1LT9B

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 89
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9B03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9B02
2J3UA 3GHGB 1M1JB 2J5ZA 2XNXC 3H32B 1LWUA 1JY2N 2HLOA 1Z3UA 2J3GA 3E1IC 2J61A 2H43C 2Q9IC 2J61B 2HLOB 3H32A 1FIBA 1RF0C 4R9TA 1RE4A 1N73B 2J0HA 1FZFB 1LT9B 1JC9A 1JY3N 2J3FD 2JHKF 1FZBC 2OYHA 2FFDC 2OYIB 2Z4EC 2J3FA 2HPCB 1FZGB 1JY3P 2JHIF 2J60A 3FIBA 1FZEA 3GHGC 1FZBA 2Z4EA 4NYTA 2JHMF 2XNXB 1FZEB 3BVHA 1FIDA 2HODB 2GY7A 1RF1A 1JY3O 2J1GA 2OYIA 2OYHB 1FZFA 3E1IA 2H43A 1FZFC 2XNXA 1FZBB 2Z4EB 2OYIC 4M7FA 1RF1C 2FIBA 2HPCC 4JZCA 3HUSA 1FZGC 1LTJB 1N86B 1Z3SA 1LWUB 3BVHC 2J2PA 1FZAC 1W2EA 3GHGA 1FZEC 1LT9A 2JHHC 1N73A 2HODC 1RE3C 1FZDA 4M7HA 2FFDA 2OYHC 1FICA 2J3OA 2WNPF 1FZCB 1LTJA 1N86A 3HUSB 1RE4C 1RF0A 1M1JA 2A45G 1M1JC 3H32C 2A45H 1RF1B 4ZFGA 3E1IB 4EPUA 2H43B 1LTJC 2Q9IA 1N86C 2Q9IB 2HLOC 1LWUC 3BVHB 4JYOX 2A45I 1FZAB 1JY2O 1RE3A 1JY2P 1RF0B 2JHLF 2J0GA 2HODA 1N73C 1FZCA 1RE3B 1LT9C 1FZAA 2D39A 2FFDB 2J0YA 4R9JA 1FZCC 1FZGA 3HUSC 2J64A 1T3UA 2HPCA 1RE4B
chains in the Genus database with same CATH superfamily
1SQVK 4I7ZC 1E79H 3E1IC 2H43C 3L74E 2J61A 1J1EB 2HLOB 3FXEA 3KQGA 3L74J 2P10A 3LW5J 3ZDMA 2KSEA 1BDCA 1NTMG 2P58A 2C0XA 4PD4H 2J5UA 1PIXA 2WPQA 3NMDA 3KZIE 2B87A 1IK7A 2NPSA 1KZUB 4GOEA 1W2BO 3L72G 3GHGC 3JSVC 4NYTA 1NAFA 3H1ID 1PFIA 3AEBC 3L72J 1KILE 3P7KA 1S1CX 5AW3B 3P8CD 4TT3H 3O6QA 1NWQA 3RK3D 1IJDB 3AE3C 2QE7H 4R4LA 1FZGC 3G9RA 2KOGA 2GUVA 2XKMA 1PP9G 1DEEG 4H0LC 4WWIA 2WPRA 3G3ZA 2O01H 4M3LA 1SQQE 3AE6C 3ABVC 1NTME 3M91A 2N1TB 5CMZA 3C1LA 2XDJA 1UIIA 3L74G 1RF1B 4ZFGA 1KQLA 3P8MC 2ZXEB 2ZAEB 1ZRTE 1KTMA 1JY2P 2YKOA 2J0YA 4OGQD 4IL6H 5TISH 1KILB 1G2CB 4XE5B 3G4SP 5CJ4A 1SQVG 2Y0EA 3OA7A 3P32A 3M0DC 1URQA 1RE4A 2K9JA 3CMAP 2Q5UA 3H1HJ 2OYHA 3SSUA 1S72P 5KAIH 4K3AA 3FIBA 2J60A 2BEQD 1OVRA 3H1IG 4LLHA 4Z1MH 5AVTB 1OVUA 2JJLA 1SQBD 2QA4P 1FZFA 1ZV8A 1FZFC 3SFEC 4PV1B 1GW4A 1U7MA 3FXDA 1X22A 3M9HA 3KDPB 3TGUG 5AW5B 1JEKA 5E79E 3C8VA 3L4FA 5GTIH 2OYHC 1DD4A 1OMIA 4AUWA 3MUDA 1FE6A 2M5AB 4XA4A 3B5NC 1RE4C 3PH0A 1FS0E 1AV1A 1SQXK 1S9KE 2UWJE 1ZP0C 3L70G 1MZ9A 4U3FD 3CC4P 1LTIC 1FDMA 1DD3A 3TSIA 4ZMDA 1GDTA 1RE4B 4O9BA 2M8RA 4JBZA 3KPEA 2FYUK 2KI7B 4N78E 3CXHE 1H88A 4L75A 3VMYA 2OYOA 2HR3A 3A0HE 1LP1B 1JY3N 4KJMA 2W6BA 1SQBE 1YJ9P 5APSA 2HPCB 2O3JA 4PV1D 1FZBA 1K05A 5CCGC 1GZLA 3RBZA 4HJGH 3H1HG 1P84H 3W67A 1QVGO 2WVRA 2AXCA 1VPCA 3CMEP 2JKVA 2O1JA 1USEA 3L73D 2V7QJ 1VQNP 2HPCC 3OJAB 3HUSA 1CI6B 3HTKB 3H1JJ 3GHGA 1FZEC 1AQTA 2FXMA 3U1AA 4BXLA 1T6AA 3JCUE 1EXJA 1SQQG 3CCEP 2FYNC 1NYHA 2R44A 2WNPF 3GLMA 3TGUJ 5CCHD 2PFXA 4IOIH 1RQUA 1QEXA 3KZIH 1L2PA 2KS1B 2CPSA 1PGJA 2XNDH 2RN0A 2Q3EA 5CBNA 1NTZE 1WRGA 3TYYA 3N7NA 3L75G 3HE5A 1OW8A 3I55P 5KAFH 3SWFA 1SP4A 2QJPB 3PRJA 5M1BA 3EWKA 2E74B 1NHLA 1IFJA 1NTMK 1J2JB 4N3YB 5DJTB 2J0HA 1EZVG 2JR8A 1FZGB 3K5BA 2R5DA 2WMMA 3A5TA 2HODB 1J1EC 1X9VA 3AE1C 2OYIA 2YNYA 2L91A 3L37A 4U7JA 4L76A 1NU1J 4PJ0E 2GA1A 3TDKA 5KLIB 1SQVE 4LC1A 2OYIC 5KLVK 3L71J 2FYZA 2G3AA 3GF7A 3D6ZA 1VQKP 2IZ1A 2R5BA 1QX8A 1JMBA 1A02F 4OWFA 5B5EE 1LTJA 3I5CA 4KHXA 2JO1A 1YQ4C 2HG5D 4C46A 2A06E 3VOPA 5KAFE 1S2EA 2QIWA 3IF4A 2O1KA 4H0LB 2J0GA 3W68A 2W27A 2WSEH 3SFDC 2WZ7A 3CXHD 3BCCE 1LT1A 3L70D 4XFJA 4WY4A 3B4SA 4TLFA 3AE9C 3BCCG 1L0ND 2XV5A 2WT7B 2K1AA 3BCCJ 2O01J 1JCCA 1JC9A 2J3FD 4L74A 3CXHI 3CCSP 2ZYGA 3SWKA 1BE3E 2BCCJ 3JCUH 4YPCA 5AW4B 1HJ0A 2J58A 2A06G 1FZEA 1N2DC 2GUSA 5AVSB 2XU6A 1M90Q 2QJYC 3T97A 3V4WA 5KLVE 2KUBA 2OYHB 3II6A 1IK9A 2Z5IA 2YIUB 1VQ9P 3F89A 1IZNB 2N1TA 4C7NA 2QM8A 1X0TA 2C9NY 2PGDA 2Y0DA 3VP8A 1SQQK 4UB8E 1ZW0A 2JHHC 3PLNA 3B5ND 2QJYB 1OFCX 2E76D 2KNCB 3BRVB 1QLED 4WY4B 2JP3A 1IFIA 1NTKJ 1G2CA 1JB0J 2W6JH 3HE4B 3MUDC 1ZN5A 5CCGD 2O01N 1JOCA 2WSEJ 2RKLA 1RE3B 1XTGB 1GK6A 2MKVA 4EIJA 4RJTA 2IBZI 1LTTC 1QGKB 1MFTA 4GOFA 1BE3D 2E5TA 3LW5H 2QRXA 1KYOI 3WU2H 1GU5A 1EDJA 1Q2NA 1NTZD 2ZT9C 1BE3J 1L4AA 2BCCE 1OIPA 2B88A 3TNUA 2IBZD 1IO4A 2WPSA 5E79H 2Q3IA 5GTHE 2WPVB 1ZR2A 2JHMF 3BVHA 1JTHB 2BCCG 2WSCJ 4DJGA 1SS1A 2DW3A 5AVRB 1IC2A 4RO0A 3A3YB 1RY3A 3V2RA 1FZBB 4KT0J 2ZVOB 3EFGA 4M7FA 2E76B 1LJ2A 4BRYA 3GF3A 2J2PA 1FZAC 1YITP 1SQPE 1Y47A 4ASWA 4I2LC 2M0BA 3SWYA 2FKWB 2I1KA 3HUSB 3V5BA 1M1JC 1HH0A 1T2KC 1VQPP 5AVQB 2ZYDA 1Q81Q 3CC2P 1FAVA 2KZIA 2Q7CA 3VMAA 2E74C 2BEZF 1T2KD 1N7SA 5B5EH 3CC7P 1Q7YQ 1NTZK 1FZCC 3MD0A 1M1JB 1L0LG 1SQXD 1DX7A 1SLQA 3CPWO 2AEJA 1R5SA 1YIJP 4JYCA 5BU5A 2KLVA 3AE5C 2H8PD 1M7LA 5H2FH 2Q1KA 3UIAA 3L70E 1SQVD 1JNMA 2E74D 1VF5B 3AEEC 1SFCD 3GG2A 3P8CE 1W5CE 3IAOA 3L71D 2J1GA 2WTYA 1BCCE 2N1TC 2POHA 3D71A 2K9JB 3AE7C 3WUTA 5KLVG 2IPPA 3L71E 1URQB 2A06D 2E75B 1FJKA 1LWUB 1KB9I 3HRNA 4GODA 1VF5C 1L4AB 5APXA 1CSBA 2HODC 1NU1K 1QL2A 1NTKG 1HVVA 2KK7A 3CCMP 1HGZA 2H7HA 2AEFA 3Q5SA 1CZQA 5AW2B 3WU2E 3RL0D 5KLIC 1U57A 4H44D 2PP6A 2QVAA 5DJUB 4GDOA 1LTJC 4A7PA 1LWUC 3BVHB 1OW7A 2W90A 4OH8B 2YXRB 1JY2O 1JTHA 2PAJA 3V2QA 4OVNF 2Z5HA 1KFNA 3HD7A 3PHLA 2HFED 5CHXA 2ITAA 1H8AA 3Q3DA 2J64A 1YJNP 2NRGA 5TJHA 1YYCA 4UB6E 1D7MA 3V2NA 3U1CA 5GTIE 2IBZE 1FIBA 3NTNA 4UB8H 2JWDA 1FZFB 3LIEA 1JM0A 1VQ4P 1KYOE 1JMMA 3MHVA 2Y9ZA 5B66H 3H1KJ 1Q86Q 1K9MQ 3CX5H 1H0TA 1Q90D 1OWAA 1JY3O 4IL6X 1T8ZA 3B5NB 3H1IJ 4HKZH 1AA0A 3L72D 2KLUA 1HBWA 2N1TD 1SVFA 3RL0B 2M5AA 4H44B 3CWBE 1RH5B 4YTPC 1VDFA 3MGNA 1NTKD 1QL1A 5L8RJ 1RE3C 3RBXA 2FBWC 4DZOA 3TK1A 3VN0A 2MJZA 2XZRA 2IX7C 3Q5PA 1PPJG 2H89C 3RL0C 3CCUP 2D2CB 2HODA 5APTA 4BWNA 3LIDA 4WY4D 3RGUA 1NTZG 1P84E 3B71A 1R5LA 1HUCA 3S4RA 4ZKUA 1NTMD 2HPCA 2OARA 3FX0A 2FYUG 3U59A 3HD7D 2P7JA 2YO3A 1X79B 2ZFCA 1LWUA 2ZT9D 3CI9A 2J3GA 1HJBA 2Q9IC 1NTMJ 3A0HH 1KQFB 2B9BA 2WITA 2D2CC 1VQ5P 1KV4A 1FZBC 2M3EA 5KKZB 1HWTC 1ZRTD 4AYCA 2JHIF 2Z4EA 1JUNA 4NPDA 1BGYE 1FIDA 2KYVA 1BSHA 3VTPC 2FYNB 3H1LG 3L35A 1S4XA 3CD6P 3KHUA 5KLVD 3H1LJ 1PP9J 3C9IA 5CJ0A 2RMZA 1BGYG 2C0WA 1N7SD 1SQBJ 1Z3SA 2WSFH 1BSNA 4PD4E 3TNUB 4JQ0D 4I1LA 4DT0A 1SQBG 1GD2E 3M9QA 2WSFJ 3GMAA 2E42A 2VRSA 3H1JG 2FFDA 1FICA 2ZVNB 3M0AA 3G6EP 1NKNA 1PGPA 5AVZB 1LGHB 1M1JA 3NFQA 1RHZB 1JCDA 3TF5A 2E76C 1J1DC 1HF9A 1KYOH 2FYUE 1BDDA 4DOJA 1FZAB 3VMZA 2B87B 2NPSB 3CCQP 1FZAA 1PZQA 4ZNCA 4R9JA 4IFMA 1N7SC 4U3FJ 5KJ7D 1L0LK 1CW5A 3WUUA 2FYUD 4EDFA 3OW2O 3EQ2A 1KB9E 1OX3A 4AQRD 1VL2A 5KJ7C 3IFMA 2Y0CA 1RF0C 1SQVJ 2FYUJ 3AEGC 1LT9B 4PJ0H 2R32A 2OYIB 2KIKA 3A2AA 1SFCC 3TGUE 1KQSO 3AEDC 2AXTE 1L4AC 3AE8C 2LXCB 2GY7A 4WBAA 3QWOC 2RH0A 5BVZA 1JO5A 3H1IE 1VF5D 3M06A 1LTJB 1BGYD 1SFCB 1LTBC 3BVHC 1GW3A 1FBMA 5AW6B 3FGAD 3V2PA 1BGYJ 2CPBA 1N7LA 2YKQA 2ZJSE 1N86A 2KP8A 2FXOA 4D6TE 1URQC 5KTBA 2SPZA 3H32C 1L4AD 3BRTB 4ASVA 1EQ7A 3HE5B 4D6TD 3E7KA 1KN7A 2JHLF 3WUVA 3L70J 2QG4A 5AVVB 1T3UA 1NKZB 1S5LX 2J5ZA 4RESB 2HLOA 4RKUJ 1LNQA 1ZXGA 3A0BH 1FU1A 1EZVE 1VQ8P 2H88C 1BCCD 2QSIA 1GU4A 2YIUC 4OGQB 3L75D 1NTKE 2J3FA 1DEBA 1JY3P 1PP9E 3L72E 1SQPD 3L75J 5APYA 4I7ZB 1N8RQ 3MZWB 3L71G 1P84I 3IN6A 2YXQB 3E1IA 4WY4C 2H43A 1DIPA 1YBKA 4PD4D 2FIBA 1SQPK 3PTZA 1NU1D 1SQBK 1SQQJ 2QEXP 5CBOA 1X8YA 1N73A 2K88A 1XTCC 2IFNA 3G71P 2J3OA 1M1KQ 2D2CD 4PD4I 1S5LH 3H1KE 1M8OB 2A45G 4CPGA 2W8ZA 4DCKA 3KYQA 2Q9IA 4D6TG 1EXIA 1KB9H 1OVVA 4JYOX 4H44C 3S9OA 1A02J 1KORA 2ZT9B 3VYIA 3FWLA 1YQ3C 4U3FG 2K9YA 4GT1A 1ZMEC 2D39A 1YTZI 5AVWB 1VQMP 2L5GB 1EC5A 3OAKA 1DH3A 2WSSH 2KSJA 1GL2D 5AVYB 4L73A 2J61B 3RK2B 2M3BA 3D6YA 1ZLLA 2IZ0A 3CCVP 3HTKA 1KILA 1GK4A 3VP9A 1KB9D 1KILC 2E5YA 3CCRP 1VQ6P 3BCCD 2R3CA 5APUA 1KMIZ 5KAIE 2G8YA 1H0TB 3RK2C 3PP5A 2W83C 4C7RA 2Z4EB 1AQ5A 5KKZC 1J1DB 1EDLA 3CX5I 5BU8B 3HD7C 3TGUD 4BRYB 3D70A 4EYYQ 5TISE 3RK3E 5AW8B 1CI6A 1FZCB 5APWA 1P84D 1N7SB 2NPSD 4GKGA 3CX5D 3O6QB 4H13B 3R4YA 1NGMB 1L0LD 1SQXG 2A45I 3KXDA 1GL2B 4LGDE 3JC22 5APVA 3AEAC 3H1JE 1N73C 1GTWA 1SQXJ 1GL2A 1K8AQ 1MFZA 1IFDA 4NPFX 1EZVD 1RQVA 2XNXC 1L0LE 4Y99B 1JY2N 2Y9YA 1NVOA 3AE2C 3MP7B 3Q5RA 1YTZT 2IYOA 2IBZG 5H2FE 2JDIH 1EZVI 4GIFA 1SQXE 5GTHH 5CCHA 1H89A 2E75C 1FOSE 5AVUB 4Y99C 4Y28J 3FWNA 3RK3C 5EFWB 4YXWH 1LTGC 1L0NE 4JF7A 1UIXA 2OGUA 4W7YA 2QJKB 1SQPG 4JZCA 2OTLP 1NU1G 5CCGA 1MKMA 1W2EA 1NTKK 1LP1A 2YMYA 3L73J 3F5HA 4EOTA 4D6TJ 4W7ZA 2P2UA 1TU3F 3AEFC 3B5NA 3PJSK 1YI2P 1N86C 1PPJE 2HLOC 4UB6H 2KZJA 2OTKE 4B86A 4ZKPA 1FZCA 2PRRA 3CWBG 1KD1Q 1L0NJ 1WMKA 1BCCJ 2J3UA 3GHGB 2GM4A 2Q6QA 4N6JA 3H32B 1K04A 3IR9A 4HB1A 4H0LD 1EDKA 1L0NK 2KNCA 1M56D 3H32A 1KC8Q 4C7NB 1QVFO 1SQPJ 2I8DA 3CCJP 4NPEA 3M9BA 3O8ZA 4N78D 3NXSA 1NJIQ 4IFDK 1AFOA 1USDA 1KQGB 1G1JA 1URQD 1E5WA 4HH2A 2QJPC 2E75D 1YJWP 2YO2A 2OQQA 3H1KG 3M0DA 5APQA 1RF1A 2FXPA 5KJ7A 1NO4A 1SQQD 3I56P 1RF1C 2NZ2A 4R4MA 1U7JA 4IL6E 3VMXA 1FC2C 2AXTH 1SFCA 3CCLP 3H6PA 1FZDA 1NH4A 3V6IA 1IFNA 1ZOYC 2B89A 1YHQP 1RF0A 2K37A 3Q1MA 2A45H 2Q9IB 3S1KA 2JEEA 3CL3D 1EDIA 3L75E 3N4XA 3A7OA 3USSA 1PGOA 1HGVA 2FFDB 3CXHH 3HE4A 1NU1E 1FZGA 3WMM0 3MTUE 4I6MC 3QH9A 1S3JA 2N9YB 3CX5E 3MIWA 2V7QH 1S9KD 2BASA 2WT7A 2KXPB 1K73Q 1L0NG 1BCCG 2W6AA 4R9TA 1Y8AA 1KILD 3L36A 2Z4EC 5AW0B 2P67A 2FFDC 1T3JA 2P1JA 2WQYC 2CK3H 2QM7A 1PV3A 3H1HD 3RK2D 2BCCD 1PP9D 1VQLP 4MN4C 3H1KD 1VQ7P 1M57D 5C39A 2AEMA 1OW6A 2XNXA 1IFMA 4H13C 3L73G 3V4QA 2IDBA 2YKPA 1NAYA 4IFFA 1OXZA 2LKMA 1GL2C 2LXBA 4H13D 1Z56A 3H25A 5CCHC 1FDIA 2NPSC 3A0BE 4QMAA 1L0LJ 1PPJD 4PV1C 1WT6A 1GMJA 3L73E 4EPUA 2WSCH 4JPZB 2OTJP 5K5GB 3HD7B 2LR2A 3CWBJ 1RE3A 1RF0B 1KYOD 1PGQA 1AVYA 3GW6A 1S5LE 2R3SA 2HYNA 1LT9C 5AW1B 4K35A 2I1JA 3AECC 3CWBD 3Q2YA 1Z3UA 1BE3G 3RL0g 4EI2A 2N9BA 1FDOA 2WWWA 2YMKA 4W80A 1N73B 3AE4C 1MUUA 4HYTB 1LTAC 3R2PA 1KFMA 2JHKF 1IFPA 1ZR4A 2QJKC 1VQOP 1NTZJ 5AW7B 2JWAA 2XNXB 1FZEB 3EFFK 1NOHA 1R8EA 2ZYAA 4WB4A 1LTSC 3T97B 1AJYA 4JYBA 2J59M 1PL5A 5AW9B 1HTLC 2IYPA 4WVZA 3CLQA 5AVXB 1N86B 1FOSF 2E43A 2FY8A 3E1RA 3ITKA 1LT9A 3BATA 5KLVJ 1G1IA 2KB7P 3H1LD 1MV8A 5B66E 3B8EB 3BASA 2ZXXA 2C9LY 3RK3B 4M7HA 3H1JD 2V4HA 1Y9BA 3H1LE 1OZHA 3H1HE 4YXDC 3E1IB 2H43B 2KS1A 1FJPA 4OGQC 1Q82Q 2IFMA 2K3RA 4U3FE 1AVOA 3HUSC 3L74D
chains in the Genus database with same CATH topology
3U59A 1SQVK 3HD7D 2P7JA 2YO3A 2XNXC 1X79B 2ZFCA 1LWUA 1JY2N 3CI9A 4WY4A 4Y99B 2J3GA 2J61A 3E1IC 2H43C 1J1EB 1HJBA 2Q9IC 2HLOB 3KQGA 2XV5A 2WITA 2WT7B 1YTZT 2C0XA 1JC9A 1JCCA 2J3FD 1FZBC 2WPQA 3NMDA 4GIFA 2NPSA 1HWTC 5CCHA 1KZUB 5AW4B 1H89A 1FOSE 5AVUB 4AYCA 2J58A 2JHIF 1FZEA 3GHGC 2Z4EA 4NYTA 1N2DC 1JUNA 2GUSA 5AVSB 1NAFA 2XU6A 4Y99C 1PFIA 1FIDA 2KYVA 3T97A 3RK3C 3V4WA 3VTPC 3P7KA 2OYHB 3II6A 1IK9A 1LTGC 2Z5IA 3L35A 4JF7A 5AW3B 3P8CD 2N1TA 4C7NA 3RK3D 1NWQA 1IJDB 2QM8A 3C9IA 4W7YA 5CJ0A 2C0WA 4JZCA 2C9NY 1FZGC 1N7SD 1Z3SA 2KOGA 2GUVA 2WSFH 2XKMA 3VP8A 5CCGA 1W2EA 1NTKK 3TNUB 4I1LA 1SQQK 2YMYA 2JHHC 2WPRA 1GD2E 3G3ZA 2O01H 3M9QA 3B5ND 4M3LA 4EOTA 2E42A 2VRSA 2FFDA 3M91A 1FICA 2N1TB 3M0AA 1NKNA 3BRVB 4W7ZA 5CMZA 4WY4B 5AVZB 2P2UA 1IFIA 1LGHB 1M1JA 2XDJA 3NFQA 1JCDA 1G2CA 1RF1B 4ZFGA 1KQLA 1J1DC 3B5NA 1N86C 3P8MC 3HE4B 2ZXEB 2HLOC 4B86A 1ZN5A 5CCGD 4DOJA 1FZAB 3VMZA 1JY2P 4ZKPA 1JOCA 1FZCA 1RE3B 2NPSB 2YKOA 1XTGB 1FZAA 1GK6A 2J0YA 4R9JA 4IFMA 4EIJA 1N7SC 1KILB 5KJ7D 1L0LK 1LTTC 1G2CB 2J3UA 4XE5B 3GHGB 2GM4A 1CW5A 4N6JA 3H32B 3EQ2A 3IR9A 3LW5H 5CJ4A 4AQRD 1L0NK 5KJ7C 1GU5A 3OA7A 3IFMA 3H32A 3P32A 3M0DC 1URQA 4C7NB 1RF0C 1RE4A 1L4AA 1LT9B 2Q5UA 3TNUA 2R32A 1IO4A 2OYHA 2OYIB 3M9BA 2WPSA 3A2AA 3O8ZA 4N78D 3NXSA 4IFDK 1AFOA 2Q3IA 1SFCC 3FIBA 1URQD 1G1JA 2J60A 1ZR2A 1E5WA 2JHMF 4HH2A 3BVHA 1L4AC 2YO2A 1JTHB 4LLHA 2GY7A 4WBAA 3M0DA 5APQA 5AVTB 1RF1A 2JJLA 5AVRB 5KJ7A 1FZFA 1IC2A 1ZV8A 1NO4A 1RY3A 3A3YB 5BVZA 1FZFC 3V2RA 1FZBB 3EFGA 1JO5A 4M7FA 1GW4A 1RF1C 3M06A 1LTJB 3M9HA 3KDPB 1SFCB 3VMXA 1LTBC 3BVHC 1GW3A 2J2PA 5AW5B 1FBMA 5AW6B 1FZAC 1SFCA 4I2LC 3V2PA 3L4FA 3H6PA 1FZDA 2CPBA 3SWYA 1N7LA 2YKQA 1NH4A 2OYHC 2FKWB 1IFNA 4AUWA 3MUDA 2I1KA 1N86A 3HUSB 4XA4A 3B5NC 1RE4C 2KP8A 1RF0A 3V5BA 1URQC 5KTBA 1M1JC 1HH0A 3H32C 2A45H 1T2KC 1L4AD 1SQXK 3BRTB 5AVQB 1EQ7A 1S9KE 2Q9IB 3HE5B 1FAVA 2JEEA 2Q7CA 1MZ9A 3CL3D 1T2KD 2JHLF 3N4XA 1N7SA 3A7OA 1LTIC 1FDMA 3TSIA 1HGVA 2FFDB 1GDTA 5AVVB 3HE4A 1NTZK 1FZCC 1FZGA 1T3UA 1RE4B 3WMM0 3MTUE 4O9BA 4I6MC 1NKZB 3MD0A 2M8RA 1M1JB 2J5ZA 4RESB 2HLOA 3KPEA 1SLQA 2FYUK 3MIWA 1DX7A 4N78E 1FU1A 1S9KD 1H88A 2BASA 2WT7A 4JYCA 5BU5A 2KLVA 3VMYA 1GU4A 2W6AA 2H8PD 4R9TA 1M7LA 1KILD 3L36A 3UIAA 1JY3N 2Z4EC 5AW0B 2P67A 2FFDC 1T3JA 2W6BA 2J3FA 2P1JA 5APSA 2HPCB 1DEBA 1JY3P 1JNMA 1FZBA 5APYA 2QM7A 5CCGC 1GZLA 3RK2D 1SFCD 3P8CE 2J1GA 2WTYA 1VPCA 2N1TC 2POHA 3E1IA 4WY4C 2H43A 2IPPA 2O1JA 2XNXA 1URQB 1IFMA 2FIBA 2HPCC 3V4QA 3OJAB 3HUSA 2YKPA 1CI6B 1FJKA 1SQPK 3HTKB 1LWUB 1OXZA 4IFFA 1SQBK 2LKMA 3HRNA 1GL2C 3GHGA 1FZEC 1Z56A 1L4AB 5APXA 1CSBA 2FXMA 1X8YA 1N73A 1NU1K 3U1AA 1QL2A 5CCHC 2HODC 1HVVA 2NPSC 1HGZA 2H7HA 1XTCC 2IFNA 1CZQA 5AW2B 2J3OA 2WNPF 5CCHD 3RL0D 2A45G 1WT6A 2PP6A 3KYQA 4EPUA 1LTJC 2WSCH 2Q9IA 1LWUC 3BVHB 2CPSA 4JYOX 3HD7B 4OH8B 1A02J 1JY2O 1JTHA 1RE3A 1RF0B 3VYIA 2PAJA 4GT1A 2HYNA 3V2QA 1LT9C 5AW1B 1WRGA 2Z5HA 3TYYA 2D39A 1KFNA 3HD7A 1YTZI 2HFED 5CHXA 3N7NA 2I1JA 1H8AA 5AVWB 3HE5A 2J64A 2L5GB 3OAKA 1DH3A 3SWFA 2KSJA 1YYCA 1GL2D 5AVYB 1SP4A 1Z3UA 3V2NA 2J61B 3U1CA 1NHLA 1IFJA 1FIBA 1NTMK 1J2JB 4N3YB 2N9BA 3RK2B 2WWWA 3NTNA 4W80A 1N73B 2M3BA 1MUUA 4HYTB 2J0HA 1LTAC 1FZFB 3R2PA 3LIEA 1KFMA 2JHKF 1ZR4A 1JMMA 1ZLLA 3HTKA 1KILA 1FZGB 1GK4A 3VP9A 1KILC 5AW7B 2R5DA 2R3CA 2XNXB 1FZEB 5APUA 3A5TA 1NOHA 2HODB 1J1EC 1X9VA 1OWAA 1JY3O 4WB4A 2OYIA 1LTSC 2YNYA 1T8ZA 3L37A 4JYBA 3RK2C 2J59M 3PP5A 3B5NB 5AW9B 1HTLC 4C7RA 2Z4EB 4LC1A 2OYIC 1AQ5A 1HBWA 3CLQA 5KLVK 2N1TD 1SVFA 1J1DB 5AVXB 3RL0B 1N86B 2FYZA 1FOSF 5BU8B 3HD7C 2E43A 1LT9A 2R5BA 3BATA 1G1IA 2KB7P 3MGNA 1MV8A 1VDFA 3B8EB 3BASA 1QL1A 2C9LY 1RE3C 3RK3B 5AW8B 4M7HA 1A02F 4DZOA 3TK1A 3VN0A 1CI6A 1FZCB 5APWA 1LTJA 2MJZA 3I5CA 2XZRA 1N7SB 2IX7C 2NPSD 4KHXA 4GKGA 2HG5D 4C46A 3E1IB 2H43B 3RL0C 1FJPA 3VOPA 2A45I 1GL2B 4LGDE 2O1KA 5APVA 2J0GA 2HODA 5APTA 1N73C 1GTWA 3LIDA 2W27A 4WY4D 2IFMA 2WSEH 1GL2A 1HUCA 1MFZA 4ZKUA 1IFDA 3HUSC 2WZ7A 2HPCA 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3U A;  3GHG B;  1M1J B;  2J5Z A;  2XNX C;  3H32 B;  1LWU A;  1JY2 N;  2HLO A;  1Z3U A;  2J3G A;  3E1I C;  2J61 A;  2H43 C;  2Q9I C;  2J61 B;  2HLO B;  3H32 A;  1FIB A;  1RF0 C;  4R9T A;  1RE4 A;  1N73 B;  2J0H A;  1FZF B;  1LT9 B;  1JC9 A;  1JY3 N;  2J3F D;  2JHK F;  1FZB C;  2OYH A;  2FFD C;  2OYI B;  2Z4E C;  2J3F A;  2HPC B;  1FZG B;  1JY3 P;  2JHI F;  2J60 A;  3FIB A;  1FZE A;  3GHG C;  1FZB A;  2Z4E A;  4NYT A;  2JHM F;  2XNX B;  1FZE B;  3BVH A;  1FID A;  2HOD B;  2GY7 A;  1RF1 A;  1JY3 O;  2J1G A;  2OYI A;  2OYH B;  1FZF A;  3E1I A;  2H43 A;  1FZF C;  2XNX A;  1FZB B;  2Z4E B;  2OYI C;  4M7F A;  1RF1 C;  2FIB A;  2HPC C;  4JZC A;  3HUS A;  1FZG C;  1LTJ B;  1N86 B;  1Z3S A;  1LWU B;  3BVH C;  2J2P A;  1FZA C;  1W2E A;  3GHG A;  1FZE C;  1LT9 A;  2JHH C;  1N73 A;  2HOD C;  1RE3 C;  1FZD A;  4M7H A;  2FFD A;  2OYH C;  1FIC A;  2J3O A;  2WNP F;  1FZC B;  1LTJ A;  1N86 A;  3HUS B;  1RE4 C;  1RF0 A;  1M1J A;  2A45 G;  1M1J C;  3H32 C;  2A45 H;  1RF1 B;  4ZFG A;  3E1I B;  4EPU A;  2H43 B;  1LTJ C;  2Q9I A;  1N86 C;  2Q9I B;  2HLO C;  1LWU C;  3BVH B;  4JYO X;  2A45 I;  1FZA B;  1JY2 O;  1RE3 A;  1JY2 P;  1RF0 B;  2JHL F;  2J0G A;  2HOD A;  1N73 C;  1FZC A;  1RE3 B;  1LT9 C;  1FZA A;  2D39 A;  2FFD B;  2J0Y A;  4R9J A;  1FZC C;  1FZG A;  3HUS C;  2J64 A;  1T3U A;  2HPC A;  1RE4 B; 
#chains in the Genus database with same CATH topology
 1SQV K;  4I7Z C;  1E79 H;  3E1I C;  2H43 C;  3L74 E;  2J61 A;  1J1E B;  2HLO B;  3FXE A;  3KQG A;  3L74 J;  2P10 A;  3LW5 J;  3ZDM A;  2KSE A;  1BDC A;  1NTM G;  2P58 A;  2C0X A;  4PD4 H;  2J5U A;  1PIX A;  2WPQ A;  3NMD A;  3KZI E;  2B87 A;  1IK7 A;  2NPS A;  1KZU B;  4GOE A;  1W2B O;  3L72 G;  3GHG C;  3JSV C;  4NYT A;  1NAF A;  3H1I D;  1PFI A;  3AEB C;  3L72 J;  1KIL E;  3P7K A;  1S1C X;  5AW3 B;  3P8C D;  4TT3 H;  3O6Q A;  1NWQ A;  3RK3 D;  1IJD B;  3AE3 C;  2QE7 H;  4R4L A;  1FZG C;  3G9R A;  2KOG A;  2GUV A;  2XKM A;  1PP9 G;  1DEE G;  4H0L C;  4WWI A;  2WPR A;  3G3Z A;  2O01 H;  4M3L A;  1SQQ E;  3AE6 C;  3ABV C;  1NTM E;  3M91 A;  2N1T B;  5CMZ A;  3C1L A;  2XDJ A;  1UII A;  3L74 G;  1RF1 B;  4ZFG A;  1KQL A;  3P8M C;  2ZXE B;  2ZAE B;  1ZRT E;  1KTM A;  1JY2 P;  2YKO A;  2J0Y A;  4OGQ D;  4IL6 H;  5TIS H;  1KIL B;  1G2C B;  4XE5 B;  3G4S P;  5CJ4 A;  1SQV G;  2Y0E A;  3OA7 A;  3P32 A;  3M0D C;  1URQ A;  1RE4 A;  2K9J A;  3CMA P;  2Q5U A;  3H1H J;  2OYH A;  3SSU A;  1S72 P;  5KAI H;  4K3A A;  3FIB A;  2J60 A;  2BEQ D;  1OVR A;  3H1I G;  4LLH A;  4Z1M H;  5AVT B;  1OVU A;  2JJL A;  1SQB D;  2QA4 P;  1FZF A;  1ZV8 A;  1FZF C;  3SFE C;  4PV1 B;  1GW4 A;  1U7M A;  3FXD A;  1X22 A;  3M9H A;  3KDP B;  3TGU G;  5AW5 B;  1JEK A;  5E79 E;  3C8V A;  3L4F A;  5GTI H;  2OYH C;  1DD4 A;  1OMI A;  4AUW A;  3MUD A;  1FE6 A;  2M5A B;  4XA4 A;  3B5N C;  1RE4 C;  3PH0 A;  1FS0 E;  1AV1 A;  1SQX K;  1S9K E;  2UWJ E;  1ZP0 C;  3L70 G;  1MZ9 A;  4U3F D;  3CC4 P;  1LTI C;  1FDM A;  1DD3 A;  3TSI A;  4ZMD A;  1GDT A;  1RE4 B;  4O9B A;  2M8R A;  4JBZ A;  3KPE A;  2FYU K;  2KI7 B;  4N78 E;  3CXH E;  1H88 A;  4L75 A;  3VMY A;  2OYO A;  2HR3 A;  3A0H E;  1LP1 B;  1JY3 N;  4KJM A;  2W6B A;  1SQB E;  1YJ9 P;  5APS A;  2HPC B;  2O3J A;  4PV1 D;  1FZB A;  1K05 A;  5CCG C;  1GZL A;  3RBZ A;  4HJG H;  3H1H G;  1P84 H;  3W67 A;  1QVG O;  2WVR A;  2AXC A;  1VPC A;  3CME P;  2JKV A;  2O1J A;  1USE A;  3L73 D;  2V7Q J;  1VQN P;  2HPC C;  3OJA B;  3HUS A;  1CI6 B;  3HTK B;  3H1J J;  3GHG A;  1FZE C;  1AQT A;  2FXM A;  3U1A A;  4BXL A;  1T6A A;  3JCU E;  1EXJ A;  1SQQ G;  3CCE P;  2FYN C;  1NYH A;  2R44 A;  2WNP F;  3GLM A;  3TGU J;  5CCH D;  2PFX A;  4IOI H;  1RQU A;  1QEX A;  3KZI H;  1L2P A;  2KS1 B;  2CPS A;  1PGJ A;  2XND H;  2RN0 A;  2Q3E A;  5CBN A;  1NTZ E;  1WRG A;  3TYY A;  3N7N A;  3L75 G;  3HE5 A;  1OW8 A;  3I55 P;  5KAF H;  3SWF A;  1SP4 A;  2QJP B;  3PRJ A;  5M1B A;  3EWK A;  2E74 B;  1NHL A;  1IFJ A;  1NTM K;  1J2J B;  4N3Y B;  5DJT B;  2J0H A;  1EZV G;  2JR8 A;  1FZG B;  3K5B A;  2R5D A;  2WMM A;  3A5T A;  2HOD B;  1J1E C;  1X9V A;  3AE1 C;  2OYI A;  2YNY A;  2L91 A;  3L37 A;  4U7J A;  4L76 A;  1NU1 J;  4PJ0 E;  2GA1 A;  3TDK A;  5KLI B;  1SQV E;  4LC1 A;  2OYI C;  5KLV K;  3L71 J;  2FYZ A;  2G3A A;  3GF7 A;  3D6Z A;  1VQK P;  2IZ1 A;  2R5B A;  1QX8 A;  1JMB A;  1A02 F;  4OWF A;  5B5E E;  1LTJ A;  3I5C A;  4KHX A;  2JO1 A;  1YQ4 C;  2HG5 D;  4C46 A;  2A06 E;  3VOP A;  5KAF E;  1S2E A;  2QIW A;  3IF4 A;  2O1K A;  4H0L B;  2J0G A;  3W68 A;  2W27 A;  2WSE H;  3SFD C;  2WZ7 A;  3CXH D;  3BCC E;  1LT1 A;  3L70 D;  4XFJ A;  4WY4 A;  3B4S A;  4TLF A;  3AE9 C;  3BCC G;  1L0N D;  2XV5 A;  2WT7 B;  2K1A A;  3BCC J;  2O01 J;  1JCC A;  1JC9 A;  2J3F D;  4L74 A;  3CXH I;  3CCS P;  2ZYG A;  3SWK A;  1BE3 E;  2BCC J;  3JCU H;  4YPC A;  5AW4 B;  1HJ0 A;  2J58 A;  2A06 G;  1FZE A;  1N2D C;  2GUS A;  5AVS B;  2XU6 A;  1M90 Q;  2QJY C;  3T97 A;  3V4W A;  5KLV E;  2KUB A;  2OYH B;  3II6 A;  1IK9 A;  2Z5I A;  2YIU B;  1VQ9 P;  3F89 A;  1IZN B;  2N1T A;  4C7N A;  2QM8 A;  1X0T A;  2C9N Y;  2PGD A;  2Y0D A;  3VP8 A;  1SQQ K;  4UB8 E;  1ZW0 A;  2JHH C;  3PLN A;  3B5N D;  2QJY B;  1OFC X;  2E76 D;  2KNC B;  3BRV B;  1QLE D;  4WY4 B;  2JP3 A;  1IFI A;  1NTK J;  1G2C A;  1JB0 J;  2W6J H;  3HE4 B;  3MUD C;  1ZN5 A;  5CCG D;  2O01 N;  1JOC A;  2WSE J;  2RKL A;  1RE3 B;  1XTG B;  1GK6 A;  2MKV A;  4EIJ A;  4RJT A;  2IBZ I;  1LTT C;  1QGK B;  1MFT A;  4GOF A;  1BE3 D;  2E5T A;  3LW5 H;  2QRX A;  1KYO I;  3WU2 H;  1GU5 A;  1EDJ A;  1Q2N A;  1NTZ D;  2ZT9 C;  1BE3 J;  1L4A A;  2BCC E;  1OIP A;  2B88 A;  3TNU A;  2IBZ D;  1IO4 A;  2WPS A;  5E79 H;  2Q3I A;  5GTH E;  2WPV B;  1ZR2 A;  2JHM F;  3BVH A;  1JTH B;  2BCC G;  2WSC J;  4DJG A;  1SS1 A;  2DW3 A;  5AVR B;  1IC2 A;  4RO0 A;  3A3Y B;  1RY3 A;  3V2R A;  1FZB B;  4KT0 J;  2ZVO B;  3EFG A;  4M7F A;  2E76 B;  1LJ2 A;  4BRY A;  3GF3 A;  2J2P A;  1FZA C;  1YIT P;  1SQP E;  1Y47 A;  4ASW A;  4I2L C;  2M0B A;  3SWY A;  2FKW B;  2I1K A;  3HUS B;  3V5B A;  1M1J C;  1HH0 A;  1T2K C;  1VQP P;  5AVQ B;  2ZYD A;  1Q81 Q;  3CC2 P;  1FAV A;  2KZI A;  2Q7C A;  3VMA A;  2E74 C;  2BEZ F;  1T2K D;  1N7S A;  5B5E H;  3CC7 P;  1Q7Y Q;  1NTZ K;  1FZC C;  3MD0 A;  1M1J B;  1L0L G;  1SQX D;  1DX7 A;  1SLQ A;  3CPW O;  2AEJ A;  1R5S A;  1YIJ P;  4JYC A;  5BU5 A;  2KLV A;  3AE5 C;  2H8P D;  1M7L A;  5H2F H;  2Q1K A;  3UIA A;  3L70 E;  1SQV D;  1JNM A;  2E74 D;  1VF5 B;  3AEE C;  1SFC D;  3GG2 A;  3P8C E;  1W5C E;  3IAO A;  3L71 D;  2J1G A;  2WTY A;  1BCC E;  2N1T C;  2POH A;  3D71 A;  2K9J B;  3AE7 C;  3WUT A;  5KLV G;  2IPP A;  3L71 E;  1URQ B;  2A06 D;  2E75 B;  1FJK A;  1LWU B;  1KB9 I;  3HRN A;  4GOD A;  1VF5 C;  1L4A B;  5APX A;  1CSB A;  2HOD C;  1NU1 K;  1QL2 A;  1NTK G;  1HVV A;  2KK7 A;  3CCM P;  1HGZ A;  2H7H A;  2AEF A;  3Q5S A;  1CZQ A;  5AW2 B;  3WU2 E;  3RL0 D;  5KLI C;  1U57 A;  4H44 D;  2PP6 A;  2QVA A;  5DJU B;  4GDO A;  1LTJ C;  4A7P A;  1LWU C;  3BVH B;  1OW7 A;  2W90 A;  4OH8 B;  2YXR B;  1JY2 O;  1JTH A;  2PAJ A;  3V2Q A;  4OVN F;  2Z5H A;  1KFN A;  3HD7 A;  3PHL A;  2HFE D;  5CHX A;  2ITA A;  1H8A A;  3Q3D A;  2J64 A;  1YJN P;  2NRG A;  5TJH A;  1YYC A;  4UB6 E;  1D7M A;  3V2N A;  3U1C A;  5GTI E;  2IBZ E;  1FIB A;  3NTN A;  4UB8 H;  2JWD A;  1FZF B;  3LIE A;  1JM0 A;  1VQ4 P;  1KYO E;  1JMM A;  3MHV A;  2Y9Z A;  5B66 H;  3H1K J;  1Q86 Q;  1K9M Q;  3CX5 H;  1H0T A;  1Q90 D;  1OWA A;  1JY3 O;  4IL6 X;  1T8Z A;  3B5N B;  3H1I J;  4HKZ H;  1AA0 A;  3L72 D;  2KLU A;  1HBW A;  2N1T D;  1SVF A;  3RL0 B;  2M5A A;  4H44 B;  3CWB E;  1RH5 B;  4YTP C;  1VDF A;  3MGN A;  1NTK D;  1QL1 A;  5L8R J;  1RE3 C;  3RBX A;  2FBW C;  4DZO A;  3TK1 A;  3VN0 A;  2MJZ A;  2XZR A;  2IX7 C;  3Q5P A;  1PPJ G;  2H89 C;  3RL0 C;  3CCU P;  2D2C B;  2HOD A;  5APT A;  4BWN A;  3LID A;  4WY4 D;  3RGU A;  1NTZ G;  1P84 E;  3B71 A;  1R5L A;  1HUC A;  3S4R A;  4ZKU A;  1NTM D;  2HPC A;  2OAR A;  3FX0 A;  2FYU G;  3U59 A;  3HD7 D;  2P7J A;  2YO3 A;  1X79 B;  2ZFC A;  1LWU A;  2ZT9 D;  3CI9 A;  2J3G A;  1HJB A;  2Q9I C;  1NTM J;  3A0H H;  1KQF B;  2B9B A;  2WIT A;  2D2C C;  1VQ5 P;  1KV4 A;  1FZB C;  2M3E A;  5KKZ B;  1HWT C;  1ZRT D;  4AYC A;  2JHI F;  2Z4E A;  1JUN A;  4NPD A;  1BGY E;  1FID A;  2KYV A;  1BSH A;  3VTP C;  2FYN B;  3H1L G;  3L35 A;  1S4X A;  3CD6 P;  3KHU A;  5KLV D;  3H1L J;  1PP9 J;  3C9I A;  5CJ0 A;  2RMZ A;  1BGY G;  2C0W A;  1N7S D;  1SQB J;  1Z3S A;  2WSF H;  1BSN A;  4PD4 E;  3TNU B;  4JQ0 D;  4I1L A;  4DT0 A;  1SQB G;  1GD2 E;  3M9Q A;  2WSF J;  3GMA A;  2E42 A;  2VRS A;  3H1J G;  2FFD A;  1FIC A;  2ZVN B;  3M0A A;  3G6E P;  1NKN A;  1PGP A;  5AVZ B;  1LGH B;  1M1J A;  3NFQ A;  1RHZ B;  1JCD A;  3TF5 A;  2E76 C;  1J1D C;  1HF9 A;  1KYO H;  2FYU E;  1BDD A;  4DOJ A;  1FZA B;  3VMZ A;  2B87 B;  2NPS B;  3CCQ P;  1FZA A;  1PZQ A;  4ZNC A;  4R9J A;  4IFM A;  1N7S C;  4U3F J;  5KJ7 D;  1L0L K;  1CW5 A;  3WUU A;  2FYU D;  4EDF A;  3OW2 O;  3EQ2 A;  1KB9 E;  1OX3 A;  4AQR D;  1VL2 A;  5KJ7 C;  3IFM A;  2Y0C A;  1RF0 C;  1SQV J;  2FYU J;  3AEG C;  1LT9 B;  4PJ0 H;  2R32 A;  2OYI B;  2KIK A;  3A2A A;  1SFC C;  3TGU E;  1KQS O;  3AED C;  2AXT E;  1L4A C;  3AE8 C;  2LXC B;  2GY7 A;  4WBA A;  3QWO C;  2RH0 A;  5BVZ A;  1JO5 A;  3H1I E;  1VF5 D;  3M06 A;  1LTJ B;  1BGY D;  1SFC B;  1LTB C;  3BVH C;  1GW3 A;  1FBM A;  5AW6 B;  3FGA D;  3V2P A;  1BGY J;  2CPB A;  1N7L A;  2YKQ A;  2ZJS E;  1N86 A;  2KP8 A;  2FXO A;  4D6T E;  1URQ C;  5KTB A;  2SPZ A;  3H32 C;  1L4A D;  3BRT B;  4ASV A;  1EQ7 A;  3HE5 B;  4D6T D;  3E7K A;  1KN7 A;  2JHL F;  3WUV A;  3L70 J;  2QG4 A;  5AVV B;  1T3U A;  1NKZ B;  1S5L X;  2J5Z A;  4RES B;  2HLO A;  4RKU J;  1LNQ A;  1ZXG A;  3A0B H;  1FU1 A;  1EZV E;  1VQ8 P;  2H88 C;  1BCC D;  2QSI A;  1GU4 A;  2YIU C;  4OGQ B;  3L75 D;  1NTK E;  2J3F A;  1DEB A;  1JY3 P;  1PP9 E;  3L72 E;  1SQP D;  3L75 J;  5APY A;  4I7Z B;  1N8R Q;  3MZW B;  3L71 G;  1P84 I;  3IN6 A;  2YXQ B;  3E1I A;  4WY4 C;  2H43 A;  1DIP A;  1YBK A;  4PD4 D;  2FIB A;  1SQP K;  3PTZ A;  1NU1 D;  1SQB K;  1SQQ J;  2QEX P;  5CBO A;  1X8Y A;  1N73 A;  2K88 A;  1XTC C;  2IFN A;  3G71 P;  2J3O A;  1M1K Q;  2D2C D;  4PD4 I;  1S5L H;  3H1K E;  1M8O B;  2A45 G;  4CPG A;  2W8Z A;  4DCK A;  3KYQ A;  2Q9I A;  4D6T G;  1EXI A;  1KB9 H;  1OVV A;  4JYO X;  4H44 C;  3S9O A;  1A02 J;  1KOR A;  2ZT9 B;  3VYI A;  3FWL A;  1YQ3 C;  4U3F G;  2K9Y A;  4GT1 A;  1ZME C;  2D39 A;  1YTZ I;  5AVW B;  1VQM P;  2L5G B;  1EC5 A;  3OAK A;  1DH3 A;  2WSS H;  2KSJ A;  1GL2 D;  5AVY B;  4L73 A;  2J61 B;  3RK2 B;  2M3B A;  3D6Y A;  1ZLL A;  2IZ0 A;  3CCV P;  3HTK A;  1KIL A;  1GK4 A;  3VP9 A;  1KB9 D;  1KIL C;  2E5Y A;  3CCR P;  1VQ6 P;  3BCC D;  2R3C A;  5APU A;  1KMI Z;  5KAI E;  2G8Y A;  1H0T B;  3RK2 C;  3PP5 A;  2W83 C;  4C7R A;  2Z4E B;  1AQ5 A;  5KKZ C;  1J1D B;  1EDL A;  3CX5 I;  5BU8 B;  3HD7 C;  3TGU D;  4BRY B;  3D70 A;  4EYY Q;  5TIS E;  3RK3 E;  5AW8 B;  1CI6 A;  1FZC B;  5APW A;  1P84 D;  1N7S B;  2NPS D;  4GKG A;  3CX5 D;  3O6Q B;  4H13 B;  3R4Y A;  1NGM B;  1L0L D;  1SQX G;  2A45 I;  3KXD A;  1GL2 B;  4LGD E;  3JC2 2;  5APV A;  3AEA C;  3H1J E;  1N73 C;  1GTW A;  1SQX J;  1GL2 A;  1K8A Q;  1MFZ A;  1IFD A;  4NPF X;  1EZV D;  1RQV A;  2XNX C;  1L0L E;  4Y99 B;  1JY2 N;  2Y9Y A;  1NVO A;  3AE2 C;  3MP7 B;  3Q5R A;  1YTZ T;  2IYO A;  2IBZ G;  5H2F E;  2JDI H;  1EZV I;  4GIF A;  1SQX E;  5GTH H;  5CCH A;  1H89 A;  2E75 C;  1FOS E;  5AVU B;  4Y99 C;  4Y28 J;  3FWN A;  3RK3 C;  5EFW B;  4YXW H;  1LTG C;  1L0N E;  4JF7 A;  1UIX A;  2OGU A;  4W7Y A;  2QJK B;  1SQP G;  4JZC A;  2OTL P;  1NU1 G;  5CCG A;  1MKM A;  1W2E A;  1NTK K;  1LP1 A;  2YMY A;  3L73 J;  3F5H A;  4EOT A;  4D6T J;  4W7Z A;  2P2U A;  1TU3 F;  3AEF C;  3B5N A;  3PJS K;  1YI2 P;  1N86 C;  1PPJ E;  2HLO C;  4UB6 H;  2KZJ A;  2OTK E;  4B86 A;  4ZKP A;  1FZC A;  2PRR A;  3CWB G;  1KD1 Q;  1L0N J;  1WMK A;  1BCC J;  2J3U A;  3GHG B;  2GM4 A;  2Q6Q A;  4N6J A;  3H32 B;  1K04 A;  3IR9 A;  4HB1 A;  4H0L D;  1EDK A;  1L0N K;  2KNC A;  1M56 D;  3H32 A;  1KC8 Q;  4C7N B;  1QVF O;  1SQP J;  2I8D A;  3CCJ P;  4NPE A;  3M9B A;  3O8Z A;  4N78 D;  3NXS A;  1NJI Q;  4IFD K;  1AFO A;  1USD A;  1KQG B;  1G1J A;  1URQ D;  1E5W A;  4HH2 A;  2QJP C;  2E75 D;  1YJW P;  2YO2 A;  2OQQ A;  3H1K G;  3M0D A;  5APQ A;  1RF1 A;  2FXP A;  5KJ7 A;  1NO4 A;  1SQQ D;  3I56 P;  1RF1 C;  2NZ2 A;  4R4M A;  1U7J A;  4IL6 E;  3VMX A;  1FC2 C;  2AXT H;  1SFC A;  3CCL P;  3H6P A;  1FZD A;  1NH4 A;  3V6I A;  1IFN A;  1ZOY C;  2B89 A;  1YHQ P;  1RF0 A;  2K37 A;  3Q1M A;  2A45 H;  2Q9I B;  3S1K A;  2JEE A;  3CL3 D;  1EDI A;  3L75 E;  3N4X A;  3A7O A;  3USS A;  1PGO A;  1HGV A;  2FFD B;  3CXH H;  3HE4 A;  1NU1 E;  1FZG A;  3WMM 0;  3MTU E;  4I6M C;  3QH9 A;  1S3J A;  2N9Y B;  3CX5 E;  3MIW A;  2V7Q H;  1S9K D;  2BAS A;  2WT7 A;  2KXP B;  1K73 Q;  1L0N G;  1BCC G;  2W6A A;  4R9T A;  1Y8A A;  1KIL D;  3L36 A;  2Z4E C;  5AW0 B;  2P67 A;  2FFD C;  1T3J A;  2P1J A;  2WQY C;  2CK3 H;  2QM7 A;  1PV3 A;  3H1H D;  3RK2 D;  2BCC D;  1PP9 D;  1VQL P;  4MN4 C;  3H1K D;  1VQ7 P;  1M57 D;  5C39 A;  2AEM A;  1OW6 A;  2XNX A;  1IFM A;  4H13 C;  3L73 G;  3V4Q A;  2IDB A;  2YKP A;  1NAY A;  4IFF A;  1OXZ A;  2LKM A;  1GL2 C;  2LXB A;  4H13 D;  1Z56 A;  3H25 A;  5CCH C;  1FDI A;  2NPS C;  3A0B E;  4QMA A;  1L0L J;  1PPJ D;  4PV1 C;  1WT6 A;  1GMJ A;  3L73 E;  4EPU A;  2WSC H;  4JPZ B;  2OTJ P;  5K5G B;  3HD7 B;  2LR2 A;  3CWB J;  1RE3 A;  1RF0 B;  1KYO D;  1PGQ A;  1AVY A;  3GW6 A;  1S5L E;  2R3S A;  2HYN A;  1LT9 C;  5AW1 B;  4K35 A;  2I1J A;  3AEC C;  3CWB D;  3Q2Y A;  1Z3U A;  1BE3 G;  3RL0 g;  4EI2 A;  2N9B A;  1FDO A;  2WWW A;  2YMK A;  4W80 A;  1N73 B;  3AE4 C;  1MUU A;  4HYT B;  1LTA C;  3R2P A;  1KFM A;  2JHK F;  1IFP A;  1ZR4 A;  2QJK C;  1VQO P;  1NTZ J;  5AW7 B;  2JWA A;  2XNX B;  1FZE B;  3EFF K;  1NOH A;  1R8E A;  2ZYA A;  4WB4 A;  1LTS C;  3T97 B;  1AJY A;  4JYB A;  2J59 M;  1PL5 A;  5AW9 B;  1HTL C;  2IYP A;  4WVZ A;  3CLQ A;  5AVX B;  1N86 B;  1FOS F;  2E43 A;  2FY8 A;  3E1R A;  3ITK A;  1LT9 A;  3BAT A;  5KLV J;  1G1I A;  2KB7 P;  3H1L D;  1MV8 A;  5B66 E;  3B8E B;  3BAS A;  2ZXX A;  2C9L Y;  3RK3 B;  4M7H A;  3H1J D;  2V4H A;  1Y9B A;  3H1L E;  1OZH A;  3H1H E;  4YXD C;  3E1I B;  2H43 B;  2KS1 A;  1FJP A;  4OGQ C;  1Q82 Q;  2IFM A;  2K3R A;  4U3F E;  1AVO A;  3HUS C;  3L74 D; 
#chains in the Genus database with same CATH homology
 3U59 A;  1SQV K;  3HD7 D;  2P7J A;  2YO3 A;  2XNX C;  1X79 B;  2ZFC A;  1LWU A;  1JY2 N;  3CI9 A;  4WY4 A;  4Y99 B;  2J3G A;  2J61 A;  3E1I C;  2H43 C;  1J1E B;  1HJB A;  2Q9I C;  2HLO B;  3KQG A;  2XV5 A;  2WIT A;  2WT7 B;  1YTZ T;  2C0X A;  1JC9 A;  1JCC A;  2J3F D;  1FZB C;  2WPQ A;  3NMD A;  4GIF A;  2NPS A;  1HWT C;  5CCH A;  1KZU B;  5AW4 B;  1H89 A;  1FOS E;  5AVU B;  4AYC A;  2J58 A;  2JHI F;  1FZE A;  3GHG C;  2Z4E A;  4NYT A;  1N2D C;  1JUN A;  2GUS A;  5AVS B;  1NAF A;  2XU6 A;  4Y99 C;  1PFI A;  1FID A;  2KYV A;  3T97 A;  3RK3 C;  3V4W A;  3VTP C;  3P7K A;  2OYH B;  3II6 A;  1IK9 A;  1LTG C;  2Z5I A;  3L35 A;  4JF7 A;  5AW3 B;  3P8C D;  2N1T A;  4C7N A;  3RK3 D;  1NWQ A;  1IJD B;  2QM8 A;  3C9I A;  4W7Y A;  5CJ0 A;  2C0W A;  4JZC A;  2C9N Y;  1FZG C;  1N7S D;  1Z3S A;  2KOG A;  2GUV A;  2WSF H;  2XKM A;  3VP8 A;  5CCG A;  1W2E A;  1NTK K;  3TNU B;  4I1L A;  1SQQ K;  2YMY A;  2JHH C;  2WPR A;  1GD2 E;  3G3Z A;  2O01 H;  3M9Q A;  3B5N D;  4M3L A;  4EOT A;  2E42 A;  2VRS A;  2FFD A;  3M91 A;  1FIC A;  2N1T B;  3M0A A;  1NKN A;  3BRV B;  4W7Z A;  5CMZ A;  4WY4 B;  5AVZ B;  2P2U A;  1IFI A;  1LGH B;  1M1J A;  2XDJ A;  3NFQ A;  1JCD A;  1G2C A;  1RF1 B;  4ZFG A;  1KQL A;  1J1D C;  3B5N A;  1N86 C;  3P8M C;  3HE4 B;  2ZXE B;  2HLO C;  4B86 A;  1ZN5 A;  5CCG D;  4DOJ A;  1FZA B;  3VMZ A;  1JY2 P;  4ZKP A;  1JOC A;  1FZC A;  1RE3 B;  2NPS B;  2YKO A;  1XTG B;  1FZA A;  1GK6 A;  2J0Y A;  4R9J A;  4IFM A;  4EIJ A;  1N7S C;  1KIL B;  5KJ7 D;  1L0L K;  1LTT C;  1G2C B;  2J3U A;  4XE5 B;  3GHG B;  2GM4 A;  1CW5 A;  4N6J A;  3H32 B;  3EQ2 A;  3IR9 A;  3LW5 H;  5CJ4 A;  4AQR D;  1L0N K;  5KJ7 C;  1GU5 A;  3OA7 A;  3IFM A;  3H32 A;  3P32 A;  3M0D C;  1URQ A;  4C7N B;  1RF0 C;  1RE4 A;  1L4A A;  1LT9 B;  2Q5U A;  3TNU A;  2R32 A;  1IO4 A;  2OYH A;  2OYI B;  3M9B A;  2WPS A;  3A2A A;  3O8Z A;  4N78 D;  3NXS A;  4IFD K;  1AFO A;  2Q3I A;  1SFC C;  3FIB A;  1URQ D;  1G1J A;  2J60 A;  1ZR2 A;  1E5W A;  2JHM F;  4HH2 A;  3BVH A;  1L4A C;  2YO2 A;  1JTH B;  4LLH A;  2GY7 A;  4WBA A;  3M0D A;  5APQ A;  5AVT B;  1RF1 A;  2JJL A;  5AVR B;  5KJ7 A;  1FZF A;  1IC2 A;  1ZV8 A;  1NO4 A;  1RY3 A;  3A3Y B;  5BVZ A;  1FZF C;  3V2R A;  1FZB B;  3EFG A;  1JO5 A;  4M7F A;  1GW4 A;  1RF1 C;  3M06 A;  1LTJ B;  3M9H A;  3KDP B;  1SFC B;  3VMX A;  1LTB C;  3BVH C;  1GW3 A;  2J2P A;  5AW5 B;  1FBM A;  5AW6 B;  1FZA C;  1SFC A;  4I2L C;  3V2P A;  3L4F A;  3H6P A;  1FZD A;  2CPB A;  3SWY A;  1N7L A;  2YKQ A;  1NH4 A;  2OYH C;  2FKW B;  1IFN A;  4AUW A;  3MUD A;  2I1K A;  1N86 A;  3HUS B;  4XA4 A;  3B5N C;  1RE4 C;  2KP8 A;  1RF0 A;  3V5B A;  1URQ C;  5KTB A;  1M1J C;  1HH0 A;  3H32 C;  2A45 H;  1T2K C;  1L4A D;  1SQX K;  3BRT B;  5AVQ B;  1EQ7 A;  1S9K E;  2Q9I B;  3HE5 B;  1FAV A;  2JEE A;  2Q7C A;  1MZ9 A;  3CL3 D;  1T2K D;  2JHL F;  3N4X A;  1N7S A;  3A7O A;  1LTI C;  1FDM A;  3TSI A;  1HGV A;  2FFD B;  1GDT A;  5AVV B;  3HE4 A;  1NTZ K;  1FZC C;  1FZG A;  1T3U A;  1RE4 B;  3WMM 0;  3MTU E;  4O9B A;  4I6M C;  1NKZ B;  3MD0 A;  2M8R A;  1M1J B;  2J5Z A;  4RES B;  2HLO A;  3KPE A;  1SLQ A;  2FYU K;  3MIW A;  1DX7 A;  4N78 E;  1FU1 A;  1S9K D;  1H88 A;  2BAS A;  2WT7 A;  4JYC A;  5BU5 A;  2KLV A;  3VMY A;  1GU4 A;  2W6A A;  2H8P D;  4R9T A;  1M7L A;  1KIL D;  3L36 A;  3UIA A;  1JY3 N;  2Z4E C;  5AW0 B;  2P67 A;  2FFD C;  1T3J A;  2W6B A;  2J3F A;  2P1J A;  5APS A;  2HPC B;  1DEB A;  1JY3 P;  1JNM A;  1FZB A;  5APY A;  2QM7 A;  5CCG C;  1GZL A;  3RK2 D;  1SFC D;  3P8C E;  2J1G A;  2WTY A;  1VPC A;  2N1T C;  2POH A;  3E1I A;  4WY4 C;  2H43 A;  2IPP A;  2O1J A;  2XNX A;  1URQ B;  1IFM A;  2FIB A;  2HPC C;  3V4Q A;  3OJA B;  3HUS A;  2YKP A;  1CI6 B;  1FJK A;  1SQP K;  3HTK B;  1LWU B;  1OXZ A;  4IFF A;  1SQB K;  2LKM A;  3HRN A;  1GL2 C;  3GHG A;  1FZE C;  1Z56 A;  1L4A B;  5APX A;  1CSB A;  2FXM A;  1X8Y A;  1N73 A;  1NU1 K;  3U1A A;  1QL2 A;  5CCH C;  2HOD C;  1HVV A;  2NPS C;  1HGZ A;  2H7H A;  1XTC C;  2IFN A;  1CZQ A;  5AW2 B;  2J3O A;  2WNP F;  5CCH D;  3RL0 D;  2A45 G;  1WT6 A;  2PP6 A;  3KYQ A;  4EPU A;  1LTJ C;  2WSC H;  2Q9I A;  1LWU C;  3BVH B;  2CPS A;  4JYO X;  3HD7 B;  4OH8 B;  1A02 J;  1JY2 O;  1JTH A;  1RE3 A;  1RF0 B;  3VYI A;  2PAJ A;  4GT1 A;  2HYN A;  3V2Q A;  1LT9 C;  5AW1 B;  1WRG A;  2Z5H A;  3TYY A;  2D39 A;  1KFN A;  3HD7 A;  1YTZ I;  2HFE D;  5CHX A;  3N7N A;  2I1J A;  1H8A A;  5AVW B;  3HE5 A;  2J64 A;  2L5G B;  3OAK A;  1DH3 A;  3SWF A;  2KSJ A;  1YYC A;  1GL2 D;  5AVY B;  1SP4 A;  1Z3U A;  3V2N A;  2J61 B;  3U1C A;  1NHL A;  1IFJ A;  1FIB A;  1NTM K;  1J2J B;  4N3Y B;  2N9B A;  3RK2 B;  2WWW A;  3NTN A;  4W80 A;  1N73 B;  2M3B A;  1MUU A;  4HYT B;  2J0H A;  1LTA C;  1FZF B;  3R2P A;  3LIE A;  1KFM A;  2JHK F;  1ZR4 A;  1JMM A;  1ZLL A;  3HTK A;  1KIL A;  1FZG B;  1GK4 A;  3VP9 A;  1KIL C;  5AW7 B;  2R5D A;  2R3C A;  2XNX B;  1FZE B;  5APU A;  3A5T A;  1NOH A;  2HOD B;  1J1E C;  1X9V A;  1OWA A;  1JY3 O;  4WB4 A;  2OYI A;  1LTS C;  2YNY A;  1T8Z A;  3L37 A;  4JYB A;  3RK2 C;  2J59 M;  3PP5 A;  3B5N B;  5AW9 B;  1HTL C;  4C7R A;  2Z4E B;  4LC1 A;  2OYI C;  1AQ5 A;  1HBW A;  3CLQ A;  5KLV K;  2N1T D;  1SVF A;  1J1D B;  5AVX B;  3RL0 B;  1N86 B;  2FYZ A;  1FOS F;  5BU8 B;  3HD7 C;  2E43 A;  1LT9 A;  2R5B A;  3BAT A;  1G1I A;  2KB7 P;  3MGN A;  1MV8 A;  1VDF A;  3B8E B;  3BAS A;  1QL1 A;  2C9L Y;  1RE3 C;  3RK3 B;  5AW8 B;  4M7H A;  1A02 F;  4DZO A;  3TK1 A;  3VN0 A;  1CI6 A;  1FZC B;  5APW A;  1LTJ A;  2MJZ A;  3I5C A;  2XZR A;  1N7S B;  2IX7 C;  2NPS D;  4KHX A;  4GKG A;  2HG5 D;  4C46 A;  3E1I B;  2H43 B;  3RL0 C;  1FJP A;  3VOP A;  2A45 I;  1GL2 B;  4LGD E;  2O1K A;  5APV A;  2J0G A;  2HOD A;  5APT A;  1N73 C;  1GTW A;  3LID A;  2W27 A;  4WY4 D;  2IFM A;  2WSE H;  1GL2 A;  1HUC A;  1MFZ A;  4ZKU A;  1IFD A;  3HUS C;  2WZ7 A;  2HPC A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...