1LT9B

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 89
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9B03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9B02
2J3FD 1FIDA 1N86A 2Q9IB 1JC9A 4JYOX 4R9TA 2J0HA 2J2PA 2JHLF 1RF1C 1FZGA 1N86B 4NYTA 1FZCA 4M7FA 1FZBA 1FZFB 2OYHA 2J61B 1RE3C 1M1JB 3E1IB 2A45I 1FZAA 2J3GA 1LT9C 1M1JA 2J61A 2A45H 2OYHB 2Z4EC 1FZFA 1FZBB 2J60A 3FIBA 3E1IC 3H32C 1FZCB 1FICA 1FZGB 1T3UA 1JY2O 2HPCC 1FZCC 2Q9IA 4ZFGA 3HUSB 1RE3A 2WNPF 4M7HA 1JY3N 2Z4EA 2FFDC 1FZDA 1RF0B 2H43B 1LT9B 1JY3P 2FFDB 2HODB 1RF1B 1Z3SA 1LWUA 2OYIB 3BVHB 1FZFC 3GHGC 1JY3O 2XNXB 1FZEB 2HPCB 3GHGB 3H32B 1RE4B 2Q9IC 2HLOB 1Z3UA 2J0YA 2J64A 1N73C 1JY2P 2J3UA 1LTJB 2J0GA 3HUSC 1N73B 2JHMF 1JY2N 1FIBA 1RE4A 2XNXC 2JHIF 3GHGA 2FIBA 1FZEA 1W2EA 1FZGC 2HODC 1N73A 3BVHA 2OYIA 1LWUB 1LTJA 2FFDA 4JZCA 2A45G 1FZAC 1RE4C 1LWUC 2D39A 1RF0C 2H43C 1N86C 2J3FA 2HLOA 3H32A 1RE3B 3HUSA 2J3OA 2HPCA 2XNXA 2J5ZA 2J1GA 1FZBC 1LTJC 4R9JA 1FZEC 2OYHC 2JHKF 1RF1A 2HODA 2JHHC 4EPUA 1M1JC 1LT9A 1RF0A 2H43A 2OYIC 3BVHC 2HLOC 2GY7A 2Z4EB 1FZAB 3E1IA
chains in the Genus database with same CATH superfamily
1DIPA 2J3FD 5GTHH 3H1LD 1OW8A 1USDA 1K73Q 2LKMA 3P8CD 3W67A 1NTKJ 1NO4A 1EZVD 3GF3A 1BCCJ 2XZRA 4RESB 1KILD 1SQPD 1SQPJ 1FICA 2SPZA 2I1KA 1P84I 1SFCD 1S5LX 3V4WA 1RE3A 3LIEA 1JY3N 3SWKA 2WVRA 3KYQA 2OYIB 1AVOA 1PIXA 1NTMK 3MUDC 1IFDA 1CW5A 5KLIB 1RE4B 1IK7A 1YI2P 3L70J 2ZAEB 1H88A 2J59M 3B71A 1VQKP 2KOGA 2FXMA 5APSA 3EWKA 5AVYB 5BU5A 3CCRP 2J3FA 1NGMB 4OGQB 2J1GA 4PD4I 2M0BA 2ZJSE 1M57D 2BCCE 3RL0B 4EPUA 3L75J 2WPSA 2J5UA 2Z4EB 3BCCG 4L73A 2ZYDA 3LIDA 2V4HA 1FZGA 1N86B 3V5BA 1FZFB 2OARA 2E42A 3VMXA 1GL2A 1JTHB 1OIPA 3ITKA 1DEBA 3MUDA 1BCCE 2OYHB 2M5AB 3ZDMA 2KIKA 2P10A 3KHUA 3TDKA 2WSSH 5AVVB 1WT6A 1J1EC 2FYUE 1ZRTE 3V2RA 2R3CA 1HJBA 1N7SC 4H13B 1FS0E 4IFMA 3GHGC 1N7LA 1SQVG 4Y28J 1Z56A 2Q9IC 1S2EA 1BE3G 2WT7B 4IL6X 5APTA 1H0TB 3CX5I 3L70E 4BRYB 1P84D 3AE7C 1BGYE 2W6AA 3OW2O 1SQQG 1L0NK 4JBZA 1LWUB 2R44A 3B5ND 4H0LD 1FZAC 3L71E 1LNQA 2D39A 3HD7D 1NH4A 1NU1E 4EDFA 3CI9A 3Q5PA 1FZBC 3CCMP 2JHHC 3HTKB 1SQBE 2B87B 4K3AA 1MFTA 2J0HA 2KNCB 4EI2A 1DD4A 1T8ZA 2C9NY 3H1KD 1PP9J 4WWIA 3E1IB 1KFNA 1QL2A 1KB9I 1QLED 2JR8A 3CMAP 3HTKA 3A5TA 1JEKA 3AE3C 4MN4C 3FIBA 1RQUA 1X79B 2W6BA 3HD7C 3CC4P 2J58A 1T6AA 3A0BH 1RF0B 2HODB 1L2PA 3P8MC 3CCSP 1KN7A 4LGDE 2IBZG 4JPZB 3CCJP 4BRYA 1NYHA 3GG2A 2XU6A 1MUUA 2J64A 3MTUE 3M06A 2YIUB 1KORA 1L4AC 1GU4A 1SQXJ 3M91A 1FZEA 4AUWA 3CX5E 1K9MQ 1EXIA 3CD6P 1JMBA 1LTJA 1MKMA 2YIUC 2H43C 1NTZD 2IYPA 5DJUB 1KMIZ 1GW4A 4U3FG 2XNXA 1K8AQ 5KLVE 3EFFK 1IK9A 2QSIA 4R9JA 1KD1Q 3A7OA 4D6TJ 3L73J 3M9BA 1G1IA 4IL6E 3AE6C 4PV1B 1YTZT 3H1LG 1AQ5A 2YMKA 1L0LD 4L75A 4U7JA 5KAIE 2R5BA 1IFPA 2OYHA 1OW7A 2FXOA 2K37A 3E1IC 3G3ZA 5DJTB 3CWBE 2E75B 2Y0DA 2MJZA 1HF9A 1S9KD 4YPCA 2FFDC 3IAOA 1VQ4P 1CSBA 2Q5UA 3GMAA 3L73E 1BE3E 4R4MA 3Q5SA 2QJPC 3HE5A 5CCGD 4W7ZA 2Z5IA 3H1IE 1YQ3C 2JDIH 2A06G 1KTMA 1G1JA 1OW6A 1SQQJ 4D6TD 2JJLA 4OGQC 3L35A 2YMYA 2XNXC 2E74B 1KYOI 1VDFA 3K5BA 2Y0EA 4UB6E 1KFMA 2OYIA 2FFDA 2O1KA 2AEMA 3BRVB 3TGUJ 3H25A 3SFEC 1JCCA 1PP9D 1L0NJ 1GD2E 1RE3B 4NPFX 1PV3A 3KZIH 3AE9C 2H8PD 4L76A 2CK3H 2PRRA 2IPPA 1NWQA 1S72P 4JF7A 1FC2C 2OYIC 1EDJA 2FXPA 1OVUA 3QWOC 1GDTA 3BCCJ 4K35A 2YKPA 2VRSA 1SQQE 3VN0A 1PGQA 4OGQD 3H1JD 1NTZJ 1NKNA 4TLFA 1XTCC 1X9VA 4PD4D 1VQNP 4W80A 3TNUA 3RK2D 4UB6H 2QVAA 1FJPA 3H1JJ 2PFXA 5B66H 1H89A 2A06D 2Q7CA 4W7YA 1LT9B 1KC8Q 3SWFA 2LXCB 2ZT9B 2XKMA 2RMZA 3PTZA 2XNXB 1LT1A 1Q90D 2BASA 4ZKPA 2Q3EA 4GT1A 1SQXK 2J0YA 5H2FH 2XNDH 3HRNA 1BSNA 1JY2P 1BDDA 3H1HE 3H1IJ 3D70A 3HUSC 1BGYJ 3TYYA 5AVXB 2ZT9C 3AE8C 4DOJA 4XA4A 3AEAC 1FAVA 4ZKUA 4H44C 1FOSF 1LTTC 5CCHA 1VF5D 3HUSA 1DD3A 2IX7C 3HD7A 3E1RA 1RQVA 4B86A 5CBOA 1YTZI 1OFCX 2JHKF 3H1HD 2R3SA 2HODA 2QG4A 1RF0A 4PJ0E 2GM4A 4H13D 1ZLLA 4OVNF 4UB8E 1MV8A 1NTMD 2KI7B 2IFMA 2ITAA 1M8OB 4HJGH 2RH0A 2UWJE 2YKOA 1DEEG 2ZVNB 2IYOA 2NPSA 2A45H 2D2CC 2O01N 5AW9B 4I6MC 2KP8A 1FOSE 4ZFGA 3KDPB 2M3EA 3A2AA 4CPGA 2B87A 5TISE 3VTPC 1KILA 3V4QA 2QJKC 2XDJA 3CXHE 1X22A 1D7MA 2BCCJ 2NRGA 5B5EH 1PGOA 1ZMEC 3A0HE 2GA1A 2E74C 5KLVK 3MIWA 2POHA 3AE4C 4C7NB 1KZUB 1SQQK 1L0NG 1AQTA 4JYCA 4GODA 1KYOH 3CCEP 4H0LB 1NJIQ 1HJ0A 2QA4P 3GLMA 2K3RA 1W5CE 1OMIA 3GHGA 1M90Q 1PPJE 5M1BA 1PP9E 1HBWA 3MD0A 3VP9A 3BASA 3KXDA 1YIJP 4M3LA 2FKWB 2HLOA 1BSHA 1JNMA 1NTZG 2CPBA 4IOIH 1JM0A 4BWNA 1P84H 4U3FJ 2E74D 4D6TE 2K9JB 2YO2A 4UB8H 2W83C 4IFFA 1LT9A 3AEDC 3D6ZA 1QVFO 1YYCA 3HE4A 3MHVA 1L0LG 4I2LC 3L73D 2FYNB 1EQ7A 2C9LY 1HUCA 2CPSA 1U7JA 2YXRB 2ZXEB 4OH8B 1FZFA 1URQB 3CWBD 1UIXA 3F89A 3EFGA 3CWBJ 3WMM0 3RK3C 5AVSB 1NU1J 5CJ4A 1PPJD 2WPVB 3HUSB 2Q1KA 3R4YA 2KSEA 2Z4EA 5CCHD 2E5YA 4RO0A 3IR9A 3IFMA 3CXHI 3VYIA 2KUBA 5AVQB 3KPEA 2WSEH 1HWTC 1IJDB 1N73C 1KB9H 5AVRB 1HH0A 1AJYA 2H89C 1A02J 3CXHD 4I7ZB 1TU3F 1S5LE 4WY4D 4A7PA 1VQMP 3KQGA 1LTAC 4O9BA 1CI6A 4H44D 1SS1A 1VF5C 5APQA 1ZXGA 3CX5D 1LTBC 2FYZA 2J3OA 4JYBA 3B5NA 1T2KD 2D2CD 4ASVA 1LP1A 3AEBC 1NTME 4Y99B 2OYHC 2MKVA 1X8YA 5GTHE 4HB1A 1ZV8A 1AV1A 1KQGB 2HR3A 1IFMA 3L72G 3LW5J 1LGHB 1FBMA 2W90A 3M0AA 2IBZI 2N1TD 1FZCA 2G3AA 1AVYA 2GUVA 4KJMA 1EZVG 5KJ7D 2A45I 1ZP0C 1M1JA 3L74J 2J61A 3B4SA 2QRXA 1FZBB 3L71G 3CX5H 1SQPG 1FZCC 3JCUE 2QM8A 1FZDA 4HKZH 1S1CX 4HYTB 2QJKB 1Z3SA 1W2BO 3WU2H 2WSCJ 1L4AD 2KS1B 3MZWB 1YJ9P 3VMYA 1NAFA 3GF7A 1LTJB 5KJ7C 4RJTA 2A06E 1YBKA 1BGYG 2E76C 2O1JA 1VL2A 1SFCB 3M9QA 2N1TA 1VQ7P 1DX7A 1GU5A 2W27A 4ASWA 3JCUH 2Z5HA 4PD4E 1BGYD 1P84E 1Y47A 3V2PA 3L70D 3H1JE 2JWAA 2FBWC 3H1HG 2ZXXA 2IZ0A 1SQQD 2IFNA 3CLQA 3AE5C 1JB0J 2LR2A 1FIDA 2ZVOB 5CCHC 2FY8A 3OA7A 3FXEA 3B5NC 4NYTA 3NMDA 3CCVP 4M7FA 2FYUD 3FWNA 4XFJA 5AW8B 2QM7A 5B66E 1J1DB 3S4RA 2E75C 1JY2O 1KV4A 2B89A 2WITA 4EYYQ 1UIIA 2WPRA 3CC2P 2K9YA 5APXA 4WVZA 3L73G 2N9BA 4I7ZC 1E79H 1SQXG 2BCCG 4IFDK 3BVHB 2FYNC 3FX0A 1NKZB 3H1ID 2W6JH 1QL1A 3GHGB 2V7QJ 2HFED 5CHXA 1BE3D 3T97B 2BCCD 4C7NA 1N73B 1S9KE 3FGAD 1KQSO 3M0DC 1EC5A 2E75D 5APUA 1N73A 2KYVA 1J2JB 2B88A 3G4SP 2L91A 1K05A 5EFWB 1T2KC 1X0TA 1IC2A 2HPCA 3Q3DA 1L0LE 3L72J 3F5HA 1SQBJ 1FZEC 5AW6B 2JEEA 3CCQP 2QJYC 2W8ZA 2HLOC 5BU8B 1RH5B 2ZYGA 4KT0J 1RY3A 3CCLP 1PGJA 1M1KQ 1VQ6P 5AVWB 5KLVD 1VQOP 1ZW0A 2N9YB 1NTZE 2WMMA 3WUTA 1Y8AA 5TISH 2OTJP 3A0BE 1FZGB 3FXDA 3KZIE 2AXCA 1EXJA 1SQPE 5KLVG 2KK7A 4DCKA 4H0LC 3RK2B 3P7KA 1GTWA 1YHQP 3A3YB 3H1KJ 1LWUA 5AVUB 1FZFC 1PFIA 3AEGC 3GW6A 1DH3A 1JY3O 1SFCA 3H1LE 3PP5A 4H44B 1R5SA 4WBAA 1H0TA 1LTGC 4PV1D 3SWYA 4NPEA 3VOPA 1Q82Q 4Z1MH 1NTZK 5CJ0A 2BEZF 3TK1A 3CC7P 2D2CB 2NPSC 2R5DA 1N86C 2FYUJ 2I8DA 4WY4C 1N7SD 3H1KE 1SLQA 3L37A 3UIAA 1PGPA 1URQC 4IL6H 2M5AA 1HVVA 1L0LK 1IFNA 2I1JA 1JTHA 1GL2B 1SQBD 5KKZC 3S9OA 2Q9IB 1N86A 5AVTB 1IFJA 5KLIC 2RN0A 2JHLF 3Q2YA 3QH9A 1ZR2A 1FZBA 1NU1D 1M1JB 5AW2B 2K1AA 3L71D 4YTPC 5E79H 1VF5B 3L71J 1AA0A 1SFCC 1LP1B 4DT0A 1VQ8P 5C39A 2P7JA 2YXQB 3U1AA 4M7HA 4OWFA 5CMZA 4C7RA 3NTNA 4KHXA 4EOTA 1JY3P 3VP8A 2WQYC 5AW4B 5KAFH 2E43A 2OTLP 2O3JA 1OZHA 1Z3UA 5H2FE 1NHLA 1ZRTD 2KXPB 2J0GA 3AE1C 3CMEP 2Y0CA 3I56P 1N7SA 2H88C 3RBZA 1IO4A 1VQLP 2OTKE 2P2UA 5K5GB 3RK3B 1S3JA 5KJ7A 1A02F 1BCCD 2A45G 1BCCG 1FJKA 1SQBG 3C8VA 2JKVA 2E76D 3CL3D 1YJNP 3CXHH 2AEJA 1Q7YQ 3G6EP 2J5ZA 1PZQA 3USSA 3H6PA 2GUSA 1RF1A 2H43A 3N4XA 2R32A 3FWLA 3G9RA 3HE4B 1NVOA 1SQPK 3M9HA 3H1KG 2XV5A 1OVRA 2J3GA 3WUUA 5GTIH 2QEXP 3PJSK 2WSFH 3H1IG 4YXWH 3IF4A 3IN6A 3CCUP 4PD4H 1EZVI 2O01H 4DZOA 3TGUE 1WRGA 1EDKA 1USEA 4L74A 4LC1A 2NPSD 1Y9BA 1FZEB 2JWDA 4PV1C 2HLOB 4RKUJ 3T97A 3PH0A 1FE6A 2RKLA 1GK6A 1FIBA 2QE7H 2JHIF 1FDIA 3AE2C 4I1LA 1WMKA 3BVHA 1PL5A 1KILE 1ZR4A 1GMJA 1NAYA 4NPDA 3H32A 1EZVE 1L0LJ 1XTGB 3RBXA 3P8CE 3E7KA 3PHLA 1L4AB 2FYUG 2N1TC 2P58A 3BVHC 1AFOA 2GY7A 2WSCH 4WY4A 1SQVE 3RL0g 5AW7B 3L75D 5CBNA 2KNCA 4U3FD 1G2CA 2PP6A 1JCDA 3O6QA 5E79E 1YITP 2AXTH 1T3JA 2C0WA 1J1DC 3B8EB 1LTIC 3HD7B 1NTKD 1GL2C 3BATA 1VQ5P 3CPWO 2H43B 1KB9D 3N7NA 3G71P 3H1LJ 3C9IA 3W68A 2IBZD 2ZFCA 1JO5A 2PGDA 2YKQA 4HH2A 1YQ4C 1GW3A 1JMMA 3LW5H 3RL0D 2WT7A 1L0ND 3NFQA 5AW5B 3RK3D 1GZLA 2P1JA 1VPCA 4DJGA 3U59A 2QJPB 2KS1A 3EQ2A 1KYOE 3Q1MA 1QX8A 1KYOD 2AEFA 1IZNB 1S4XA 1LWUC 1RF0C 4N78E 4WB4A 3V2NA 1GK4A 1N2DC 1LTJC 3D6YA 1NU1G 4QMAA 3TNUB 3V2QA 3BCCD 3BRTB 2ZYAA 2IBZE 3NXSA 5KAIH 1RF1C 1NTKG 2IDBA 2J61B 1RE3C 5KTBA 2WPQA 2E5TA 2KSJA 1FZCB 1KQFB 4N3YB 1U57A 3L4FA 2M8RA 3B5NB 2Q9IA 3H1JG 1IFIA 1BDCA 2WSEJ 1Q86Q 1Q81Q 2FFDB 2JO1A 5AVZB 1CI6B 4U3FE 3AEEC 1HTLC 1SQVD 1OXZA 2KB7P 1R8EA 4AQRD 1MFZA 3C1LA 1J1EB 3O8ZA 1SQXE 4AYCA 3PRJA 2B9BA 4D6TG 1M56D 2JHMF 1EDIA 1JY2N 1RE4A 3H1HJ 3L36A 3HE5B 1W2EA 1QVGO 1FZGC 4YXDC 1OVVA 2WZ7A 1E5WA 2LXBA 5B5EE 4JZCA 1RE4C 4GKGA 2KLVA 3L74G 3L74D 3WUVA 3RK2C 1FU1A 4N6JA 1OWAA 1R5LA 2QIWA 5L8RJ 3L72E 1M1JC 2OYOA 4GOEA 3U1CA 5AW0B 3L72D 5APVA 4R9TA 2K88A 1NTMG 4GDOA 1CZQA 2V7QH 5APWA 1YJWP 2Y9ZA 1VQPP 1URQA 3L74E 3MP7B 3P32A 4ZNCA 3TGUD 2Z4EC 2C0XA 1FDOA 5GTIE 3H32C 3RL0C 1SP4A 2K9JA 2HPCC 5CCGA 2FYUK 1LJ2A 3Q5RA 2WWWA 3OAKA 2M3BA 1FDMA 2G8YA 3R2PA 4GOFA 3SSUA 1SQXD 3TGUG 1RHZB 2HPCB 3H32B 4LLHA 1KILC 2KLUA 1QGKB 1JOCA 4JQ0D 3JSVC 1MZ9A 3MGNA 3OJAB 1H8AA 1HGZA 1SQBK 4TT3H 3ABVC 5CCGC 2E76B 3II6A 2WSFJ 1U7MA 4H13C 2HODC 1URQD 2PAJA 5AW1B 2AXTE 4ZMDA 3TSIA 1KILB 3AECC 3L70G 3VMZA 3M0DA 1N8RQ 3WU2E 1VQ9P 3I5CA 1M7LA 3BCCE 4PJ0H 4EIJA 3O6QB 5KKZB 2NPSB 4R4LA 1FZAB 3E1IA 2Q3IA 1G2CB 1JC9A 4JYOX 2BEQD 3L75G 2J2PA 1K04A 2WTYA 4N78D 1ZOYC 1EDLA 2JP3A 1S5LH 1SQVK 3V6IA 3S1KA 4WY4B 2QJYB 1FZAA 2HYNA 2OQQA 1LT9C 3SFDC 2HG5D 2J60A 1JUNA 1L4AA 3CWBG 2O01J 2KZJA 1T3UA 1NU1K 2Y9YA 1OX3A 3VMAA 3I55P 2WNPF 3RK3E 1L0NE 1RF1B 1NTKK 2OGUA 1GL2D 2L5GB 1PPJG 5TJHA 2YO3A 5AW3B 1SQVJ 2IZ1A 2DW3A 2J3UA 1KB9E 3JC22 5APYA 3D71A 2N1TB 2YNYA 4Y99C 1NTKE 2FIBA 4XE5B 1N7SB 2Q6QA 1NOHA 3RGUA 4GIFA 2KZIA 2ZT9D 3PLNA 1BE3J 1KQLA 3AEFC 5KAFE 3A0HH 4C46A 1ZN5A 1SVFA 3L75E 2NZ2A 2H7HA 5KLVJ 2P67A 1NTMJ 5BVZA 3TF5A 1QEXA 1HGVA 1LTSC 4BXLA 1Q2NA 1PP9G
chains in the Genus database with same CATH topology
2J3FD 2VRSA 1FIDA 5CCHC 5AW7B 3OA7A 3VN0A 2LKMA 3B5NC 3P8CD 4NYTA 3NMDA 4M7FA 1G2CA 1NKNA 1NO4A 2PP6A 1XTCC 1X9VA 4W80A 3TNUA 1JCDA 3RK2D 5AW8B 2XZRA 2QM7A 1T3JA 4RESB 1KILD 1J1DB 1FICA 2C0WA 1JY2O 1J1DC 2WITA 3B8EB 1LTIC 2I1KA 1FJPA 3HD7B 1SFCD 2WPRA 3V4WA 5APXA 1GL2C 1RE3A 2N9BA 3BATA 3LIEA 1JY3N 1H89A 2Q7CA 2H43B 4W7YA 1LT9B 3N7NA 4IFDK 3KYQA 2OYIB 3SWFA 3BVHB 1NTMK 1NKZB 1IFDA 3C9IA 2XKMA 1CW5A 2XNXB 2ZFCA 1JO5A 1QL1A 2BASA 3GHGB 4ZKPA 2YKQA 4GT1A 4HH2A 1RE4B 1SQXK 1GW3A 2J0YA 2HFED 5CHXA 1JMMA 3LW5H 3HRNA 3RL0D 2WT7A 1JY2P 3NFQA 5AW5B 3RK3D 1GZLA 4C7NA 2P1JA 3HUSC 1VPCA 3TYYA 1N73B 5AVXB 1H88A 3U59A 1S9KE 2J59M 2KOGA 3M0DC 2FXMA 5APUA 4DOJA 3EQ2A 5APSA 4XA4A 1N73A 2KYVA 1J2JB 1FAVA 5AVYB 4ZKUA 5BU5A 1LWUC 1FOSF 1LTTC 1RF0C 2J3FA 5CCHA 1T2KC 3HUSA 2IX7C 3HD7A 1IC2A 4N78E 4WB4A 3V2NA 1GK4A 2HPCA 1N2DC 4B86A 2J1GA 1LTJC 1YTZI 1FZEC 2JHKF 2HODA 5AW6B 3RL0B 2JEEA 4EPUA 1RF0A 2WPSA 2HLOC 3TNUB 2Z4EB 5BU8B 3V2QA 3BRTB 2GM4A 1RY3A 1ZLLA 3LIDA 1MV8A 3NXSA 2IFMA 5AVWB 1RF1C 1FZGA 1N86B 3V5BA 2YKOA 1FZFB 2OARA 2E42A 3VMXA 2J61B 1GL2A 1RE3C 1JTHB 5KTBA 2NPSA 2WPQA 1DEBA 2A45H 3MUDA 2OYHB 2KSJA 1FZCB 4N3YB 5AW9B 4I6MC 1FZGB 2KP8A 3L4FA 1FOSE 2M8RA 3B5NB 2Q9IA 3KDPB 4ZFGA 3A2AA 3VTPC 1IFIA 1KILA 3RK2B 3V4QA 2XDJA 5AVVB 3P7KA 1WT6A 1GTWA 1J1EC 3V2RA 2R3CA 1HJBA 2FFDB 1N7SC 3A3YB 1LWUA 5AVZB 1CI6B 5AVUB 4IFMA 1FZFC 1PFIA 3GHGC 5KLVK 1DH3A 3MIWA 1JY3O 1SFCA 1N7LA 2POHA 1HTLC 1OXZA 3PP5A 1Z56A 2KB7P 2Q9IC 4WBAA 4AQRD 4C7NB 1KZUB 1LTGC 3SWYA 1SQQK 1MFZA 1J1EB 3O8ZA 4AYCA 2WT7B 3VOPA 4JYCA 5APTA 2JHMF 1JY2N 1RE4A 3L36A 3GHGA 3HE5B 1NTZK 1W2EA 2W6AA 5CJ0A 1HBWA 1FZGC 1L0NK 3MD0A 3VP9A 3TK1A 3BASA 2WZ7A 1LWUB 1E5WA 4JZCA 3B5ND 1FZAC 2NPSC 4M3LA 1RE4C 2R5DA 2D39A 3HD7D 4GKGA 2FKWB 2KLVA 1N86C 2HLOA 1NH4A 1JNMA 2CPBA 4WY4C 1N7SD 3RK2C 1SLQA 3L37A 3CI9A 3UIAA 1FU1A 4N6JA 1FZBC 1URQC 1OWAA 2YO2A 1HVVA 1L0LK 1IFNA 2JHHC 3HTKB 4IFFA 1LT9A 1M1JC 2I1JA 3U1CA 5AW0B 1JTHA 1GL2B 5APVA 1YYCA 2Q9IB 1N86A 5AVTB 1IFJA 4R9TA 2J0HA 3HE4A 1CZQA 2JHLF 1T8ZA 4I2LC 5APWA 2C9NY 1ZR2A 1URQA 1FZBA 1EQ7A 3P32A 2C9LY 1HUCA 2CPSA 1M1JB 2ZXEB 1KFNA 3E1IB 1QL2A 4OH8B 5AW2B 3HTKA 3A5TA 2Z4EC 1FZFA 2C0XA 3FIBA 1URQB 3H32C 1X79B 3RL0C 1SP4A 1SFCC 3EFGA 2W6BA 3HD7C 2HPCC 3WMM0 3RK3C 5AVSB 5CCGA 2FYUK 5CJ4A 2J58A 2P7JA 3U1AA 3HUSB 2WWWA 3OAKA 4M7HA 2Z4EA 5CMZA 4C7RA 2M3BA 3NTNA 1FDMA 1RF0B 3R2PA 5CCHD 4KHXA 4EOTA 1JY3P 2HODB 3IR9A 3P8MC 3VP8A 3IFMA 3VYIA 4LGDE 5AW4B 2HPCB 2E43A 5AVQB 3H32B 4LLHA 1Z3UA 3KPEA 2WSEH 2XU6A 1HWTC 1MUUA 1KILC 2J64A 1JOCA 1IJDB 3MTUE 1N73C 1NHLA 1MZ9A 1HH0A 3M06A 5AVRB 3MGNA 3OJAB 1H8AA 2J0GA 1HGZA 1L4AC 1A02J 1N7SA 1GU4A 3M91A 1SQBK 5CCGC 4WY4D 3II6A 1IO4A 1FZEA 4AUWA 2P2UA 3KQGA 2HODC 1URQD 1LTAC 3RK3B 4O9BA 1CI6A 1LTJA 2PAJA 5KJ7A 1A02F 2A45G 5APQA 5AW1B 1FJKA 2H43C 3CL3D 3TSIA 1KILB 1LTBC 2FYZA 2J3OA 1GW4A 4JYBA 3B5NA 2XNXA 1T2KD 2J5ZA 1IK9A 3VMZA 4R9JA 3M0DA 4Y99B 2OYHC 3H6PA 1X8YA 2GUSA 1RF1A 3A7OA 3I5CA 1M7LA 4EIJA 2H43A 1ZV8A 2NPSB 3M9BA 1FZAB 3N4XA 2R32A 3E1IA 1IFMA 2Q3IA 1G1IA 1LGHB 1FBMA 1G2CB 1YTZT 1JC9A 4JYOX 1AQ5A 3HE4B 3M0AA 2J2PA 1SQPK 2WTYA 4N78D 2N1TD 1FZCA 2GUVA 2R5BA 1SQVK 2OYHA 3M9HA 4WY4B 5KJ7D 2A45I 1FZAA 2XV5A 2HYNA 2J3GA 1LT9C 1M1JA 2J61A 2HG5D 1FZBB 2J60A 3E1IC 1JUNA 1L4AA 2WSFH 1T3UA 3G3ZA 1FZCC 1NU1K 4DZOA 2O01H 2MJZA 2WNPF 1S9KD 2QM8A 1WRGA 2FFDC 1FZDA 1CSBA 2Q5UA 4HYTB 1RF1B 1Z3SA 1NTKK 1L4AD 4LC1A 2NPSD 1FZEB 3HE5A 1GL2D 5CCGD 2L5GB 3VMYA 2HLOB 4W7ZA 2Z5IA 2YO3A 1NAFA 5AW3B 3T97A 1G1JA 2J3UA 1LTJB 5APYA 5KJ7C 2JJLA 2N1TB 2YNYA 4Y99C 1GK6A 1FIBA 3L35A 2YMYA 2XNXC 2JHIF 2O1JA 2FIBA 1VDFA 1SFCB 4XE5B 3M9QA 1N7SB 4I1LA 2N1TA 1DX7A 1KFMA 3BVHA 2OYIA 1NOHA 1GU5A 2FFDA 2W27A 1ZR4A 2O1KA 3BRVB 4GIFA 1JCCA 2Z5HA 3H32A 1GD2E 1XTGB 1RE3B 1KQLA 3V2PA 3P8CE 4C46A 2H8PD 1ZN5A 1SVFA 2H7HA 1L4AB 2N1TC 2IPPA 2P67A 1NWQA 4JF7A 2IFNA 2OYIC 3BVHC 5BVZA 1AFOA 2GY7A 2WSCH 1HGVA 3CLQA 1LTSC 4WY4A 1GDTA 2YKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3F D;  1FID A;  1N86 A;  2Q9I B;  1JC9 A;  4JYO X;  4R9T A;  2J0H A;  2J2P A;  2JHL F;  1RF1 C;  1FZG A;  1N86 B;  4NYT A;  1FZC A;  4M7F A;  1FZB A;  1FZF B;  2OYH A;  2J61 B;  1RE3 C;  1M1J B;  3E1I B;  2A45 I;  1FZA A;  2J3G A;  1LT9 C;  1M1J A;  2J61 A;  2A45 H;  2OYH B;  2Z4E C;  1FZF A;  1FZB B;  2J60 A;  3FIB A;  3E1I C;  3H32 C;  1FZC B;  1FIC A;  1FZG B;  1T3U A;  1JY2 O;  2HPC C;  1FZC C;  2Q9I A;  4ZFG A;  3HUS B;  1RE3 A;  2WNP F;  4M7H A;  1JY3 N;  2Z4E A;  2FFD C;  1FZD A;  1RF0 B;  2H43 B;  1LT9 B;  1JY3 P;  2FFD B;  2HOD B;  1RF1 B;  1Z3S A;  1LWU A;  2OYI B;  3BVH B;  1FZF C;  3GHG C;  1JY3 O;  2XNX B;  1FZE B;  2HPC B;  3GHG B;  3H32 B;  1RE4 B;  2Q9I C;  2HLO B;  1Z3U A;  2J0Y A;  2J64 A;  1N73 C;  1JY2 P;  2J3U A;  1LTJ B;  2J0G A;  3HUS C;  1N73 B;  2JHM F;  1JY2 N;  1FIB A;  1RE4 A;  2XNX C;  2JHI F;  3GHG A;  2FIB A;  1FZE A;  1W2E A;  1FZG C;  2HOD C;  1N73 A;  3BVH A;  2OYI A;  1LWU B;  1LTJ A;  2FFD A;  4JZC A;  2A45 G;  1FZA C;  1RE4 C;  1LWU C;  2D39 A;  1RF0 C;  2H43 C;  1N86 C;  2J3F A;  2HLO A;  3H32 A;  1RE3 B;  3HUS A;  2J3O A;  2HPC A;  2XNX A;  2J5Z A;  2J1G A;  1FZB C;  1LTJ C;  4R9J A;  1FZE C;  2OYH C;  2JHK F;  1RF1 A;  2HOD A;  2JHH C;  4EPU A;  1M1J C;  1LT9 A;  1RF0 A;  2H43 A;  2OYI C;  3BVH C;  2HLO C;  2GY7 A;  2Z4E B;  1FZA B;  3E1I A; 
#chains in the Genus database with same CATH topology
 1DIP A;  2J3F D;  5GTH H;  3H1L D;  1OW8 A;  1USD A;  1K73 Q;  2LKM A;  3P8C D;  3W67 A;  1NTK J;  1NO4 A;  1EZV D;  3GF3 A;  1BCC J;  2XZR A;  4RES B;  1KIL D;  1SQP D;  1SQP J;  1FIC A;  2SPZ A;  2I1K A;  1P84 I;  1SFC D;  1S5L X;  3V4W A;  1RE3 A;  3LIE A;  1JY3 N;  3SWK A;  2WVR A;  3KYQ A;  2OYI B;  1AVO A;  1PIX A;  1NTM K;  3MUD C;  1IFD A;  1CW5 A;  5KLI B;  1RE4 B;  1IK7 A;  1YI2 P;  3L70 J;  2ZAE B;  1H88 A;  2J59 M;  3B71 A;  1VQK P;  2KOG A;  2FXM A;  5APS A;  3EWK A;  5AVY B;  5BU5 A;  3CCR P;  2J3F A;  1NGM B;  4OGQ B;  2J1G A;  4PD4 I;  2M0B A;  2ZJS E;  1M57 D;  2BCC E;  3RL0 B;  4EPU A;  3L75 J;  2WPS A;  2J5U A;  2Z4E B;  3BCC G;  4L73 A;  2ZYD A;  3LID A;  2V4H A;  1FZG A;  1N86 B;  3V5B A;  1FZF B;  2OAR A;  2E42 A;  3VMX A;  1GL2 A;  1JTH B;  1OIP A;  3ITK A;  1DEB A;  3MUD A;  1BCC E;  2OYH B;  2M5A B;  3ZDM A;  2KIK A;  2P10 A;  3KHU A;  3TDK A;  2WSS H;  5AVV B;  1WT6 A;  1J1E C;  2FYU E;  1ZRT E;  3V2R A;  2R3C A;  1HJB A;  1N7S C;  4H13 B;  1FS0 E;  4IFM A;  3GHG C;  1N7L A;  1SQV G;  4Y28 J;  1Z56 A;  2Q9I C;  1S2E A;  1BE3 G;  2WT7 B;  4IL6 X;  5APT A;  1H0T B;  3CX5 I;  3L70 E;  4BRY B;  1P84 D;  3AE7 C;  1BGY E;  2W6A A;  3OW2 O;  1SQQ G;  1L0N K;  4JBZ A;  1LWU B;  2R44 A;  3B5N D;  4H0L D;  1FZA C;  3L71 E;  1LNQ A;  2D39 A;  3HD7 D;  1NH4 A;  1NU1 E;  4EDF A;  3CI9 A;  3Q5P A;  1FZB C;  3CCM P;  2JHH C;  3HTK B;  1SQB E;  2B87 B;  4K3A A;  1MFT A;  2J0H A;  2KNC B;  4EI2 A;  1DD4 A;  1T8Z A;  2C9N Y;  3H1K D;  1PP9 J;  4WWI A;  3E1I B;  1KFN A;  1QL2 A;  1KB9 I;  1QLE D;  2JR8 A;  3CMA P;  3HTK A;  3A5T A;  1JEK A;  3AE3 C;  4MN4 C;  3FIB A;  1RQU A;  1X79 B;  2W6B A;  3HD7 C;  3CC4 P;  2J58 A;  1T6A A;  3A0B H;  1RF0 B;  2HOD B;  1L2P A;  3P8M C;  3CCS P;  1KN7 A;  4LGD E;  2IBZ G;  4JPZ B;  3CCJ P;  4BRY A;  1NYH A;  3GG2 A;  2XU6 A;  1MUU A;  2J64 A;  3MTU E;  3M06 A;  2YIU B;  1KOR A;  1L4A C;  1GU4 A;  1SQX J;  3M91 A;  1FZE A;  4AUW A;  3CX5 E;  1K9M Q;  1EXI A;  3CD6 P;  1JMB A;  1LTJ A;  1MKM A;  2YIU C;  2H43 C;  1NTZ D;  2IYP A;  5DJU B;  1KMI Z;  1GW4 A;  4U3F G;  2XNX A;  1K8A Q;  5KLV E;  3EFF K;  1IK9 A;  2QSI A;  4R9J A;  1KD1 Q;  3A7O A;  4D6T J;  3L73 J;  3M9B A;  1G1I A;  4IL6 E;  3AE6 C;  4PV1 B;  1YTZ T;  3H1L G;  1AQ5 A;  2YMK A;  1L0L D;  4L75 A;  4U7J A;  5KAI E;  2R5B A;  1IFP A;  2OYH A;  1OW7 A;  2FXO A;  2K37 A;  3E1I C;  3G3Z A;  5DJT B;  3CWB E;  2E75 B;  2Y0D A;  2MJZ A;  1HF9 A;  1S9K D;  4YPC A;  2FFD C;  3IAO A;  1VQ4 P;  1CSB A;  2Q5U A;  3GMA A;  3L73 E;  1BE3 E;  4R4M A;  3Q5S A;  2QJP C;  3HE5 A;  5CCG D;  4W7Z A;  2Z5I A;  3H1I E;  1YQ3 C;  2JDI H;  2A06 G;  1KTM A;  1G1J A;  1OW6 A;  1SQQ J;  4D6T D;  2JJL A;  4OGQ C;  3L35 A;  2YMY A;  2XNX C;  2E74 B;  1KYO I;  1VDF A;  3K5B A;  2Y0E A;  4UB6 E;  1KFM A;  2OYI A;  2FFD A;  2O1K A;  2AEM A;  3BRV B;  3TGU J;  3H25 A;  3SFE C;  1JCC A;  1PP9 D;  1L0N J;  1GD2 E;  1RE3 B;  4NPF X;  1PV3 A;  3KZI H;  3AE9 C;  2H8P D;  4L76 A;  2CK3 H;  2PRR A;  2IPP A;  1NWQ A;  1S72 P;  4JF7 A;  1FC2 C;  2OYI C;  1EDJ A;  2FXP A;  1OVU A;  3QWO C;  1GDT A;  3BCC J;  4K35 A;  2YKP A;  2VRS A;  1SQQ E;  3VN0 A;  1PGQ A;  4OGQ D;  3H1J D;  1NTZ J;  1NKN A;  4TLF A;  1XTC C;  1X9V A;  4PD4 D;  1VQN P;  4W80 A;  3TNU A;  3RK2 D;  4UB6 H;  2QVA A;  1FJP A;  3H1J J;  2PFX A;  5B66 H;  1H89 A;  2A06 D;  2Q7C A;  4W7Y A;  1LT9 B;  1KC8 Q;  3SWF A;  2LXC B;  2ZT9 B;  2XKM A;  2RMZ A;  3PTZ A;  2XNX B;  1LT1 A;  1Q90 D;  2BAS A;  4ZKP A;  2Q3E A;  4GT1 A;  1SQX K;  2J0Y A;  5H2F H;  2XND H;  3HRN A;  1BSN A;  1JY2 P;  1BDD A;  3H1H E;  3H1I J;  3D70 A;  3HUS C;  1BGY J;  3TYY A;  5AVX B;  2ZT9 C;  3AE8 C;  4DOJ A;  4XA4 A;  3AEA C;  1FAV A;  4ZKU A;  4H44 C;  1FOS F;  1LTT C;  5CCH A;  1VF5 D;  3HUS A;  1DD3 A;  2IX7 C;  3HD7 A;  3E1R A;  1RQV A;  4B86 A;  5CBO A;  1YTZ I;  1OFC X;  2JHK F;  3H1H D;  2R3S A;  2HOD A;  2QG4 A;  1RF0 A;  4PJ0 E;  2GM4 A;  4H13 D;  1ZLL A;  4OVN F;  4UB8 E;  1MV8 A;  1NTM D;  2KI7 B;  2IFM A;  2ITA A;  1M8O B;  4HJG H;  2RH0 A;  2UWJ E;  2YKO A;  1DEE G;  2ZVN B;  2IYO A;  2NPS A;  2A45 H;  2D2C C;  2O01 N;  5AW9 B;  4I6M C;  2KP8 A;  1FOS E;  4ZFG A;  3KDP B;  2M3E A;  3A2A A;  4CPG A;  2B87 A;  5TIS E;  3VTP C;  1KIL A;  3V4Q A;  2QJK C;  2XDJ A;  3CXH E;  1X22 A;  1D7M A;  2BCC J;  2NRG A;  5B5E H;  1PGO A;  1ZME C;  3A0H E;  2GA1 A;  2E74 C;  5KLV K;  3MIW A;  2POH A;  3AE4 C;  4C7N B;  1KZU B;  1SQQ K;  1L0N G;  1AQT A;  4JYC A;  4GOD A;  1KYO H;  3CCE P;  4H0L B;  1NJI Q;  1HJ0 A;  2QA4 P;  3GLM A;  2K3R A;  1W5C E;  1OMI A;  3GHG A;  1M90 Q;  1PPJ E;  5M1B A;  1PP9 E;  1HBW A;  3MD0 A;  3VP9 A;  3BAS A;  3KXD A;  1YIJ P;  4M3L A;  2FKW B;  2HLO A;  1BSH A;  1JNM A;  1NTZ G;  2CPB A;  4IOI H;  1JM0 A;  4BWN A;  1P84 H;  4U3F J;  2E74 D;  4D6T E;  2K9J B;  2YO2 A;  4UB8 H;  2W83 C;  4IFF A;  1LT9 A;  3AED C;  3D6Z A;  1QVF O;  1YYC A;  3HE4 A;  3MHV A;  1L0L G;  4I2L C;  3L73 D;  2FYN B;  1EQ7 A;  2C9L Y;  1HUC A;  2CPS A;  1U7J A;  2YXR B;  2ZXE B;  4OH8 B;  1FZF A;  1URQ B;  3CWB D;  1UIX A;  3F89 A;  3EFG A;  3CWB J;  3WMM 0;  3RK3 C;  5AVS B;  1NU1 J;  5CJ4 A;  1PPJ D;  2WPV B;  3HUS B;  2Q1K A;  3R4Y A;  2KSE A;  2Z4E A;  5CCH D;  2E5Y A;  4RO0 A;  3IR9 A;  3IFM A;  3CXH I;  3VYI A;  2KUB A;  5AVQ B;  3KPE A;  2WSE H;  1HWT C;  1IJD B;  1N73 C;  1KB9 H;  5AVR B;  1HH0 A;  1AJY A;  2H89 C;  1A02 J;  3CXH D;  4I7Z B;  1TU3 F;  1S5L E;  4WY4 D;  4A7P A;  1VQM P;  3KQG A;  1LTA C;  4O9B A;  1CI6 A;  4H44 D;  1SS1 A;  1VF5 C;  5APQ A;  1ZXG A;  3CX5 D;  1LTB C;  2FYZ A;  2J3O A;  4JYB A;  3B5N A;  1T2K D;  2D2C D;  4ASV A;  1LP1 A;  3AEB C;  1NTM E;  4Y99 B;  2OYH C;  2MKV A;  1X8Y A;  5GTH E;  4HB1 A;  1ZV8 A;  1AV1 A;  1KQG B;  2HR3 A;  1IFM A;  3L72 G;  3LW5 J;  1LGH B;  1FBM A;  2W90 A;  3M0A A;  2IBZ I;  2N1T D;  1FZC A;  2G3A A;  1AVY A;  2GUV A;  4KJM A;  1EZV G;  5KJ7 D;  2A45 I;  1ZP0 C;  1M1J A;  3L74 J;  2J61 A;  3B4S A;  2QRX A;  1FZB B;  3L71 G;  3CX5 H;  1SQP G;  1FZC C;  3JCU E;  2QM8 A;  1FZD A;  4HKZ H;  1S1C X;  4HYT B;  2QJK B;  1Z3S A;  1W2B O;  3WU2 H;  2WSC J;  1L4A D;  2KS1 B;  3MZW B;  1YJ9 P;  3VMY A;  1NAF A;  3GF7 A;  1LTJ B;  5KJ7 C;  4RJT A;  2A06 E;  1YBK A;  1BGY G;  2E76 C;  2O1J A;  1VL2 A;  1SFC B;  3M9Q A;  2N1T A;  1VQ7 P;  1DX7 A;  1GU5 A;  2W27 A;  4ASW A;  3JCU H;  2Z5H A;  4PD4 E;  1BGY D;  1P84 E;  1Y47 A;  3V2P A;  3L70 D;  3H1J E;  2JWA A;  2FBW C;  3H1H G;  2ZXX A;  2IZ0 A;  1SQQ D;  2IFN A;  3CLQ A;  3AE5 C;  1JB0 J;  2LR2 A;  1FID A;  2ZVO B;  5CCH C;  2FY8 A;  3OA7 A;  3FXE A;  3B5N C;  4NYT A;  3NMD A;  3CCV P;  4M7F A;  2FYU D;  3FWN A;  4XFJ A;  5AW8 B;  2QM7 A;  5B66 E;  1J1D B;  3S4R A;  2E75 C;  1JY2 O;  1KV4 A;  2B89 A;  2WIT A;  4EYY Q;  1UII A;  2WPR A;  3CC2 P;  2K9Y A;  5APX A;  4WVZ A;  3L73 G;  2N9B A;  4I7Z C;  1E79 H;  1SQX G;  2BCC G;  4IFD K;  3BVH B;  2FYN C;  3FX0 A;  1NKZ B;  3H1I D;  2W6J H;  1QL1 A;  3GHG B;  2V7Q J;  2HFE D;  5CHX A;  1BE3 D;  3T97 B;  2BCC D;  4C7N A;  1N73 B;  1S9K E;  3FGA D;  1KQS O;  3M0D C;  1EC5 A;  2E75 D;  5APU A;  1N73 A;  2KYV A;  1J2J B;  2B88 A;  3G4S P;  2L91 A;  1K05 A;  5EFW B;  1T2K C;  1X0T A;  1IC2 A;  2HPC A;  3Q3D A;  1L0L E;  3L72 J;  3F5H A;  1SQB J;  1FZE C;  5AW6 B;  2JEE A;  3CCQ P;  2QJY C;  2W8Z A;  2HLO C;  5BU8 B;  1RH5 B;  2ZYG A;  4KT0 J;  1RY3 A;  3CCL P;  1PGJ A;  1M1K Q;  1VQ6 P;  5AVW B;  5KLV D;  1VQO P;  1ZW0 A;  2N9Y B;  1NTZ E;  2WMM A;  3WUT A;  1Y8A A;  5TIS H;  2OTJ P;  3A0B E;  1FZG B;  3FXD A;  3KZI E;  2AXC A;  1EXJ A;  1SQP E;  5KLV G;  2KK7 A;  4DCK A;  4H0L C;  3RK2 B;  3P7K A;  1GTW A;  1YHQ P;  3A3Y B;  3H1K J;  1LWU A;  5AVU B;  1FZF C;  1PFI A;  3AEG C;  3GW6 A;  1DH3 A;  1JY3 O;  1SFC A;  3H1L E;  3PP5 A;  4H44 B;  1R5S A;  4WBA A;  1H0T A;  1LTG C;  4PV1 D;  3SWY A;  4NPE A;  3VOP A;  1Q82 Q;  4Z1M H;  1NTZ K;  5CJ0 A;  2BEZ F;  3TK1 A;  3CC7 P;  2D2C B;  2NPS C;  2R5D A;  1N86 C;  2FYU J;  2I8D A;  4WY4 C;  1N7S D;  3H1K E;  1SLQ A;  3L37 A;  3UIA A;  1PGP A;  1URQ C;  4IL6 H;  2M5A A;  1HVV A;  1L0L K;  1IFN A;  2I1J A;  1JTH A;  1GL2 B;  1SQB D;  5KKZ C;  3S9O A;  2Q9I B;  1N86 A;  5AVT B;  1IFJ A;  5KLI C;  2RN0 A;  2JHL F;  3Q2Y A;  3QH9 A;  1ZR2 A;  1FZB A;  1NU1 D;  1M1J B;  5AW2 B;  2K1A A;  3L71 D;  4YTP C;  5E79 H;  1VF5 B;  3L71 J;  1AA0 A;  1SFC C;  1LP1 B;  4DT0 A;  1VQ8 P;  5C39 A;  2P7J A;  2YXQ B;  3U1A A;  4M7H A;  4OWF A;  5CMZ A;  4C7R A;  3NTN A;  4KHX A;  4EOT A;  1JY3 P;  3VP8 A;  2WQY C;  5AW4 B;  5KAF H;  2E43 A;  2OTL P;  2O3J A;  1OZH A;  1Z3U A;  5H2F E;  1NHL A;  1ZRT D;  2KXP B;  2J0G A;  3AE1 C;  3CME P;  2Y0C A;  3I56 P;  1N7S A;  2H88 C;  3RBZ A;  1IO4 A;  1VQL P;  2OTK E;  2P2U A;  5K5G B;  3RK3 B;  1S3J A;  5KJ7 A;  1A02 F;  1BCC D;  2A45 G;  1BCC G;  1FJK A;  1SQB G;  3C8V A;  2JKV A;  2E76 D;  3CL3 D;  1YJN P;  3CXH H;  2AEJ A;  1Q7Y Q;  3G6E P;  2J5Z A;  1PZQ A;  3USS A;  3H6P A;  2GUS A;  1RF1 A;  2H43 A;  3N4X A;  2R32 A;  3FWL A;  3G9R A;  3HE4 B;  1NVO A;  1SQP K;  3M9H A;  3H1K G;  2XV5 A;  1OVR A;  2J3G A;  3WUU A;  5GTI H;  2QEX P;  3PJS K;  2WSF H;  3H1I G;  4YXW H;  3IF4 A;  3IN6 A;  3CCU P;  4PD4 H;  1EZV I;  2O01 H;  4DZO A;  3TGU E;  1WRG A;  1EDK A;  1USE A;  4L74 A;  4LC1 A;  2NPS D;  1Y9B A;  1FZE B;  2JWD A;  4PV1 C;  2HLO B;  4RKU J;  3T97 A;  3PH0 A;  1FE6 A;  2RKL A;  1GK6 A;  1FIB A;  2QE7 H;  2JHI F;  1FDI A;  3AE2 C;  4I1L A;  1WMK A;  3BVH A;  1PL5 A;  1KIL E;  1ZR4 A;  1GMJ A;  1NAY A;  4NPD A;  3H32 A;  1EZV E;  1L0L J;  1XTG B;  3RBX A;  3P8C E;  3E7K A;  3PHL A;  1L4A B;  2FYU G;  2N1T C;  2P58 A;  3BVH C;  1AFO A;  2GY7 A;  2WSC H;  4WY4 A;  1SQV E;  3RL0 g;  5AW7 B;  3L75 D;  5CBN A;  2KNC A;  4U3F D;  1G2C A;  2PP6 A;  1JCD A;  3O6Q A;  5E79 E;  1YIT P;  2AXT H;  1T3J A;  2C0W A;  1J1D C;  3B8E B;  1LTI C;  3HD7 B;  1NTK D;  1GL2 C;  3BAT A;  1VQ5 P;  3CPW O;  2H43 B;  1KB9 D;  3N7N A;  3G71 P;  3H1L J;  3C9I A;  3W68 A;  2IBZ D;  2ZFC A;  1JO5 A;  2PGD A;  2YKQ A;  4HH2 A;  1YQ4 C;  1GW3 A;  1JMM A;  3LW5 H;  3RL0 D;  2WT7 A;  1L0N D;  3NFQ A;  5AW5 B;  3RK3 D;  1GZL A;  2P1J A;  1VPC A;  4DJG A;  3U59 A;  2QJP B;  2KS1 A;  3EQ2 A;  1KYO E;  3Q1M A;  1QX8 A;  1KYO D;  2AEF A;  1IZN B;  1S4X A;  1LWU C;  1RF0 C;  4N78 E;  4WB4 A;  3V2N A;  1GK4 A;  1N2D C;  1LTJ C;  3D6Y A;  1NU1 G;  4QMA A;  3TNU B;  3V2Q A;  3BCC D;  3BRT B;  2ZYA A;  2IBZ E;  3NXS A;  5KAI H;  1RF1 C;  1NTK G;  2IDB A;  2J61 B;  1RE3 C;  5KTB A;  2WPQ A;  2E5T A;  2KSJ A;  1FZC B;  1KQF B;  4N3Y B;  1U57 A;  3L4F A;  2M8R A;  3B5N B;  2Q9I A;  3H1J G;  1IFI A;  1BDC A;  2WSE J;  1Q86 Q;  1Q81 Q;  2FFD B;  2JO1 A;  5AVZ B;  1CI6 B;  4U3F E;  3AEE C;  1HTL C;  1SQV D;  1OXZ A;  2KB7 P;  1R8E A;  4AQR D;  1MFZ A;  3C1L A;  1J1E B;  3O8Z A;  1SQX E;  4AYC A;  3PRJ A;  2B9B A;  4D6T G;  1M56 D;  2JHM F;  1EDI A;  1JY2 N;  1RE4 A;  3H1H J;  3L36 A;  3HE5 B;  1W2E A;  1QVG O;  1FZG C;  4YXD C;  1OVV A;  2WZ7 A;  1E5W A;  2LXB A;  5B5E E;  4JZC A;  1RE4 C;  4GKG A;  2KLV A;  3L74 G;  3L74 D;  3WUV A;  3RK2 C;  1FU1 A;  4N6J A;  1OWA A;  1R5L A;  2QIW A;  5L8R J;  3L72 E;  1M1J C;  2OYO A;  4GOE A;  3U1C A;  5AW0 B;  3L72 D;  5APV A;  4R9T A;  2K88 A;  1NTM G;  4GDO A;  1CZQ A;  2V7Q H;  5APW A;  1YJW P;  2Y9Z A;  1VQP P;  1URQ A;  3L74 E;  3MP7 B;  3P32 A;  4ZNC A;  3TGU D;  2Z4E C;  2C0X A;  1FDO A;  5GTI E;  3H32 C;  3RL0 C;  1SP4 A;  2K9J A;  2HPC C;  5CCG A;  2FYU K;  1LJ2 A;  3Q5R A;  2WWW A;  3OAK A;  2M3B A;  1FDM A;  2G8Y A;  3R2P A;  4GOF A;  3SSU A;  1SQX D;  3TGU G;  1RHZ B;  2HPC B;  3H32 B;  4LLH A;  1KIL C;  2KLU A;  1QGK B;  1JOC A;  4JQ0 D;  3JSV C;  1MZ9 A;  3MGN A;  3OJA B;  1H8A A;  1HGZ A;  1SQB K;  4TT3 H;  3ABV C;  5CCG C;  2E76 B;  3II6 A;  2WSF J;  1U7M A;  4H13 C;  2HOD C;  1URQ D;  2PAJ A;  5AW1 B;  2AXT E;  4ZMD A;  3TSI A;  1KIL B;  3AEC C;  3L70 G;  3VMZ A;  3M0D A;  1N8R Q;  3WU2 E;  1VQ9 P;  3I5C A;  1M7L A;  3BCC E;  4PJ0 H;  4EIJ A;  3O6Q B;  5KKZ B;  2NPS B;  4R4L A;  1FZA B;  3E1I A;  2Q3I A;  1G2C B;  1JC9 A;  4JYO X;  2BEQ D;  3L75 G;  2J2P A;  1K04 A;  2WTY A;  4N78 D;  1ZOY C;  1EDL A;  2JP3 A;  1S5L H;  1SQV K;  3V6I A;  3S1K A;  4WY4 B;  2QJY B;  1FZA A;  2HYN A;  2OQQ A;  1LT9 C;  3SFD C;  2HG5 D;  2J60 A;  1JUN A;  1L4A A;  3CWB G;  2O01 J;  2KZJ A;  1T3U A;  1NU1 K;  2Y9Y A;  1OX3 A;  3VMA A;  3I55 P;  2WNP F;  3RK3 E;  1L0N E;  1RF1 B;  1NTK K;  2OGU A;  1GL2 D;  2L5G B;  1PPJ G;  5TJH A;  2YO3 A;  5AW3 B;  1SQV J;  2IZ1 A;  2DW3 A;  2J3U A;  1KB9 E;  3JC2 2;  5APY A;  3D71 A;  2N1T B;  2YNY A;  4Y99 C;  1NTK E;  2FIB A;  4XE5 B;  1N7S B;  2Q6Q A;  1NOH A;  3RGU A;  4GIF A;  2KZI A;  2ZT9 D;  3PLN A;  1BE3 J;  1KQL A;  3AEF C;  5KAF E;  3A0H H;  4C46 A;  1ZN5 A;  1SVF A;  3L75 E;  2NZ2 A;  2H7H A;  5KLV J;  2P67 A;  1NTM J;  5BVZ A;  3TF5 A;  1QEX A;  1HGV A;  1LTS C;  4BXL A;  1Q2N A;  1PP9 G; 
#chains in the Genus database with same CATH homology
 2J3F D;  2VRS A;  1FID A;  5CCH C;  5AW7 B;  3OA7 A;  3VN0 A;  2LKM A;  3B5N C;  3P8C D;  4NYT A;  3NMD A;  4M7F A;  1G2C A;  1NKN A;  1NO4 A;  2PP6 A;  1XTC C;  1X9V A;  4W80 A;  3TNU A;  1JCD A;  3RK2 D;  5AW8 B;  2XZR A;  2QM7 A;  1T3J A;  4RES B;  1KIL D;  1J1D B;  1FIC A;  2C0W A;  1JY2 O;  1J1D C;  2WIT A;  3B8E B;  1LTI C;  2I1K A;  1FJP A;  3HD7 B;  1SFC D;  2WPR A;  3V4W A;  5APX A;  1GL2 C;  1RE3 A;  2N9B A;  3BAT A;  3LIE A;  1JY3 N;  1H89 A;  2Q7C A;  2H43 B;  4W7Y A;  1LT9 B;  3N7N A;  4IFD K;  3KYQ A;  2OYI B;  3SWF A;  3BVH B;  1NTM K;  1NKZ B;  1IFD A;  3C9I A;  2XKM A;  1CW5 A;  2XNX B;  2ZFC A;  1JO5 A;  1QL1 A;  2BAS A;  3GHG B;  4ZKP A;  2YKQ A;  4GT1 A;  4HH2 A;  1RE4 B;  1SQX K;  1GW3 A;  2J0Y A;  2HFE D;  5CHX A;  1JMM A;  3LW5 H;  3HRN A;  3RL0 D;  2WT7 A;  1JY2 P;  3NFQ A;  5AW5 B;  3RK3 D;  1GZL A;  4C7N A;  2P1J A;  3HUS C;  1VPC A;  3TYY A;  1N73 B;  5AVX B;  1H88 A;  3U59 A;  1S9K E;  2J59 M;  2KOG A;  3M0D C;  2FXM A;  5APU A;  4DOJ A;  3EQ2 A;  5APS A;  4XA4 A;  1N73 A;  2KYV A;  1J2J B;  1FAV A;  5AVY B;  4ZKU A;  5BU5 A;  1LWU C;  1FOS F;  1LTT C;  1RF0 C;  2J3F A;  5CCH A;  1T2K C;  3HUS A;  2IX7 C;  3HD7 A;  1IC2 A;  4N78 E;  4WB4 A;  3V2N A;  1GK4 A;  2HPC A;  1N2D C;  4B86 A;  2J1G A;  1LTJ C;  1YTZ I;  1FZE C;  2JHK F;  2HOD A;  5AW6 B;  3RL0 B;  2JEE A;  4EPU A;  1RF0 A;  2WPS A;  2HLO C;  3TNU B;  2Z4E B;  5BU8 B;  3V2Q A;  3BRT B;  2GM4 A;  1RY3 A;  1ZLL A;  3LID A;  1MV8 A;  3NXS A;  2IFM A;  5AVW B;  1RF1 C;  1FZG A;  1N86 B;  3V5B A;  2YKO A;  1FZF B;  2OAR A;  2E42 A;  3VMX A;  2J61 B;  1GL2 A;  1RE3 C;  1JTH B;  5KTB A;  2NPS A;  2WPQ A;  1DEB A;  2A45 H;  3MUD A;  2OYH B;  2KSJ A;  1FZC B;  4N3Y B;  5AW9 B;  4I6M C;  1FZG B;  2KP8 A;  3L4F A;  1FOS E;  2M8R A;  3B5N B;  2Q9I A;  3KDP B;  4ZFG A;  3A2A A;  3VTP C;  1IFI A;  1KIL A;  3RK2 B;  3V4Q A;  2XDJ A;  5AVV B;  3P7K A;  1WT6 A;  1GTW A;  1J1E C;  3V2R A;  2R3C A;  1HJB A;  2FFD B;  1N7S C;  3A3Y B;  1LWU A;  5AVZ B;  1CI6 B;  5AVU B;  4IFM A;  1FZF C;  1PFI A;  3GHG C;  5KLV K;  1DH3 A;  3MIW A;  1JY3 O;  1SFC A;  1N7L A;  2POH A;  1HTL C;  1OXZ A;  3PP5 A;  1Z56 A;  2KB7 P;  2Q9I C;  4WBA A;  4AQR D;  4C7N B;  1KZU B;  1LTG C;  3SWY A;  1SQQ K;  1MFZ A;  1J1E B;  3O8Z A;  4AYC A;  2WT7 B;  3VOP A;  4JYC A;  5APT A;  2JHM F;  1JY2 N;  1RE4 A;  3L36 A;  3GHG A;  3HE5 B;  1NTZ K;  1W2E A;  2W6A A;  5CJ0 A;  1HBW A;  1FZG C;  1L0N K;  3MD0 A;  3VP9 A;  3TK1 A;  3BAS A;  2WZ7 A;  1LWU B;  1E5W A;  4JZC A;  3B5N D;  1FZA C;  2NPS C;  4M3L A;  1RE4 C;  2R5D A;  2D39 A;  3HD7 D;  4GKG A;  2FKW B;  2KLV A;  1N86 C;  2HLO A;  1NH4 A;  1JNM A;  2CPB A;  4WY4 C;  1N7S D;  3RK2 C;  1SLQ A;  3L37 A;  3CI9 A;  3UIA A;  1FU1 A;  4N6J A;  1FZB C;  1URQ C;  1OWA A;  2YO2 A;  1HVV A;  1L0L K;  1IFN A;  2JHH C;  3HTK B;  4IFF A;  1LT9 A;  1M1J C;  2I1J A;  3U1C A;  5AW0 B;  1JTH A;  1GL2 B;  5APV A;  1YYC A;  2Q9I B;  1N86 A;  5AVT B;  1IFJ A;  4R9T A;  2J0H A;  3HE4 A;  1CZQ A;  2JHL F;  1T8Z A;  4I2L C;  5APW A;  2C9N Y;  1ZR2 A;  1URQ A;  1FZB A;  1EQ7 A;  3P32 A;  2C9L Y;  1HUC A;  2CPS A;  1M1J B;  2ZXE B;  1KFN A;  3E1I B;  1QL2 A;  4OH8 B;  5AW2 B;  3HTK A;  3A5T A;  2Z4E C;  1FZF A;  2C0X A;  3FIB A;  1URQ B;  3H32 C;  1X79 B;  3RL0 C;  1SP4 A;  1SFC C;  3EFG A;  2W6B A;  3HD7 C;  2HPC C;  3WMM 0;  3RK3 C;  5AVS B;  5CCG A;  2FYU K;  5CJ4 A;  2J58 A;  2P7J A;  3U1A A;  3HUS B;  2WWW A;  3OAK A;  4M7H A;  2Z4E A;  5CMZ A;  4C7R A;  2M3B A;  3NTN A;  1FDM A;  1RF0 B;  3R2P A;  5CCH D;  4KHX A;  4EOT A;  1JY3 P;  2HOD B;  3IR9 A;  3P8M C;  3VP8 A;  3IFM A;  3VYI A;  4LGD E;  5AW4 B;  2HPC B;  2E43 A;  5AVQ B;  3H32 B;  4LLH A;  1Z3U A;  3KPE A;  2WSE H;  2XU6 A;  1HWT C;  1MUU A;  1KIL C;  2J64 A;  1JOC A;  1IJD B;  3MTU E;  1N73 C;  1NHL A;  1MZ9 A;  1HH0 A;  3M06 A;  5AVR B;  3MGN A;  3OJA B;  1H8A A;  2J0G A;  1HGZ A;  1L4A C;  1A02 J;  1N7S A;  1GU4 A;  3M91 A;  1SQB K;  5CCG C;  4WY4 D;  3II6 A;  1IO4 A;  1FZE A;  4AUW A;  2P2U A;  3KQG A;  2HOD C;  1URQ D;  1LTA C;  3RK3 B;  4O9B A;  1CI6 A;  1LTJ A;  2PAJ A;  5KJ7 A;  1A02 F;  2A45 G;  5APQ A;  5AW1 B;  1FJK A;  2H43 C;  3CL3 D;  3TSI A;  1KIL B;  1LTB C;  2FYZ A;  2J3O A;  1GW4 A;  4JYB A;  3B5N A;  2XNX A;  1T2K D;  2J5Z A;  1IK9 A;  3VMZ A;  4R9J A;  3M0D A;  4Y99 B;  2OYH C;  3H6P A;  1X8Y A;  2GUS A;  1RF1 A;  3A7O A;  3I5C A;  1M7L A;  4EIJ A;  2H43 A;  1ZV8 A;  2NPS B;  3M9B A;  1FZA B;  3N4X A;  2R32 A;  3E1I A;  1IFM A;  2Q3I A;  1G1I A;  1LGH B;  1FBM A;  1G2C B;  1YTZ T;  1JC9 A;  4JYO X;  1AQ5 A;  3HE4 B;  3M0A A;  2J2P A;  1SQP K;  2WTY A;  4N78 D;  2N1T D;  1FZC A;  2GUV A;  2R5B A;  1SQV K;  2OYH A;  3M9H A;  4WY4 B;  5KJ7 D;  2A45 I;  1FZA A;  2XV5 A;  2HYN A;  2J3G A;  1LT9 C;  1M1J A;  2J61 A;  2HG5 D;  1FZB B;  2J60 A;  3E1I C;  1JUN A;  1L4A A;  2WSF H;  1T3U A;  3G3Z A;  1FZC C;  1NU1 K;  4DZO A;  2O01 H;  2MJZ A;  2WNP F;  1S9K D;  2QM8 A;  1WRG A;  2FFD C;  1FZD A;  1CSB A;  2Q5U A;  4HYT B;  1RF1 B;  1Z3S A;  1NTK K;  1L4A D;  4LC1 A;  2NPS D;  1FZE B;  3HE5 A;  1GL2 D;  5CCG D;  2L5G B;  3VMY A;  2HLO B;  4W7Z A;  2Z5I A;  2YO3 A;  1NAF A;  5AW3 B;  3T97 A;  1G1J A;  2J3U A;  1LTJ B;  5APY A;  5KJ7 C;  2JJL A;  2N1T B;  2YNY A;  4Y99 C;  1GK6 A;  1FIB A;  3L35 A;  2YMY A;  2XNX C;  2JHI F;  2O1J A;  2FIB A;  1VDF A;  1SFC B;  4XE5 B;  3M9Q A;  1N7S B;  4I1L A;  2N1T A;  1DX7 A;  1KFM A;  3BVH A;  2OYI A;  1NOH A;  1GU5 A;  2FFD A;  2W27 A;  1ZR4 A;  2O1K A;  3BRV B;  4GIF A;  1JCC A;  2Z5H A;  3H32 A;  1GD2 E;  1XTG B;  1RE3 B;  1KQL A;  3V2P A;  3P8C E;  4C46 A;  2H8P D;  1ZN5 A;  1SVF A;  2H7H A;  1L4A B;  2N1T C;  2IPP A;  2P67 A;  1NWQ A;  4JF7 A;  2IFN A;  2OYI C;  3BVH C;  5BVZ A;  1AFO A;  2GY7 A;  2WSC H;  1HGV A;  3CLQ A;  1LTS C;  4WY4 A;  1GDT A;  2YKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...