1LT9B

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 89
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9B03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9B02
3E1IB 1FZEB 2XNXC 1LT9A 1FZGB 1N86A 3H32B 2JHIF 2J61A 2Z4EC 1FIBA 2HODC 3BVHC 2J3FD 2HLOB 2J0YA 2H43B 3H32A 1W2EA 1LWUC 1FZFB 2Q9IB 1M1JB 2HLOA 2H43A 2J3GA 1LTJC 1FZFA 1RE3C 2Q9IA 1LT9C 2JHHC 1RF1A 2FFDB 1N86B 3E1IC 2J61B 1FZEC 1FZAA 1FZCB 1Z3SA 4EPUA 1RF0B 2FFDA 1FZGC 4JYOX 2A45H 3H32C 4NYTA 2OYIB 1FZCA 1RF0A 2J5ZA 2D39A 2H43C 2J3FA 2OYIA 4M7HA 2J3OA 1FZDA 2A45G 2Q9IC 1M1JC 1RF1B 1JC9A 1JY2P 2J1GA 2FIBA 1FZAB 1FZBB 3GHGB 2OYHB 1N86C 2JHLF 2J0HA 1FICA 1FZBA 3GHGA 1FZCC 3HUSB 2OYHA 2JHKF 1LWUB 4JZCA 2HODA 2J64A 2OYIC 2GY7A 3HUSA 4R9JA 1JY3P 2HLOC 1LWUA 2HPCB 1JY3N 1N73B 2J0GA 1FZFC 1RE4B 2A45I 1M1JA 2J60A 1T3UA 1Z3UA 1LTJA 1RF1C 2HPCA 2XNXB 1RE3A 1JY2N 1N73A 1RE4A 2J3UA 1FZAC 1FZBC 2J2PA 4M7FA 3GHGC 3E1IA 2XNXA 2FFDC 2WNPF 4R9TA 1FZEA 2OYHC 2Z4EB 2HODB 3BVHB 4ZFGA 1FZGA 1LT9B 1JY3O 1RF0C 3HUSC 1FIDA 3FIBA 2Z4EA 3BVHA 1JY2O 1LTJB 1RE3B 2HPCC 2JHMF 1N73C 1RE4C
chains in the Genus database with same CATH superfamily
3CMEP 3AE6C 1BGYD 4PJ0E 2L91A 2Q6QA 5GTHE 2MJZA 3WMM0 2Y9ZA 2Q3EA 1H0TA 1FOSE 5APTA 3L71D 4H13B 1H88A 4HYTB 2LXBA 2NZ2A 2I1KA 2QM7A 3CX5D 3V4WA 1HGZA 1P84I 2BCCG 1LTJC 1FZFA 2JWDA 4YXWH 3IAOA 3C9IA 3BASA 3L72J 1EQ7A 1KB9E 1BCCJ 3H1LG 1K73Q 1VQ4P 1VQNP 1X0TA 2Q1KA 1AA0A 3RL0B 2KIKA 2KNCA 4R9JA 2LKMA 2V7QJ 2J0GA 3FX0A 2D2CD 1RE4B 2A45I 4I7ZB 1T3UA 2XZRA 3L73E 2YKOA 2E75B 1HTLC 2KLVA 2QVAA 3NFQA 2G3AA 2WSCJ 3KZIH 1GW3A 5KLVE 1SQBJ 3AEEC 1RQVA 1YIJP 2WSEH 4PV1B 3A0BH 4L75A 3CI9A 3IFMA 3GF7A 4H0LD 1VQ5P 1N7SA 2V4HA 1SQVE 1KMIZ 1NTZK 1JEKA 1N86A 1L4AC 2YMKA 1PPJD 3CL3D 2OTLP 2H43B 2LXCB 3FWNA 1RE3C 2J61B 5KAIE 1JUNA 2QG4A 3AE3C 1EXJA 3H32C 4RESB 3JSVC 2JKVA 2IZ0A 3Q5RA 1IZNB 2J3OA 1JC9A 4N78E 4L73A 1L0LK 1J1DB 4BRYB 1S9KD 2BCCJ 3M9BA 3BCCE 3TNUA 2NPSC 2M3BA 1NTMG 3P32A 2R3CA 1VF5D 3AE8C 3AEDC 1G1IA 1RF1C 1SS1A 1GU4A 2P2UA 1S3JA 3H1LJ 3L75G 2IYOA 3D71A 2XNXA 1FZEA 1T6AA 3HD7A 2QA4P 3WU2E 5B66H 5KAFH 1FDIA 1LTJB 1LJ2A 5CCGC 2WT7A 2J1GA 2KI7B 5KJ7D 4GDOA 1SQXG 1URQA 3CC2P 2FYUG 2HODC 3S4RA 2HR3A 2E42A 3V2RA 2ZXXA 2D2CC 1NU1E 2FXMA 3CWBD 3JCUE 3USSA 4LC1A 1HJ0A 2Z5HA 1E79H 2GM4A 2KSJA 4AYCA 3H6PA 2O1JA 3F89A 3GW6A 3PTZA 2M0BA 2WSEJ 1GW4A 1KFMA 2QJKC 5APWA 2WSFH 2OYIA 1BGYE 3G71P 1M1JC 2XU6A 5AVZB 1VQ7P 3H1KD 2XKMA 5CMZA 1Y8AA 3MUDA 1CSBA 1EDLA 3CXHD 4JBZA 3L72D 4JPZB 4ASWA 1BCCD 1GU5A 1DH3A 1OW8A 3FWLA 3EQ2A 1JY2N 1L4AB 1PFIA 2FXPA 3FIBA 1OIPA 1SQQK 2KZJA 3RL0g 4XFJA 1RE3B 1IFPA 3I55P 4DCKA 1GL2C 3MGNA 1BDCA 2BEZF 1NTMJ 2IFMA 2IDBA 2IZ1A 3RK3C 3MP7B 3H32B 2JHIF 1OXZA 3T97A 1GK6A 4NPEA 2HLOA 3PRJA 2J3GA 2JJLA 1VF5C 1W2BO 2C9NY 1SLQA 3KDPB 2N1TD 4WY4A 4W7ZA 1XTCC 3SWKA 1R5LA 4OH8B 1P84D 1NO4A 3UIAA 2WWWA 3I56P 3B5NA 1YQ4C 2NPSB 1KORA 2J5ZA 1OVVA 1SQXJ 2FY8A 4GODA 2FYUJ 2CPBA 4I6MC 1RF1B 1JY2P 4OWFA 4YPCA 4EIJA 2FIBA 4JYCA 1MZ9A 2PGDA 1S5LH 1OX3A 2JEEA 5KJ7A 1SP4A 1PL5A 3H1IG 1L0NK 2OYHA 2XDJA 1MFZA 3PHLA 2UWJE 4D6TE 2WPVB 2K9JA 1NYHA 3RGUA 5CBNA 3Q2YA 2R44A 3PH0A 1EZVG 3E7KA 5CCHA 2HODB 4ZFGA 2BCCD 5APXA 2WSFJ 2AXTH 2FBWC 1SVFA 1WMKA 2C0XA 2D2CB 3TSIA 3RK3E 3KXDA 4PD4H 1KV4A 1FE6A 3LW5H 1L0LG 3TGUG 3H1LD 3H1JE 3U1CA 3CCUP 1CZQA 2QJKB 3R2PA 3CC7P 1M1JB 1Z56A 3VMAA 2O1KA 1NTZE 1BSHA 4H0LB 1K05A 1JNMA 5AVTB 1KILC 4GOEA 2E75C 1KQSO 1SFCA 5AVXB 1EZVI 1S2EA 4DZOA 1NU1K 3CCSP 2POHA 3CPWO 2AXCA 3OW2O 1A02F 3V2NA 1OW7A 5GTIH 1FJPA 5AVYB 4EI2A 3AE2C 3CCQP 1FZBA 1S4XA 4K35A 3M9HA 4PD4I 4PJ0H 2Y0CA 2YNYA 5GTHH 2GY7A 3HUSA 2E74C 2RKLA 1LWUA 2KK7A 1IFDA 1N7SD 1GL2B 1IK7A 2KYVA 3TYYA 2N1TC 1KYOH 3GHGC 4ZMDA 4R9TA 2ZT9D 1AJYA 2KXPB 4A7PA 3H1KE 2OTJP 2Y9YA 2A06E 4ZKPA 2WTYA 3H1IJ 3F5HA 2M5AA 1VF5B 3H1HD 1KB9H 1DEEG 3OA7A 5AVRB 3WUVA 2P58A 2JWAA 2J61A 2Z5IA 2QJYC 2PRRA 1KILE 4IFMA 3KQGA 1EDKA 2YKQA 3RBXA 1NTKE 1RF0B 3M0AA 2FFDA 2A45H 1L0LJ 1KYOI 3TGUJ 2IPPA 2J3FA 3L73G 3L75D 3HE4B 1R8EA 1FZDA 2A45G 4EYYQ 1KYOE 3BRTB 1FBMA 2WPSA 3L74J 3LW5J 5KLVG 1YITP 3HD7D 1BE3E 1EDIA 1KB9I 4DJGA 5APUA 4C7RA 1SQPD 1AQTA 1JY3N 1SQXD 1ZP0C 1SQVG 2FYUD 1LTJA 2Q3IA 4XA4A 1URQD 1IK9A 4M7FA 2WNPF 4TLFA 1M57D 3R4YA 2Z4EA 5KAIH 1ZN5A 2KOGA 2VRSA 4R4MA 1KILB 2KUBA 1FDMA 3PP5A 3VOPA 1ZR4A 1KFNA 1SQQE 1LGHB 1X79B 2OARA 3S1KA 1J1EC 3AEBC 1FIBA 3A0HE 1QL2A 4IOIH 1GDTA 2N9YB 4AQRD 1YTZT 3AECC 1H8AA 3BCCG 2ZT9C 2IYPA 1FZCA 2E74B 2XNDH 1USEA 3TDKA 2ZXEB 3WU2H 1M90Q 2ZAEB 3QWOC 1X8YA 2N1TB 2WVRA 1IJDB 1T2KD 3GHGB 1ZMEC 2I8DA 1L4AA 3O6QA 2JHKF 2E43A 2J64A 1AVOA 2E5TA 5CBOA 5B5EE 1L0NE 2HPCA 1RE3A 4KHXA 3CCJP 3L73J 2J2PA 1ZRTE 4Z1MH 1NWQA 3JCUH 1LP1B 2QJYB 3P8CD 1TU3F 1JM0A 5KLVJ 1FIDA 2OQQA 2M8RA 1LTSC 1NU1G 1MV8A 1YHQP 3M0DC 4WY4D 1Y9BA 2WSSH 4U7JA 5CHXA 5DJUB 2XNXC 4RJTA 1HGVA 1LT9A 3B5ND 1SQVJ 4C46A 3L70E 1H0TB 5H2FH 1PGOA 1YI2P 1BGYG 4OGQD 1QLED 3HRNA 1FZFB 3VP9A 2NPSA 3OJAB 3H1ID 1NHLA 2E76D 2O01H 2ITAA 1USDA 1RF1A 1URQC 1JB0J 1YJWP 4W7YA 4JYOX 3H1HE 2KP8A 1FU1A 2IBZI 3K5BA 4IL6X 1QGKB 3V2QA 2SPZA 4IL6E 3SFDC 1VQMP 1NTKK 2IBZE 1PZQA 3PJSK 1EZVD 5CCGA 2H89C 5CCHD 4U3FE 1U57A 2JHLF 2J0HA 1FICA 2HG5D 1DIPA 1KQLA 3CCRP 3HE5A 1PP9E 2HODA 2OYIC 3BCCJ 1ZR2A 1YJ9P 4H13D 1L0LD 3TGUD 2QE7H 3Q1MA 1VQOP 4H0LC 5H2FE 1FZAC 4JQ0D 3CX5I 2AEFA 1IFMA 1J1EB 3L71E 3M9QA 3L75E 3W67A 3CX5E 1PGPA 3U1AA 1VPCA 1NAFA 1JY2O 1N7SB 3AEFC 2JHMF 1M1JA 1VL2A 1SFCD 2B87A 4YTPC 1LTAC 2R5DA 2ZT9B 1FC2C 1SQPE 2OYOA 2KS1B 3EWKA 1PGQA 3PLNA 1YYCA 3ITKA 2WPQA 3CC4P 1N7LA 1JMBA 2Y0EA 5CJ4A 1YJNP 2Q9IA 1RQUA 1N8RQ 1NU1J 3E1IC 1NKNA 1Z3SA 3G3ZA 3L36A 5AW5B 1FZGC 4D6TG 2E5YA 1SQBD 2K88A 4PV1D 5BVZA 1JCCA 1HH0A 3A3YB 4QMAA 1BGYJ 4WY4C 1BSNA 1GL2A 3TNUB 3B5NC 2O01N 3CMAP 3AEAC 3W68A 2KZIA 4JZCA 2JP3A 1FJKA 2O01J 1JMMA 2ZJSE 1KB9D 2E76C 2XNXB 1N73A 2H7HA 4UB8E 5KJ7C 3H1JG 3HD7B 1PPJE 4W80A 2KB7P 2OYHC 2G8YA 2QM8A 1RF0C 1NTZG 3AE9C 2WT7B 3BVHA 1WRGA 2DW3A 2WQYC 3SWYA 2W6JH 4EOTA 1URQB 4RO0A 5CCHC 1LTBC 3LIDA 3IF4A 2YMYA 3L73D 3VP8A 2J3FD 5K5GB 2RH0A 5KLVD 1CI6B 3TK1A 1S9KE 3O8ZA 3BATA 3P8CE 1OFCX 2JHHC 1HWTC 4EPUA 1RY3A 4I2LC 1HUCA 1SQVD 2B89A 2OYIB 2Y0DA 3CCVP 1JTHB 1DEBA 2KLUA 1PGJA 4WVZA 5TISE 3L74G 3IR9A 4M3LA 1G1JA 1VQKP 4UB6H 2YXRB 1FZAB 3VYIA 1SFCC 1VQ6P 1WT6A 3G6EP 1LTGC 3H1KG 3M06A 1OVRA 1K8AQ 2A06G 5AW6B 2K3RA 2Q7CA 3EFGA 2P1JA 1AVYA 4D6TJ 4AUWA 3FXDA 5CJ0A 1IFJA 1RE4A 2XV5A 2J3UA 5AVWB 1FZBC 4N78D 3EFFK 3RBZA 1KN7A 2OTKE 3HUSC 2WITA 3CWBE 2B9BA 1XTGB 5AW0B 1Q90D 2GUVA 3BCCD 3C8VA 2V7QH 1GTWA 1NTKG 2M3EA 3E1IB 2H88C 1IO4A 2W83C 1FZGB 3T97B 1ZW0A 3A5TA 3H1JJ 3CD6P 2HLOB 1PIXA 4CPGA 4UB6E 1SQPK 2J58A 1QX8A 2H43A 4WY4B 2PAJA 3V6IA 1HVVA 1BE3G 1NTZJ 2FYUK 3B5NB 2WMMA 3CXHE 1L4AD 2PP6A 4HH2A 3L72E 1KQFB 1BCCE 2RN0A 4NYTA 4OGQB 2ZYGA 4ZNCA 2D39A 2OGUA 3L4FA 4C7NB 2E76B 3VN0A 5AW4B 2H8PD 1IC2A 3GG2A 2OYHB 1W5CE 1CW5A 2I1JA 1NU1D 1NTMD 4BRYA 3SSUA 2K9JB 1LP1A 2CPSA 2LR2A 2MKVA 2ZVNB 3G4SP 2GA1A 1FZFC 3A0HH 1Q7YQ 4KT0J 1SQQG 1T8ZA 3NMDA 3MD0A 1SQBE 1UIXA 3CCLP 1ZXGA 1KQGB 1JY3O 3Q5PA 2NPSD 1BDDA 4LLHA 2J59M 3H1KJ 1NAYA 1L2PA 4JYBA 1P84E 4EDFA 1QL1A 2QRXA 2Z4EC 5E79H 3HTKB 1M7LA 5BU5A 2P67A 4IFFA 5CCGD 4TT3H 3AE1C 1SFCB 5KTBA 1D7MA 1AFOA 3C1LA 2W6BA 3V5BA 5B5EH 3D6YA 1S1CX 2ZYAA 3S9OA 4L74A 4K3AA 1NTKJ 1GD2E 2K37A 1U7JA 1M1KQ 1RHZB 1EDJA 1L0NG 1OW6A 4H44D 4L76A 2O3JA 1N7SC 4HB1A 1FZBB 2BCCE 2PFXA 4BWNA 1A02J 1DD3A 1N86C 1FZCC 1MUUA 3HUSB 1BE3J 1LWUB 1QEXA 1LTTC 1S72P 1JY3P 1G2CB 5AW8B 1KD1Q 3VTPC 1RH5B 3H1LE 1QVGO 3L70G 5E79E 3CLQA 2M5AB 1OVUA 2KS1A 5APYA 3N7NA 3H25A 1ZV8A 2BEQD 5AW2B 2HPCC 3II6A 3G9RA 3MZWB 2ZYDA 4D6TD 4IL6H 1EXIA 1ZOYC 3H1HG 5KKZC 4JF7A 5BU8B 3MIWA 1SQQJ 2IBZG 2QSIA 3H32A 5APQA 5EFWB 1VQLP 2YKPA 4XE5B 3RK2D 4BXLA 1FDOA 1GL2D 3KZIE 4U3FG 1LT9C 4NPFX 2FFDB 1GZLA 3RK3D 1FZEC 1PP9G 1NKZB 3HD7C 3A0BE 1LNQA 3FGAD 4HKZH 4WB4A 3IN6A 2RMZA 1HF9A 3CCEP 2FXOA 2IFNA 3H1JD 1ZLLA 3CX5H 4N3YB 3M0DA 2R3SA 3L71G 4NPDA 1NTZD 1N2DC 1IFIA 2L5GB 3P7KA 3SFEC 4B86A 2JO1A 2CK3H 1UIIA 3MHVA 3SWFA 4Y99C 1Z3UA 4GIFA 3ZDMA 1SQPG 4GOFA 1L0NJ 2R32A 3LIEA 2Z4EB 2ZFCA 2KNCB 1U7MA 1SQBK 2FYNC 4GT1A 1PV3A 1JCDA 2WZ7A 3L35A 4H44C 4MN4C 1CI6A 1NTME 1X9VA 4LGDE 3BRVB 4PD4D 3AEGC 5AW9B 3L74D 3MUDC 3D6ZA 1HJBA 4WWIA 1YBKA 1VQ9P 2ZVOB 3NTNA 2YIUC 3L70J 1LT1A 1JO5A 1W2EA 2W90A 1Q82Q 5AW3B 1JTHA 1K04A 2A06D 5M1BA 1AQ5A 2KSEA 1N86B 3V2PA 1T2KC 5B66E 5KAFE 2IX7C 1KC8Q 3I5CA 4GKGA 1FZAA 1FZCB 1NVOA 1E5WA 4UB8H 1SQXE 3RL0D 2FYUE 3H1HJ 1OMIA 3FXEA 1K9MQ 2GUSA 3V4QA 2Q9IC 3A7OA 1PPJG 5KLIC 1KILD 2K9YA 3ABVC 3Q3DA 2E75D 3O6QB 1LTIC 2QJPC 2K1AA 4U3FJ 2C9LY 3AE5C 5AW1B 3KPEA 1IFNA 4DT0A 1NTKD 1OZHA 5AVUB 1PP9J 1GMJA 1NH4A 1R5SA 2HLOC 3RK2C 2HPCB 5KLVK 2HFED 1AV1A 5TJHA 3AE4C 1KZUB 5KKZB 1KYOD 3E1IA 2P7JA 3E1RA 4YXDC 2QEXP 4N6JA 1VDFA 1FZGA 3L71J 5C39A 3L75J 2Q5UA 1SQVK 1BE3D 2E74D 2R5BA 4OGQC 3WUTA 5L8RJ 1FS0E 1LT9B 2YO3A 5TISH 1N73C 1FAVA 1FZEB 1VQPP 4O9BA 4KJMA 3CCMP 3B71A 1M8OB 2YO2A 1SQPJ 3BVHC 5AVSB 1DD4A 1VQ8P 4C7NA 5AVVB 2QIWA 4DOJA 4I1LA 2JDIH 1RF0A 1SQQD 1YQ3C 4M7HA 4H13C 4Y99B 1KTMA 1Y47A 3Q5SA 3HE4A 1QVFO 1JOCA 3HE5B 3VMZA 1X22A 5AW7B 2N9BA 5APSA 3NXSA 3CWBG 1J2JB 1GK4A 1MFTA 3JC22 2FYNB 2YXQB 3AE7C 2C0WA 4H44B 2J60A 3KHUA 3A2AA 2BASA 5APVA 1HBWA 3L37A 2JR8A 2W8ZA 2YIUB 3H1IE 3RL0C 3CXHH 4ZKUA 1S5LX 3OAKA 2B87B 1S5LE 3HTKA 1RE4C 4I7ZC 3L72G 2J5UA 1Q86Q 1BCCG 1KILA 2NRGA 1L0ND 3B8EB 1FOSF 3KYQA 1NTMK 1EZVE 2HYNA 1ZRTD 2J0YA 1DX7A 1LWUC 4ASVA 2FYZA 1OWAA 1H89A 3GMAA 2Q9IB 3VMXA 5KLIB 1NOHA 4PV1C 2QJPB 2P10A 2AXTE 4OVNF 2AEMA 2W6AA 2WSCH 3U59A 4R4LA 1L0LE 3TGUE 3RK2B 3L70D 4PD4E 3QH9A 2H43C 4IFDK 3L74E 1SQBG 3MTUE 4WBAA 1SQXK 1G2CA 3WUUA 2B88A 1Q81Q 3CXHI 3RK3B 2FKWB 1M56D 2N1TA 4RKUJ 1P84H 3GHGA 1NGMB 1EC5A 3TF5A 1NJIQ 5AVQB 4HJGH 3N4XA 3B4SA 3P8MC 1N73B 3GLMA 3M91A 4Y28J 2IBZD 3D70A 1MKMA 5DJTB 1J1DC 3VMYA 2FFDC 3GF3A 1T3JA 3BVHB 2W27A 1Q2NA 4U3FD 1YTZI 2AEJA 2WPRA 5GTIE 1PP9D 3CWBJ
chains in the Genus database with same CATH topology
1SFCD 3LW5H 1LTAC 2R5DA 4JF7A 5BU8B 3MIWA 2MJZA 3U1CA 3WMM0 1CZQA 3R2PA 3H32A 5APQA 1FOSE 5APTA 2YKPA 4XE5B 3RK2D 1H88A 4HYTB 1M1JB 1YYCA 2QM7A 1Z56A 2I1KA 2WPQA 3V4WA 2O1KA 1HGZA 1N7LA 1GL2D 1LTJC 1FZFA 1JNMA 5CJ4A 2Q9IA 5AVTB 1LT9C 1KILC 2FFDB 3E1IC 1GZLA 1NKNA 3RK3D 1FZEC 1SFCA 5AVXB 1NKZB 3G3ZA 1Z3SA 3HD7C 3L36A 5AW5B 1FZGC 3C9IA 4WB4A 4DZOA 1NU1K 3BASA 2POHA 1EQ7A 2IFNA 1ZLLA 1A02F 5BVZA 1JCCA 3V2NA 1HH0A 4N3YB 3A3YB 3M0DA 4WY4C 1FJPA 1GL2A 5AVYB 3TNUB 1N2DC 1IFIA 3B5NC 1FZBA 2L5GB 3P7KA 3RL0B 3M9HA 4JZCA 2YNYA 2GY7A 4B86A 3HUSA 1FJKA 4R9JA 2LKMA 1LWUA 1IFDA 1JMMA 2J0GA 3SWFA 1RE4B 1N7SD 1GL2B 2A45I 4Y99C 1T3UA 1Z3UA 4GIFA 2XZRA 2KYVA 2YKOA 2XNXB 1HTLC 1N73A 2H7HA 3TYYA 5KJ7C 2KLVA 3HD7B 2N1TC 4W80A 2R32A 3NFQA 3GHGC 4R9TA 2KB7P 3LIEA 1GW3A 2OYHC 2Z4EB 2ZFCA 2QM8A 1RF0C 2WSEH 1SQBK 2WT7B 3BVHA 4ZKPA 2WTYA 1WRGA 3CI9A 4GT1A 1JCDA 2WZ7A 3L35A 3IFMA 1CI6A 3OA7A 1X9VA 3SWYA 4EOTA 5AVRB 1N7SA 4LGDE 1URQB 3BRVB 5CCHC 1LTBC 3LIDA 5AW9B 1HJBA 2YMYA 1NTZK 1N86A 1L4AC 2J61A 2Z5IA 3NTNA 3VP8A 2J3FD 3CL3D 1JO5A 2H43B 1W2EA 5AW3B 1CI6B 1JTHA 3TK1A 4IFMA 1RE3C 3KQGA 1S9KE 3O8ZA 3BATA 3P8CE 2JHHC 1AQ5A 2YKQA 1N86B 3V2PA 1T2KC 2IX7C 2J61B 1HWTC 3I5CA 4GKGA 1FZAA 1FZCB 1JUNA 4EPUA 1E5WA 1RY3A 3M0AA 1RF0B 2FFDA 4I2LC 1HUCA 2A45H 3H32C 2OYIB 1JTHB 4RESB 1DEBA 3RL0D 3IR9A 2IPPA 4M3LA 2J3FA 2J3OA 2GUSA 3V4QA 3HE4B 1FZDA 2A45G 2Q9IC 1JC9A 3A7OA 3BRTB 4N78E 1FBMA 2WPSA 1KILD 1L0LK 1G1JA 1FZAB 3VYIA 1SFCC 1J1DB 1WT6A 1LTIC 3HD7D 1S9KD 1LTGC 3M06A 2C9LY 5AW1B 3KPEA 1IFNA 3M9BA 3TNUA 5APUA 4C7RA 5AW6B 5AVUB 2NPSC 1NH4A 2M3BA 2Q7CA 3P32A 3EFGA 2HLOC 2P1JA 3RK2C 2HPCB 2R3CA 5KLVK 1JY3N 4AUWA 2HFED 1G1IA 1LTJA 1RF1C 2Q3IA 4XA4A 5CJ0A 1IFJA 1RE4A 2XV5A 2J3UA 1KZUB 1URQD 2P2UA 1GU4A 5AVWB 1FZBC 1IK9A 4M7FA 3E1IA 4N78D 2XNXA 2WNPF 2P7JA 1FZEA 4N6JA 3HD7A 1VDFA 1FZGA 3HUSC 2WITA 2Q5UA 1SQVK 2Z4EA 1ZN5A 2KOGA 2VRSA 2R5BA 1XTGB 5AW0B 2GUVA 1LTJB 5CCGC 1GTWA 1LT9B 2YO3A 2WT7A 1N73C 2J1GA 1KILB 1FAVA 5KJ7D 1FDMA 3PP5A 3E1IB 3VOPA 1IO4A 1FZEB 1ZR4A 1KFNA 1FZGB 1LGHB 1URQA 1X79B 4O9BA 2OARA 1J1EC 3A5TA 2YO2A 1FIBA 2HODC 3BVHC 2HLOB 1QL2A 5AVSB 1GDTA 2E42A 3V2RA 1SQPK 2J58A 2H43A 4WY4B 2PAJA 1HVVA 4AQRD 2FXMA 2FYUK 4LC1A 4C7NA 1YTZT 2Z5HA 5AVVB 4DOJA 2GM4A 3B5NB 1H8AA 1L4AD 2KSJA 2PP6A 4HH2A 4AYCA 4I1LA 3H6PA 2O1JA 4NYTA 1FZCA 1RF0A 1GW4A 1KFMA 2D39A 3L4FA 5APWA 2WSFH 2OYIA 4M7HA 4Y99B 4C7NB 1M1JC 2XU6A 2ZXEB 5AVZB 3VN0A 1X8YA 2XKMA 2N1TB 5AW4B 1IJDB 3HE4A 1T2KD 1JOCA 3GHGB 5CMZA 2H8PD 3HE5B 1IC2A 3VMZA 2OYHB 5AW7B 1CW5A 2N9BA 2I1JA 5APSA 3MUDA 1CSBA 3NXSA 1J2JB 1GK4A 1L4AA 2JHKF 2E43A 2J64A 2CPSA 1GU5A 1DH3A 2C0WA 1FZFC 2J60A 3EQ2A 2HPCA 1RE3A 1T8ZA 4KHXA 1JY2N 3A2AA 3NMDA 3MD0A 2J2PA 2BASA 1L4AB 5APVA 1NWQA 1HBWA 3L37A 3P8CD 1PFIA 1JY3O 2NPSD 1FIDA 3FIBA 3RL0C 2M8RA 4LLHA 1LTSC 4ZKUA 2J59M 1SQQK 3OAKA 1MV8A 1RE3B 3HTKA 3M0DC 4WY4D 1RE4C 4JYBA 1GL2C 3MGNA 5CHXA 2XNXC 1QL1A 1HGVA 1LT9A 2IFMA 1KILA 3RK3C 3B5ND 4C46A 3B8EB 1FOSF 3H32B 3KYQA 2JHIF 1NTMK 2Z4EC 1OXZA 2HYNA 2J0YA 1DX7A 3T97A 1LWUC 1GK6A 1M7LA 2FYZA 3HRNA 1OWAA 3HTKB 3VP9A 2NPSA 5BU5A 2P67A 1H89A 1FZFB 4IFFA 2Q9IB 3VMXA 5CCGD 1NOHA 2HLOA 3OJAB 2J3GA 2JJLA 2C9NY 1NHLA 2O01H 1SFCB 5KTBA 1AFOA 1SLQA 2W6BA 1RF1A 3KDPB 2N1TD 4WY4A 3V5BA 4W7ZA 1URQC 1XTCC 4OH8B 2W6AA 4W7YA 1NO4A 3UIAA 4JYOX 2WSCH 1GD2E 3U59A 2WWWA 3B5NA 2KP8A 1FU1A 2NPSB 3V2QA 2J5ZA 3RK2B 2H43C 1NTKK 2CPBA 4IFDK 4I6MC 1RF1B 1JY2P 1N7SC 3MTUE 4WBAA 1SQXK 1G2CA 5CCGA 4EIJA 2FIBA 5CCHD 1FZBB 3RK3B 4JYCA 1MZ9A 2FKWB 1A02J 1N86C 2JEEA 2JHLF 5KJ7A 2J0HA 1FICA 2N1TA 1SP4A 2HG5D 3GHGA 1FZCC 1KQLA 1MUUA 3HE5A 3HUSB 1L0NK 2OYHA 1LWUB 2XDJA 2HODA 1MFZA 5AVQB 1LTTC 2OYIC 1ZR2A 3N4XA 1JY3P 1G2CB 5AW8B 3P8MC 1N73B 3M91A 3VTPC 1FZAC 1J1DC 3VMYA 5CCHA 2FFDC 1IFMA 1J1EB 1T3JA 3M9QA 2HODB 3CLQA 3BVHB 2W27A 4ZFGA 5APXA 1YTZI 3U1AA 5APYA 3N7NA 2WPRA 1VPCA 1ZV8A 1NAFA 1SVFA 1JY2O 2C0XA 1N7SB 5AW2B 3TSIA 2HPCC 3II6A 2JHMF 1M1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1I B;  1FZE B;  2XNX C;  1LT9 A;  1FZG B;  1N86 A;  3H32 B;  2JHI F;  2J61 A;  2Z4E C;  1FIB A;  2HOD C;  3BVH C;  2J3F D;  2HLO B;  2J0Y A;  2H43 B;  3H32 A;  1W2E A;  1LWU C;  1FZF B;  2Q9I B;  1M1J B;  2HLO A;  2H43 A;  2J3G A;  1LTJ C;  1FZF A;  1RE3 C;  2Q9I A;  1LT9 C;  2JHH C;  1RF1 A;  2FFD B;  1N86 B;  3E1I C;  2J61 B;  1FZE C;  1FZA A;  1FZC B;  1Z3S A;  4EPU A;  1RF0 B;  2FFD A;  1FZG C;  4JYO X;  2A45 H;  3H32 C;  4NYT A;  2OYI B;  1FZC A;  1RF0 A;  2J5Z A;  2D39 A;  2H43 C;  2J3F A;  2OYI A;  4M7H A;  2J3O A;  1FZD A;  2A45 G;  2Q9I C;  1M1J C;  1RF1 B;  1JC9 A;  1JY2 P;  2J1G A;  2FIB A;  1FZA B;  1FZB B;  3GHG B;  2OYH B;  1N86 C;  2JHL F;  2J0H A;  1FIC A;  1FZB A;  3GHG A;  1FZC C;  3HUS B;  2OYH A;  2JHK F;  1LWU B;  4JZC A;  2HOD A;  2J64 A;  2OYI C;  2GY7 A;  3HUS A;  4R9J A;  1JY3 P;  2HLO C;  1LWU A;  2HPC B;  1JY3 N;  1N73 B;  2J0G A;  1FZF C;  1RE4 B;  2A45 I;  1M1J A;  2J60 A;  1T3U A;  1Z3U A;  1LTJ A;  1RF1 C;  2HPC A;  2XNX B;  1RE3 A;  1JY2 N;  1N73 A;  1RE4 A;  2J3U A;  1FZA C;  1FZB C;  2J2P A;  4M7F A;  3GHG C;  3E1I A;  2XNX A;  2FFD C;  2WNP F;  4R9T A;  1FZE A;  2OYH C;  2Z4E B;  2HOD B;  3BVH B;  4ZFG A;  1FZG A;  1LT9 B;  1JY3 O;  1RF0 C;  3HUS C;  1FID A;  3FIB A;  2Z4E A;  3BVH A;  1JY2 O;  1LTJ B;  1RE3 B;  2HPC C;  2JHM F;  1N73 C;  1RE4 C; 
#chains in the Genus database with same CATH topology
 3CME P;  3AE6 C;  1BGY D;  4PJ0 E;  2L91 A;  2Q6Q A;  5GTH E;  2MJZ A;  3WMM 0;  2Y9Z A;  2Q3E A;  1H0T A;  1FOS E;  5APT A;  3L71 D;  4H13 B;  1H88 A;  4HYT B;  2LXB A;  2NZ2 A;  2I1K A;  2QM7 A;  3CX5 D;  3V4W A;  1HGZ A;  1P84 I;  2BCC G;  1LTJ C;  1FZF A;  2JWD A;  4YXW H;  3IAO A;  3C9I A;  3BAS A;  3L72 J;  1EQ7 A;  1KB9 E;  1BCC J;  3H1L G;  1K73 Q;  1VQ4 P;  1VQN P;  1X0T A;  2Q1K A;  1AA0 A;  3RL0 B;  2KIK A;  2KNC A;  4R9J A;  2LKM A;  2V7Q J;  2J0G A;  3FX0 A;  2D2C D;  1RE4 B;  2A45 I;  4I7Z B;  1T3U A;  2XZR A;  3L73 E;  2YKO A;  2E75 B;  1HTL C;  2KLV A;  2QVA A;  3NFQ A;  2G3A A;  2WSC J;  3KZI H;  1GW3 A;  5KLV E;  1SQB J;  3AEE C;  1RQV A;  1YIJ P;  2WSE H;  4PV1 B;  3A0B H;  4L75 A;  3CI9 A;  3IFM A;  3GF7 A;  4H0L D;  1VQ5 P;  1N7S A;  2V4H A;  1SQV E;  1KMI Z;  1NTZ K;  1JEK A;  1N86 A;  1L4A C;  2YMK A;  1PPJ D;  3CL3 D;  2OTL P;  2H43 B;  2LXC B;  3FWN A;  1RE3 C;  2J61 B;  5KAI E;  1JUN A;  2QG4 A;  3AE3 C;  1EXJ A;  3H32 C;  4RES B;  3JSV C;  2JKV A;  2IZ0 A;  3Q5R A;  1IZN B;  2J3O A;  1JC9 A;  4N78 E;  4L73 A;  1L0L K;  1J1D B;  4BRY B;  1S9K D;  2BCC J;  3M9B A;  3BCC E;  3TNU A;  2NPS C;  2M3B A;  1NTM G;  3P32 A;  2R3C A;  1VF5 D;  3AE8 C;  3AED C;  1G1I A;  1RF1 C;  1SS1 A;  1GU4 A;  2P2U A;  1S3J A;  3H1L J;  3L75 G;  2IYO A;  3D71 A;  2XNX A;  1FZE A;  1T6A A;  3HD7 A;  2QA4 P;  3WU2 E;  5B66 H;  5KAF H;  1FDI A;  1LTJ B;  1LJ2 A;  5CCG C;  2WT7 A;  2J1G A;  2KI7 B;  5KJ7 D;  4GDO A;  1SQX G;  1URQ A;  3CC2 P;  2FYU G;  2HOD C;  3S4R A;  2HR3 A;  2E42 A;  3V2R A;  2ZXX A;  2D2C C;  1NU1 E;  2FXM A;  3CWB D;  3JCU E;  3USS A;  4LC1 A;  1HJ0 A;  2Z5H A;  1E79 H;  2GM4 A;  2KSJ A;  4AYC A;  3H6P A;  2O1J A;  3F89 A;  3GW6 A;  3PTZ A;  2M0B A;  2WSE J;  1GW4 A;  1KFM A;  2QJK C;  5APW A;  2WSF H;  2OYI A;  1BGY E;  3G71 P;  1M1J C;  2XU6 A;  5AVZ B;  1VQ7 P;  3H1K D;  2XKM A;  5CMZ A;  1Y8A A;  3MUD A;  1CSB A;  1EDL A;  3CXH D;  4JBZ A;  3L72 D;  4JPZ B;  4ASW A;  1BCC D;  1GU5 A;  1DH3 A;  1OW8 A;  3FWL A;  3EQ2 A;  1JY2 N;  1L4A B;  1PFI A;  2FXP A;  3FIB A;  1OIP A;  1SQQ K;  2KZJ A;  3RL0 g;  4XFJ A;  1RE3 B;  1IFP A;  3I55 P;  4DCK A;  1GL2 C;  3MGN A;  1BDC A;  2BEZ F;  1NTM J;  2IFM A;  2IDB A;  2IZ1 A;  3RK3 C;  3MP7 B;  3H32 B;  2JHI F;  1OXZ A;  3T97 A;  1GK6 A;  4NPE A;  2HLO A;  3PRJ A;  2J3G A;  2JJL A;  1VF5 C;  1W2B O;  2C9N Y;  1SLQ A;  3KDP B;  2N1T D;  4WY4 A;  4W7Z A;  1XTC C;  3SWK A;  1R5L A;  4OH8 B;  1P84 D;  1NO4 A;  3UIA A;  2WWW A;  3I56 P;  3B5N A;  1YQ4 C;  2NPS B;  1KOR A;  2J5Z A;  1OVV A;  1SQX J;  2FY8 A;  4GOD A;  2FYU J;  2CPB A;  4I6M C;  1RF1 B;  1JY2 P;  4OWF A;  4YPC A;  4EIJ A;  2FIB A;  4JYC A;  1MZ9 A;  2PGD A;  1S5L H;  1OX3 A;  2JEE A;  5KJ7 A;  1SP4 A;  1PL5 A;  3H1I G;  1L0N K;  2OYH A;  2XDJ A;  1MFZ A;  3PHL A;  2UWJ E;  4D6T E;  2WPV B;  2K9J A;  1NYH A;  3RGU A;  5CBN A;  3Q2Y A;  2R44 A;  3PH0 A;  1EZV G;  3E7K A;  5CCH A;  2HOD B;  4ZFG A;  2BCC D;  5APX A;  2WSF J;  2AXT H;  2FBW C;  1SVF A;  1WMK A;  2C0X A;  2D2C B;  3TSI A;  3RK3 E;  3KXD A;  4PD4 H;  1KV4 A;  1FE6 A;  3LW5 H;  1L0L G;  3TGU G;  3H1L D;  3H1J E;  3U1C A;  3CCU P;  1CZQ A;  2QJK B;  3R2P A;  3CC7 P;  1M1J B;  1Z56 A;  3VMA A;  2O1K A;  1NTZ E;  1BSH A;  4H0L B;  1K05 A;  1JNM A;  5AVT B;  1KIL C;  4GOE A;  2E75 C;  1KQS O;  1SFC A;  5AVX B;  1EZV I;  1S2E A;  4DZO A;  1NU1 K;  3CCS P;  2POH A;  3CPW O;  2AXC A;  3OW2 O;  1A02 F;  3V2N A;  1OW7 A;  5GTI H;  1FJP A;  5AVY B;  4EI2 A;  3AE2 C;  3CCQ P;  1FZB A;  1S4X A;  4K35 A;  3M9H A;  4PD4 I;  4PJ0 H;  2Y0C A;  2YNY A;  5GTH H;  2GY7 A;  3HUS A;  2E74 C;  2RKL A;  1LWU A;  2KK7 A;  1IFD A;  1N7S D;  1GL2 B;  1IK7 A;  2KYV A;  3TYY A;  2N1T C;  1KYO H;  3GHG C;  4ZMD A;  4R9T A;  2ZT9 D;  1AJY A;  2KXP B;  4A7P A;  3H1K E;  2OTJ P;  2Y9Y A;  2A06 E;  4ZKP A;  2WTY A;  3H1I J;  3F5H A;  2M5A A;  1VF5 B;  3H1H D;  1KB9 H;  1DEE G;  3OA7 A;  5AVR B;  3WUV A;  2P58 A;  2JWA A;  2J61 A;  2Z5I A;  2QJY C;  2PRR A;  1KIL E;  4IFM A;  3KQG A;  1EDK A;  2YKQ A;  3RBX A;  1NTK E;  1RF0 B;  3M0A A;  2FFD A;  2A45 H;  1L0L J;  1KYO I;  3TGU J;  2IPP A;  2J3F A;  3L73 G;  3L75 D;  3HE4 B;  1R8E A;  1FZD A;  2A45 G;  4EYY Q;  1KYO E;  3BRT B;  1FBM A;  2WPS A;  3L74 J;  3LW5 J;  5KLV G;  1YIT P;  3HD7 D;  1BE3 E;  1EDI A;  1KB9 I;  4DJG A;  5APU A;  4C7R A;  1SQP D;  1AQT A;  1JY3 N;  1SQX D;  1ZP0 C;  1SQV G;  2FYU D;  1LTJ A;  2Q3I A;  4XA4 A;  1URQ D;  1IK9 A;  4M7F A;  2WNP F;  4TLF A;  1M57 D;  3R4Y A;  2Z4E A;  5KAI H;  1ZN5 A;  2KOG A;  2VRS A;  4R4M A;  1KIL B;  2KUB A;  1FDM A;  3PP5 A;  3VOP A;  1ZR4 A;  1KFN A;  1SQQ E;  1LGH B;  1X79 B;  2OAR A;  3S1K A;  1J1E C;  3AEB C;  1FIB A;  3A0H E;  1QL2 A;  4IOI H;  1GDT A;  2N9Y B;  4AQR D;  1YTZ T;  3AEC C;  1H8A A;  3BCC G;  2ZT9 C;  2IYP A;  1FZC A;  2E74 B;  2XND H;  1USE A;  3TDK A;  2ZXE B;  3WU2 H;  1M90 Q;  2ZAE B;  3QWO C;  1X8Y A;  2N1T B;  2WVR A;  1IJD B;  1T2K D;  3GHG B;  1ZME C;  2I8D A;  1L4A A;  3O6Q A;  2JHK F;  2E43 A;  2J64 A;  1AVO A;  2E5T A;  5CBO A;  5B5E E;  1L0N E;  2HPC A;  1RE3 A;  4KHX A;  3CCJ P;  3L73 J;  2J2P A;  1ZRT E;  4Z1M H;  1NWQ A;  3JCU H;  1LP1 B;  2QJY B;  3P8C D;  1TU3 F;  1JM0 A;  5KLV J;  1FID A;  2OQQ A;  2M8R A;  1LTS C;  1NU1 G;  1MV8 A;  1YHQ P;  3M0D C;  4WY4 D;  1Y9B A;  2WSS H;  4U7J A;  5CHX A;  5DJU B;  2XNX C;  4RJT A;  1HGV A;  1LT9 A;  3B5N D;  1SQV J;  4C46 A;  3L70 E;  1H0T B;  5H2F H;  1PGO A;  1YI2 P;  1BGY G;  4OGQ D;  1QLE D;  3HRN A;  1FZF B;  3VP9 A;  2NPS A;  3OJA B;  3H1I D;  1NHL A;  2E76 D;  2O01 H;  2ITA A;  1USD A;  1RF1 A;  1URQ C;  1JB0 J;  1YJW P;  4W7Y A;  4JYO X;  3H1H E;  2KP8 A;  1FU1 A;  2IBZ I;  3K5B A;  4IL6 X;  1QGK B;  3V2Q A;  2SPZ A;  4IL6 E;  3SFD C;  1VQM P;  1NTK K;  2IBZ E;  1PZQ A;  3PJS K;  1EZV D;  5CCG A;  2H89 C;  5CCH D;  4U3F E;  1U57 A;  2JHL F;  2J0H A;  1FIC A;  2HG5 D;  1DIP A;  1KQL A;  3CCR P;  3HE5 A;  1PP9 E;  2HOD A;  2OYI C;  3BCC J;  1ZR2 A;  1YJ9 P;  4H13 D;  1L0L D;  3TGU D;  2QE7 H;  3Q1M A;  1VQO P;  4H0L C;  5H2F E;  1FZA C;  4JQ0 D;  3CX5 I;  2AEF A;  1IFM A;  1J1E B;  3L71 E;  3M9Q A;  3L75 E;  3W67 A;  3CX5 E;  1PGP A;  3U1A A;  1VPC A;  1NAF A;  1JY2 O;  1N7S B;  3AEF C;  2JHM F;  1M1J A;  1VL2 A;  1SFC D;  2B87 A;  4YTP C;  1LTA C;  2R5D A;  2ZT9 B;  1FC2 C;  1SQP E;  2OYO A;  2KS1 B;  3EWK A;  1PGQ A;  3PLN A;  1YYC A;  3ITK A;  2WPQ A;  3CC4 P;  1N7L A;  1JMB A;  2Y0E A;  5CJ4 A;  1YJN P;  2Q9I A;  1RQU A;  1N8R Q;  1NU1 J;  3E1I C;  1NKN A;  1Z3S A;  3G3Z A;  3L36 A;  5AW5 B;  1FZG C;  4D6T G;  2E5Y A;  1SQB D;  2K88 A;  4PV1 D;  5BVZ A;  1JCC A;  1HH0 A;  3A3Y B;  4QMA A;  1BGY J;  4WY4 C;  1BSN A;  1GL2 A;  3TNU B;  3B5N C;  2O01 N;  3CMA P;  3AEA C;  3W68 A;  2KZI A;  4JZC A;  2JP3 A;  1FJK A;  2O01 J;  1JMM A;  2ZJS E;  1KB9 D;  2E76 C;  2XNX B;  1N73 A;  2H7H A;  4UB8 E;  5KJ7 C;  3H1J G;  3HD7 B;  1PPJ E;  4W80 A;  2KB7 P;  2OYH C;  2G8Y A;  2QM8 A;  1RF0 C;  1NTZ G;  3AE9 C;  2WT7 B;  3BVH A;  1WRG A;  2DW3 A;  2WQY C;  3SWY A;  2W6J H;  4EOT A;  1URQ B;  4RO0 A;  5CCH C;  1LTB C;  3LID A;  3IF4 A;  2YMY A;  3L73 D;  3VP8 A;  2J3F D;  5K5G B;  2RH0 A;  5KLV D;  1CI6 B;  3TK1 A;  1S9K E;  3O8Z A;  3BAT A;  3P8C E;  1OFC X;  2JHH C;  1HWT C;  4EPU A;  1RY3 A;  4I2L C;  1HUC A;  1SQV D;  2B89 A;  2OYI B;  2Y0D A;  3CCV P;  1JTH B;  1DEB A;  2KLU A;  1PGJ A;  4WVZ A;  5TIS E;  3L74 G;  3IR9 A;  4M3L A;  1G1J A;  1VQK P;  4UB6 H;  2YXR B;  1FZA B;  3VYI A;  1SFC C;  1VQ6 P;  1WT6 A;  3G6E P;  1LTG C;  3H1K G;  3M06 A;  1OVR A;  1K8A Q;  2A06 G;  5AW6 B;  2K3R A;  2Q7C A;  3EFG A;  2P1J A;  1AVY A;  4D6T J;  4AUW A;  3FXD A;  5CJ0 A;  1IFJ A;  1RE4 A;  2XV5 A;  2J3U A;  5AVW B;  1FZB C;  4N78 D;  3EFF K;  3RBZ A;  1KN7 A;  2OTK E;  3HUS C;  2WIT A;  3CWB E;  2B9B A;  1XTG B;  5AW0 B;  1Q90 D;  2GUV A;  3BCC D;  3C8V A;  2V7Q H;  1GTW A;  1NTK G;  2M3E A;  3E1I B;  2H88 C;  1IO4 A;  2W83 C;  1FZG B;  3T97 B;  1ZW0 A;  3A5T A;  3H1J J;  3CD6 P;  2HLO B;  1PIX A;  4CPG A;  4UB6 E;  1SQP K;  2J58 A;  1QX8 A;  2H43 A;  4WY4 B;  2PAJ A;  3V6I A;  1HVV A;  1BE3 G;  1NTZ J;  2FYU K;  3B5N B;  2WMM A;  3CXH E;  1L4A D;  2PP6 A;  4HH2 A;  3L72 E;  1KQF B;  1BCC E;  2RN0 A;  4NYT A;  4OGQ B;  2ZYG A;  4ZNC A;  2D39 A;  2OGU A;  3L4F A;  4C7N B;  2E76 B;  3VN0 A;  5AW4 B;  2H8P D;  1IC2 A;  3GG2 A;  2OYH B;  1W5C E;  1CW5 A;  2I1J A;  1NU1 D;  1NTM D;  4BRY A;  3SSU A;  2K9J B;  1LP1 A;  2CPS A;  2LR2 A;  2MKV A;  2ZVN B;  3G4S P;  2GA1 A;  1FZF C;  3A0H H;  1Q7Y Q;  4KT0 J;  1SQQ G;  1T8Z A;  3NMD A;  3MD0 A;  1SQB E;  1UIX A;  3CCL P;  1ZXG A;  1KQG B;  1JY3 O;  3Q5P A;  2NPS D;  1BDD A;  4LLH A;  2J59 M;  3H1K J;  1NAY A;  1L2P A;  4JYB A;  1P84 E;  4EDF A;  1QL1 A;  2QRX A;  2Z4E C;  5E79 H;  3HTK B;  1M7L A;  5BU5 A;  2P67 A;  4IFF A;  5CCG D;  4TT3 H;  3AE1 C;  1SFC B;  5KTB A;  1D7M A;  1AFO A;  3C1L A;  2W6B A;  3V5B A;  5B5E H;  3D6Y A;  1S1C X;  2ZYA A;  3S9O A;  4L74 A;  4K3A A;  1NTK J;  1GD2 E;  2K37 A;  1U7J A;  1M1K Q;  1RHZ B;  1EDJ A;  1L0N G;  1OW6 A;  4H44 D;  4L76 A;  2O3J A;  1N7S C;  4HB1 A;  1FZB B;  2BCC E;  2PFX A;  4BWN A;  1A02 J;  1DD3 A;  1N86 C;  1FZC C;  1MUU A;  3HUS B;  1BE3 J;  1LWU B;  1QEX A;  1LTT C;  1S72 P;  1JY3 P;  1G2C B;  5AW8 B;  1KD1 Q;  3VTP C;  1RH5 B;  3H1L E;  1QVG O;  3L70 G;  5E79 E;  3CLQ A;  2M5A B;  1OVU A;  2KS1 A;  5APY A;  3N7N A;  3H25 A;  1ZV8 A;  2BEQ D;  5AW2 B;  2HPC C;  3II6 A;  3G9R A;  3MZW B;  2ZYD A;  4D6T D;  4IL6 H;  1EXI A;  1ZOY C;  3H1H G;  5KKZ C;  4JF7 A;  5BU8 B;  3MIW A;  1SQQ J;  2IBZ G;  2QSI A;  3H32 A;  5APQ A;  5EFW B;  1VQL P;  2YKP A;  4XE5 B;  3RK2 D;  4BXL A;  1FDO A;  1GL2 D;  3KZI E;  4U3F G;  1LT9 C;  4NPF X;  2FFD B;  1GZL A;  3RK3 D;  1FZE C;  1PP9 G;  1NKZ B;  3HD7 C;  3A0B E;  1LNQ A;  3FGA D;  4HKZ H;  4WB4 A;  3IN6 A;  2RMZ A;  1HF9 A;  3CCE P;  2FXO A;  2IFN A;  3H1J D;  1ZLL A;  3CX5 H;  4N3Y B;  3M0D A;  2R3S A;  3L71 G;  4NPD A;  1NTZ D;  1N2D C;  1IFI A;  2L5G B;  3P7K A;  3SFE C;  4B86 A;  2JO1 A;  2CK3 H;  1UII A;  3MHV A;  3SWF A;  4Y99 C;  1Z3U A;  4GIF A;  3ZDM A;  1SQP G;  4GOF A;  1L0N J;  2R32 A;  3LIE A;  2Z4E B;  2ZFC A;  2KNC B;  1U7M A;  1SQB K;  2FYN C;  4GT1 A;  1PV3 A;  1JCD A;  2WZ7 A;  3L35 A;  4H44 C;  4MN4 C;  1CI6 A;  1NTM E;  1X9V A;  4LGD E;  3BRV B;  4PD4 D;  3AEG C;  5AW9 B;  3L74 D;  3MUD C;  3D6Z A;  1HJB A;  4WWI A;  1YBK A;  1VQ9 P;  2ZVO B;  3NTN A;  2YIU C;  3L70 J;  1LT1 A;  1JO5 A;  1W2E A;  2W90 A;  1Q82 Q;  5AW3 B;  1JTH A;  1K04 A;  2A06 D;  5M1B A;  1AQ5 A;  2KSE A;  1N86 B;  3V2P A;  1T2K C;  5B66 E;  5KAF E;  2IX7 C;  1KC8 Q;  3I5C A;  4GKG A;  1FZA A;  1FZC B;  1NVO A;  1E5W A;  4UB8 H;  1SQX E;  3RL0 D;  2FYU E;  3H1H J;  1OMI A;  3FXE A;  1K9M Q;  2GUS A;  3V4Q A;  2Q9I C;  3A7O A;  1PPJ G;  5KLI C;  1KIL D;  2K9Y A;  3ABV C;  3Q3D A;  2E75 D;  3O6Q B;  1LTI C;  2QJP C;  2K1A A;  4U3F J;  2C9L Y;  3AE5 C;  5AW1 B;  3KPE A;  1IFN A;  4DT0 A;  1NTK D;  1OZH A;  5AVU B;  1PP9 J;  1GMJ A;  1NH4 A;  1R5S A;  2HLO C;  3RK2 C;  2HPC B;  5KLV K;  2HFE D;  1AV1 A;  5TJH A;  3AE4 C;  1KZU B;  5KKZ B;  1KYO D;  3E1I A;  2P7J A;  3E1R A;  4YXD C;  2QEX P;  4N6J A;  1VDF A;  1FZG A;  3L71 J;  5C39 A;  3L75 J;  2Q5U A;  1SQV K;  1BE3 D;  2E74 D;  2R5B A;  4OGQ C;  3WUT A;  5L8R J;  1FS0 E;  1LT9 B;  2YO3 A;  5TIS H;  1N73 C;  1FAV A;  1FZE B;  1VQP P;  4O9B A;  4KJM A;  3CCM P;  3B71 A;  1M8O B;  2YO2 A;  1SQP J;  3BVH C;  5AVS B;  1DD4 A;  1VQ8 P;  4C7N A;  5AVV B;  2QIW A;  4DOJ A;  4I1L A;  2JDI H;  1RF0 A;  1SQQ D;  1YQ3 C;  4M7H A;  4H13 C;  4Y99 B;  1KTM A;  1Y47 A;  3Q5S A;  3HE4 A;  1QVF O;  1JOC A;  3HE5 B;  3VMZ A;  1X22 A;  5AW7 B;  2N9B A;  5APS A;  3NXS A;  3CWB G;  1J2J B;  1GK4 A;  1MFT A;  3JC2 2;  2FYN B;  2YXQ B;  3AE7 C;  2C0W A;  4H44 B;  2J60 A;  3KHU A;  3A2A A;  2BAS A;  5APV A;  1HBW A;  3L37 A;  2JR8 A;  2W8Z A;  2YIU B;  3H1I E;  3RL0 C;  3CXH H;  4ZKU A;  1S5L X;  3OAK A;  2B87 B;  1S5L E;  3HTK A;  1RE4 C;  4I7Z C;  3L72 G;  2J5U A;  1Q86 Q;  1BCC G;  1KIL A;  2NRG A;  1L0N D;  3B8E B;  1FOS F;  3KYQ A;  1NTM K;  1EZV E;  2HYN A;  1ZRT D;  2J0Y A;  1DX7 A;  1LWU C;  4ASV A;  2FYZ A;  1OWA A;  1H89 A;  3GMA A;  2Q9I B;  3VMX A;  5KLI B;  1NOH A;  4PV1 C;  2QJP B;  2P10 A;  2AXT E;  4OVN F;  2AEM A;  2W6A A;  2WSC H;  3U59 A;  4R4L A;  1L0L E;  3TGU E;  3RK2 B;  3L70 D;  4PD4 E;  3QH9 A;  2H43 C;  4IFD K;  3L74 E;  1SQB G;  3MTU E;  4WBA A;  1SQX K;  1G2C A;  3WUU A;  2B88 A;  1Q81 Q;  3CXH I;  3RK3 B;  2FKW B;  1M56 D;  2N1T A;  4RKU J;  1P84 H;  3GHG A;  1NGM B;  1EC5 A;  3TF5 A;  1NJI Q;  5AVQ B;  4HJG H;  3N4X A;  3B4S A;  3P8M C;  1N73 B;  3GLM A;  3M91 A;  4Y28 J;  2IBZ D;  3D70 A;  1MKM A;  5DJT B;  1J1D C;  3VMY A;  2FFD C;  3GF3 A;  1T3J A;  3BVH B;  2W27 A;  1Q2N A;  4U3F D;  1YTZ I;  2AEJ A;  2WPR A;  5GTI E;  1PP9 D;  3CWB J; 
#chains in the Genus database with same CATH homology
 1SFC D;  3LW5 H;  1LTA C;  2R5D A;  4JF7 A;  5BU8 B;  3MIW A;  2MJZ A;  3U1C A;  3WMM 0;  1CZQ A;  3R2P A;  3H32 A;  5APQ A;  1FOS E;  5APT A;  2YKP A;  4XE5 B;  3RK2 D;  1H88 A;  4HYT B;  1M1J B;  1YYC A;  2QM7 A;  1Z56 A;  2I1K A;  2WPQ A;  3V4W A;  2O1K A;  1HGZ A;  1N7L A;  1GL2 D;  1LTJ C;  1FZF A;  1JNM A;  5CJ4 A;  2Q9I A;  5AVT B;  1LT9 C;  1KIL C;  2FFD B;  3E1I C;  1GZL A;  1NKN A;  3RK3 D;  1FZE C;  1SFC A;  5AVX B;  1NKZ B;  3G3Z A;  1Z3S A;  3HD7 C;  3L36 A;  5AW5 B;  1FZG C;  3C9I A;  4WB4 A;  4DZO A;  1NU1 K;  3BAS A;  2POH A;  1EQ7 A;  2IFN A;  1ZLL A;  1A02 F;  5BVZ A;  1JCC A;  3V2N A;  1HH0 A;  4N3Y B;  3A3Y B;  3M0D A;  4WY4 C;  1FJP A;  1GL2 A;  5AVY B;  3TNU B;  1N2D C;  1IFI A;  3B5N C;  1FZB A;  2L5G B;  3P7K A;  3RL0 B;  3M9H A;  4JZC A;  2YNY A;  2GY7 A;  4B86 A;  3HUS A;  1FJK A;  4R9J A;  2LKM A;  1LWU A;  1IFD A;  1JMM A;  2J0G A;  3SWF A;  1RE4 B;  1N7S D;  1GL2 B;  2A45 I;  4Y99 C;  1T3U A;  1Z3U A;  4GIF A;  2XZR A;  2KYV A;  2YKO A;  2XNX B;  1HTL C;  1N73 A;  2H7H A;  3TYY A;  5KJ7 C;  2KLV A;  3HD7 B;  2N1T C;  4W80 A;  2R32 A;  3NFQ A;  3GHG C;  4R9T A;  2KB7 P;  3LIE A;  1GW3 A;  2OYH C;  2Z4E B;  2ZFC A;  2QM8 A;  1RF0 C;  2WSE H;  1SQB K;  2WT7 B;  3BVH A;  4ZKP A;  2WTY A;  1WRG A;  3CI9 A;  4GT1 A;  1JCD A;  2WZ7 A;  3L35 A;  3IFM A;  1CI6 A;  3OA7 A;  1X9V A;  3SWY A;  4EOT A;  5AVR B;  1N7S A;  4LGD E;  1URQ B;  3BRV B;  5CCH C;  1LTB C;  3LID A;  5AW9 B;  1HJB A;  2YMY A;  1NTZ K;  1N86 A;  1L4A C;  2J61 A;  2Z5I A;  3NTN A;  3VP8 A;  2J3F D;  3CL3 D;  1JO5 A;  2H43 B;  1W2E A;  5AW3 B;  1CI6 B;  1JTH A;  3TK1 A;  4IFM A;  1RE3 C;  3KQG A;  1S9K E;  3O8Z A;  3BAT A;  3P8C E;  2JHH C;  1AQ5 A;  2YKQ A;  1N86 B;  3V2P A;  1T2K C;  2IX7 C;  2J61 B;  1HWT C;  3I5C A;  4GKG A;  1FZA A;  1FZC B;  1JUN A;  4EPU A;  1E5W A;  1RY3 A;  3M0A A;  1RF0 B;  2FFD A;  4I2L C;  1HUC A;  2A45 H;  3H32 C;  2OYI B;  1JTH B;  4RES B;  1DEB A;  3RL0 D;  3IR9 A;  2IPP A;  4M3L A;  2J3F A;  2J3O A;  2GUS A;  3V4Q A;  3HE4 B;  1FZD A;  2A45 G;  2Q9I C;  1JC9 A;  3A7O A;  3BRT B;  4N78 E;  1FBM A;  2WPS A;  1KIL D;  1L0L K;  1G1J A;  1FZA B;  3VYI A;  1SFC C;  1J1D B;  1WT6 A;  1LTI C;  3HD7 D;  1S9K D;  1LTG C;  3M06 A;  2C9L Y;  5AW1 B;  3KPE A;  1IFN A;  3M9B A;  3TNU A;  5APU A;  4C7R A;  5AW6 B;  5AVU B;  2NPS C;  1NH4 A;  2M3B A;  2Q7C A;  3P32 A;  3EFG A;  2HLO C;  2P1J A;  3RK2 C;  2HPC B;  2R3C A;  5KLV K;  1JY3 N;  4AUW A;  2HFE D;  1G1I A;  1LTJ A;  1RF1 C;  2Q3I A;  4XA4 A;  5CJ0 A;  1IFJ A;  1RE4 A;  2XV5 A;  2J3U A;  1KZU B;  1URQ D;  2P2U A;  1GU4 A;  5AVW B;  1FZB C;  1IK9 A;  4M7F A;  3E1I A;  4N78 D;  2XNX A;  2WNP F;  2P7J A;  1FZE A;  4N6J A;  3HD7 A;  1VDF A;  1FZG A;  3HUS C;  2WIT A;  2Q5U A;  1SQV K;  2Z4E A;  1ZN5 A;  2KOG A;  2VRS A;  2R5B A;  1XTG B;  5AW0 B;  2GUV A;  1LTJ B;  5CCG C;  1GTW A;  1LT9 B;  2YO3 A;  2WT7 A;  1N73 C;  2J1G A;  1KIL B;  1FAV A;  5KJ7 D;  1FDM A;  3PP5 A;  3E1I B;  3VOP A;  1IO4 A;  1FZE B;  1ZR4 A;  1KFN A;  1FZG B;  1LGH B;  1URQ A;  1X79 B;  4O9B A;  2OAR A;  1J1E C;  3A5T A;  2YO2 A;  1FIB A;  2HOD C;  3BVH C;  2HLO B;  1QL2 A;  5AVS B;  1GDT A;  2E42 A;  3V2R A;  1SQP K;  2J58 A;  2H43 A;  4WY4 B;  2PAJ A;  1HVV A;  4AQR D;  2FXM A;  2FYU K;  4LC1 A;  4C7N A;  1YTZ T;  2Z5H A;  5AVV B;  4DOJ A;  2GM4 A;  3B5N B;  1H8A A;  1L4A D;  2KSJ A;  2PP6 A;  4HH2 A;  4AYC A;  4I1L A;  3H6P A;  2O1J A;  4NYT A;  1FZC A;  1RF0 A;  1GW4 A;  1KFM A;  2D39 A;  3L4F A;  5APW A;  2WSF H;  2OYI A;  4M7H A;  4Y99 B;  4C7N B;  1M1J C;  2XU6 A;  2ZXE B;  5AVZ B;  3VN0 A;  1X8Y A;  2XKM A;  2N1T B;  5AW4 B;  1IJD B;  3HE4 A;  1T2K D;  1JOC A;  3GHG B;  5CMZ A;  2H8P D;  3HE5 B;  1IC2 A;  3VMZ A;  2OYH B;  5AW7 B;  1CW5 A;  2N9B A;  2I1J A;  5APS A;  3MUD A;  1CSB A;  3NXS A;  1J2J B;  1GK4 A;  1L4A A;  2JHK F;  2E43 A;  2J64 A;  2CPS A;  1GU5 A;  1DH3 A;  2C0W A;  1FZF C;  2J60 A;  3EQ2 A;  2HPC A;  1RE3 A;  1T8Z A;  4KHX A;  1JY2 N;  3A2A A;  3NMD A;  3MD0 A;  2J2P A;  2BAS A;  1L4A B;  5APV A;  1NWQ A;  1HBW A;  3L37 A;  3P8C D;  1PFI A;  1JY3 O;  2NPS D;  1FID A;  3FIB A;  3RL0 C;  2M8R A;  4LLH A;  1LTS C;  4ZKU A;  2J59 M;  1SQQ K;  3OAK A;  1MV8 A;  1RE3 B;  3HTK A;  3M0D C;  4WY4 D;  1RE4 C;  4JYB A;  1GL2 C;  3MGN A;  5CHX A;  2XNX C;  1QL1 A;  1HGV A;  1LT9 A;  2IFM A;  1KIL A;  3RK3 C;  3B5N D;  4C46 A;  3B8E B;  1FOS F;  3H32 B;  3KYQ A;  2JHI F;  1NTM K;  2Z4E C;  1OXZ A;  2HYN A;  2J0Y A;  1DX7 A;  3T97 A;  1LWU C;  1GK6 A;  1M7L A;  2FYZ A;  3HRN A;  1OWA A;  3HTK B;  3VP9 A;  2NPS A;  5BU5 A;  2P67 A;  1H89 A;  1FZF B;  4IFF A;  2Q9I B;  3VMX A;  5CCG D;  1NOH A;  2HLO A;  3OJA B;  2J3G A;  2JJL A;  2C9N Y;  1NHL A;  2O01 H;  1SFC B;  5KTB A;  1AFO A;  1SLQ A;  2W6B A;  1RF1 A;  3KDP B;  2N1T D;  4WY4 A;  3V5B A;  4W7Z A;  1URQ C;  1XTC C;  4OH8 B;  2W6A A;  4W7Y A;  1NO4 A;  3UIA A;  4JYO X;  2WSC H;  1GD2 E;  3U59 A;  2WWW A;  3B5N A;  2KP8 A;  1FU1 A;  2NPS B;  3V2Q A;  2J5Z A;  3RK2 B;  2H43 C;  1NTK K;  2CPB A;  4IFD K;  4I6M C;  1RF1 B;  1JY2 P;  1N7S C;  3MTU E;  4WBA A;  1SQX K;  1G2C A;  5CCG A;  4EIJ A;  2FIB A;  5CCH D;  1FZB B;  3RK3 B;  4JYC A;  1MZ9 A;  2FKW B;  1A02 J;  1N86 C;  2JEE A;  2JHL F;  5KJ7 A;  2J0H A;  1FIC A;  2N1T A;  1SP4 A;  2HG5 D;  3GHG A;  1FZC C;  1KQL A;  1MUU A;  3HE5 A;  3HUS B;  1L0N K;  2OYH A;  1LWU B;  2XDJ A;  2HOD A;  1MFZ A;  5AVQ B;  1LTT C;  2OYI C;  1ZR2 A;  3N4X A;  1JY3 P;  1G2C B;  5AW8 B;  3P8M C;  1N73 B;  3M91 A;  3VTP C;  1FZA C;  1J1D C;  3VMY A;  5CCH A;  2FFD C;  1IFM A;  1J1E B;  1T3J A;  3M9Q A;  2HOD B;  3CLQ A;  3BVH B;  2W27 A;  4ZFG A;  5APX A;  1YTZ I;  3U1A A;  5APY A;  3N7N A;  2WPR A;  1VPC A;  1ZV8 A;  1NAF A;  1SVF A;  1JY2 O;  2C0X A;  1N7S B;  5AW2 B;  3TSI A;  2HPC C;  3II6 A;  2JHM F;  1M1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...