1LT9C

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9C02
1LT9C 2J3FA 2OYHB 1LTJB 1RE3A 3HUSB 2FFDC 1FZAC 1FZBC 2OYIB 1FZCB 2XNXA 1RF1C 2FFDB 2HLOA 2JHIF 1Z3SA 4JYOX 4ZFGA 1N86C 1LWUA 3E1IB 3BVHB 3GHGB 1FZFA 2WNPF 2HPCA 4R9TA 1LT9A 2J64A 1RF0B 2OYIC 1FZCC 2J0YA 3FIBA 2HLOC 2JHHC 4EPUA 2HPCB 1Z3UA 3GHGA 1RF1A 1FZBA 2J0HA 1JY3O 1T3UA 3E1IA 1FZEB 1M1JC 3H32B 2J3UA 1FZGB 3BVHC 2J61A 1JY2O 2OYHA 3H32C 4M7HA 1N73C 2Q9IA 2GY7A 1RE4C 2J5ZA 2J60A 2HODA 1LWUC 2J3OA 1N73B 2Z4EB 3GHGC 1LTJA 3HUSA 1RE3B 1JY3N 2JHLF 2A45G 4JZCA 2FIBA 2H43B 1FZCA 2OYIA 2J61B 2JHKF 2J2PA 2H43C 2HODC 2Q9IB 2HPCC 1JC9A 1RE4A 1RE3C 1N73A 2Z4EC 2D39A 2HODB 2Q9IC 2J3FD 1JY2N 4M7FA 1RF0A 1JY3P 1LT9B 1FZBB 1N86B 3E1IC 1M1JA 1LTJC 3HUSC 1FZAA 1FZEC 2A45I 2J0GA 4NYTA 2HLOB 1FZGA 1FZFB 1JY2P 1FZAB 1LWUB 3BVHA 2J3GA 2Z4EA 2J1GA 1M1JB 4R9JA 1N86A 1FIDA 1FZDA 2H43A 1FICA 2JHMF 2XNXC 1FZEA 1RE4B 2A45H 2FFDA 1W2EA 1RF1B 2XNXB 1FIBA 1FZFC 1FZGC 1RF0C 2OYHC 3H32A
chains in the Genus database with same CATH superfamily
1W2BO 1EDKA 5CHXA 5DJUB 1FE6A 1EC5A 1IJDB 1FZCB 3MTUE 3FXEA 3RK2C 2OTLP 4NPDA 2Q1KA 1SQQG 2WSEJ 4JYOX 2FYUG 4PJ0E 3GHGB 2YMKA 2G8YA 3L72D 3JC22 1T6AA 3NFQA 4TLFA 3A7OA 3KYQA 2J0HA 4PD4H 1QLED 3L75J 1LGHB 2QM8A 1GDTA 1FAVA 1NU1D 2O01N 4Z1MH 2DW3A 2O1KA 4D6TJ 1N7SB 1ZRTD 1KB9H 3CX5H 2OYIA 3CC7P 2AEMA 2PRRA 1URQB 1SQPJ 2H43C 2HODC 1SFCD 2Q7CA 1M56D 1S5LH 3RK2B 4BRYB 3M91A 2Y9YA 3Q3DA 1UIXA 2ITAA 3HE5A 3IFMA 1VL2A 2KLUA 3RGUA 2P67A 1SQBE 1L0NK 2H43A 1YTZI 2KK7A 2QRXA 1BE3D 4UB6E 5AVYB 4TT3H 1NU1K 3H1IE 4OH8B 1E79H 1EDLA 3M9QA 2WZ7A 2QE7H 3VTPC 1FDIA 1RF1C 1N7SC 5C39A 2M0BA 1L4AA 2E75B 3BRVB 3H1HE 2FKWB 1IFJA 3RL0C 3Q5PA 2QJYC 1SQVE 4YTPC 3H1KJ 1SQBD 1AJYA 4C7NB 1FJKA 1N7LA 2VRSA 2FYUK 3O6QB 4A7PA 1BE3E 2J58A 3MUDA 2V7QH 1N73B 2MKVA 3GHGC 3CL3D 2JHLF 1H8AA 3D71A 1U7MA 5AW7B 5AW2B 3T97B 2BASA 2KXPB 2ZXXA 1N73A 1CI6A 2HODB 3L74E 1NKZB 4M7FA 3RK3C 3RK2D 5CCGC 2N1TC 1L0ND 2J0GA 2QA4P 2ZYAA 1S72P 4IL6X 2Z4EA 1WT6A 1USDA 3G6EP 1WMKA 3B5NC 3RBZA 5KLVJ 1MFZA 3E7KA 4N6JA 1LP1A 3RK3E 5E79H 5APXA 3MP7B 3P8CD 4BWNA 2IZ1A 3EFFK 2HR3A 2M3EA 1AVYA 1RE3A 1NO4A 4ZFGA 1OMIA 4ZKPA 2HPCA 2W6BA 1S3JA 1QEXA 1VQ4P 1LTBC 4L74A 1X8YA 3FIBA 2KOGA 1KYOD 4M3LA 1G1IA 1JNMA 3LIEA 4ZKUA 1W5CE 3V2NA 1OVVA 2O01J 3LW5H 4H44C 2J60A 5APUA 1SQVK 1LTJA 1DEEG 3JSVC 1LNQA 1FZCA 2V4HA 2JKVA 2E74D 4L75A 5GTIH 1M57D 1KC8Q 4GKGA 1R5SA 2FYUJ 3L37A 1JY2N 1NOHA 3H1JD 1NTKJ 1JUNA 1SQBG 1EXJA 2K1AA 3A0HH 1BGYG 3MZWB 4JBZA 4EOTA 2YKPA 2V7QJ 4OVNF 5CJ4A 3FWNA 1NTMG 5AVSB 1U7JA 3CXHE 2R3SA 1VPCA 5CJ0A 1SQBK 2KNCA 3H1LE 4IOIH 1GL2A 1ZMEC 2HFED 2YXQB 5APYA 3KZIH 3HUSB 5E79E 4ASVA 4IFDK 3L36A 3BCCD 5B66E 5AW5B 3U59A 3AEGC 1N8RQ 1KILD 2WPRA 1H0TB 4DT0A 1OFCX 1M8OB 3H1ID 1X79B 3K5BA 3NTNA 3V2PA 3CMEP 3BVHC 1JY2O 1URQA 1S5LX 2PGDA 1BDCA 3H1HJ 1NTKK 2K9JA 4Y99B 2WSFJ 4IL6H 2HODA 1NTMJ 2IFNA 2QJYB 3H25A 3TGUE 1PP9G 2E43A 2FIBA 1ZV8A 4YXDC 1N2DC 4DJGA 4H0LD 3AE6C 3OJAB 2XNDH 4XA4A 3WUUA 3HTKB 4H0LB 1N7SD 2K88A 3OA7A 2ZXEB 1JY2P 1FZAB 3I5CA 1YIJP 2WTYA 1L0LJ 1OVUA 3CCVP 1RE4B 3L73E 4DCKA 2KI7B 3N7NA 5AW8B 2WMMA 5H2FE 2OYHC 3D6ZA 1NH4A 3L70E 3TGUD 2IDBA 3H1IG 5APQA 2OGUA 1VQMP 2P1JA 2LR2A 2CK3H 2QM7A 2AXTH 1Z3SA 5KLVK 1NTMD 4BXLA 4C7NA 5AW1B 1Q82Q 3H1HD 2AXCA 1LT9A 1KTMA 1S4XA 5CCGA 3H1IJ 1FZBA 4AUWA 1HBWA 1SQXG 1FZEB 4RJTA 2XKMA 5KAIE 1GW3A 3TSIA 1VQ9P 2GY7A 2FY8A 2J5ZA 3A2AA 1BSHA 1YQ4C 3G9RA 3ABVC 1PPJD 1S1CX 1GK6A 3S9OA 3TDKA 5AVUB 2C0WA 4PV1B 5AVZB 2UWJE 1PGQA 1IZNB 3IF4A 3H1LG 3CWBD 2YIUC 2YO3A 2IX7C 3FWLA 4OGQD 4QMAA 4AYCA 2E76D 1FIDA 2KS1B 3HE4A 3CCUP 1AFOA 1R8EA 2JHMF 1SQPK 1EZVG 4JQ0D 1FIBA 2I8DA 1NTKD 3H1JJ 1OVRA 3H32A 2M5AB 1JEKA 2OYHB 1GL2C 2C9NY 1EQ7A 2Y9ZA 3WUTA 3BRTB 2W6JH 3G71P 3I56P 1J1EB 4WWIA 1EXIA 3MIWA 4UB8H 5AVVB 3MUDC 1CW5A 1DD4A 1T2KD 2JHHC 2WSCJ 3GMAA 1Q81Q 2OTKE 1AVOA 1FZGB 2IBZD 1VQLP 1M1KQ 3WU2H 4RESB 4HH2A 3V4WA 2FXPA 2GUVA 2J3OA 1GK4A 3OAKA 1PL5A 1BCCD 1VQ8P 1DX7A 2NPSA 1NTZJ 1YQ3C 3TNUB 2A06D 1SQXK 2K37A 3AECC 2J2PA 3CX5D 5H2FH 2AEFA 2ZVOB 2O1JA 3A0BH 1X22A 5KLVD 5TISH 3L71G 5KAFH 1YTZT 2M8RA 3PHLA 3P32A 5GTHE 2WT7B 1L2PA 1MV8A 3L70G 1DIPA 1T3JA 2A45H 1E5WA 1S5LE 3T97A 2GUSA 2R32A 1SFCB 1NWQA 1OW6A 3A3YB 3V6IA 2FFDB 1SQXD 2JHIF 4L73A 1K73Q 4PV1D 4I6MC 3RBXA 2QEXP 1SQVD 2BCCE 5BU5A 1JTHA 1KMIZ 2J64A 2GA1A 1RF0B 2XV5A 3S4RA 1RHZB 1YJ9P 3H1KD 1T3UA 2FYUE 1M1JC 3E1RA 1N73C 1ZLLA 2JJLA 2KLVA 1SVFA 2ZFCA 3LW5J 3U1AA 1T8ZA 2Y0EA 5KJ7A 3R4YA 3L74G 3EWKA 1PP9E 3CWBE 4L76A 1YYCA 2D39A 3L70D 1SQQK 2L91A 5TISE 3RL0B 3GW6A 2ZT9D 1BE3J 3QH9A 1HF9A 1L0NG 3W68A 2A45I 1J1DB 2KP8A 2XDJA 3BVHA 1M7LA 3HD7A 4LGDE 1N86A 1BCCG 2M5AA 2NPSB 4R4MA 1VF5C 4LLHA 3RK3D 2P10A 1KB9I 3KHUA 2D2CB 1PPJG 1Q90D 3L73G 1OWAA 1JO5A 1LT9C 3R2PA 2WSEH 1YHQP 1FZAC 2W6AA 1LTGC 3N4XA 1RQUA 2B87A 1YJNP 4W7YA 2W90A 5KKZB 1EZVI 4N3YB 3L70J 3CPWO 1P84H 3Q2YA 1EDIA 2WNPF 1NU1J 3L75D 2A06E 2E5YA 1VQOP 4EIJA 1NAYA 1JY3O 2KB7P 5AVXB 2J61A 1SQVG 2NZ2A 4PD4I 4HB1A 1NVOA 1YI2P 1RE3B 3TF5A 4JZCA 2J61B 2JHKF 3M9HA 1FC2C 3L71E 4MN4C 4WY4A 1USEA 2YXRB 2O3JA 5APTA 2Q9IC 1SQVJ 3OW2O 1P84E 1BGYE 2WT7A 1D7MA 3TYYA 1FZBB 1SQXJ 2W27A 1LTJC 3AE9C 4PD4E 1FZAA 1SP4A 4NYTA 2QJKC 1LWUB 1FDMA 4ASWA 1HVVA 2QVAA 3M0DA 5AW6B 1EDJA 1CI6B 2NPSD 3FX0A 2W8ZA 1W2EA 2ZAEB 2ZYGA 4XFJA 4I7ZB 1KILA 1H0TA 3GF7A 3II6A 4OWFA 2RN0A 2XNXA 3HE5B 3M9BA 1K9MQ 2IZ0A 3H1JE 1RH5B 1BDDA 2CPBA 4UB8E 3GLMA 2KS1A 3SWFA 2KYVA 2H8PD 2C0XA 1YJWP 1FZCC 1X9VA 4PD4D 1NTZD 1BCCJ 2R44A 1HUCA 3CD6P 5AVWB 5L8RJ 2YKOA 2YNYA 2WQYC 1LT1A 5APSA 3L74D 4JYBA 5CBOA 2AEJA 3TGUG 2FXMA 3O8ZA 1RE4C 2K9YA 3ZDMA 1MKMA 3HUSA 1JY3N 3UIAA 4I2LC 1KB9D 1RE3C 1XTCC 2E74B 4GT1A 2J3FD 2NRGA 3L73J 5BU8B 4I7ZC 1N86B 3E1IC 5B66H 5AVRB 3L72G 2QG4A 1KN7A 3V2RA 2QSIA 4RKUJ 3B5NA 3H1KG 4DZOA 1FZFB 3SWKA 4WB4A 3Q1MA 3NMDA 3TNUA 2LXCB 4KHXA 3CCRP 1MFTA 1NTZK 2Q6QA 1VQ6P 3FXDA 5AW3B 2CPSA 4D6TG 2JWAA 2ZJSE 3CWBJ 1L4AC 3AEFC 3U1CA 1JTHB 3CC4P 2ZYDA 4ZNCA 3MD0A 3F89A 1K8AQ 4CPGA 3A0BE 2KIKA 1NJIQ 4H44D 3KDPB 3H6PA 4C46A 3F5HA 1AA0A 2JEEA 2BEZF 2BCCG 2ZT9B 1J1DC 3D6YA 4H13B 3VP8A 3AE2C 1NTKG 1IFMA 3AE7C 2XU6A 1FS0E 1ZR2A 3KQGA 2A45G 4WVZA 4U3FE 1PP9J 1N7SA 1QX8A 1HJ0A 1JB0J 1OIPA 1OX3A 3AEBC 2IFMA 3CWBG 4WBAA 1LT9B 1VF5D 1FU1A 5APWA 4U3FJ 1K05A 3VYIA 3PTZA 3TGUJ 5AW4B 3NXSA 2PFXA 5CCGD 1EZVE 2WPQA 2NPSC 3V2QA 2ZT9C 5CMZA 3L71J 1KFMA 1L0LD 1Q2NA 1A02F 3SFEC 1DH3A 4WY4D 3G4SP 1L0LE 5GTHH 1NGMB 1G2CB 1KFNA 1PPJE 2J3FA 1QVFO 2GM4A 2I1JA 5EFWB 3IAOA 1KQSO 3HRNA 5CCHD 2I1KA 2H89C 5K5GB 2IBZG 4R9TA 3AEAC 2JDIH 2B89A 1VQKP 2YO2A 2M3BA 3KZIE 4BRYA 2N1TB 3V4QA 3IN6A 1HWTC 2A06G 3CC2P 2R5DA 1FDOA 3H1LJ 2LXBA 1SFCA 1KORA 1KILB 4PV1C 2E42A 1LTTC 3AE4C 3QWOC 4KJMA 3L72E 1PFIA 3P7KA 1URQD 2KUBA 4H13C 1L4AD 2BCCD 1NHLA 3WUVA 1VDFA 1RF0A 1GW4A 1ZW0A 1WRGA 3CLQA 3BCCJ 5CCHC 2D2CC 1ZR4A 1Y47A 3BASA 2OARA 1LTIC 2HLOB 5TJHA 1FZGA 1NTZE 2IYOA 2J1GA 4R9JA 1VQ5P 2OYOA 3GF3A 3SWYA 1FICA 5BVZA 5AVTB 3G3ZA 2FFDA 3WU2E 1RF1B 2XNXB 2K3RA 3EFGA 1ZN5A 2B87B 1J2JB 1ZRTE 2RMZA 2N1TD 1SLQA 1MUUA 2BEQD 4HYTB 2R5BA 1KYOI 2H88C 2QIWA 3B5NB 3E1IB 1N86C 4AQRD 1GZLA 2WITA 2FYUD 1Z56A 4YXWH 1FZFA 3BVHB 3EQ2A 2P2UA 3C9IA 2J0YA 3AE5C 2HPCB 1BGYD 1PZQA 3MHVA 3E1IA 3H32B 4EYYQ 2OYHA 1RY3A 3RK3B 1HJBA 1AQTA 5KAIH 3B71A 2HG5D 5AW0B 3PP5A 3CCJP 2KZJA 4NPFX 4K3AA 1GMJA 1JCCA 2Z4EC 2Z5IA 1UIIA 3L75G 1M1JA 1GTWA 2Q3IA 5B5EH 1FZEC 1KYOH 2E76C 3AE8C 4OGQC 1KZUB 1VQNP 3H1KE 1M1JB 2FYNC 3P8CE 3W67A 1H89A 3AEEC 4I1LA 2JWDA 5CCHA 4XE5B 4WY4B 1NYHA 1YBKA 1RQVA 2IYPA 3CXHH 3ITKA 2K9JB 1K04A 5KLIB 1QL2A 2IBZE 1L0NJ 3C1LA 5KKZC 1OW7A 4LC1A 3IR9A 4IFFA 4PJ0H 1LWUA 4O9BA 3AE1C 1SFCC 3H1HG 2AXTE 3HD7D 2KSJA 3PJSK 3VN0A 1TU3F 4IFMA 5AVQB 4HJGH 1VF5B 1RF1A 1BGYJ 4EDFA 2B88A 2J3UA 3CXHI 3CCMP 1Y9BA 1IFPA 5CBNA 3H32C 2E75D 1JCDA 1PV3A 1KD1Q 1SQBJ 3AEDC 1X0TA 2HPCC 4U3FG 1R5LA 1MZ9A 3SFDC 3GG2A 4GIFA 1JY3P 1NTZG 1FOSE 2RH0A 3A5TA 2YKQA 3HD7B 1NU1E 4YPCA 4EI2A 1VQ7P 1GL2D 4NPEA 1SQPE 4DOJA 2J3GA 5KJ7C 3VMXA 4JYCA 5KAFE 1L0NE 3BCCE 1PGOA 1AV1A 2WPVB 3WMM0 2SPZA 3C8VA 1KILE 5KJ7D 3I55P 2BCCJ 1BCCE 1LTAC 1M90Q 1J1EC 4GOEA 3PH0A 4H0LC 1LTJB 2FFDC 1SQQE 1FZBC 4JF7A 3AE3C 2Q3EA 1DD3A 2HYNA 2PAJA 3L4FA 1FOSF 3JCUH 4JPZB 1L4AB 3H1LD 2FYNB 4GOFA 4Y99C 2WSCH 1SQPD 2ZVNB 4RO0A 3CMAP 1Z3UA 3GHGA 4Y28J 1QGKB 4D6TD 1IO4A 3SSUA 4B86A 2MJZA 4M7HA 2E75C 2FYZA 2N9BA 2YIUB 2Z5HA 2Z4EB 1OXZA 3VOPA 2IPPA 1S9KE 3L75E 2OQQA 1P84I 1EZVD 3L72J 1LP1B 1PIXA 4OGQB 3LIDA 2E76B 2Y0CA 3TK1A 2N1TA 3A0HE 3HUSC 1L0LK 3L71D 1NAFA 5KLVG 3RL0g 2H7HA 2OTJP 4K35A 1FJPA 3VMYA 5GTIE 2E5TA 1SS1A 3FGAD 1QL1A 1KYOE 2WWWA 5B5EE 4W80A 1QVGO 2D2CD 1KQFB 4UB6H 3M06A 4U3FD 3CI9A 1NKNA 3HE4B 3CXHD 1S9KD 2WVRA 2W83C 1NTMK 1GU5A 2N9YB 2Q5UA 1BSNA 1IFNA 1ZP0C 1URQC 4H13D 3O6QA 4N78D 3CCQP 2L5GB 1PP9D 2FXOA 2OYIB 2QJPC 1GL2B 1KV4A 1Y8AA 1H88A 3CCSP 4GDOA 2J5UA 1SQXE 1G1JA 2PP6A 2IBZI 1Q7YQ 2KSEA 3KXDA 5AW9B 2OYIC 2HLOC 3H1JG 4EPUA 1NTKE 3BATA 1SQQD 2POHA 1CSBA 3B4SA 1IFIA 4HKZH 2QJKB 3CX5I 2Q9IA 5APVA 1LWUC 1Q86Q 1FBMA 5KLIC 1IK9A 3PLNA 1NU1G 2Q9IB 4GODA 2J59M 4WY4C 3JCUE 2B9BA 1SQPG 1KILC 5M1BA 1OW8A 1ZXGA 1DEBA 3BCCG 3M0DC 1GD2E 3VMZA 1IK7A 3D70A 1FZDA 2O01H 3PRJA 1A02J 1FZEA 5KTBA 1CZQA 1KQLA 1L0LG 2WSSH 3V5BA 1FZFC 1ZOYC 3L73D 1LJ2A 1PGJA 4U7JA 1OZHA 4W7ZA 1JM0A 4D6TE 2HLOA 1PGPA 1P84D 1JMMA 1JOCA 1GU4A 3P8MC 2LKMA 2R3CA 3L74J 2JO1A 3S1KA 2E74C 2P7JA 1HGZA 3KPEA 1HTLC 2WSFH 1KB9E 1XTGB 3HD7C 3MGNA 3CCEP 4KT0J 4IL6E 1S2EA 3RL0D 1JMBA 2G3AA 2QJPB 1G2CA 1SQQJ 2Y0DA 2H43B 3L35A 3M0AA 2XZRA 1HGVA 1T2KC 1U57A 1BE3G 2JP3A 5KLVE 1JC9A 1RE4A 2KNCB 2P58A 1HH0A 2KZIA 1IC2A 1KQGB 4ZMDA 2JR8A 3USSA 2FBWC 3B8EB 1YITP 1NTME 1AQ5A 4C7RA 2YMYA 3HTKA 5DJTB 1LTSC 3VMAA 1IFDA 4H44B 3Q5RA 4N78E 2WPSA 3CCLP 1VQPP 3CX5E 2C9LY 2RKLA 2XNXC 3Q5SA 3B5ND 3VP9A 1FZGC 1RF0C 4R4LA
chains in the Genus database with same CATH topology
5CHXA 1QL2A 3II6A 5APQA 1IJDB 1FZCB 2XNXA 2P1JA 3MTUE 3HE5B 3M9BA 3RK2C 2QM7A 4LC1A 3IR9A 2CPBA 1Z3SA 5KLVK 4JYOX 4IFFA 4C7NA 5AW1B 1LWUA 4O9BA 2KYVA 3GHGB 3SWFA 2H8PD 1SFCC 1LT9A 2C0XA 3HD7D 2KSJA 3NFQA 1FZCC 1X9VA 3A7OA 3VN0A 4IFMA 5CCGA 5AVQB 1RF1A 1HUCA 1FZBA 5AVWB 3KYQA 4AUWA 2J0HA 1HBWA 1FZEB 2YKOA 2YNYA 2J3UA 1LGHB 2XKMA 2QM8A 1GDTA 5APSA 4JYBA 1FAVA 1GW3A 3TSIA 3H32C 1JCDA 2FXMA 3O8ZA 2GY7A 1RE4C 2J5ZA 2O1KA 1N7SB 3A2AA 3HUSA 1JY3N 3UIAA 2OYIA 1URQB 4I2LC 2H43C 2HODC 2HPCC 1RE3C 1XTCC 1SFCD 1MZ9A 4GT1A 2Q7CA 2J3FD 3RK2B 1GK6A 4GIFA 1JY3P 5BU8B 1FOSE 3M91A 1N86B 3E1IC 5AVRB 3A5TA 2YKQA 3HE5A 5AVUB 3IFMA 2C0WA 3HD7B 3V2RA 5AVZB 1KILA 3B5NA 4DZOA 1GL2D 1FZFB 4DOJA 2J3GA 2YO3A 4WB4A 2IX7C 2P67A 4AYCA 1L0NK 3NMDA 3TNUA 4KHXA 5KJ7C 3VMXA 1FIDA 4JYCA 2H43A 3HE4A 1YTZI 1AFOA 1NTZK 2JHMF 3WMM0 1SQPK 5AW3B 2CPSA 5AVYB 1FIBA 5KJ7D 1NU1K 4OH8B 3H32A 1LTAC 1L4AC 1J1EC 3U1CA 2OYHB 1LTJB 1GL2C 1JTHB 3M9QA 2WZ7A 2FFDC 2C9NY 3VTPC 1EQ7A 1FZBC 3BRTB 1RF1C 3MD0A 1N7SC 4JF7A 1L4AA 1J1EB 2HYNA 3BRVB 3KDPB 2PAJA 3H6PA 2FKWB 3MIWA 4C46A 1IFJA 3RL0C 3L4FA 5AVVB 1FOSF 2JEEA 1L4AB 4Y99C 2WSCH 1CW5A 1J1DC 1T2KD 2JHHC 1Z3UA 3GHGA 3VP8A 4C7NB 1FJKA 1N7LA 2VRSA 1IFMA 2FYUK 1IO4A 1FZGB 4B86A 2MJZA 4M7HA 4RESB 4HH2A 2FYZA 2N9BA 2XU6A 3V4WA 2J58A 2GUVA 2Z5HA 3MUDA 2J3OA 1N73B 1GK4A 1OXZA 2Z4EB 3VOPA 2IPPA 3GHGC 1S9KE 3OAKA 1ZR2A 3CL3D 2JHLF 3KQGA 2A45G 1H8AA 1DX7A 2NPSA 3TNUB 1SQXK 1N7SA 5AW7B 2J2PA 5AW2B 2BASA 3LIDA 1CI6A 1N73A 3TK1A 2HODB 1NKZB 2IFMA 4WBAA 4M7FA 1LT9B 3RK3C 2N1TA 1FU1A 5APWA 2O1JA 3HUSC 1L0LK 3RK2D 1NAFA 1YTZT 2N1TC 5CCGC 3VYIA 2H7HA 2M8RA 2J0GA 3BVHB 5AW4B 3P32A 1FJPA 3VMYA 2WT7B 2Z4EA 1WT6A 3NXSA 1QL1A 1MV8A 5CCGD 2WWWA 2WPQA 2NPSC 4W80A 1T3JA 3V2QA 3B5NC 5CMZA 3M06A 3CI9A 1MFZA 1KFMA 1NKNA 2A45H 1E5WA 3HE4B 4N6JA 1S9KD 3T97A 1NTMK 1GU5A 5APXA 1A02F 2GUSA 1DH3A 4WY4D 3P8CD 2Q5UA 2R32A 1SFCB 1IFNA 1URQC 1G2CB 1KFNA 2J3FA 4N78D 1RE3A 1NWQA 3A3YB 2I1JA 2GM4A 2L5GB 2OYIB 1NO4A 1GL2B 3HRNA 2FFDB 5CCHD 2JHIF 1H88A 4I6MC 2I1KA 4ZFGA 1G1JA 4ZKPA 5BU5A 2PP6A 1JTHA 2HPCA 4R9TA 2W6BA 3E1IB 2J64A 1LTBC 1RF0B 2XV5A 1X8YA 5AW9B 2OYIC 3FIBA 2KOGA 2HLOC 4EPUA 4M3LA 1G1IA 3BATA 2YO2A 1JNMA 2M3BA 3LIEA 2N1TB 3V4QA 2POHA 1T3UA 4ZKUA 1M1JC 1CSBA 1HWTC 3V2NA 1IFIA 2R5DA 3LW5H 1N73C 1ZLLA 2Q9IA 1SFCA 5APVA 1KILB 2JJLA 2KLVA 2J60A 5APUA 1LWUC 1SVFA 2ZFCA 2E42A 3U1AA 1SQVK 1LTTC 1LTJA 1T8ZA 1FZCA 1FBMA 1PFIA 1IK9A 5KJ7A 3P7KA 2Q9IB 1URQD 1L4AD 1YYCA 2J59M 4WY4C 4GKGA 3L37A 2D39A 1NHLA 1JY2N 1KILC 1VDFA 1SQQK 1NOHA 1RF0A 1GW4A 3RL0B 1JUNA 1WRGA 3CLQA 5CCHC 4EOTA 1ZR4A 1DEBA 2YKPA 3M0DC 1GD2E 2A45I 3BASA 2OARA 1LTIC 3VMZA 5CJ4A 2HLOB 1J1DB 1FZGA 2KP8A 2XDJA 3BVHA 1M7LA 5AVSB 2J1GA 3HD7A 4LGDE 4R9JA 1N86A 1VPCA 1FZDA 2NPSB 2O01H 5CJ0A 1SQBK 3SWYA 1FICA 1A02J 5BVZA 5AVTB 3G3ZA 1FZEA 5KTBA 1CZQA 4LLHA 3RK3D 1GL2A 1KQLA 2FFDA 2XNXB 3V5BA 1RF1B 1FZFC 3EFGA 2HFED 1ZN5A 1OWAA 1JO5A 1LT9C 3R2PA 2WSEH 5APYA 4W7ZA 1J2JB 3HUSB 1FZAC 4IFDK 2W6AA 3L36A 1LTGC 2N1TD 1SLQA 1MUUA 3N4XA 4HYTB 2HLOA 2R5BA 4W7YA 5AW5B 1JMMA 4N3YB 1JOCA 3U59A 3B5NB 1GU4A 3P8MC 1N86C 1KILD 1GZLA 2WITA 4AQRD 1Z56A 1FZFA 2LKMA 2WNPF 2WPRA 2R3CA 3EQ2A 2P2UA 3C9IA 2J0YA 2P7JA 1HGZA 2HPCB 3KPEA 1HTLC 1X79B 2WSFH 4EIJA 1XTGB 3NTNA 1JY3O 3E1IA 3V2PA 3HD7C 3MGNA 3H32B 2KB7P 5AVXB 3BVHC 2J61A 1JY2O 1URQA 2OYHA 1RY3A 3RK3B 3RL0D 1NTKK 4Y99B 1HJBA 2HODA 1G2CA 2IFNA 1RE3B 2HG5D 5AW0B 4JZCA 3PP5A 2E43A 2FIBA 2H43B 1ZV8A 2J61B 2JHKF 3L35A 3M0AA 2XZRA 3M9HA 1HGVA 1N2DC 1T2KC 1JC9A 4WY4A 1RE4A 3OJAB 1JCCA 4XA4A 2Z4EC 2Z5IA 5APTA 2Q9IC 2WT7A 1HH0A 1IC2A 3TYYA 1FZBB 3HTKB 1M1JA 2W27A 1GTWA 1LTJC 2Q3IA 1FZAA 1FZEC 1N7SD 1SP4A 3B8EB 1AQ5A 3OA7A 4C7RA 2YMYA 3HTKA 4NYTA 2ZXEB 1JY2P 1LTSC 1FZAB 1LWUB 1FDMA 1IFDA 1KZUB 3I5CA 4N78E 1M1JB 2WTYA 2WPSA 1HVVA 3P8CE 2C9LY 1H89A 2XNXC 4I1LA 3M0DA 5AW6B 3B5ND 3VP9A 1RE4B 1CI6B 2NPSD 5CCHA 1W2EA 4XE5B 4WY4B 3N7NA 5AW8B 1FZGC 1RF0C 2OYHC 1NH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 C;  2J3F A;  2OYH B;  1LTJ B;  1RE3 A;  3HUS B;  2FFD C;  1FZA C;  1FZB C;  2OYI B;  1FZC B;  2XNX A;  1RF1 C;  2FFD B;  2HLO A;  2JHI F;  1Z3S A;  4JYO X;  4ZFG A;  1N86 C;  1LWU A;  3E1I B;  3BVH B;  3GHG B;  1FZF A;  2WNP F;  2HPC A;  4R9T A;  1LT9 A;  2J64 A;  1RF0 B;  2OYI C;  1FZC C;  2J0Y A;  3FIB A;  2HLO C;  2JHH C;  4EPU A;  2HPC B;  1Z3U A;  3GHG A;  1RF1 A;  1FZB A;  2J0H A;  1JY3 O;  1T3U A;  3E1I A;  1FZE B;  1M1J C;  3H32 B;  2J3U A;  1FZG B;  3BVH C;  2J61 A;  1JY2 O;  2OYH A;  3H32 C;  4M7H A;  1N73 C;  2Q9I A;  2GY7 A;  1RE4 C;  2J5Z A;  2J60 A;  2HOD A;  1LWU C;  2J3O A;  1N73 B;  2Z4E B;  3GHG C;  1LTJ A;  3HUS A;  1RE3 B;  1JY3 N;  2JHL F;  2A45 G;  4JZC A;  2FIB A;  2H43 B;  1FZC A;  2OYI A;  2J61 B;  2JHK F;  2J2P A;  2H43 C;  2HOD C;  2Q9I B;  2HPC C;  1JC9 A;  1RE4 A;  1RE3 C;  1N73 A;  2Z4E C;  2D39 A;  2HOD B;  2Q9I C;  2J3F D;  1JY2 N;  4M7F A;  1RF0 A;  1JY3 P;  1LT9 B;  1FZB B;  1N86 B;  3E1I C;  1M1J A;  1LTJ C;  3HUS C;  1FZA A;  1FZE C;  2A45 I;  2J0G A;  4NYT A;  2HLO B;  1FZG A;  1FZF B;  1JY2 P;  1FZA B;  1LWU B;  3BVH A;  2J3G A;  2Z4E A;  2J1G A;  1M1J B;  4R9J A;  1N86 A;  1FID A;  1FZD A;  2H43 A;  1FIC A;  2JHM F;  2XNX C;  1FZE A;  1RE4 B;  2A45 H;  2FFD A;  1W2E A;  1RF1 B;  2XNX B;  1FIB A;  1FZF C;  1FZG C;  1RF0 C;  2OYH C;  3H32 A; 
#chains in the Genus database with same CATH topology
 1W2B O;  1EDK A;  5CHX A;  5DJU B;  1FE6 A;  1EC5 A;  1IJD B;  1FZC B;  3MTU E;  3FXE A;  3RK2 C;  2OTL P;  4NPD A;  2Q1K A;  1SQQ G;  2WSE J;  4JYO X;  2FYU G;  4PJ0 E;  3GHG B;  2YMK A;  2G8Y A;  3L72 D;  3JC2 2;  1T6A A;  3NFQ A;  4TLF A;  3A7O A;  3KYQ A;  2J0H A;  4PD4 H;  1QLE D;  3L75 J;  1LGH B;  2QM8 A;  1GDT A;  1FAV A;  1NU1 D;  2O01 N;  4Z1M H;  2DW3 A;  2O1K A;  4D6T J;  1N7S B;  1ZRT D;  1KB9 H;  3CX5 H;  2OYI A;  3CC7 P;  2AEM A;  2PRR A;  1URQ B;  1SQP J;  2H43 C;  2HOD C;  1SFC D;  2Q7C A;  1M56 D;  1S5L H;  3RK2 B;  4BRY B;  3M91 A;  2Y9Y A;  3Q3D A;  1UIX A;  2ITA A;  3HE5 A;  3IFM A;  1VL2 A;  2KLU A;  3RGU A;  2P67 A;  1SQB E;  1L0N K;  2H43 A;  1YTZ I;  2KK7 A;  2QRX A;  1BE3 D;  4UB6 E;  5AVY B;  4TT3 H;  1NU1 K;  3H1I E;  4OH8 B;  1E79 H;  1EDL A;  3M9Q A;  2WZ7 A;  2QE7 H;  3VTP C;  1FDI A;  1RF1 C;  1N7S C;  5C39 A;  2M0B A;  1L4A A;  2E75 B;  3BRV B;  3H1H E;  2FKW B;  1IFJ A;  3RL0 C;  3Q5P A;  2QJY C;  1SQV E;  4YTP C;  3H1K J;  1SQB D;  1AJY A;  4C7N B;  1FJK A;  1N7L A;  2VRS A;  2FYU K;  3O6Q B;  4A7P A;  1BE3 E;  2J58 A;  3MUD A;  2V7Q H;  1N73 B;  2MKV A;  3GHG C;  3CL3 D;  2JHL F;  1H8A A;  3D71 A;  1U7M A;  5AW7 B;  5AW2 B;  3T97 B;  2BAS A;  2KXP B;  2ZXX A;  1N73 A;  1CI6 A;  2HOD B;  3L74 E;  1NKZ B;  4M7F A;  3RK3 C;  3RK2 D;  5CCG C;  2N1T C;  1L0N D;  2J0G A;  2QA4 P;  2ZYA A;  1S72 P;  4IL6 X;  2Z4E A;  1WT6 A;  1USD A;  3G6E P;  1WMK A;  3B5N C;  3RBZ A;  5KLV J;  1MFZ A;  3E7K A;  4N6J A;  1LP1 A;  3RK3 E;  5E79 H;  5APX A;  3MP7 B;  3P8C D;  4BWN A;  2IZ1 A;  3EFF K;  2HR3 A;  2M3E A;  1AVY A;  1RE3 A;  1NO4 A;  4ZFG A;  1OMI A;  4ZKP A;  2HPC A;  2W6B A;  1S3J A;  1QEX A;  1VQ4 P;  1LTB C;  4L74 A;  1X8Y A;  3FIB A;  2KOG A;  1KYO D;  4M3L A;  1G1I A;  1JNM A;  3LIE A;  4ZKU A;  1W5C E;  3V2N A;  1OVV A;  2O01 J;  3LW5 H;  4H44 C;  2J60 A;  5APU A;  1SQV K;  1LTJ A;  1DEE G;  3JSV C;  1LNQ A;  1FZC A;  2V4H A;  2JKV A;  2E74 D;  4L75 A;  5GTI H;  1M57 D;  1KC8 Q;  4GKG A;  1R5S A;  2FYU J;  3L37 A;  1JY2 N;  1NOH A;  3H1J D;  1NTK J;  1JUN A;  1SQB G;  1EXJ A;  2K1A A;  3A0H H;  1BGY G;  3MZW B;  4JBZ A;  4EOT A;  2YKP A;  2V7Q J;  4OVN F;  5CJ4 A;  3FWN A;  1NTM G;  5AVS B;  1U7J A;  3CXH E;  2R3S A;  1VPC A;  5CJ0 A;  1SQB K;  2KNC A;  3H1L E;  4IOI H;  1GL2 A;  1ZME C;  2HFE D;  2YXQ B;  5APY A;  3KZI H;  3HUS B;  5E79 E;  4ASV A;  4IFD K;  3L36 A;  3BCC D;  5B66 E;  5AW5 B;  3U59 A;  3AEG C;  1N8R Q;  1KIL D;  2WPR A;  1H0T B;  4DT0 A;  1OFC X;  1M8O B;  3H1I D;  1X79 B;  3K5B A;  3NTN A;  3V2P A;  3CME P;  3BVH C;  1JY2 O;  1URQ A;  1S5L X;  2PGD A;  1BDC A;  3H1H J;  1NTK K;  2K9J A;  4Y99 B;  2WSF J;  4IL6 H;  2HOD A;  1NTM J;  2IFN A;  2QJY B;  3H25 A;  3TGU E;  1PP9 G;  2E43 A;  2FIB A;  1ZV8 A;  4YXD C;  1N2D C;  4DJG A;  4H0L D;  3AE6 C;  3OJA B;  2XND H;  4XA4 A;  3WUU A;  3HTK B;  4H0L B;  1N7S D;  2K88 A;  3OA7 A;  2ZXE B;  1JY2 P;  1FZA B;  3I5C A;  1YIJ P;  2WTY A;  1L0L J;  1OVU A;  3CCV P;  1RE4 B;  3L73 E;  4DCK A;  2KI7 B;  3N7N A;  5AW8 B;  2WMM A;  5H2F E;  2OYH C;  3D6Z A;  1NH4 A;  3L70 E;  3TGU D;  2IDB A;  3H1I G;  5APQ A;  2OGU A;  1VQM P;  2P1J A;  2LR2 A;  2CK3 H;  2QM7 A;  2AXT H;  1Z3S A;  5KLV K;  1NTM D;  4BXL A;  4C7N A;  5AW1 B;  1Q82 Q;  3H1H D;  2AXC A;  1LT9 A;  1KTM A;  1S4X A;  5CCG A;  3H1I J;  1FZB A;  4AUW A;  1HBW A;  1SQX G;  1FZE B;  4RJT A;  2XKM A;  5KAI E;  1GW3 A;  3TSI A;  1VQ9 P;  2GY7 A;  2FY8 A;  2J5Z A;  3A2A A;  1BSH A;  1YQ4 C;  3G9R A;  3ABV C;  1PPJ D;  1S1C X;  1GK6 A;  3S9O A;  3TDK A;  5AVU B;  2C0W A;  4PV1 B;  5AVZ B;  2UWJ E;  1PGQ A;  1IZN B;  3IF4 A;  3H1L G;  3CWB D;  2YIU C;  2YO3 A;  2IX7 C;  3FWL A;  4OGQ D;  4QMA A;  4AYC A;  2E76 D;  1FID A;  2KS1 B;  3HE4 A;  3CCU P;  1AFO A;  1R8E A;  2JHM F;  1SQP K;  1EZV G;  4JQ0 D;  1FIB A;  2I8D A;  1NTK D;  3H1J J;  1OVR A;  3H32 A;  2M5A B;  1JEK A;  2OYH B;  1GL2 C;  2C9N Y;  1EQ7 A;  2Y9Z A;  3WUT A;  3BRT B;  2W6J H;  3G71 P;  3I56 P;  1J1E B;  4WWI A;  1EXI A;  3MIW A;  4UB8 H;  5AVV B;  3MUD C;  1CW5 A;  1DD4 A;  1T2K D;  2JHH C;  2WSC J;  3GMA A;  1Q81 Q;  2OTK E;  1AVO A;  1FZG B;  2IBZ D;  1VQL P;  1M1K Q;  3WU2 H;  4RES B;  4HH2 A;  3V4W A;  2FXP A;  2GUV A;  2J3O A;  1GK4 A;  3OAK A;  1PL5 A;  1BCC D;  1VQ8 P;  1DX7 A;  2NPS A;  1NTZ J;  1YQ3 C;  3TNU B;  2A06 D;  1SQX K;  2K37 A;  3AEC C;  2J2P A;  3CX5 D;  5H2F H;  2AEF A;  2ZVO B;  2O1J A;  3A0B H;  1X22 A;  5KLV D;  5TIS H;  3L71 G;  5KAF H;  1YTZ T;  2M8R A;  3PHL A;  3P32 A;  5GTH E;  2WT7 B;  1L2P A;  1MV8 A;  3L70 G;  1DIP A;  1T3J A;  2A45 H;  1E5W A;  1S5L E;  3T97 A;  2GUS A;  2R32 A;  1SFC B;  1NWQ A;  1OW6 A;  3A3Y B;  3V6I A;  2FFD B;  1SQX D;  2JHI F;  4L73 A;  1K73 Q;  4PV1 D;  4I6M C;  3RBX A;  2QEX P;  1SQV D;  2BCC E;  5BU5 A;  1JTH A;  1KMI Z;  2J64 A;  2GA1 A;  1RF0 B;  2XV5 A;  3S4R A;  1RHZ B;  1YJ9 P;  3H1K D;  1T3U A;  2FYU E;  1M1J C;  3E1R A;  1N73 C;  1ZLL A;  2JJL A;  2KLV A;  1SVF A;  2ZFC A;  3LW5 J;  3U1A A;  1T8Z A;  2Y0E A;  5KJ7 A;  3R4Y A;  3L74 G;  3EWK A;  1PP9 E;  3CWB E;  4L76 A;  1YYC A;  2D39 A;  3L70 D;  1SQQ K;  2L91 A;  5TIS E;  3RL0 B;  3GW6 A;  2ZT9 D;  1BE3 J;  3QH9 A;  1HF9 A;  1L0N G;  3W68 A;  2A45 I;  1J1D B;  2KP8 A;  2XDJ A;  3BVH A;  1M7L A;  3HD7 A;  4LGD E;  1N86 A;  1BCC G;  2M5A A;  2NPS B;  4R4M A;  1VF5 C;  4LLH A;  3RK3 D;  2P10 A;  1KB9 I;  3KHU A;  2D2C B;  1PPJ G;  1Q90 D;  3L73 G;  1OWA A;  1JO5 A;  1LT9 C;  3R2P A;  2WSE H;  1YHQ P;  1FZA C;  2W6A A;  1LTG C;  3N4X A;  1RQU A;  2B87 A;  1YJN P;  4W7Y A;  2W90 A;  5KKZ B;  1EZV I;  4N3Y B;  3L70 J;  3CPW O;  1P84 H;  3Q2Y A;  1EDI A;  2WNP F;  1NU1 J;  3L75 D;  2A06 E;  2E5Y A;  1VQO P;  4EIJ A;  1NAY A;  1JY3 O;  2KB7 P;  5AVX B;  2J61 A;  1SQV G;  2NZ2 A;  4PD4 I;  4HB1 A;  1NVO A;  1YI2 P;  1RE3 B;  3TF5 A;  4JZC A;  2J61 B;  2JHK F;  3M9H A;  1FC2 C;  3L71 E;  4MN4 C;  4WY4 A;  1USE A;  2YXR B;  2O3J A;  5APT A;  2Q9I C;  1SQV J;  3OW2 O;  1P84 E;  1BGY E;  2WT7 A;  1D7M A;  3TYY A;  1FZB B;  1SQX J;  2W27 A;  1LTJ C;  3AE9 C;  4PD4 E;  1FZA A;  1SP4 A;  4NYT A;  2QJK C;  1LWU B;  1FDM A;  4ASW A;  1HVV A;  2QVA A;  3M0D A;  5AW6 B;  1EDJ A;  1CI6 B;  2NPS D;  3FX0 A;  2W8Z A;  1W2E A;  2ZAE B;  2ZYG A;  4XFJ A;  4I7Z B;  1KIL A;  1H0T A;  3GF7 A;  3II6 A;  4OWF A;  2RN0 A;  2XNX A;  3HE5 B;  3M9B A;  1K9M Q;  2IZ0 A;  3H1J E;  1RH5 B;  1BDD A;  2CPB A;  4UB8 E;  3GLM A;  2KS1 A;  3SWF A;  2KYV A;  2H8P D;  2C0X A;  1YJW P;  1FZC C;  1X9V A;  4PD4 D;  1NTZ D;  1BCC J;  2R44 A;  1HUC A;  3CD6 P;  5AVW B;  5L8R J;  2YKO A;  2YNY A;  2WQY C;  1LT1 A;  5APS A;  3L74 D;  4JYB A;  5CBO A;  2AEJ A;  3TGU G;  2FXM A;  3O8Z A;  1RE4 C;  2K9Y A;  3ZDM A;  1MKM A;  3HUS A;  1JY3 N;  3UIA A;  4I2L C;  1KB9 D;  1RE3 C;  1XTC C;  2E74 B;  4GT1 A;  2J3F D;  2NRG A;  3L73 J;  5BU8 B;  4I7Z C;  1N86 B;  3E1I C;  5B66 H;  5AVR B;  3L72 G;  2QG4 A;  1KN7 A;  3V2R A;  2QSI A;  4RKU J;  3B5N A;  3H1K G;  4DZO A;  1FZF B;  3SWK A;  4WB4 A;  3Q1M A;  3NMD A;  3TNU A;  2LXC B;  4KHX A;  3CCR P;  1MFT A;  1NTZ K;  2Q6Q A;  1VQ6 P;  3FXD A;  5AW3 B;  2CPS A;  4D6T G;  2JWA A;  2ZJS E;  3CWB J;  1L4A C;  3AEF C;  3U1C A;  1JTH B;  3CC4 P;  2ZYD A;  4ZNC A;  3MD0 A;  3F89 A;  1K8A Q;  4CPG A;  3A0B E;  2KIK A;  1NJI Q;  4H44 D;  3KDP B;  3H6P A;  4C46 A;  3F5H A;  1AA0 A;  2JEE A;  2BEZ F;  2BCC G;  2ZT9 B;  1J1D C;  3D6Y A;  4H13 B;  3VP8 A;  3AE2 C;  1NTK G;  1IFM A;  3AE7 C;  2XU6 A;  1FS0 E;  1ZR2 A;  3KQG A;  2A45 G;  4WVZ A;  4U3F E;  1PP9 J;  1N7S A;  1QX8 A;  1HJ0 A;  1JB0 J;  1OIP A;  1OX3 A;  3AEB C;  2IFM A;  3CWB G;  4WBA A;  1LT9 B;  1VF5 D;  1FU1 A;  5APW A;  4U3F J;  1K05 A;  3VYI A;  3PTZ A;  3TGU J;  5AW4 B;  3NXS A;  2PFX A;  5CCG D;  1EZV E;  2WPQ A;  2NPS C;  3V2Q A;  2ZT9 C;  5CMZ A;  3L71 J;  1KFM A;  1L0L D;  1Q2N A;  1A02 F;  3SFE C;  1DH3 A;  4WY4 D;  3G4S P;  1L0L E;  5GTH H;  1NGM B;  1G2C B;  1KFN A;  1PPJ E;  2J3F A;  1QVF O;  2GM4 A;  2I1J A;  5EFW B;  3IAO A;  1KQS O;  3HRN A;  5CCH D;  2I1K A;  2H89 C;  5K5G B;  2IBZ G;  4R9T A;  3AEA C;  2JDI H;  2B89 A;  1VQK P;  2YO2 A;  2M3B A;  3KZI E;  4BRY A;  2N1T B;  3V4Q A;  3IN6 A;  1HWT C;  2A06 G;  3CC2 P;  2R5D A;  1FDO A;  3H1L J;  2LXB A;  1SFC A;  1KOR A;  1KIL B;  4PV1 C;  2E42 A;  1LTT C;  3AE4 C;  3QWO C;  4KJM A;  3L72 E;  1PFI A;  3P7K A;  1URQ D;  2KUB A;  4H13 C;  1L4A D;  2BCC D;  1NHL A;  3WUV A;  1VDF A;  1RF0 A;  1GW4 A;  1ZW0 A;  1WRG A;  3CLQ A;  3BCC J;  5CCH C;  2D2C C;  1ZR4 A;  1Y47 A;  3BAS A;  2OAR A;  1LTI C;  2HLO B;  5TJH A;  1FZG A;  1NTZ E;  2IYO A;  2J1G A;  4R9J A;  1VQ5 P;  2OYO A;  3GF3 A;  3SWY A;  1FIC A;  5BVZ A;  5AVT B;  3G3Z A;  2FFD A;  3WU2 E;  1RF1 B;  2XNX B;  2K3R A;  3EFG A;  1ZN5 A;  2B87 B;  1J2J B;  1ZRT E;  2RMZ A;  2N1T D;  1SLQ A;  1MUU A;  2BEQ D;  4HYT B;  2R5B A;  1KYO I;  2H88 C;  2QIW A;  3B5N B;  3E1I B;  1N86 C;  4AQR D;  1GZL A;  2WIT A;  2FYU D;  1Z56 A;  4YXW H;  1FZF A;  3BVH B;  3EQ2 A;  2P2U A;  3C9I A;  2J0Y A;  3AE5 C;  2HPC B;  1BGY D;  1PZQ A;  3MHV A;  3E1I A;  3H32 B;  4EYY Q;  2OYH A;  1RY3 A;  3RK3 B;  1HJB A;  1AQT A;  5KAI H;  3B71 A;  2HG5 D;  5AW0 B;  3PP5 A;  3CCJ P;  2KZJ A;  4NPF X;  4K3A A;  1GMJ A;  1JCC A;  2Z4E C;  2Z5I A;  1UII A;  3L75 G;  1M1J A;  1GTW A;  2Q3I A;  5B5E H;  1FZE C;  1KYO H;  2E76 C;  3AE8 C;  4OGQ C;  1KZU B;  1VQN P;  3H1K E;  1M1J B;  2FYN C;  3P8C E;  3W67 A;  1H89 A;  3AEE C;  4I1L A;  2JWD A;  5CCH A;  4XE5 B;  4WY4 B;  1NYH A;  1YBK A;  1RQV A;  2IYP A;  3CXH H;  3ITK A;  2K9J B;  1K04 A;  5KLI B;  1QL2 A;  2IBZ E;  1L0N J;  3C1L A;  5KKZ C;  1OW7 A;  4LC1 A;  3IR9 A;  4IFF A;  4PJ0 H;  1LWU A;  4O9B A;  3AE1 C;  1SFC C;  3H1H G;  2AXT E;  3HD7 D;  2KSJ A;  3PJS K;  3VN0 A;  1TU3 F;  4IFM A;  5AVQ B;  4HJG H;  1VF5 B;  1RF1 A;  1BGY J;  4EDF A;  2B88 A;  2J3U A;  3CXH I;  3CCM P;  1Y9B A;  1IFP A;  5CBN A;  3H32 C;  2E75 D;  1JCD A;  1PV3 A;  1KD1 Q;  1SQB J;  3AED C;  1X0T A;  2HPC C;  4U3F G;  1R5L A;  1MZ9 A;  3SFD C;  3GG2 A;  4GIF A;  1JY3 P;  1NTZ G;  1FOS E;  2RH0 A;  3A5T A;  2YKQ A;  3HD7 B;  1NU1 E;  4YPC A;  4EI2 A;  1VQ7 P;  1GL2 D;  4NPE A;  1SQP E;  4DOJ A;  2J3G A;  5KJ7 C;  3VMX A;  4JYC A;  5KAF E;  1L0N E;  3BCC E;  1PGO A;  1AV1 A;  2WPV B;  3WMM 0;  2SPZ A;  3C8V A;  1KIL E;  5KJ7 D;  3I55 P;  2BCC J;  1BCC E;  1LTA C;  1M90 Q;  1J1E C;  4GOE A;  3PH0 A;  4H0L C;  1LTJ B;  2FFD C;  1SQQ E;  1FZB C;  4JF7 A;  3AE3 C;  2Q3E A;  1DD3 A;  2HYN A;  2PAJ A;  3L4F A;  1FOS F;  3JCU H;  4JPZ B;  1L4A B;  3H1L D;  2FYN B;  4GOF A;  4Y99 C;  2WSC H;  1SQP D;  2ZVN B;  4RO0 A;  3CMA P;  1Z3U A;  3GHG A;  4Y28 J;  1QGK B;  4D6T D;  1IO4 A;  3SSU A;  4B86 A;  2MJZ A;  4M7H A;  2E75 C;  2FYZ A;  2N9B A;  2YIU B;  2Z5H A;  2Z4E B;  1OXZ A;  3VOP A;  2IPP A;  1S9K E;  3L75 E;  2OQQ A;  1P84 I;  1EZV D;  3L72 J;  1LP1 B;  1PIX A;  4OGQ B;  3LID A;  2E76 B;  2Y0C A;  3TK1 A;  2N1T A;  3A0H E;  3HUS C;  1L0L K;  3L71 D;  1NAF A;  5KLV G;  3RL0 g;  2H7H A;  2OTJ P;  4K35 A;  1FJP A;  3VMY A;  5GTI E;  2E5T A;  1SS1 A;  3FGA D;  1QL1 A;  1KYO E;  2WWW A;  5B5E E;  4W80 A;  1QVG O;  2D2C D;  1KQF B;  4UB6 H;  3M06 A;  4U3F D;  3CI9 A;  1NKN A;  3HE4 B;  3CXH D;  1S9K D;  2WVR A;  2W83 C;  1NTM K;  1GU5 A;  2N9Y B;  2Q5U A;  1BSN A;  1IFN A;  1ZP0 C;  1URQ C;  4H13 D;  3O6Q A;  4N78 D;  3CCQ P;  2L5G B;  1PP9 D;  2FXO A;  2OYI B;  2QJP C;  1GL2 B;  1KV4 A;  1Y8A A;  1H88 A;  3CCS P;  4GDO A;  2J5U A;  1SQX E;  1G1J A;  2PP6 A;  2IBZ I;  1Q7Y Q;  2KSE A;  3KXD A;  5AW9 B;  2OYI C;  2HLO C;  3H1J G;  4EPU A;  1NTK E;  3BAT A;  1SQQ D;  2POH A;  1CSB A;  3B4S A;  1IFI A;  4HKZ H;  2QJK B;  3CX5 I;  2Q9I A;  5APV A;  1LWU C;  1Q86 Q;  1FBM A;  5KLI C;  1IK9 A;  3PLN A;  1NU1 G;  2Q9I B;  4GOD A;  2J59 M;  4WY4 C;  3JCU E;  2B9B A;  1SQP G;  1KIL C;  5M1B A;  1OW8 A;  1ZXG A;  1DEB A;  3BCC G;  3M0D C;  1GD2 E;  3VMZ A;  1IK7 A;  3D70 A;  1FZD A;  2O01 H;  3PRJ A;  1A02 J;  1FZE A;  5KTB A;  1CZQ A;  1KQL A;  1L0L G;  2WSS H;  3V5B A;  1FZF C;  1ZOY C;  3L73 D;  1LJ2 A;  1PGJ A;  4U7J A;  1OZH A;  4W7Z A;  1JM0 A;  4D6T E;  2HLO A;  1PGP A;  1P84 D;  1JMM A;  1JOC A;  1GU4 A;  3P8M C;  2LKM A;  2R3C A;  3L74 J;  2JO1 A;  3S1K A;  2E74 C;  2P7J A;  1HGZ A;  3KPE A;  1HTL C;  2WSF H;  1KB9 E;  1XTG B;  3HD7 C;  3MGN A;  3CCE P;  4KT0 J;  4IL6 E;  1S2E A;  3RL0 D;  1JMB A;  2G3A A;  2QJP B;  1G2C A;  1SQQ J;  2Y0D A;  2H43 B;  3L35 A;  3M0A A;  2XZR A;  1HGV A;  1T2K C;  1U57 A;  1BE3 G;  2JP3 A;  5KLV E;  1JC9 A;  1RE4 A;  2KNC B;  2P58 A;  1HH0 A;  2KZI A;  1IC2 A;  1KQG B;  4ZMD A;  2JR8 A;  3USS A;  2FBW C;  3B8E B;  1YIT P;  1NTM E;  1AQ5 A;  4C7R A;  2YMY A;  3HTK A;  5DJT B;  1LTS C;  3VMA A;  1IFD A;  4H44 B;  3Q5R A;  4N78 E;  2WPS A;  3CCL P;  1VQP P;  3CX5 E;  2C9L Y;  2RKL A;  2XNX C;  3Q5S A;  3B5N D;  3VP9 A;  1FZG C;  1RF0 C;  4R4L A; 
#chains in the Genus database with same CATH homology
 5CHX A;  1QL2 A;  3II6 A;  5APQ A;  1IJD B;  1FZC B;  2XNX A;  2P1J A;  3MTU E;  3HE5 B;  3M9B A;  3RK2 C;  2QM7 A;  4LC1 A;  3IR9 A;  2CPB A;  1Z3S A;  5KLV K;  4JYO X;  4IFF A;  4C7N A;  5AW1 B;  1LWU A;  4O9B A;  2KYV A;  3GHG B;  3SWF A;  2H8P D;  1SFC C;  1LT9 A;  2C0X A;  3HD7 D;  2KSJ A;  3NFQ A;  1FZC C;  1X9V A;  3A7O A;  3VN0 A;  4IFM A;  5CCG A;  5AVQ B;  1RF1 A;  1HUC A;  1FZB A;  5AVW B;  3KYQ A;  4AUW A;  2J0H A;  1HBW A;  1FZE B;  2YKO A;  2YNY A;  2J3U A;  1LGH B;  2XKM A;  2QM8 A;  1GDT A;  5APS A;  4JYB A;  1FAV A;  1GW3 A;  3TSI A;  3H32 C;  1JCD A;  2FXM A;  3O8Z A;  2GY7 A;  1RE4 C;  2J5Z A;  2O1K A;  1N7S B;  3A2A A;  3HUS A;  1JY3 N;  3UIA A;  2OYI A;  1URQ B;  4I2L C;  2H43 C;  2HOD C;  2HPC C;  1RE3 C;  1XTC C;  1SFC D;  1MZ9 A;  4GT1 A;  2Q7C A;  2J3F D;  3RK2 B;  1GK6 A;  4GIF A;  1JY3 P;  5BU8 B;  1FOS E;  3M91 A;  1N86 B;  3E1I C;  5AVR B;  3A5T A;  2YKQ A;  3HE5 A;  5AVU B;  3IFM A;  2C0W A;  3HD7 B;  3V2R A;  5AVZ B;  1KIL A;  3B5N A;  4DZO A;  1GL2 D;  1FZF B;  4DOJ A;  2J3G A;  2YO3 A;  4WB4 A;  2IX7 C;  2P67 A;  4AYC A;  1L0N K;  3NMD A;  3TNU A;  4KHX A;  5KJ7 C;  3VMX A;  1FID A;  4JYC A;  2H43 A;  3HE4 A;  1YTZ I;  1AFO A;  1NTZ K;  2JHM F;  3WMM 0;  1SQP K;  5AW3 B;  2CPS A;  5AVY B;  1FIB A;  5KJ7 D;  1NU1 K;  4OH8 B;  3H32 A;  1LTA C;  1L4A C;  1J1E C;  3U1C A;  2OYH B;  1LTJ B;  1GL2 C;  1JTH B;  3M9Q A;  2WZ7 A;  2FFD C;  2C9N Y;  3VTP C;  1EQ7 A;  1FZB C;  3BRT B;  1RF1 C;  3MD0 A;  1N7S C;  4JF7 A;  1L4A A;  1J1E B;  2HYN A;  3BRV B;  3KDP B;  2PAJ A;  3H6P A;  2FKW B;  3MIW A;  4C46 A;  1IFJ A;  3RL0 C;  3L4F A;  5AVV B;  1FOS F;  2JEE A;  1L4A B;  4Y99 C;  2WSC H;  1CW5 A;  1J1D C;  1T2K D;  2JHH C;  1Z3U A;  3GHG A;  3VP8 A;  4C7N B;  1FJK A;  1N7L A;  2VRS A;  1IFM A;  2FYU K;  1IO4 A;  1FZG B;  4B86 A;  2MJZ A;  4M7H A;  4RES B;  4HH2 A;  2FYZ A;  2N9B A;  2XU6 A;  3V4W A;  2J58 A;  2GUV A;  2Z5H A;  3MUD A;  2J3O A;  1N73 B;  1GK4 A;  1OXZ A;  2Z4E B;  3VOP A;  2IPP A;  3GHG C;  1S9K E;  3OAK A;  1ZR2 A;  3CL3 D;  2JHL F;  3KQG A;  2A45 G;  1H8A A;  1DX7 A;  2NPS A;  3TNU B;  1SQX K;  1N7S A;  5AW7 B;  2J2P A;  5AW2 B;  2BAS A;  3LID A;  1CI6 A;  1N73 A;  3TK1 A;  2HOD B;  1NKZ B;  2IFM A;  4WBA A;  4M7F A;  1LT9 B;  3RK3 C;  2N1T A;  1FU1 A;  5APW A;  2O1J A;  3HUS C;  1L0L K;  3RK2 D;  1NAF A;  1YTZ T;  2N1T C;  5CCG C;  3VYI A;  2H7H A;  2M8R A;  2J0G A;  3BVH B;  5AW4 B;  3P32 A;  1FJP A;  3VMY A;  2WT7 B;  2Z4E A;  1WT6 A;  3NXS A;  1QL1 A;  1MV8 A;  5CCG D;  2WWW A;  2WPQ A;  2NPS C;  4W80 A;  1T3J A;  3V2Q A;  3B5N C;  5CMZ A;  3M06 A;  3CI9 A;  1MFZ A;  1KFM A;  1NKN A;  2A45 H;  1E5W A;  3HE4 B;  4N6J A;  1S9K D;  3T97 A;  1NTM K;  1GU5 A;  5APX A;  1A02 F;  2GUS A;  1DH3 A;  4WY4 D;  3P8C D;  2Q5U A;  2R32 A;  1SFC B;  1IFN A;  1URQ C;  1G2C B;  1KFN A;  2J3F A;  4N78 D;  1RE3 A;  1NWQ A;  3A3Y B;  2I1J A;  2GM4 A;  2L5G B;  2OYI B;  1NO4 A;  1GL2 B;  3HRN A;  2FFD B;  5CCH D;  2JHI F;  1H88 A;  4I6M C;  2I1K A;  4ZFG A;  1G1J A;  4ZKP A;  5BU5 A;  2PP6 A;  1JTH A;  2HPC A;  4R9T A;  2W6B A;  3E1I B;  2J64 A;  1LTB C;  1RF0 B;  2XV5 A;  1X8Y A;  5AW9 B;  2OYI C;  3FIB A;  2KOG A;  2HLO C;  4EPU A;  4M3L A;  1G1I A;  3BAT A;  2YO2 A;  1JNM A;  2M3B A;  3LIE A;  2N1T B;  3V4Q A;  2POH A;  1T3U A;  4ZKU A;  1M1J C;  1CSB A;  1HWT C;  3V2N A;  1IFI A;  2R5D A;  3LW5 H;  1N73 C;  1ZLL A;  2Q9I A;  1SFC A;  5APV A;  1KIL B;  2JJL A;  2KLV A;  2J60 A;  5APU A;  1LWU C;  1SVF A;  2ZFC A;  2E42 A;  3U1A A;  1SQV K;  1LTT C;  1LTJ A;  1T8Z A;  1FZC A;  1FBM A;  1PFI A;  1IK9 A;  5KJ7 A;  3P7K A;  2Q9I B;  1URQ D;  1L4A D;  1YYC A;  2J59 M;  4WY4 C;  4GKG A;  3L37 A;  2D39 A;  1NHL A;  1JY2 N;  1KIL C;  1VDF A;  1SQQ K;  1NOH A;  1RF0 A;  1GW4 A;  3RL0 B;  1JUN A;  1WRG A;  3CLQ A;  5CCH C;  4EOT A;  1ZR4 A;  1DEB A;  2YKP A;  3M0D C;  1GD2 E;  2A45 I;  3BAS A;  2OAR A;  1LTI C;  3VMZ A;  5CJ4 A;  2HLO B;  1J1D B;  1FZG A;  2KP8 A;  2XDJ A;  3BVH A;  1M7L A;  5AVS B;  2J1G A;  3HD7 A;  4LGD E;  4R9J A;  1N86 A;  1VPC A;  1FZD A;  2NPS B;  2O01 H;  5CJ0 A;  1SQB K;  3SWY A;  1FIC A;  1A02 J;  5BVZ A;  5AVT B;  3G3Z A;  1FZE A;  5KTB A;  1CZQ A;  4LLH A;  3RK3 D;  1GL2 A;  1KQL A;  2FFD A;  2XNX B;  3V5B A;  1RF1 B;  1FZF C;  3EFG A;  2HFE D;  1ZN5 A;  1OWA A;  1JO5 A;  1LT9 C;  3R2P A;  2WSE H;  5APY A;  4W7Z A;  1J2J B;  3HUS B;  1FZA C;  4IFD K;  2W6A A;  3L36 A;  1LTG C;  2N1T D;  1SLQ A;  1MUU A;  3N4X A;  4HYT B;  2HLO A;  2R5B A;  4W7Y A;  5AW5 B;  1JMM A;  4N3Y B;  1JOC A;  3U59 A;  3B5N B;  1GU4 A;  3P8M C;  1N86 C;  1KIL D;  1GZL A;  2WIT A;  4AQR D;  1Z56 A;  1FZF A;  2LKM A;  2WNP F;  2WPR A;  2R3C A;  3EQ2 A;  2P2U A;  3C9I A;  2J0Y A;  2P7J A;  1HGZ A;  2HPC B;  3KPE A;  1HTL C;  1X79 B;  2WSF H;  4EIJ A;  1XTG B;  3NTN A;  1JY3 O;  3E1I A;  3V2P A;  3HD7 C;  3MGN A;  3H32 B;  2KB7 P;  5AVX B;  3BVH C;  2J61 A;  1JY2 O;  1URQ A;  2OYH A;  1RY3 A;  3RK3 B;  3RL0 D;  1NTK K;  4Y99 B;  1HJB A;  2HOD A;  1G2C A;  2IFN A;  1RE3 B;  2HG5 D;  5AW0 B;  4JZC A;  3PP5 A;  2E43 A;  2FIB A;  2H43 B;  1ZV8 A;  2J61 B;  2JHK F;  3L35 A;  3M0A A;  2XZR A;  3M9H A;  1HGV A;  1N2D C;  1T2K C;  1JC9 A;  4WY4 A;  1RE4 A;  3OJA B;  1JCC A;  4XA4 A;  2Z4E C;  2Z5I A;  5APT A;  2Q9I C;  2WT7 A;  1HH0 A;  1IC2 A;  3TYY A;  1FZB B;  3HTK B;  1M1J A;  2W27 A;  1GTW A;  1LTJ C;  2Q3I A;  1FZA A;  1FZE C;  1N7S D;  1SP4 A;  3B8E B;  1AQ5 A;  3OA7 A;  4C7R A;  2YMY A;  3HTK A;  4NYT A;  2ZXE B;  1JY2 P;  1LTS C;  1FZA B;  1LWU B;  1FDM A;  1IFD A;  1KZU B;  3I5C A;  4N78 E;  1M1J B;  2WTY A;  2WPS A;  1HVV A;  3P8C E;  2C9L Y;  1H89 A;  2XNX C;  4I1L A;  3M0D A;  5AW6 B;  3B5N D;  3VP9 A;  1RE4 B;  1CI6 B;  2NPS D;  5CCH A;  1W2E A;  4XE5 B;  4WY4 B;  3N7N A;  5AW8 B;  1FZG C;  1RF0 C;  2OYH C;  1NH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...