1LT9A

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9A00
1JY3P 2HLOA 1RF1C 1N73C 2FFDA 2HODA 1FZCC 2Q9IA 1M1JA 1T3UA 1JY2N 3GHGA 2Z4EA 1FZGA 1RE3C 2OYIC 1LT9B 1M1JB 2OYHC 3H32B 1LTJA 1LWUC 1FZAA 1LT9A 2HPCA 1N86A 2FFDC 1W2EA 2A45G 2XNXA 2HPCB 1FZEA 1RF1B 2OYHA 1N73B 3GHGB 1FZBA 1LWUA 1JY3N 1FZFA 2OYHB 2A45I 1RF0C 3HUSB 1LWUB 1LT9C 1LTJB 1RE4A 3E1IA 3HUSA 2HODB 1JY2P 1JY2O 2OYIB 1FZCB 1RF1A 1RF0A 1N73A 2A45H 3BVHA 1FZCA 1RE4C 1RE3A 2OYIA 1M1JC 3GHGC 3H32A 3HUSC 2H43A 2FFDB 1LTJC 1JY3O
chains in the Genus database with same CATH superfamily
1QLED 4JYBA 3MTUE 2R3SA 1GK4A 1KQLA 1SVFA 3VTPC 3M91A 4WVZA 4D6TG 1MZ9A 3BCCD 1P84E 1PPJG 4H13D 4Y28J 3USSA 3VMXA 3W67A 1M90Q 2GUSA 2P7JA 5APXA 1S9KE 4EI2A 3AE8C 3L70D 2XU6A 3B71A 3B5NA 3OA7A 5KKZC 3G71P 1IFDA 1ZV8A 2HPCB 1NTMK 3FGAD 2IBZD 1OIPA 3D6ZA 5TISE 3G3ZA 3EFGA 2Y0EA 3AE3C 3HD7A 1EZVD 2A45I 2WVRA 3H6PA 4L76A 3M9QA 4OVNF 2BCCE 1M57D 1PP9E 1ZRTD 4I6MC 1RQVA 1VF5D 4DZOA 2YO2A 4IL6H 4H13C 4JPZB 3CC2P 1FDIA 1LTIC 2H8PD 1SQBJ 1IO4A 1IFPA 3N7NA 1SQVD 2N1TD 3MP7B 2QG4A 1NTKJ 4GIFA 4PD4D 4D6TE 2QA4P 3D71A 1SQVK 3TGUJ 4HH2A 5AVWB 5AVZB 1T3UA 1T3JA 5KLVG 2ZJSE 2QJYC 3V6IA 2OARA 3FWNA 4CPGA 1YQ3C 4AQRD 2K37A 3AEEC 1QX8A 1URQB 1SQQG 1DEBA 2G8YA 1M1KQ 1NTKE 3AE7C 4UB6H 5AW8B 2XNXA 1SQQK 3BATA 2AXCA 2NPSD 1DD3A 4ZKPA 2O01N 2WSEJ 3RK3E 1EXIA 3RK2C 2FXPA 2P58A 2WQYC 2YKOA 2W8ZA 1LTJB 3L71D 5CBNA 1AJYA 3GLMA 4N78D 1KQSO 5CJ4A 4W80A 1JCCA 1K05A 1XTCC 2QJPC 1JY2O 3EFFK 3L74D 2FXOA 4L74A 4WY4C 3WU2H 1BCCG 4GT1A 1YHQP 1FDOA 3KPEA 3L75G 1SQXK 2QSIA 3NFQA 2OQQA 1USEA 3HD7B 4H0LB 3V4QA 3HE5B 1KZUB 2K9YA 3PP5A 1VQNP 3A7OA 2XDJA 1SQBK 1L0LJ 1LTTC 1VQ5P 1J1DC 1KTMA 4QMAA 1BSHA 2IBZG 3E1RA 4PD4I 5KAIE 1FZAA 1NTZJ 4L75A 2I8DA 1K73Q 3SWYA 2QJKB 4OGQC 1NTZD 2A45G 1DX7A 1S3JA 2XV5A 3L75E 1EDKA 1MKMA 2HYNA 2KP8A 1PGOA 2O01H 3ABVC 3H1LJ 1FZFA 3CC7P 2AXTH 2IZ0A 2FXMA 2B88A 2Q5UA 4RO0A 1NGMB 3CL3D 1J2JB 4WY4D 1KYOD 1OZHA 2OYHC 2QJYB 3BVHA 1FZCA 1RE3A 2KK7A 4L73A 3L73G 3A2AA 4BXLA 3D70A 5AW6B 3TF5A 3RK2D 1NTKK 4KJMA 1VQPP 1JM0A 3FX0A 1KYOI 1OFCX 2NPSC 2W90A 3IN6A 2QJKC 4LGDE 4U3FE 3M9BA 5AVUB 5AW5B 1S72P 1PZQA 1HH0A 1SQXD 3HRNA 2K9JA 2P10A 2KIKA 3A0HE 1RE3C 2M3BA 3H1KD 2WT7A 2WTYA 1L0NJ 1Q82Q 1X8YA 1IFJA 3B5ND 1NH4A 4PJ0H 3CMAP 1N8RQ 3D6YA 1M8OB 3WU2E 4H0LD 2OYHA 2GM4A 3M0DA 1OW8A 2KXPB 1LWUA 1OVUA 2Y9YA 3L70G 4EOTA 3L36A 3HE5A 3RL0D 1L4AB 5CBOA 3E1IA 1P84I 1LTSC 1GK6A 1OVRA 1PL5A 2IZ1A 3TGUG 2RH0A 1YYCA 2VRSA 1VF5C 2J59M 3TNUA 3CCVP 3ZDMA 3PTZA 3LIEA 4HB1A 4YTPC 3V4WA 3L74G 3WUVA 4H44B 3LW5H 1PGPA 5AW3B 5AW9B 1H8AA 2QEXP 1OW7A 2WITA 1ZOYC 1BCCE 3PJSK 3S1KA 3V5BA 4LLHA 2Z5IA 1WT6A 3CXHI 3I5CA 2FYZA 1AVYA 4GOEA 1BGYE 2KOGA 3G4SP 2K3RA 2ZVNB 2D2CC 4NPFX 1AFOA 3H1LD 2JJLA 4JBZA 5TJHA 3V2PA 2C9NY 3KHUA 1IFIA 1EZVG 1JY3N 1G2CA 1LJ2A 1NTMD 1SQPG 2KSJA 2W6AA 1S1CX 1YQ4C 3V2QA 1KILB 2POHA 3W68A 1S4XA 3O8ZA 2E74B 5KAFH 2KYVA 3JCUH 1GD2E 1S5LH 1BE3E 2HODB 2P2UA 3B4SA 3L74J 3RK3D 3Q5PA 1JCDA 1KV4A 1GMJA 2FYUE 1N7SB 4YXWH 1PP9D 1URQC 1ZRTE 3H1IJ 4JF7A 4H44D 5APUA 1JUNA 3BCCE 1FS0E 2YXRB 2H43A 2BEZF 4PJ0E 4ZNCA 1HJ0A 1RY3A 4IFFA 2FFDA 1EDJA 2AEJA 3Q5SA 1OW6A 3CCSP 2IYPA 4M3LA 1ZLLA 2N1TA 1G1IA 3AEGC 1NJIQ 2HFED 2IFMA 3A3YB 2ZYDA 1EQ7A 3H1JE 2YNYA 2ZAEB 3CXHD 5APYA 3CC4P 2O1KA 4Z1MH 3II6A 1FE6A 1QVGO 1KILD 2GA1A 3GHGB 5DJTB 3NMDA 3TK1A 3Q3DA 3F89A 2E74D 2V4HA 2HR3A 3H1KJ 2M5AB 3BCCG 5BU5A 5KTBA 1FOSE 1SQXJ 5KJ7C 2QE7H 1KN7A 3AE9C 2JR8A 5CCHA 3T97B 1MUUA 2NPSA 3I55P 3L73J 2K1AA 1FU1A 3MUDA 3NXSA 5BVZA 2O1JA 1GZLA 2PGDA 4BRYB 1LTJC 3L4FA 5KJ7A 1A02F 3RK2B 5GTHH 1KB9E 3V2RA 2HODA 5B66E 5CCHC 1LT1A 2H89C 3AEFC 1U7MA 2KZJA 3L72D 5APTA 3CXHE 5H2FH 1NU1D 3VP8A 1N2DC 1SFCC 3AEBC 3H1LG 1MV8A 4ZMDA 1JMBA 1GL2A 3HE4A 1GW4A 1VF5B 5E79E 3H32B 1LTJA 1LWUC 2LR2A 3CXHH 5EFWB 5H2FE 3S9OA 1BDCA 2C0XA 1N7SD 1NKZB 2FYUD 5B5EE 2BCCJ 2Y0DA 1P84H 2OYOA 1SFCA 1MFZA 2N1TB 4KT0J 4RESB 1CI6B 3I56P 1ZMEC 2ITAA 5KLVD 3H25A 5B5EH 2E5YA 2J58A 2JWDA 2E76D 2YMYA 3GF7A 3H1JG 3FXDA 2QRXA 3L37A 3MHVA 1XTGB 4HJGH 1PPJE 1VQLP 4BWNA 2OYIB 1SQPD 2L5GB 1E79H 2SPZA 3R4YA 5TISH 1FC2C 3T97A 3U1CA 1VPCA 1H88A 1BCCJ 3AE6C 1NTME 2Q3IA 3CMEP 3TGUD 3B8EB 3MD0A 2WSCH 4WY4A 1JNMA 1L0LK 2CPBA 3H1KE 1LTAC 4N6JA 3H1LE 1SQXG 2W27A 2LXCB 2QM8A 2P1JA 2OTJP 2PAJA 4IFMA 4KHXA 2CK3H 2N9YB 1NHLA 3PH0A 2MKVA 2M5AA 2K9JB 2IYOA 2E76B 2N9BA 1OXZA 3SWKA 3SWFA 3A0BH 1S5LX 2QIWA 2XNDH 4IL6X 1W2EA 3P32A 4W7ZA 1SQQJ 4WWIA 3C8VA 3A5TA 5CCGA 3A0BE 1YJNP 2ZT9D 1QGKB 3AE1C 1AQ5A 1CW5A 2UWJE 1JO5A 2OYHB 1T8ZA 5KLVJ 1SFCB 1JTHB 2KNCB 3PHLA 1U57A 3CD6P 3Q1MA 5APSA 3L72E 3RBZA 2J5UA 1RF0A 2ZFCA 4GDOA 2R3CA 1SP4A 4I2LC 1IK7A 1R5LA 5APVA 2KZIA 5AW1B 3RK3B 4XA4A 3WMM0 1SQBG 2KS1B 5E79H 2OYIA 2RMZA 5M1BA 4PV1D 3ITKA 1M7LA 3B5NB 2OTLP 1FBMA 1RF1C 2YIUB 1AVOA 1GW3A 2YXQB 3KZIE 2FYUJ 2YMKA 1N73C 3L72J 1H89A 1FZCC 1PPJD 4D6TD 1SQPJ 3AEAC 2OYIC 1L0NK 3KZIH 3HD7C 1PGQA 4Y99B 1L4AD 4U7JA 1VQKP 1KYOH 1FDMA 3H1HG 3CWBD 4WY4B 3L73D 3OW2O 1H0TA 5APQA 1IC2A 3BRTB 1KYOE 3CX5H 3CWBJ 1BGYD 1IZNB 2BCCD 3L70E 2FYNB 4XFJA 5AVXB 1FZBA 1NTMG 4D6TJ 4GODA 2IBZE 2FYUG 1Q90D 4EYYQ 2YKQA 2KUBA 2ZXXA 4I7ZB 1U7JA 2OTKE 1JOCA 2A45H 3Q2YA 2FBWC 4IL6E 4NPDA 1N7SA 3K5BA 2V7QJ 4PV1C 4OGQB 1P84D 3VP9A 4DJGA 4RJTA 2WSCJ 2P67A 1GL2C 2PP6A 3BRVB 3CCLP 2WPVB 4W7YA 1NU1J 5BU8B 4UB8H 5AVRB 2A06D 2MJZA 2E75D 1BGYG 1FZGA 1G2CB 1Y47A 4WB4A 1VQOP 1K9MQ 1NAFA 1SS1A 2QVAA 4UB8E 2BEQD 4EIJA 3MZWB 2WSFH 3CLQA 4RKUJ 3MGNA 2M8RA 5KLIC 1AV1A 1RF1B 3GG2A 1N73B 1L0NG 1YTZI 2WPRA 3E7KA 1L4AA 2KLUA 4PV1B 1T6AA 3CCJP 1L0NE 3L71G 2WPSA 1FOSF 1NAYA 2AEFA 4HYTB 5AW4B 2B9BA 3H1HE 4U3FD 4JYCA 1T2KD 2L91A 2KLVA 5KLVE 1KMIZ 1EDIA 3HTKA 4C7NB 2Y9ZA 4AYCA 4C46A 2RN0A 1LNQA 1RE4C 2W6BA 2C0WA 1RHZB 2WSFJ 3C1LA 2I1JA 3HUSC 1UIIA 2CPSA 2Y0CA 1BDDA 3CX5D 4R4LA 3M0AA 4B86A 3H1JJ 1HTLC 1KB9I 5KAIH 2JWAA 2H88C 4I7ZC 3SSUA 2BCCG 3F5HA 1SQBE 4IOIH 2C9LY 4AUWA 2ZYGA 2DW3A 4ASWA 1HBWA 1BE3D 1IFNA 1YJ9P 4U3FG 2NPSB 1YBKA 2YIUC 1S2EA 3H1HD 1KQGB 2B87A 2E42A 1FJKA 1SQVE 1RF0C 3L74E 3CCMP 2ZT9B 5CHXA 1JEKA 2W83C 3RBXA 1NYHA 1X22A 3H1JD 3EQ2A 1J1EC 1SFCD 4ASVA 3PRJA 1RF1A 2R5BA 1N73A 3KXDA 2JO1A 1KILE 1NKNA 3L75J 1SQQE 3HE4B 3IF4A 3MIWA 3AE4C 1EZVE 2A06G 1LGHB 3H32A 3KYQA 1VQ9P 1NO4A 1JMMA 4UB6E 1MFTA 2HLOA 3IAOA 2AEMA 5KAFE 3MUDC 4N78E 3TDKA 3CCRP 1YIJP 2Q9IA 1FJPA 1M1JA 3GW6A 2Z4EA 3H1KG 2RKLA 3EWKA 4YPCA 2Q3EA 3CX5I 2ZYAA 5KJ7D 3CCQP 3L75D 1TU3F 2K88A 2E74C 4PD4E 2E75C 1GTWA 3LIDA 1J1EB 5KLVK 1VQ6P 1FZEA 2JDIH 1EZVI 4A7PA 1VDFA 1CSBA 3KQGA 3TNUB 3GF3A 1GL2D 1PGJA 1VQMP 3HUSB 3VN0A 1K04A 1JB0J 1R5SA 3M9HA 1VL2A 1VQ8P 2BASA 3KDPB 1ZXGA 1JY2P 1IK9A 4Y99C 3OAKA 3SFDC 3U1AA 4JQ0D 3TGUE 1HWTC 1NOHA 4MN4C 1GU4A 1PP9J 3H1ID 4HKZH 4LC1A 2E43A 1X79B 1NVOA 1GU5A 1DD4A 2JEEA 2O01J 5GTIH 1HUCA 2PFXA 3UIAA 1KC8Q 2WT7B 5C39A 1OX3A 3RK3C 1WMKA 4ZKUA 3WUTA 1NTMJ 3IFMA 1LT9B 1M1JB 4XE5B 4K35A 2AXTE 1FZCB 2KNCA 1L4AC 2GUVA 3CWBG 2XKMA 3HD7D 2A06E 2R32A 3L35A 4EDFA 1R8EA 1N86A 2JP3A 1KB9H 5B66H 3H1HJ 1A02J 1CI6A 3VYIA 1ZR4A 5AVSB 2D2CD 1Q86Q 1NU1E 1PV3A 3P8CD 1WRGA 2Q7CA 3L72G 1RE4A 1HVVA 2O3JA 3PLNA 1QEXA 3HUSA 1USDA 3AEDC 5AW7B 1L0ND 4DCKA 1PP9G 4GOFA 3A0HH 4O9BA 3AE2C 3JCUE 1BE3J 1QL1A 3NTNA 1M56D 3U59A 2FY8A 1Z56A 4PD4H 3P8MC 2FYUK 2ZT9C 5APWA 5AVVB 4YXDC 5KLIB 4H13B 1W5CE 3SFEC 1Q81Q 2HG5D 3M06A 1DH3A 3GHGA 3CI9A 1AA0A 1URQA 3CWBE 3L70J 5K5GB 1N7LA 1PIXA 1KQFB 1VQ7P 3CCEP 1QVFO 1AQTA 2R5DA 1DIPA 1NU1K 1IFMA 1LT9A 3RL0C 1ZN5A 2V7QH 2ZVOB 3VMZA 2FFDC 3P8CE 1X9VA 3O6QB 1SQPE 2JKVA 3RL0B 1VQ4P 4GKGA 3L71E 1SQXE 4H0LC 4R4MA 1X0TA 3LW5J 1JTHA 1LTBC 1NTKD 2M3EA 2OGUA 3B5NC 1NTZE 4N3YB 1IJDB 1LWUB 1LT9C 3FWLA 1YJWP 3WUUA 2H7HA 2WMMA 5GTIE 2R44A 1Y8AA 2YO3A 5AVTB 5CCGD 2E75B 1OVVA 2PRRA 2KS1A 1EC5A 5AW2B 2E76C 1M1JC 1ZW0A 2WWWA 3HTKB 3IR9A 3VMAA 1OWAA 2KB7P 1HGZA 1L0LD 2FFDB 3JC22 3L73E 1PFIA 1SQVJ 3QH9A 1D7MA 4C7RA 5AW0B 2D2CB 1NTZK 1HGVA 1N7SC 3N4XA 2QJPB 2WPQA 1SQPK 1KFMA 1SLQA 2KI7B 4WBAA 5AVYB 3RL0g 3TSIA 3TYYA 1YI2P 3M0DC 1QL2A 4OWFA 3H1IE 1Q2NA 5AVQB 4BRYA 3FXEA 2B89A 4TLFA 4U3FJ 3JSVC 1S5LE 4OH8B 1DEEG 1NTZG 3P7KA 2WSEH 1SQBD 2WSSH 5CCHD 3QWOC 3VMYA 3Q5RA 1RH5B 3OJAB 3O6QA 4OGQD 1BCCD 1LP1B 2KSEA 3RGUA 1OMIA 2I1KA 1GL2B 1FAVA 2IDBA 3C9IA 2B87B 2E5TA 2LKMA 5KKZB 2W6JH 3VOPA 1L0LG 1SQVG 1KILA 5L8RJ 1GDTA 3CX5E 1L0LE 3CCUP 2Z5HA 3CPWO 3R2PA 1KFNA 2FKWB 2NZ2A 3AECC 2WZ7A 1S9KD 2NRGA 1T2KC 2IPPA 4DT0A 4K3AA 1KD1Q 2Q6QA 1LTGC 1JY3P 4NPEA 1KILC 1HF9A 2Q1KA 1SQQD 1CZQA 1YTZT 1RQUA 3BASA 3L71J 3S4RA 3BCCJ 2M0BA 1JY2N 5CCGC 2FYNC 2IBZI 4TT3H 2QM7A 1EDLA 3V2NA 2IFNA 1Y9BA 4I1LA 3AE5C 2HPCA 1EXJA 5DJUB 1G1JA 1KB9D 4DOJA 3G6EP 1ZR2A 1L2PA 1BGYJ 1ZP0C 5CJ0A 3GMAA 2IX7C 1K8AQ 2ZXEB 1UIXA 5CMZA 1NU1G 1W2BO 1H0TB 4H44C 1J1DB 1URQD 5GTHE 4C7NA 2YKPA 3G9RA 1NTKG 1NWQA 1YITP 1BE3G 2G3AA 4IFDK 2LXBA 1LP1A 3H1IG 1Q7YQ 1HJBA 2XZRA 3GHGC 1E5WA 2N1TC 1KORA 1BSNA 1JY3O
chains in the Genus database with same CATH topology
4JYBA 3MTUE 1GK4A 1KQLA 1SVFA 3VTPC 3M91A 1MZ9A 3VMXA 2GUSA 2P7JA 5APXA 1S9KE 2XU6A 3OA7A 3B5NA 1IFDA 1ZV8A 2HPCB 1NTMK 3G3ZA 3EFGA 3HD7A 2A45I 3H6PA 3M9QA 4I6MC 4DZOA 2YO2A 1LTIC 2H8PD 1IO4A 3N7NA 2N1TD 4GIFA 1SQVK 4HH2A 5AVWB 5AVZB 1T3UA 1T3JA 2OARA 4AQRD 1URQB 1DEBA 5AW8B 2XNXA 1SQQK 3BATA 2NPSD 4ZKPA 3RK2C 2YKOA 1LTJB 4N78D 5CJ4A 4W80A 1JCCA 1XTCC 5CCGD 1JY2O 4WY4C 1FZCB 4GT1A 3KPEA 3NFQA 1SQXK 3HD7B 3V4QA 3HE5B 1KZUB 3PP5A 3A7OA 2XDJA 1SQBK 1LTTC 1J1DC 1FZAA 3SWYA 1DX7A 2A45G 2XV5A 2KP8A 2O01H 2HYNA 1FZFA 2FXMA 2Q5UA 3CL3D 1J2JB 4WY4D 3BVHA 1FZCA 1RE3A 3A2AA 3RK2D 1NTKK 2NPSC 4LGDE 5AVUB 3M9BA 5AW5B 1HH0A 3HRNA 1RE3C 2M3BA 2WTYA 2WT7A 1X8YA 1IFJA 3B5ND 1NH4A 2OYHA 2GM4A 3M0DA 1LWUA 4EOTA 3L36A 3HE5A 3RL0D 1L4AB 3E1IA 1LTSC 1GK6A 1YYCA 2VRSA 3TNUA 2J59M 3LIEA 3V4WA 3LW5H 5AW3B 5AW9B 1H8AA 2WITA 3V5BA 4LLHA 2Z5IA 1WT6A 3I5CA 2FYZA 2KOGA 1AFOA 2JJLA 2C9NY 1IFIA 1JY3N 1G2CA 2KSJA 2W6AA 3V2QA 1KILB 2POHA 3O8ZA 1GD2E 2KYVA 2HODB 2P2UA 3RK3D 1JCDA 1N7SB 1URQC 5APUA 4JF7A 1JUNA 2H43A 1RY3A 4IFFA 2FFDA 4M3LA 1ZLLA 2N1TA 1G1IA 2HFED 2IFMA 3A3YB 1EQ7A 2YNYA 5APYA 2O1KA 3II6A 1KILD 3GHGB 3TK1A 3NMDA 1HWTC 1FOSE 5BU5A 5KTBA 5KJ7C 5CCHA 1MUUA 2NPSA 3MUDA 1FU1A 3NXSA 5BVZA 2O1JA 1GZLA 1LTJC 3L4FA 5KJ7A 1A02F 3RK2B 3V2RA 2HODA 5CCHC 5APTA 3VP8A 1N2DC 1SFCC 1MV8A 2OYHC 1GL2A 3HE4A 1GW4A 1AQ5A 3H32B 1LTJA 1LWUC 2C0XA 1N7SD 1NKZB 1MFZA 1SFCA 2N1TB 4RESB 1CI6B 2J58A 3L37A 3RL0B 3V2PA 2YMYA 1GU4A 1XTGB 2OYIB 2L5GB 3T97A 3U1CA 1VPCA 1H88A 2Q3IA 3B8EB 3MD0A 2WSCH 4WY4A 1JNMA 1L0LK 2CPBA 1LTAC 4N6JA 2W27A 2QM8A 2P1JA 2PAJA 4IFMA 4KHXA 1NHLA 2N9BA 1OXZA 3SWFA 1W2EA 3P32A 4W7ZA 3A5TA 5CCGA 1CW5A 1JO5A 2OYHB 1T8ZA 1SFCB 1JTHB 5APSA 2ZFCA 1RF0A 3V2NA 2R3CA 1SP4A 4I2LC 5AW1B 5APVA 3RK3B 3WMM0 2OYIA 4XA4A 3B5NB 1M7LA 1FBMA 1RF1C 1GW3A 1N73C 1FZCC 1H89A 2OYIC 1L0NK 4Y99B 3HD7C 1L4AD 1FDMA 4WY4B 5APQA 1IC2A 3BRTB 5AVXB 5AW6B 1FZBA 2YKQA 1JOCA 2A45H 1N7SA 3VP9A 2P67A 1GL2C 2PP6A 3BRVB 4W7YA 5BU8B 5AVRB 2MJZA 1FZGA 1G2CB 4WB4A 1NAFA 4EIJA 2WSFH 3CLQA 3MGNA 2M8RA 1RF1B 1N73B 1YTZI 2WPRA 1L4AA 1FOSF 2WPSA 5AW4B 4HYTB 1T2KD 4JYCA 2KLVA 3HTKA 4C7NB 4AYCA 4C46A 1RE4C 2W6BA 2C0WA 3HUSC 2I1JA 2CPSA 3M0AA 4B86A 1HTLC 4AUWA 2C9LY 1HBWA 1IFNA 2NPSB 2E42A 1FJKA 1RF0C 5CHXA 3EQ2A 1J1EC 1SFCD 1RF1A 2R5BA 1N73A 1NKNA 1T2KC 3HE4B 3MIWA 3H32A 3KYQA 1LGHB 1NO4A 1JMMA 2HLOA 4N78E 1FJPA 2Q9IA 1M1JA 2Z4EA 5KJ7D 1GTWA 3LIDA 1J1EB 5KLVK 1FZEA 1VDFA 1CSBA 3KQGA 3TNUB 1GL2D 3HUSB 3VN0A 3M9HA 2BASA 3KDPB 1JY2P 1IK9A 4Y99C 3OAKA 3U1AA 1NOHA 4LC1A 2E43A 1X79B 1GU5A 2JEEA 1HUCA 3UIAA 2WT7B 3RK3C 4ZKUA 3IFMA 1LT9B 1M1JB 4XE5B 1L4AC 2GUVA 2XKMA 3HD7D 2R32A 3L35A 1N86A 1A02J 1CI6A 3VYIA 1ZR4A 5AVSB 3P8CD 1WRGA 2Q7CA 1RE4A 1HVVA 3HUSA 5AW7B 4O9BA 1QL1A 3NTNA 3U59A 1Z56A 3P8MC 2FYUK 5APWA 5AVVB 1DH3A 2HG5D 3M06A 3GHGA 3CI9A 1URQA 1N7LA 2R5DA 1NU1K 1IFMA 1LT9A 3RL0C 1ZN5A 3VMZA 2FFDC 3P8CE 1X9VA 4GKGA 1JTHA 1LTBC 4N3YB 3B5NC 1IJDB 1LWUB 1LT9C 2H7HA 2YO3A 5AVTB 5AW2B 1M1JC 2WWWA 3HTKB 3IR9A 1OWAA 2KB7P 1HGZA 2FFDB 1PFIA 4C7RA 5AW0B 1NTZK 1HGVA 1N7SC 3N4XA 4WBAA 2WPQA 1SQPK 1KFMA 1SLQA 5AVYB 3TYYA 3TSIA 3M0DC 1QL2A 5AVQB 4OH8B 3P7KA 2WSEH 5CCHD 3VMYA 3OJAB 2I1KA 1GL2B 1FAVA 3C9IA 2LKMA 3VOPA 1KILA 1GDTA 2Z5HA 3R2PA 1KFNA 2FKWB 1S9KD 2WZ7A 2IPPA 1LTGC 1JY3P 1KILC 3BASA 1CZQA 1YTZT 1JY2N 5CCGC 2QM7A 2IFNA 4I1LA 2HPCA 1G1JA 4DOJA 1ZR2A 5CJ0A 2IX7C 2ZXEB 5CMZA 1J1DB 1URQD 4C7NA 2YKPA 1NWQA 4IFDK 1HJBA 2XZRA 3GHGC 1E5WA 2N1TC 1JY3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 P;  2HLO A;  1RF1 C;  1N73 C;  2FFD A;  2HOD A;  1FZC C;  2Q9I A;  1M1J A;  1T3U A;  1JY2 N;  3GHG A;  2Z4E A;  1FZG A;  1RE3 C;  2OYI C;  1LT9 B;  1M1J B;  2OYH C;  3H32 B;  1LTJ A;  1LWU C;  1FZA A;  1LT9 A;  2HPC A;  1N86 A;  2FFD C;  1W2E A;  2A45 G;  2XNX A;  2HPC B;  1FZE A;  1RF1 B;  2OYH A;  1N73 B;  3GHG B;  1FZB A;  1LWU A;  1JY3 N;  1FZF A;  2OYH B;  2A45 I;  1RF0 C;  3HUS B;  1LWU B;  1LT9 C;  1LTJ B;  1RE4 A;  3E1I A;  3HUS A;  2HOD B;  1JY2 P;  1JY2 O;  2OYI B;  1FZC B;  1RF1 A;  1RF0 A;  1N73 A;  2A45 H;  3BVH A;  1FZC A;  1RE4 C;  1RE3 A;  2OYI A;  1M1J C;  3GHG C;  3H32 A;  3HUS C;  2H43 A;  2FFD B;  1LTJ C;  1JY3 O; 
#chains in the Genus database with same CATH topology
 1QLE D;  4JYB A;  3MTU E;  2R3S A;  1GK4 A;  1KQL A;  1SVF A;  3VTP C;  3M91 A;  4WVZ A;  4D6T G;  1MZ9 A;  3BCC D;  1P84 E;  1PPJ G;  4H13 D;  4Y28 J;  3USS A;  3VMX A;  3W67 A;  1M90 Q;  2GUS A;  2P7J A;  5APX A;  1S9K E;  4EI2 A;  3AE8 C;  3L70 D;  2XU6 A;  3B71 A;  3B5N A;  3OA7 A;  5KKZ C;  3G71 P;  1IFD A;  1ZV8 A;  2HPC B;  1NTM K;  3FGA D;  2IBZ D;  1OIP A;  3D6Z A;  5TIS E;  3G3Z A;  3EFG A;  2Y0E A;  3AE3 C;  3HD7 A;  1EZV D;  2A45 I;  2WVR A;  3H6P A;  4L76 A;  3M9Q A;  4OVN F;  2BCC E;  1M57 D;  1PP9 E;  1ZRT D;  4I6M C;  1RQV A;  1VF5 D;  4DZO A;  2YO2 A;  4IL6 H;  4H13 C;  4JPZ B;  3CC2 P;  1FDI A;  1LTI C;  2H8P D;  1SQB J;  1IO4 A;  1IFP A;  3N7N A;  1SQV D;  2N1T D;  3MP7 B;  2QG4 A;  1NTK J;  4GIF A;  4PD4 D;  4D6T E;  2QA4 P;  3D71 A;  1SQV K;  3TGU J;  4HH2 A;  5AVW B;  5AVZ B;  1T3U A;  1T3J A;  5KLV G;  2ZJS E;  2QJY C;  3V6I A;  2OAR A;  3FWN A;  4CPG A;  1YQ3 C;  4AQR D;  2K37 A;  3AEE C;  1QX8 A;  1URQ B;  1SQQ G;  1DEB A;  2G8Y A;  1M1K Q;  1NTK E;  3AE7 C;  4UB6 H;  5AW8 B;  2XNX A;  1SQQ K;  3BAT A;  2AXC A;  2NPS D;  1DD3 A;  4ZKP A;  2O01 N;  2WSE J;  3RK3 E;  1EXI A;  3RK2 C;  2FXP A;  2P58 A;  2WQY C;  2YKO A;  2W8Z A;  1LTJ B;  3L71 D;  5CBN A;  1AJY A;  3GLM A;  4N78 D;  1KQS O;  5CJ4 A;  4W80 A;  1JCC A;  1K05 A;  1XTC C;  2QJP C;  1JY2 O;  3EFF K;  3L74 D;  2FXO A;  4L74 A;  4WY4 C;  3WU2 H;  1BCC G;  4GT1 A;  1YHQ P;  1FDO A;  3KPE A;  3L75 G;  1SQX K;  2QSI A;  3NFQ A;  2OQQ A;  1USE A;  3HD7 B;  4H0L B;  3V4Q A;  3HE5 B;  1KZU B;  2K9Y A;  3PP5 A;  1VQN P;  3A7O A;  2XDJ A;  1SQB K;  1L0L J;  1LTT C;  1VQ5 P;  1J1D C;  1KTM A;  4QMA A;  1BSH A;  2IBZ G;  3E1R A;  4PD4 I;  5KAI E;  1FZA A;  1NTZ J;  4L75 A;  2I8D A;  1K73 Q;  3SWY A;  2QJK B;  4OGQ C;  1NTZ D;  2A45 G;  1DX7 A;  1S3J A;  2XV5 A;  3L75 E;  1EDK A;  1MKM A;  2HYN A;  2KP8 A;  1PGO A;  2O01 H;  3ABV C;  3H1L J;  1FZF A;  3CC7 P;  2AXT H;  2IZ0 A;  2FXM A;  2B88 A;  2Q5U A;  4RO0 A;  1NGM B;  3CL3 D;  1J2J B;  4WY4 D;  1KYO D;  1OZH A;  2OYH C;  2QJY B;  3BVH A;  1FZC A;  1RE3 A;  2KK7 A;  4L73 A;  3L73 G;  3A2A A;  4BXL A;  3D70 A;  5AW6 B;  3TF5 A;  3RK2 D;  1NTK K;  4KJM A;  1VQP P;  1JM0 A;  3FX0 A;  1KYO I;  1OFC X;  2NPS C;  2W90 A;  3IN6 A;  2QJK C;  4LGD E;  4U3F E;  3M9B A;  5AVU B;  5AW5 B;  1S72 P;  1PZQ A;  1HH0 A;  1SQX D;  3HRN A;  2K9J A;  2P10 A;  2KIK A;  3A0H E;  1RE3 C;  2M3B A;  3H1K D;  2WT7 A;  2WTY A;  1L0N J;  1Q82 Q;  1X8Y A;  1IFJ A;  3B5N D;  1NH4 A;  4PJ0 H;  3CMA P;  1N8R Q;  3D6Y A;  1M8O B;  3WU2 E;  4H0L D;  2OYH A;  2GM4 A;  3M0D A;  1OW8 A;  2KXP B;  1LWU A;  1OVU A;  2Y9Y A;  3L70 G;  4EOT A;  3L36 A;  3HE5 A;  3RL0 D;  1L4A B;  5CBO A;  3E1I A;  1P84 I;  1LTS C;  1GK6 A;  1OVR A;  1PL5 A;  2IZ1 A;  3TGU G;  2RH0 A;  1YYC A;  2VRS A;  1VF5 C;  2J59 M;  3TNU A;  3CCV P;  3ZDM A;  3PTZ A;  3LIE A;  4HB1 A;  4YTP C;  3V4W A;  3L74 G;  3WUV A;  4H44 B;  3LW5 H;  1PGP A;  5AW3 B;  5AW9 B;  1H8A A;  2QEX P;  1OW7 A;  2WIT A;  1ZOY C;  1BCC E;  3PJS K;  3S1K A;  3V5B A;  4LLH A;  2Z5I A;  1WT6 A;  3CXH I;  3I5C A;  2FYZ A;  1AVY A;  4GOE A;  1BGY E;  2KOG A;  3G4S P;  2K3R A;  2ZVN B;  2D2C C;  4NPF X;  1AFO A;  3H1L D;  2JJL A;  4JBZ A;  5TJH A;  3V2P A;  2C9N Y;  3KHU A;  1IFI A;  1EZV G;  1JY3 N;  1G2C A;  1LJ2 A;  1NTM D;  1SQP G;  2KSJ A;  2W6A A;  1S1C X;  1YQ4 C;  3V2Q A;  1KIL B;  2POH A;  3W68 A;  1S4X A;  3O8Z A;  2E74 B;  5KAF H;  2KYV A;  3JCU H;  1GD2 E;  1S5L H;  1BE3 E;  2HOD B;  2P2U A;  3B4S A;  3L74 J;  3RK3 D;  3Q5P A;  1JCD A;  1KV4 A;  1GMJ A;  2FYU E;  1N7S B;  4YXW H;  1PP9 D;  1URQ C;  1ZRT E;  3H1I J;  4JF7 A;  4H44 D;  5APU A;  1JUN A;  3BCC E;  1FS0 E;  2YXR B;  2H43 A;  2BEZ F;  4PJ0 E;  4ZNC A;  1HJ0 A;  1RY3 A;  4IFF A;  2FFD A;  1EDJ A;  2AEJ A;  3Q5S A;  1OW6 A;  3CCS P;  2IYP A;  4M3L A;  1ZLL A;  2N1T A;  1G1I A;  3AEG C;  1NJI Q;  2HFE D;  2IFM A;  3A3Y B;  2ZYD A;  1EQ7 A;  3H1J E;  2YNY A;  2ZAE B;  3CXH D;  5APY A;  3CC4 P;  2O1K A;  4Z1M H;  3II6 A;  1FE6 A;  1QVG O;  1KIL D;  2GA1 A;  3GHG B;  5DJT B;  3NMD A;  3TK1 A;  3Q3D A;  3F89 A;  2E74 D;  2V4H A;  2HR3 A;  3H1K J;  2M5A B;  3BCC G;  5BU5 A;  5KTB A;  1FOS E;  1SQX J;  5KJ7 C;  2QE7 H;  1KN7 A;  3AE9 C;  2JR8 A;  5CCH A;  3T97 B;  1MUU A;  2NPS A;  3I55 P;  3L73 J;  2K1A A;  1FU1 A;  3MUD A;  3NXS A;  5BVZ A;  2O1J A;  1GZL A;  2PGD A;  4BRY B;  1LTJ C;  3L4F A;  5KJ7 A;  1A02 F;  3RK2 B;  5GTH H;  1KB9 E;  3V2R A;  2HOD A;  5B66 E;  5CCH C;  1LT1 A;  2H89 C;  3AEF C;  1U7M A;  2KZJ A;  3L72 D;  5APT A;  3CXH E;  5H2F H;  1NU1 D;  3VP8 A;  1N2D C;  1SFC C;  3AEB C;  3H1L G;  1MV8 A;  4ZMD A;  1JMB A;  1GL2 A;  3HE4 A;  1GW4 A;  1VF5 B;  5E79 E;  3H32 B;  1LTJ A;  1LWU C;  2LR2 A;  3CXH H;  5EFW B;  5H2F E;  3S9O A;  1BDC A;  2C0X A;  1N7S D;  1NKZ B;  2FYU D;  5B5E E;  2BCC J;  2Y0D A;  1P84 H;  2OYO A;  1SFC A;  1MFZ A;  2N1T B;  4KT0 J;  4RES B;  1CI6 B;  3I56 P;  1ZME C;  2ITA A;  5KLV D;  3H25 A;  5B5E H;  2E5Y A;  2J58 A;  2JWD A;  2E76 D;  2YMY A;  3GF7 A;  3H1J G;  3FXD A;  2QRX A;  3L37 A;  3MHV A;  1XTG B;  4HJG H;  1PPJ E;  1VQL P;  4BWN A;  2OYI B;  1SQP D;  2L5G B;  1E79 H;  2SPZ A;  3R4Y A;  5TIS H;  1FC2 C;  3T97 A;  3U1C A;  1VPC A;  1H88 A;  1BCC J;  3AE6 C;  1NTM E;  2Q3I A;  3CME P;  3TGU D;  3B8E B;  3MD0 A;  2WSC H;  4WY4 A;  1JNM A;  1L0L K;  2CPB A;  3H1K E;  1LTA C;  4N6J A;  3H1L E;  1SQX G;  2W27 A;  2LXC B;  2QM8 A;  2P1J A;  2OTJ P;  2PAJ A;  4IFM A;  4KHX A;  2CK3 H;  2N9Y B;  1NHL A;  3PH0 A;  2MKV A;  2M5A A;  2K9J B;  2IYO A;  2E76 B;  2N9B A;  1OXZ A;  3SWK A;  3SWF A;  3A0B H;  1S5L X;  2QIW A;  2XND H;  4IL6 X;  1W2E A;  3P32 A;  4W7Z A;  1SQQ J;  4WWI A;  3C8V A;  3A5T A;  5CCG A;  3A0B E;  1YJN P;  2ZT9 D;  1QGK B;  3AE1 C;  1AQ5 A;  1CW5 A;  2UWJ E;  1JO5 A;  2OYH B;  1T8Z A;  5KLV J;  1SFC B;  1JTH B;  2KNC B;  3PHL A;  1U57 A;  3CD6 P;  3Q1M A;  5APS A;  3L72 E;  3RBZ A;  2J5U A;  1RF0 A;  2ZFC A;  4GDO A;  2R3C A;  1SP4 A;  4I2L C;  1IK7 A;  1R5L A;  5APV A;  2KZI A;  5AW1 B;  3RK3 B;  4XA4 A;  3WMM 0;  1SQB G;  2KS1 B;  5E79 H;  2OYI A;  2RMZ A;  5M1B A;  4PV1 D;  3ITK A;  1M7L A;  3B5N B;  2OTL P;  1FBM A;  1RF1 C;  2YIU B;  1AVO A;  1GW3 A;  2YXQ B;  3KZI E;  2FYU J;  2YMK A;  1N73 C;  3L72 J;  1H89 A;  1FZC C;  1PPJ D;  4D6T D;  1SQP J;  3AEA C;  2OYI C;  1L0N K;  3KZI H;  3HD7 C;  1PGQ A;  4Y99 B;  1L4A D;  4U7J A;  1VQK P;  1KYO H;  1FDM A;  3H1H G;  3CWB D;  4WY4 B;  3L73 D;  3OW2 O;  1H0T A;  5APQ A;  1IC2 A;  3BRT B;  1KYO E;  3CX5 H;  3CWB J;  1BGY D;  1IZN B;  2BCC D;  3L70 E;  2FYN B;  4XFJ A;  5AVX B;  1FZB A;  1NTM G;  4D6T J;  4GOD A;  2IBZ E;  2FYU G;  1Q90 D;  4EYY Q;  2YKQ A;  2KUB A;  2ZXX A;  4I7Z B;  1U7J A;  2OTK E;  1JOC A;  2A45 H;  3Q2Y A;  2FBW C;  4IL6 E;  4NPD A;  1N7S A;  3K5B A;  2V7Q J;  4PV1 C;  4OGQ B;  1P84 D;  3VP9 A;  4DJG A;  4RJT A;  2WSC J;  2P67 A;  1GL2 C;  2PP6 A;  3BRV B;  3CCL P;  2WPV B;  4W7Y A;  1NU1 J;  5BU8 B;  4UB8 H;  5AVR B;  2A06 D;  2MJZ A;  2E75 D;  1BGY G;  1FZG A;  1G2C B;  1Y47 A;  4WB4 A;  1VQO P;  1K9M Q;  1NAF A;  1SS1 A;  2QVA A;  4UB8 E;  2BEQ D;  4EIJ A;  3MZW B;  2WSF H;  3CLQ A;  4RKU J;  3MGN A;  2M8R A;  5KLI C;  1AV1 A;  1RF1 B;  3GG2 A;  1N73 B;  1L0N G;  1YTZ I;  2WPR A;  3E7K A;  1L4A A;  2KLU A;  4PV1 B;  1T6A A;  3CCJ P;  1L0N E;  3L71 G;  2WPS A;  1FOS F;  1NAY A;  2AEF A;  4HYT B;  5AW4 B;  2B9B A;  3H1H E;  4U3F D;  4JYC A;  1T2K D;  2L91 A;  2KLV A;  5KLV E;  1KMI Z;  1EDI A;  3HTK A;  4C7N B;  2Y9Z A;  4AYC A;  4C46 A;  2RN0 A;  1LNQ A;  1RE4 C;  2W6B A;  2C0W A;  1RHZ B;  2WSF J;  3C1L A;  2I1J A;  3HUS C;  1UII A;  2CPS A;  2Y0C A;  1BDD A;  3CX5 D;  4R4L A;  3M0A A;  4B86 A;  3H1J J;  1HTL C;  1KB9 I;  5KAI H;  2JWA A;  2H88 C;  4I7Z C;  3SSU A;  2BCC G;  3F5H A;  1SQB E;  4IOI H;  2C9L Y;  4AUW A;  2ZYG A;  2DW3 A;  4ASW A;  1HBW A;  1BE3 D;  1IFN A;  1YJ9 P;  4U3F G;  2NPS B;  1YBK A;  2YIU C;  1S2E A;  3H1H D;  1KQG B;  2B87 A;  2E42 A;  1FJK A;  1SQV E;  1RF0 C;  3L74 E;  3CCM P;  2ZT9 B;  5CHX A;  1JEK A;  2W83 C;  3RBX A;  1NYH A;  1X22 A;  3H1J D;  3EQ2 A;  1J1E C;  1SFC D;  4ASV A;  3PRJ A;  1RF1 A;  2R5B A;  1N73 A;  3KXD A;  2JO1 A;  1KIL E;  1NKN A;  3L75 J;  1SQQ E;  3HE4 B;  3IF4 A;  3MIW A;  3AE4 C;  1EZV E;  2A06 G;  1LGH B;  3H32 A;  3KYQ A;  1VQ9 P;  1NO4 A;  1JMM A;  4UB6 E;  1MFT A;  2HLO A;  3IAO A;  2AEM A;  5KAF E;  3MUD C;  4N78 E;  3TDK A;  3CCR P;  1YIJ P;  2Q9I A;  1FJP A;  1M1J A;  3GW6 A;  2Z4E A;  3H1K G;  2RKL A;  3EWK A;  4YPC A;  2Q3E A;  3CX5 I;  2ZYA A;  5KJ7 D;  3CCQ P;  3L75 D;  1TU3 F;  2K88 A;  2E74 C;  4PD4 E;  2E75 C;  1GTW A;  3LID A;  1J1E B;  5KLV K;  1VQ6 P;  1FZE A;  2JDI H;  1EZV I;  4A7P A;  1VDF A;  1CSB A;  3KQG A;  3TNU B;  3GF3 A;  1GL2 D;  1PGJ A;  1VQM P;  3HUS B;  3VN0 A;  1K04 A;  1JB0 J;  1R5S A;  3M9H A;  1VL2 A;  1VQ8 P;  2BAS A;  3KDP B;  1ZXG A;  1JY2 P;  1IK9 A;  4Y99 C;  3OAK A;  3SFD C;  3U1A A;  4JQ0 D;  3TGU E;  1HWT C;  1NOH A;  4MN4 C;  1GU4 A;  1PP9 J;  3H1I D;  4HKZ H;  4LC1 A;  2E43 A;  1X79 B;  1NVO A;  1GU5 A;  1DD4 A;  2JEE A;  2O01 J;  5GTI H;  1HUC A;  2PFX A;  3UIA A;  1KC8 Q;  2WT7 B;  5C39 A;  1OX3 A;  3RK3 C;  1WMK A;  4ZKU A;  3WUT A;  1NTM J;  3IFM A;  1LT9 B;  1M1J B;  4XE5 B;  4K35 A;  2AXT E;  1FZC B;  2KNC A;  1L4A C;  2GUV A;  3CWB G;  2XKM A;  3HD7 D;  2A06 E;  2R32 A;  3L35 A;  4EDF A;  1R8E A;  1N86 A;  2JP3 A;  1KB9 H;  5B66 H;  3H1H J;  1A02 J;  1CI6 A;  3VYI A;  1ZR4 A;  5AVS B;  2D2C D;  1Q86 Q;  1NU1 E;  1PV3 A;  3P8C D;  1WRG A;  2Q7C A;  3L72 G;  1RE4 A;  1HVV A;  2O3J A;  3PLN A;  1QEX A;  3HUS A;  1USD A;  3AED C;  5AW7 B;  1L0N D;  4DCK A;  1PP9 G;  4GOF A;  3A0H H;  4O9B A;  3AE2 C;  3JCU E;  1BE3 J;  1QL1 A;  3NTN A;  1M56 D;  3U59 A;  2FY8 A;  1Z56 A;  4PD4 H;  3P8M C;  2FYU K;  2ZT9 C;  5APW A;  5AVV B;  4YXD C;  5KLI B;  4H13 B;  1W5C E;  3SFE C;  1Q81 Q;  2HG5 D;  3M06 A;  1DH3 A;  3GHG A;  3CI9 A;  1AA0 A;  1URQ A;  3CWB E;  3L70 J;  5K5G B;  1N7L A;  1PIX A;  1KQF B;  1VQ7 P;  3CCE P;  1QVF O;  1AQT A;  2R5D A;  1DIP A;  1NU1 K;  1IFM A;  1LT9 A;  3RL0 C;  1ZN5 A;  2V7Q H;  2ZVO B;  3VMZ A;  2FFD C;  3P8C E;  1X9V A;  3O6Q B;  1SQP E;  2JKV A;  3RL0 B;  1VQ4 P;  4GKG A;  3L71 E;  1SQX E;  4H0L C;  4R4M A;  1X0T A;  3LW5 J;  1JTH A;  1LTB C;  1NTK D;  2M3E A;  2OGU A;  3B5N C;  1NTZ E;  4N3Y B;  1IJD B;  1LWU B;  1LT9 C;  3FWL A;  1YJW P;  3WUU A;  2H7H A;  2WMM A;  5GTI E;  2R44 A;  1Y8A A;  2YO3 A;  5AVT B;  5CCG D;  2E75 B;  1OVV A;  2PRR A;  2KS1 A;  1EC5 A;  5AW2 B;  2E76 C;  1M1J C;  1ZW0 A;  2WWW A;  3HTK B;  3IR9 A;  3VMA A;  1OWA A;  2KB7 P;  1HGZ A;  1L0L D;  2FFD B;  3JC2 2;  3L73 E;  1PFI A;  1SQV J;  3QH9 A;  1D7M A;  4C7R A;  5AW0 B;  2D2C B;  1NTZ K;  1HGV A;  1N7S C;  3N4X A;  2QJP B;  2WPQ A;  1SQP K;  1KFM A;  1SLQ A;  2KI7 B;  4WBA A;  5AVY B;  3RL0 g;  3TSI A;  3TYY A;  1YI2 P;  3M0D C;  1QL2 A;  4OWF A;  3H1I E;  1Q2N A;  5AVQ B;  4BRY A;  3FXE A;  2B89 A;  4TLF A;  4U3F J;  3JSV C;  1S5L E;  4OH8 B;  1DEE G;  1NTZ G;  3P7K A;  2WSE H;  1SQB D;  2WSS H;  5CCH D;  3QWO C;  3VMY A;  3Q5R A;  1RH5 B;  3OJA B;  3O6Q A;  4OGQ D;  1BCC D;  1LP1 B;  2KSE A;  3RGU A;  1OMI A;  2I1K A;  1GL2 B;  1FAV A;  2IDB A;  3C9I A;  2B87 B;  2E5T A;  2LKM A;  5KKZ B;  2W6J H;  3VOP A;  1L0L G;  1SQV G;  1KIL A;  5L8R J;  1GDT A;  3CX5 E;  1L0L E;  3CCU P;  2Z5H A;  3CPW O;  3R2P A;  1KFN A;  2FKW B;  2NZ2 A;  3AEC C;  2WZ7 A;  1S9K D;  2NRG A;  1T2K C;  2IPP A;  4DT0 A;  4K3A A;  1KD1 Q;  2Q6Q A;  1LTG C;  1JY3 P;  4NPE A;  1KIL C;  1HF9 A;  2Q1K A;  1SQQ D;  1CZQ A;  1YTZ T;  1RQU A;  3BAS A;  3L71 J;  3S4R A;  3BCC J;  2M0B A;  1JY2 N;  5CCG C;  2FYN C;  2IBZ I;  4TT3 H;  2QM7 A;  1EDL A;  3V2N A;  2IFN A;  1Y9B A;  4I1L A;  3AE5 C;  2HPC A;  1EXJ A;  5DJU B;  1G1J A;  1KB9 D;  4DOJ A;  3G6E P;  1ZR2 A;  1L2P A;  1BGY J;  1ZP0 C;  5CJ0 A;  3GMA A;  2IX7 C;  1K8A Q;  2ZXE B;  1UIX A;  5CMZ A;  1NU1 G;  1W2B O;  1H0T B;  4H44 C;  1J1D B;  1URQ D;  5GTH E;  4C7N A;  2YKP A;  3G9R A;  1NTK G;  1NWQ A;  1YIT P;  1BE3 G;  2G3A A;  4IFD K;  2LXB A;  1LP1 A;  3H1I G;  1Q7Y Q;  1HJB A;  2XZR A;  3GHG C;  1E5W A;  2N1T C;  1KOR A;  1BSN A;  1JY3 O; 
#chains in the Genus database with same CATH homology
 4JYB A;  3MTU E;  1GK4 A;  1KQL A;  1SVF A;  3VTP C;  3M91 A;  1MZ9 A;  3VMX A;  2GUS A;  2P7J A;  5APX A;  1S9K E;  2XU6 A;  3OA7 A;  3B5N A;  1IFD A;  1ZV8 A;  2HPC B;  1NTM K;  3G3Z A;  3EFG A;  3HD7 A;  2A45 I;  3H6P A;  3M9Q A;  4I6M C;  4DZO A;  2YO2 A;  1LTI C;  2H8P D;  1IO4 A;  3N7N A;  2N1T D;  4GIF A;  1SQV K;  4HH2 A;  5AVW B;  5AVZ B;  1T3U A;  1T3J A;  2OAR A;  4AQR D;  1URQ B;  1DEB A;  5AW8 B;  2XNX A;  1SQQ K;  3BAT A;  2NPS D;  4ZKP A;  3RK2 C;  2YKO A;  1LTJ B;  4N78 D;  5CJ4 A;  4W80 A;  1JCC A;  1XTC C;  5CCG D;  1JY2 O;  4WY4 C;  1FZC B;  4GT1 A;  3KPE A;  3NFQ A;  1SQX K;  3HD7 B;  3V4Q A;  3HE5 B;  1KZU B;  3PP5 A;  3A7O A;  2XDJ A;  1SQB K;  1LTT C;  1J1D C;  1FZA A;  3SWY A;  1DX7 A;  2A45 G;  2XV5 A;  2KP8 A;  2O01 H;  2HYN A;  1FZF A;  2FXM A;  2Q5U A;  3CL3 D;  1J2J B;  4WY4 D;  3BVH A;  1FZC A;  1RE3 A;  3A2A A;  3RK2 D;  1NTK K;  2NPS C;  4LGD E;  5AVU B;  3M9B A;  5AW5 B;  1HH0 A;  3HRN A;  1RE3 C;  2M3B A;  2WTY A;  2WT7 A;  1X8Y A;  1IFJ A;  3B5N D;  1NH4 A;  2OYH A;  2GM4 A;  3M0D A;  1LWU A;  4EOT A;  3L36 A;  3HE5 A;  3RL0 D;  1L4A B;  3E1I A;  1LTS C;  1GK6 A;  1YYC A;  2VRS A;  3TNU A;  2J59 M;  3LIE A;  3V4W A;  3LW5 H;  5AW3 B;  5AW9 B;  1H8A A;  2WIT A;  3V5B A;  4LLH A;  2Z5I A;  1WT6 A;  3I5C A;  2FYZ A;  2KOG A;  1AFO A;  2JJL A;  2C9N Y;  1IFI A;  1JY3 N;  1G2C A;  2KSJ A;  2W6A A;  3V2Q A;  1KIL B;  2POH A;  3O8Z A;  1GD2 E;  2KYV A;  2HOD B;  2P2U A;  3RK3 D;  1JCD A;  1N7S B;  1URQ C;  5APU A;  4JF7 A;  1JUN A;  2H43 A;  1RY3 A;  4IFF A;  2FFD A;  4M3L A;  1ZLL A;  2N1T A;  1G1I A;  2HFE D;  2IFM A;  3A3Y B;  1EQ7 A;  2YNY A;  5APY A;  2O1K A;  3II6 A;  1KIL D;  3GHG B;  3TK1 A;  3NMD A;  1HWT C;  1FOS E;  5BU5 A;  5KTB A;  5KJ7 C;  5CCH A;  1MUU A;  2NPS A;  3MUD A;  1FU1 A;  3NXS A;  5BVZ A;  2O1J A;  1GZL A;  1LTJ C;  3L4F A;  5KJ7 A;  1A02 F;  3RK2 B;  3V2R A;  2HOD A;  5CCH C;  5APT A;  3VP8 A;  1N2D C;  1SFC C;  1MV8 A;  2OYH C;  1GL2 A;  3HE4 A;  1GW4 A;  1AQ5 A;  3H32 B;  1LTJ A;  1LWU C;  2C0X A;  1N7S D;  1NKZ B;  1MFZ A;  1SFC A;  2N1T B;  4RES B;  1CI6 B;  2J58 A;  3L37 A;  3RL0 B;  3V2P A;  2YMY A;  1GU4 A;  1XTG B;  2OYI B;  2L5G B;  3T97 A;  3U1C A;  1VPC A;  1H88 A;  2Q3I A;  3B8E B;  3MD0 A;  2WSC H;  4WY4 A;  1JNM A;  1L0L K;  2CPB A;  1LTA C;  4N6J A;  2W27 A;  2QM8 A;  2P1J A;  2PAJ A;  4IFM A;  4KHX A;  1NHL A;  2N9B A;  1OXZ A;  3SWF A;  1W2E A;  3P32 A;  4W7Z A;  3A5T A;  5CCG A;  1CW5 A;  1JO5 A;  2OYH B;  1T8Z A;  1SFC B;  1JTH B;  5APS A;  2ZFC A;  1RF0 A;  3V2N A;  2R3C A;  1SP4 A;  4I2L C;  5AW1 B;  5APV A;  3RK3 B;  3WMM 0;  2OYI A;  4XA4 A;  3B5N B;  1M7L A;  1FBM A;  1RF1 C;  1GW3 A;  1N73 C;  1FZC C;  1H89 A;  2OYI C;  1L0N K;  4Y99 B;  3HD7 C;  1L4A D;  1FDM A;  4WY4 B;  5APQ A;  1IC2 A;  3BRT B;  5AVX B;  5AW6 B;  1FZB A;  2YKQ A;  1JOC A;  2A45 H;  1N7S A;  3VP9 A;  2P67 A;  1GL2 C;  2PP6 A;  3BRV B;  4W7Y A;  5BU8 B;  5AVR B;  2MJZ A;  1FZG A;  1G2C B;  4WB4 A;  1NAF A;  4EIJ A;  2WSF H;  3CLQ A;  3MGN A;  2M8R A;  1RF1 B;  1N73 B;  1YTZ I;  2WPR A;  1L4A A;  1FOS F;  2WPS A;  5AW4 B;  4HYT B;  1T2K D;  4JYC A;  2KLV A;  3HTK A;  4C7N B;  4AYC A;  4C46 A;  1RE4 C;  2W6B A;  2C0W A;  3HUS C;  2I1J A;  2CPS A;  3M0A A;  4B86 A;  1HTL C;  4AUW A;  2C9L Y;  1HBW A;  1IFN A;  2NPS B;  2E42 A;  1FJK A;  1RF0 C;  5CHX A;  3EQ2 A;  1J1E C;  1SFC D;  1RF1 A;  2R5B A;  1N73 A;  1NKN A;  1T2K C;  3HE4 B;  3MIW A;  3H32 A;  3KYQ A;  1LGH B;  1NO4 A;  1JMM A;  2HLO A;  4N78 E;  1FJP A;  2Q9I A;  1M1J A;  2Z4E A;  5KJ7 D;  1GTW A;  3LID A;  1J1E B;  5KLV K;  1FZE A;  1VDF A;  1CSB A;  3KQG A;  3TNU B;  1GL2 D;  3HUS B;  3VN0 A;  3M9H A;  2BAS A;  3KDP B;  1JY2 P;  1IK9 A;  4Y99 C;  3OAK A;  3U1A A;  1NOH A;  4LC1 A;  2E43 A;  1X79 B;  1GU5 A;  2JEE A;  1HUC A;  3UIA A;  2WT7 B;  3RK3 C;  4ZKU A;  3IFM A;  1LT9 B;  1M1J B;  4XE5 B;  1L4A C;  2GUV A;  2XKM A;  3HD7 D;  2R32 A;  3L35 A;  1N86 A;  1A02 J;  1CI6 A;  3VYI A;  1ZR4 A;  5AVS B;  3P8C D;  1WRG A;  2Q7C A;  1RE4 A;  1HVV A;  3HUS A;  5AW7 B;  4O9B A;  1QL1 A;  3NTN A;  3U59 A;  1Z56 A;  3P8M C;  2FYU K;  5APW A;  5AVV B;  1DH3 A;  2HG5 D;  3M06 A;  3GHG A;  3CI9 A;  1URQ A;  1N7L A;  2R5D A;  1NU1 K;  1IFM A;  1LT9 A;  3RL0 C;  1ZN5 A;  3VMZ A;  2FFD C;  3P8C E;  1X9V A;  4GKG A;  1JTH A;  1LTB C;  4N3Y B;  3B5N C;  1IJD B;  1LWU B;  1LT9 C;  2H7H A;  2YO3 A;  5AVT B;  5AW2 B;  1M1J C;  2WWW A;  3HTK B;  3IR9 A;  1OWA A;  2KB7 P;  1HGZ A;  2FFD B;  1PFI A;  4C7R A;  5AW0 B;  1NTZ K;  1HGV A;  1N7S C;  3N4X A;  4WBA A;  2WPQ A;  1SQP K;  1KFM A;  1SLQ A;  5AVY B;  3TYY A;  3TSI A;  3M0D C;  1QL2 A;  5AVQ B;  4OH8 B;  3P7K A;  2WSE H;  5CCH D;  3VMY A;  3OJA B;  2I1K A;  1GL2 B;  1FAV A;  3C9I A;  2LKM A;  3VOP A;  1KIL A;  1GDT A;  2Z5H A;  3R2P A;  1KFN A;  2FKW B;  1S9K D;  2WZ7 A;  2IPP A;  1LTG C;  1JY3 P;  1KIL C;  3BAS A;  1CZQ A;  1YTZ T;  1JY2 N;  5CCG C;  2QM7 A;  2IFN A;  4I1L A;  2HPC A;  1G1J A;  4DOJ A;  1ZR2 A;  5CJ0 A;  2IX7 C;  2ZXE B;  5CMZ A;  1J1D B;  1URQ D;  4C7N A;  2YKP A;  1NWQ A;  4IFD K;  1HJB A;  2XZR A;  3GHG C;  1E5W A;  2N1T C;  1JY3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...