 A;  1DX7 A;  3OA7 A;  1CI6 A;  2XKM A;  3A7O A;  1L4A B;  2J59 M;  5AVX B;  4N3Y B;  2R32 A;  1HGZ A;  5AW8 B;  1JTH A;  2XZR A;  1FZC A;  1GL2 A;  2P7J A;  2Q3I A;  3M9B A;  4WY4 D;  4XE5 B;  2Q7C A;  3RK2 C;  3R2P A;  2Z5I A;  1JUN A;  5AVW B;  1GTW A;  1L4A A;  2Q5U A;  5APW A;  3OAK A;  1MZ9 A;  2N1T D;  4C46 A;  3N7N A;  1LTJ A;  1N7S B;  4W80 A;  5AW7 B;  1FZC B;  1A02 F;  3NXS A;  1NO4 A;  2NPS D;  5AW4 B;  2FXM A;  3H32 A;  2C9N Y;  2C9L Y;  4JYC A;  3NMD A;  3TSI A;  5AW1 B;  3U1C A;  3MIW A;  1J1D B;  1CSB A;  3MUD A;  5KJ7 A;  1HWT C;  4Y99 C;  4DOJ A;  2Z4E A;  2HPC B;  5CCH C;  2R5B A;  4WY4 A;  3II6 A;  2CPB A;  2YO2 A;  2N9B A;  3H6P A;  3U59 A;  2YKO A;  3L35 A;  5AVV B;  1HTL C;  5BVZ A;  2WPR A;  5AW5 B;  3M0D C;  1IC2 A;  4I1L A;  1NOH A;  3L36 A;  5KJ7 C;  2N1T C;  2ZXE B;  1LTJ B;  1N7S A;  3RK3 D;  3P8M C;  2WSE H;  3M06 A;  1SFC A;  1FBM A;  2A45 H;  1J1D C;  5APS A;  3RK2 D;  1SQX K;  1A02 J;  1SQV K;  5AW2 B;  2I1K A;  2GUS A;  1W2E A;  4GIF A;  1ZR2 A;  3HE5 A;  3B8E B;  4GT1 A;  1GL2 B;  2WPQ A;  5AVZ B;  3V2Q A;  2O1J A;  1N7S C;  1FZC C;  1KIL B;  1L4A D;  5AW6 B;  2CPS A;  2HOD A;  5APY A;  3HUS A;  1JNM A;  2E43 A;  4JYB A;  1E5W A;  1IFN A;  3HE4 A;  3HRN A;  1CZQ A;  1NHL A;  3SWF A;  1YYC A;  3L4F A;  1GW3 A;  5APU A;  3B5N A;  1LTT C;  3HD7 A;  3M9H A;  3GHG B;  4JF7 A;  2NPS A;  2P2U A;  5AVU B;  3VOP A;  5AVQ B;  1GU4 A;  2N1T B;  1H88 A;  1GK4 A;  2IFN A;  3GHG C;  2VRS A;  3HUS C;  2YKQ A;  4Y99 B;  3VMY A;  3V4W A;  1FZG A;  5APQ A;  1LWU B;  1DEB A;  1GW4 A;  2POH A;  2J58 A;  3IFM A;  2NPS B;  2P1J A;  2FKW B;  3BRV B;  2KOG A;  5BU5 A;  3TNU B;  2HLO A;  2YO3 A;  3VYI A;  2GUV A;  3V5B A;  4OH8 B;  1SQB K;  1SFC C;  1SLQ A;  3CI9 A;  5CCG C;  4LC1 A;  2ZFC A;  3P8C E;  5CCG D;  1LT9 C;  3UIA A;  3EQ2 A;  2C0W A;  1N7S D;  3RL0 C;  1LWU C;  5CJ4 A;  1N7L A;  1MV8 A;  1T3U A;  1H89 A;  2XV5 A;  1URQ C;  2WT7 B;  3VN0 A;  2M8R A;  4I6M C;  5AVY B;  2A45 I;  1LT9 A;  3U1A A;  3RK3 C;  4ZKP A;  4RES B;  1RY3 A;  1GL2 C;  4O9B A;  1HH0 A;  1IK9 A;  1CI6 B;  1M7L A;  1GU5 A;  1N2D C;  2PP6 A;  2OYI B;  1G1I A;  2KSJ A;  1X8Y A;  1HVV A;  4KHX A;  1JO5 A;  4XA4 A;  2A45 G;  2JJL A;  3VP9 A;  3LIE A;  2R3C A;  1T2K D;  1RE3 C;  4DZO A;  3M9Q A;  1T8Z A;  3GHG A;  1T3J A;  5AW3 B;  2FYU K;  4GKG A;  5CCH D;  1ZLL A;  2OYH A;  5KTB A;  2W6B A;  2XDJ A;  2WWW A;  2FFD C;  4C7N B;  2R5D A;  3HUS B;  3RK3 B;  5AVR B;  1KIL A;  3I5C A;  4IFF A;  2HOD B;  4W7Y A;  5BU8 B;  3P7K A;  1RF1 B;  4AQR D;  2C0X A;  2NPS C;  3B5N D;  3HD7 D;  3CLQ A;  1J2J B;  2YNY A;  3HE5 B;  2HG5 D;  2H43 A;  1FZB A;  3IR9 A;  4ZKU A;  1NTZ K;  3BAT A;  4B86 A;  3RL0 B;  2KB7 P;  2LKM A;  4EIJ A;  3LW5 H;  3NTN A;  2JEE A;  5KJ7 D;  3V2N A;  2WSF H;  1PFI A;  4N6J A;  1FAV A;  1SVF A;  1JTH B;  4WY4 C;  3WMM 0;  3A3Y B;  2HYN A;  3BVH A;  4WB4 A;  2Z5H A;  2O01 H;  1LTG C;  4HYT B;  1LTB C;  1LWU A;  1NKN A;  3M0D A;  3HTK B;  2M3B A;  3KQG A;  3P32 A;  1HUC A;  1URQ A;  4N78 D;  2H7H A;  2QM8 A;  1G2C B;  1M1J A;  2WSC H;  2H8P D;  1GD2 E;  3G3Z A;  1LT9 B;  1X79 B;  3HTK A;  3O8Z A;  1KFM A;  2L5G B;  3VMZ A;  4WY4 B;  5CHX A;  1NWQ A;  1KFN A;  2OYI A;  2Q9I A;  2OYH C;  2IPP A;  1OXZ A;  1G2C A;  1M1J B;  3V2P A;  3OJA B;  1SP4 A;  1H8A A;  1Z56 A;  2I1J A;  1JOC A;  3P8C D;  1FZE A;  1M1J C;  1VPC A;  1FJK A;  3E1I A;  1S9K E;  1GL2 D;  1HJB A;  4W7Z A;  3BAS A;  1GDT A;  1JY2 P;  3V2R A;  3KPE A;  2WT7 A;  1FU1 A;  1JY2 N;  1MFZ A;  4IFM A;  1N86 A;  1RE3 A;  2P67 A;  2E42 A;  1YTZ T;  1URQ D;  1JY2 O;  3B5N C;  3HD7 C;  1VDF A;  1MUU A;  1HGV A;  1XTC C;  1LTA C;  2WPS A;  1IFI A;  5APV A;  1JCC A;  2QM7 A;  2PAJ A;  1NH4 A;  1RF1 A;  5CCH A;  5KLV K;  3T97 A;  5AW0 B;  1KZU B;  2FFD A;  1ZV8 A;  1IJD B;  3TYY A;  1JY3 N;  1GK6 A;  4AUW A;  1AQ5 A;  4C7R A;  1SFC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...