1LT9C

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9C02
1FZAA 1JY2N 2GY7A 1LWUB 1M1JC 1FZFA 2JHHC 1LTJA 1LT9A 2J3GA 2OYHB 1FZCA 1FZBB 1FIDA 3BVHB 1RE4C 1JY3P 1FZEB 1RF1C 3E1IB 2Q9IC 1FZDA 3FIBA 2FFDB 2JHKF 1LWUC 1RE4A 1N86B 3H32B 1RF1A 2HODB 2Q9IA 2J0HA 2J3UA 2HLOB 1LWUA 2H43B 1N73B 2J0GA 1JY2O 2HPCB 1FZEC 1JC9A 1RE3B 1N86C 1FZGB 1JY3N 1FZEA 3H32C 2J64A 2JHMF 2JHLF 2J5ZA 2J3OA 2HLOC 2XNXB 3HUSB 1N86A 1FZAB 3H32A 3GHGB 2HPCC 2J60A 2A45H 2OYIB 1FZFB 2OYHC 1LT9B 1FZBC 1Z3UA 2HLOA 1FICA 3BVHC 1RE3C 1FZGC 1M1JB 2HPCA 4JYOX 2Z4EB 2FIBA 4ZFGA 2OYHA 3E1IC 4R9TA 1FZBA 2FFDC 1T3UA 3BVHA 1RE3A 1FZGA 3GHGC 4M7HA 2J3FA 1RF0B 3E1IA 1JY3O 2OYIC 2HODC 4EPUA 2J1GA 2FFDA 2J61B 1JY2P 2H43C 1N73C 3GHGA 4JZCA 1W2EA 2HODA 2OYIA 2Z4EC 1LTJB 2WNPF 2JHIF 4NYTA 1FIBA 1FZCB 2J0YA 2H43A 1N73A 1M1JA 2Z4EA 1RF0C 1Z3SA 2A45I 4M7FA 2XNXC 3HUSC 1FZAC 2A45G 1RE4B 2J3FD 1RF0A 1FZFC 1LTJC 1LT9C 1RF1B 2D39A 2Q9IB 2J2PA 1FZCC 4R9JA 2XNXA 2J61A 3HUSA
chains in the Genus database with same CATH superfamily
1VQNP 1X9VA 1ZLLA 2O01H 2WSCH 1CW5A 1YITP 2Z5HA 3E1IB 5GTHH 2B87B 1G2CA 3R4YA 3I55P 3FIBA 1JMBA 3C9IA 3GF3A 2HLOB 3L73D 2FYNC 1MV8A 1HUCA 3M9QA 2JHMF 2JHLF 4Y99C 1W2BO 4C7NB 1NAYA 1GL2C 1SQQD 2YIUB 3Q5SA 4H44C 1L0NJ 4ZFGA 2OYHA 1SFCA 2W27A 1NTKK 2JP3A 2Q5UA 2KS1B 3L72G 2WPRA 1KILA 2FYUD 2J61B 5CCGC 1N73C 1HTLC 3PLNA 3L71G 2I1JA 2OARA 2YKOA 2KSEA 5AW2B 5KJ7A 4MN4C 4N78E 1HVVA 3PP5A 1KYOI 2FYUK 2KNCA 3BCCJ 2YXRB 1VQKP 2WPVB 2PFXA 1FZFA 3CWBJ 5AW9B 3CCRP 1AVOA 3MP7B 3K5BA 3GMAA 3RK2D 2G8YA 3BCCE 4WY4C 1BSNA 3L37A 4HKZH 3CWBE 1MFTA 2Z5IA 5AW4B 1RE3B 2IYPA 5KAFH 3IAOA 1NTMD 2ZFCA 4PV1D 1NAFA 1M57D 5AW3B 1NKNA 5AVQB 3B8EB 3P8CD 1QL1A 3PTZA 3ABVC 2IPPA 1SQBD 2XU6A 4D6TJ 3FWLA 1GL2A 3E1IC 2AEFA 1R5SA 2K37A 5AVUB 1NTMK 3LW5H 1FBMA 2P67A 1KORA 3BRVB 3M91A 3AECC 1VF5D 2ZVNB 1SQBK 5CCGA 1N73A 4D6TE 2IDBA 1S5LX 1BCCD 2M0BA 4GDOA 1SQXJ 2NPSD 1LTJC 1VF5B 1FZCC 1M7LA 2XV5A 3CPWO 5AW1B 3L75J 1DH3A 1LTSC 2YKPA 2QJYC 1FZBB 3V5BA 1ZRTE 3A7OA 2M5AB 1VQLP 4L75A 3PRJA 1A02J 3SWFA 1K05A 1SQXE 1P84H 1OZHA 5C39A 3CCUP 1VQ5P 3P7KA 1GW3A 4U3FJ 2W6AA 5AVVB 2E75D 4PD4E 1JC9A 1L0LG 3HTKB 1OWAA 2KZIA 3RK3D 1SQVJ 1H89A 2Y0DA 1URQD 1H0TA 1PP9J 3G71P 1LT9B 1L0ND 2E75B 1K8AQ 4AQRD 1FZGC 2G3AA 1M1JB 4U3FE 2FIBA 3O8ZA 4N78D 2KYVA 2D2CD 3AE4C 1FDMA 2GM4A 3E1IA 3V2RA 1SQVE 1BDDA 1ZR2A 2Z4EC 1PFIA 1L0NK 2H7HA 2HR3A 1PPJE 5AW5B 1YQ4C 1U57A 1Z3SA 1P84D 5BU8B 4JYCA 5AVXB 3BCCD 3CMEP 2D39A 4JYBA 2C0XA 4C7NA 1OVVA 3LIEA 3AEDC 1LTJA 5KLVG 1FZCA 1NTZG 1VQ4P 1RE4C 4PV1C 2N1TD 3AE1C 4IL6E 4YTPC 1FDIA 2KS1A 3MIWA 1W5CE 1NJIQ 1S4XA 1S5LE 1FJPA 5AW8B 3GG2A 2WSEJ 1R8EA 3G6EP 2R44A 1DX7A 1AFOA 3L74G 1AQTA 4AUWA 1KB9E 1SFCB 2Y9YA 3B5ND 1N7SD 4W7YA 1RHZB 3EFGA 1LTAC 2J5UA 1VF5C 3CX5E 3VP8A 3NTNA 2J3OA 2M3EA 1NO4A 2W6JH 2LR2A 1JTHB 1M8OB 1NU1J 1FZBC 4D6TD 1FICA 2GUVA 3B5NB 3MD0A 3SFDC 1PGQA 2E74B 1OFCX 3MGNA 1KQSO 1FZGA 1NTKJ 4W7ZA 3H1IJ 2KNCB 1BE3G 2WVRA 4XA4A 3AE6C 1FC2C 4UB8H 1AVYA 1NVOA 4HYTB 1ZRTD 2IBZD 3VMYA 2Z4EA 3W67A 1SQXD 3L73E 2CPSA 2OQQA 2A45I 3O6QA 3CXHI 2OGUA 1LT9C 2ZAEB 3H1IE 2RH0A 2Q1KA 2E75C 4R9JA 2FYUJ 4I7ZC 3L75D 1M1JC 3U59A 3E1RA 4PD4D 4ZKPA 2O01J 4AYCA 1KN7A 1JCDA 3KZIE 5B66E 1IK9A 2WITA 2WSCJ 2GA1A 1GK6A 2GUSA 5CBOA 1URQC 1Y47A 3VMAA 3WU2H 1LP1A 5M1BA 3L70J 1RE4A 3HD7D 1IFJA 2W90A 1KV4A 4Y99B 1YHQP 3MTUE 4U3FD 2FYUE 2L91A 2JDIH 1PGJA 1E79H 1SP4A 2OTKE 2KOGA 3CCJP 1SQVD 3NXSA 5GTHE 2QE7H 4Y28J 3V2PA 1A02F 1PP9D 2OYOA 2HPCC 2PGDA 2BEZF 1YTZT 1PPJD 2XZRA 1GD2E 1LTGC 2E5YA 5TISH 4JYOX 1ZXGA 3VOPA 3CC2P 1FZBA 1SQPG 2M5AA 2NPSA 1VPCA 1NTMJ 3Q3DA 1KZUB 2N1TC 2POHA 3MUDC 1VQ7P 2ZYDA 2BCCJ 3F5HA 1VQ8P 2YNYA 1SQBJ 4DCKA 5AW7B 2QJKC 1KTMA 3VP9A 1FE6A 2R32A 2P1JA 2JKVA 2A45G 1IFMA 1Q7YQ 2V7QH 1NTME 1OX3A 2IZ0A 3B5NC 1N7SC 2R3SA 2QM8A 1LT9A 1YJWP 3HE4A 4WWIA 1SQBE 3QWOC 1URQA 3S1KA 1H0TB 5APTA 2N9BA 2QJPC 2KLUA 1N7LA 1OW6A 1S2EA 1R5LA 1TU3F 2JWDA 2JWAA 2P2UA 1T2KD 2SPZA 3CCSP 3FX0A 3TNUA 5H2FH 3H1KG 1KB9I 2J5ZA 3LIDA 1BCCE 1FZAB 3Q5RA 1ZN5A 4EI2A 1NU1D 3CX5I 2VRSA 4JBZA 3H1LJ 2HPCA 5AVRB 2IFNA 1NTKD 1J1EB 4K35A 3H1ID 5KAFE 3LW5J 3L35A 1QEXA 1JM0A 1Q86Q 1Y8AA 3M9HA 3N4XA 2RKLA 3H1HG 3NFQA 1NU1K 1GTWA 1MKMA 1LTJB 1DIPA 1FZCB 4R4MA 2H8PD 3H1JJ 3HD7C 2N1TA 3MUDA 1RF0C 2P10A 3JCUH 4M3LA 3Q2YA 4YPCA 2QJYB 5CMZA 2C9LY 1LTTC 2ITAA 4I2LC 1LJ2A 5AVWB 2J2PA 5AVSB 4LC1A 4DT0A 3TDKA 3RK3E 1JTHA 1HBWA 3UIAA 1L0NE 2WWWA 3B5NA 1N7SA 1FIDA 1QL2A 3H1JE 2QSIA 1PL5A 3L70D 1BGYG 1M56D 1G1JA 5K5GB 1YTZI 2JEEA 1AV1A 4BWNA 4H13D 4WVZA 2JR8A 3G3ZA 1FZGB 4JPZB 5CHXA 3CCMP 1YQ3C 3V2NA 1P84E 2IZ1A 1J1DB 2A06E 4H13B 3D6YA 2Z4EB 2WT7A 2QA4P 4R9TA 3O6QB 1Q82Q 1L0LK 3AEGC 1OMIA 4TLFA 3RK2B 3WUUA 2QEXP 4EIJA 1YJNP 2J1GA 3CI9A 2WSSH 1VDFA 1IFIA 4GIFA 5AW6B 2WZ7A 2BCCD 2WSFH 5KAIH 4DJGA 3II6A 3TGUJ 4BRYB 1LP1B 4LLHA 1X22A 1FZAC 4PV1B 5KLIC 2KZJA 3HD7A 1RE4B 1RF0A 1H8AA 1KFMA 1T2KC 1D7MA 1JY2N 3B71A 3OW2O 3L73G 3KXDA 4Z1MH 3D71A 2ZT9D 1J1EC 3BVHB 3A0HH 2FFDB 1LWUC 2KXPB 2C0WA 3FXEA 2FXMA 1SQQG 2HODB 1WT6A 2ZT9B 1PV3A 2J0GA 1EDKA 3AE2C 5KLVK 2IBZE 2NPSB 1N86C 1JY3N 3TYYA 3GW6A 3AE8C 1VQ9P 3KPEA 1HWTC 3HUSB 1GU4A 1HGZA 1DEBA 4TT3H 4PJ0H 1EDJA 3H1LD 1GDTA 3L75E 1XTGB 2HG5D 2J58A 1GK4A 3AEEC 1K04A 1LTBC 2OYIC 4U7JA 1S3JA 3B4SA 1KQFB 2IFMA 1BE3D 1NOHA 4JZCA 3N7NA 2R5DA 2JHIF 4L76A 2NZ2A 3HE4B 1SVFA 3H1JD 4I7ZB 3HE5A 3RL0D 4YXDC 1YJ9P 3EWKA 3RK3B 1URQB 4BXLA 1J1DC 2OTJP 2FBWC 4H13C 3L72J 1UIIA 1GMJA 1FZAA 4H0LD 2W6BA 1PP9E 3TSIA 3RBZA 4UB8E 3IFMA 3RL0B 3L71J 2D2CB 2PP6A 1ZR4A 3RK2C 4XE5B 3TNUB 5APQA 2Q9IC 2A06D 3L72E 3CXHH 2J59M 2QIWA 5AW0B 1LWUA 1SQBG 1JCCA 2HPCB 3QH9A 3A0BH 3D6ZA 5DJTB 2R3CA 2K9YA 2KUBA 3WU2E 5AVTB 3CC4P 1N86A 3CCVP 4W80A 4L74A 2Q3EA 1VQOP 1DEEG 1Z3UA 1NYHA 5APXA 3BVHC 1S9KD 1P84I 1CI6A 2N1TB 3L36A 1BCCG 2FFDC 4IFDK 3G4SP 2HODC 2QJKB 3G9RA 3A3YB 2ZT9C 3PJSK 1M1KQ 4HH2A 2HYNA 3BASA 2OYIA 4CPGA 1NHLA 4NYTA 1IFDA 3RGUA 2NPSC 1N7SB 5TISE 1OW8A 3S9OA 3TGUD 2I1KA 1HF9A 4M7FA 1SQPK 3HUSC 3BATA 1H88A 1LTIC 1EZVD 4RJTA 4K3AA 1VL2A 2V7QJ 1USDA 3KYQA 2ZXEB 2QJPB 1NU1E 2P7JA 1OXZA 1RH5B 2LKMA 4ASWA 1ZMEC 2QRXA 4EOTA 1NTKE 3CL3D 4HB1A 4C7RA 1RY3A 1LGHB 2Q9IA 1L0NG 2W8ZA 3V4QA 1SLQA 1JY2O 2WT7B 3NMDA 1JUNA 3RK3C 3T97A 1EC5A 3L4FA 3H32C 1T3JA 4BRYA 1J2JB 1LNQA 1YI2P 1YYCA 2IBZI 2KB7P 3VMXA 2JJLA 3RL0C 2O1KA 2D2CC 4N3YB 1Z56A 2K9JA 5GTIH 5APVA 4H44D 3BVHA 1L0LJ 3HD7B 3FWNA 1RF0B 4JF7A 1JY3O 1T6AA 5H2FE 3BCCG 3I56P 2K3RA 3L70E 4PD4I 2FFDA 2O3JA 2LXBA 4OGQD 3CWBG 2HODA 2AXCA 2AXTH 2V4HA 1K73Q 1G1IA 2Y9ZA 4IFFA 1EDLA 3CCLP 1L0LE 3L72D 2K1AA 2C9NY 5APSA 3HUSA 1N8RQ 3IR9A 2B9BA 3RL0g 3L71D 3VMZA 1PZQA 1ZOYC 3Q1MA 1QVGO 3JCUE 1L4AD 3CLQA 4DOJA 1WMKA 1ZW0A 3W68A 2J3UA 4D6TG 5APYA 1FZEC 1L4AB 5KLVJ 2BCCE 1KQGB 2M8RA 4WY4D 1NTZJ 2WPQA 1NH4A 5KKZB 2L5GB 3SWYA 2E76D 3H32A 3OA7A 1EXIA 2BASA 3P8MC 3V4WA 1K9MQ 3HE5B 1KYOH 3L74J 1SQXG 4ZMDA 1SS1A 1DD4A 5KLVE 1HGVA 2Y0EA 5AVYB 3GHGC 2E76B 1QGKB 2Q3IA 5B5EH 2KI7B 1JY2P 3L75G 5KLIB 3M0DA 1CZQA 2WSFJ 3USSA 2HFED 3PHLA 3L74E 2Y0CA 4RO0A 2WPSA 4IFMA 1PIXA 3EFFK 4U3FG 1RQVA 2XKMA 1BE3J 1LWUB 4LGDE 2J3GA 1OW7A 5KAIE 3H1LE 1JY3P 4GOEA 1SQVG 2W83C 1PP9G 2E43A 1KD1Q 1N86B 3CMAP 4IOIH 1GZLA 1PPJG 1YBKA 5DJUB 3C1LA 1BE3E 2O1JA 1KYOD 2H43B 1CI6B 2DW3A 1IO4A 3U1AA 1FZEA 4OGQC 2IX7C 3A0HE 2OYIB 1SQQK 1OIPA 1QVFO 1IC2A 2NRGA 5E79H 3VYIA 1L0LD 1RQUA 4UB6H 1E5WA 1IFNA 3IN6A 3GHGA 2CPBA 3AE3C 4PJ0E 2YKQA 1L4AC 1IZNB 5KKZC 1FOSF 3JSVC 1SQPJ 1IJDB 2J3FD 2Q9IB 3KHUA 1EXJA 4O9BA 4ASVA 1GW4A 2RMZA 3T97B 5CCHD 1JB0J 3WMM0 2E76C 1BDCA 3A2AA 1S9KE 1RF1C 1BSHA 1KQLA 1SQPE 2MKVA 1NWQA 1NU1G 3V6IA 2BEQD 3WUTA 1KILE 3AE9C 2FY8A 3M0AA 4N6JA 3FXDA 5KLVD 2K9JB 1EQ7A 1NTZD 1NTKG 1S1CX 1KFNA 3H1IG 3AE7C 3TGUE 1AA0A 1HH0A 4I6MC 2HLOC 2XNXB 2YMKA 1EZVE 4IL6X 1YIJP 3CXHE 4ZNCA 2KLVA 3L74D 3A0BE 1NTZK 1T8ZA 4NPFX 4KT0J 1JMMA 4M7HA 4GT1A 2I8DA 1HJ0A 2YIUC 2FYUG 3TF5A 3H1KJ 3AEFC 4DZOA 2H43C 1PGOA 5BU5A 1FIBA 2J0YA 1QLED 3L70G 1L4AA 3WUVA 2JO1A 3I5CA 3VN0A 3H1KE 3ITKA 3SFEC 4RESB 5CJ0A 1FDOA 1EDIA 2M3BA 3H1HJ 1KC8Q 4OWFA 4WY4A 3Q5PA 4KJMA 2RN0A 3ZDMA 2MJZA 3H32B 1M90Q 1RF1A 3CD6P 3CCQP 3M9BA 4EDFA 4C46A 5KTBA 2J0HA 2WTYA 1DD3A 4B86A 2WMMA 4OH8B 3H1HE 2E5TA 5BVZA 3OJAB 2YMYA 3GLMA 3KQGA 1FU1A 2XDJA 1Y9BA 1HJBA 1WRGA 1NTMG 3AEAC 2B87A 2KIKA 2FYZA 1BGYJ 2H89C 4H0LB 2Q7CA 3RBXA 3SSUA 2A45H 2WQYC 2BCCG 1QX8A 4NPEA 2HLOA 1RE3C 2FXPA 2XNDH 2ZVOB 3L71E 1G2CB 2O01N 3GF7A 4WB4A 4HJGH 4EPUA 1IFPA 1CSBA 1BGYE 5TJHA 5CCHC 3CWBD 2WNPF 2OTLP 2H43A 3P32A 4GKGA 1SFCD 2H88C 5GTIE 1SQPD 2XNXC 2ZYAA 3H6PA 4OVNF 5AVZB 1KILD 3CC7P 3FGAD 2J61A 2ZJSE 1ZP0C 2JHHC 1X0TA 2OYHB 4PD4H 5KJ7D 2AXTE 2B88A 3BRTB 1GU5A 1FZEB 2YO2A 1USEA 2E74D 1FZDA 1KILB 3CXHD 1NGMB 1JEKA 2PRRA 3H1LG 2ZYGA 4L73A 1LT1A 3L73J 1Q90D 3A5TA 4JQ0D 1FAVA 3E7KA 2KSJA 3KDPB 3H25A 5EFWB 2J64A 1VQPP 3GHGB 2CK3H 3V2QA 1FZFB 2FXOA 1SQQJ 4EYYQ 3H1JG 3R2PA 4NPDA 1MZ9A 3IF4A 1EZVI 1RE3A 2Q6QA 2J3FA 3OAKA 3H1KD 3F89A 1UIXA 4ZKUA 4QMAA 2B89A 2KP8A 1AQ5A 2PAJA 1SQQE 4YXWH 3MHVA 5APUA 5CCHA 1GL2D 2UWJE 1KYOE 4IL6H 2FYNB 1MUUA 1SQXK 5L8RJ 5APWA 3M06A 2AEMA 1MFZA 1L2PA 4RKUJ 4H0LC 1U7JA 2QG4A 2A06G 3M0DC 3U1CA 4R4LA 1JNMA 2QM7A 1S5LH 1OVUA 2XNXA 5B5EE 2GY7A 3H1HD 1VQMP 1KB9H 1VQ6P 3TK1A 1GL2B 3AEBC 2P58A 4A7PA 1JO5A 4KHXA 4H44B 5CCGD 3PH0A 4WBAA 3VTPC 4I1LA 1FOSE 3CX5H 3AE5C 1JOCA 3C8VA 2JHKF 4GODA 4OGQB 2WSEH 4XFJA 1N73B 2K88A 1XTCC 1SQVK 2KK7A 3CCEP 1ZV8A 1BGYD 1U7MA 2IYOA 2J60A 2LXCB 2YXQB 2OYHC 1SFCC 2QVAA 3HRNA 1FS0E 5CJ4A 1S72P 3TGUG 2E42A 3S4RA 4GOFA 1KILC 1FJKA 3EQ2A 1T3UA 1NKZB 3HTKA 1N2DC 2AEJA 1EZVG 1AJYA 2ZXXA 3JC22 1X79B 5KJ7C 1Q81Q 1IK7A 1KMIZ 1KB9D 5CBNA 1W2EA 1OVRA 2R5BA 5B66H 3KZIH 3SWKA 3D70A 2E74C 2IBZG 2YO3A 3P8CE 4WY4B 1M1JA 3CX5D 2FKWB 5E79E 1PGPA 1BCCJ 1NTZE 1FZFC 2N9YB 1RF1B 3MZWB 4UB6E 1Q2NA 1X8YA
chains in the Genus database with same CATH topology
1FZAA 1X9VA 1ZLLA 2W6BA 1M1JC 3U59A 4O9BA 3TSIA 2O01H 4ZKPA 4AYCA 3IFMA 1JCDA 3RL0B 1IK9A 1GW4A 2WITA 2WSCH 1CW5A 5CCHD 2PP6A 1GK6A 1ZR4A 2GUSA 3WMM0 1URQC 3RK2C 4XE5B 2Z5HA 3A2AA 3TNUB 1S9KE 5APQA 1RF1C 3E1IB 2Q9IC 1G2CA 3FIBA 1KQLA 3C9IA 1RE4A 3HD7D 1NWQA 1IFJA 4Y99B 2J59M 3MTUE 5AW0B 2HLOB 1LWUA 1JCCA 2HPCB 3M0AA 4N6JA 1MV8A 1EQ7A 2R3CA 1HUCA 1SP4A 3M9QA 1KFNA 2KOGA 3NXSA 2JHMF 2JHLF 5AVTB 1HH0A 4Y99C 4I6MC 3V2PA 1A02F 4C7NB 2HLOC 2XNXB 1N86A 4W80A 2HPCC 1GL2C 1YTZT 2XZRA 1Z3UA 1GD2E 1LTGC 5APXA 3BVHC 2KLVA 1S9KD 4JYOX 1CI6A 2N1TB 3VOPA 2OYHA 4ZFGA 1SFCA 3L36A 2W27A 1NTZK 1FZBA 1NTKK 2FFDC 1T8ZA 2NPSA 4IFDK 1JMMA 2Q5UA 4M7HA 4GT1A 2HODC 2WPRA 1VPCA 1KILA 3A3YB 2J61B 4DZOA 2H43C 5CCGC 1N73C 4HH2A 2HYNA 3BASA 1HTLC 2OYIA 1KZUB 2N1TC 2POHA 2I1JA 2OARA 1NHLA 2YKOA 5BU5A 4NYTA 1FIBA 5AW2B 1IFDA 5KJ7A 2J0YA 2NPSC 1N7SB 2YNYA 2I1KA 5AW7B 1L4AA 4M7FA 3VP9A 1SQPK 4N78E 3HUSC 2R32A 2P1JA 3BATA 2A45G 1H88A 1HVVA 1LTIC 3I5CA 3PP5A 1IFMA 2FYUK 3VN0A 3KYQA 3B5NC 1N7SC 4RESB 5CJ0A 1FZFA 2ZXEB 2QM8A 2M3BA 1LT9A 2P7JA 3HE4A 1OXZA 2LKMA 4WY4A 4EOTA 5AW9B 1URQA 2MJZA 3CL3D 3H32B 3RK2D 4C7RA 5APTA 1RY3A 1RF1A 1LGHB 2Q9IA 2N9BA 3M9BA 4C46A 5KTBA 2J0HA 2WTYA 1N7LA 4B86A 4WY4C 4OH8B 3V4QA 1SLQA 1JY2O 3L37A 2WT7B 3NMDA 2P2UA 1JUNA 1T2KD 3RK3C 3T97A 5BVZA 3OJAB 2YMYA 3L4FA 2Z5IA 3KQGA 5AW4B 1RE3B 1FU1A 3H32C 1T3JA 2XDJA 3TNUA 1HJBA 1WRGA 1J2JB 2J5ZA 3LIDA 2ZFCA 2FYZA 2Q7CA 1FZAB 1NAFA 1YYCA 1ZN5A 5AW3B 2A45H 1NKNA 2KB7P 3VMXA 5AVQB 2JJLA 3RL0C 3B8EB 3P8CD 2O1KA 1QL1A 4N3YB 1Z56A 2HLOA 2VRSA 2IPPA 1RE3C 2XU6A 2HPCA 1GL2A 5AVRB 3E1IC 2IFNA 5APVA 1G2CB 3BVHA 4WB4A 1J1EB 5AVUB 3HD7B 1RF0B 4JF7A 1JY3O 1NTMK 4EPUA 3LW5H 1FBMA 3L35A 2FFDA 2P67A 3M9HA 1CSBA 3BRVB 3N4XA 5CCHC 3M91A 3NFQA 1NU1K 1GTWA 2HODA 1LTJB 2WNPF 1FZCB 2H43A 1SQBK 5CCGA 1N73A 2H8PD 3P32A 4GKGA 3HD7C 2N1TA 3MUDA 1RF0C 4M3LA 1G1IA 1SFCD 2XNXC 5CMZA 3H6PA 2C9LY 1LTTC 4IFFA 2NPSD 5AVZB 4I2LC 1LTJC 5AVWB 2C9NY 1KILD 2J2PA 5AVSB 4LC1A 1FZCC 5APSA 2J61A 3HUSA 1M7LA 1JTHA 2XV5A 3IR9A 1HBWA 5AW1B 2JHHC 3UIAA 1DH3A 1LTSC 2YKPA 2OYHB 5KJ7D 3VMZA 2WWWA 1FZBB 3B5NA 1N7SA 3BRTB 1QL2A 3A7OA 3V5BA 1GU5A 1FIDA 1FZEB 2YO2A 1A02J 1L4AD 3SWFA 1FZDA 1KILB 3CLQA 1G1JA 4DOJA 3P7KA 1YTZI 2J3UA 1GW3A 5APYA 1FZEC 2JEEA 2W6AA 3G3ZA 5AVVB 1L4AB 1JC9A 3A5TA 1FAVA 2M8RA 4WY4D 2KSJA 3HTKB 1FZGB 3KDPB 2WPQA 1NH4A 1OWAA 5CHXA 2J64A 2L5GB 3RK3D 1H89A 3SWYA 3V2NA 1URQD 3H32A 3GHGB 1J1DB 3OA7A 3V2QA 1FZFB 1LT9B 2BASA 3P8MC 3V4WA 4AQRD 3R2PA 1FZGC 3HE5B 1M1JB 2Z4EB 2FIBA 2WT7A 1MZ9A 3O8ZA 4R9TA 4N78D 2KYVA 1L0LK 1HGVA 1RE3A 5AVYB 3GHGC 3RK2B 1FDMA 2J3FA 2GM4A 3E1IA 3OAKA 4EIJA 2Q3IA 3V2RA 2J1GA 4ZKUA 3CI9A 1VDFA 1JY2P 1IFIA 3M0DA 4GIFA 2KP8A 1AQ5A 1ZR2A 2Z4EC 1PFIA 1CZQA 5AW6B 1L0NK 2WZ7A 2H7HA 2WSFH 2PAJA 2HFED 5APUA 5CCHA 5AW5B 1GL2D 3II6A 1Z3SA 1MUUA 1SQXK 5APWA 3M06A 1MFZA 5BU8B 4JYCA 4LLHA 1FZAC 1RE4B 2WPSA 3HD7A 3M0DC 4IFMA 3U1CA 1JNMA 1RF0A 2QM7A 1H8AA 1KFMA 5AVXB 2D39A 4JYBA 1T2KC 2C0XA 4C7NA 2XNXA 1JY2N 2XKMA 2GY7A 1LWUB 3LIEA 3TK1A 1GL2B 4LGDE 1LTJA 2J3GA 1FZCA 1JO5A 4KHXA 5CCGD 1J1EC 4WBAA 3VTPC 3BVHB 1RE4C 1JY3P 2N1TD 4I1LA 1FOSE 1JOCA 2E43A 2FFDB 2JHKF 1LWUC 1N86B 2C0WA 3MIWA 2FXMA 1FJPA 2HODB 5AW8B 1GZLA 2WSEH 1WT6A 1DX7A 1AFOA 2O1JA 2H43B 1N73B 2J0GA 4AUWA 1CI6B 1IO4A 5KLVK 1SFCB 3B5ND 3U1AA 1N7SD 4W7YA 2NPSB 1N86C 1JY3N 1FZEA 3EFGA 1XTCC 1LTAC 1SQVK 3TYYA 2IX7C 3VP8A 3NTNA 1ZV8A 2J3OA 1NO4A 3KPEA 1HWTC 3HUSB 1GU4A 1HGZA 2J60A 1JTHB 1DEBA 2OYIB 1SQQK 2OYHC 1SFCC 3HRNA 1FZBC 1GDTA 1FICA 5CJ4A 2GUVA 3B5NB 3MD0A 2E42A 1XTGB 2HG5D 2J58A 1IC2A 1GK4A 1KILC 1FJKA 3EQ2A 3MGNA 3VYIA 1T3UA 1NKZB 3HTKA 1FZGA 1N2DC 4W7ZA 1LTBC 2OYIC 1E5WA 1IFNA 1X79B 2IFMA 5KJ7C 1NOHA 3GHGA 4JZCA 1W2EA 4XA4A 2CPBA 2R5BA 3N7NA 2R5DA 2YKQA 1L4AC 4HYTB 2JHIF 3HE4B 1SVFA 2YO3A 3P8CE 4WY4B 3HE5A 1M1JA 3VMYA 2Z4EA 3RL0D 2CPSA 2A45I 2FKWB 3RK3B 1FOSF 1URQB 1IJDB 1J1DC 2J3FD 1FZFC 1RF1B 1LT9C 2Q9IB 4R9JA 1X8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZA A;  1JY2 N;  2GY7 A;  1LWU B;  1M1J C;  1FZF A;  2JHH C;  1LTJ A;  1LT9 A;  2J3G A;  2OYH B;  1FZC A;  1FZB B;  1FID A;  3BVH B;  1RE4 C;  1JY3 P;  1FZE B;  1RF1 C;  3E1I B;  2Q9I C;  1FZD A;  3FIB A;  2FFD B;  2JHK F;  1LWU C;  1RE4 A;  1N86 B;  3H32 B;  1RF1 A;  2HOD B;  2Q9I A;  2J0H A;  2J3U A;  2HLO B;  1LWU A;  2H43 B;  1N73 B;  2J0G A;  1JY2 O;  2HPC B;  1FZE C;  1JC9 A;  1RE3 B;  1N86 C;  1FZG B;  1JY3 N;  1FZE A;  3H32 C;  2J64 A;  2JHM F;  2JHL F;  2J5Z A;  2J3O A;  2HLO C;  2XNX B;  3HUS B;  1N86 A;  1FZA B;  3H32 A;  3GHG B;  2HPC C;  2J60 A;  2A45 H;  2OYI B;  1FZF B;  2OYH C;  1LT9 B;  1FZB C;  1Z3U A;  2HLO A;  1FIC A;  3BVH C;  1RE3 C;  1FZG C;  1M1J B;  2HPC A;  4JYO X;  2Z4E B;  2FIB A;  4ZFG A;  2OYH A;  3E1I C;  4R9T A;  1FZB A;  2FFD C;  1T3U A;  3BVH A;  1RE3 A;  1FZG A;  3GHG C;  4M7H A;  2J3F A;  1RF0 B;  3E1I A;  1JY3 O;  2OYI C;  2HOD C;  4EPU A;  2J1G A;  2FFD A;  2J61 B;  1JY2 P;  2H43 C;  1N73 C;  3GHG A;  4JZC A;  1W2E A;  2HOD A;  2OYI A;  2Z4E C;  1LTJ B;  2WNP F;  2JHI F;  4NYT A;  1FIB A;  1FZC B;  2J0Y A;  2H43 A;  1N73 A;  1M1J A;  2Z4E A;  1RF0 C;  1Z3S A;  2A45 I;  4M7F A;  2XNX C;  3HUS C;  1FZA C;  2A45 G;  1RE4 B;  2J3F D;  1RF0 A;  1FZF C;  1LTJ C;  1LT9 C;  1RF1 B;  2D39 A;  2Q9I B;  2J2P A;  1FZC C;  4R9J A;  2XNX A;  2J61 A;  3HUS A; 
#chains in the Genus database with same CATH topology
 1VQN P;  1X9V A;  1ZLL A;  2O01 H;  2WSC H;  1CW5 A;  1YIT P;  2Z5H A;  3E1I B;  5GTH H;  2B87 B;  1G2C A;  3R4Y A;  3I55 P;  3FIB A;  1JMB A;  3C9I A;  3GF3 A;  2HLO B;  3L73 D;  2FYN C;  1MV8 A;  1HUC A;  3M9Q A;  2JHM F;  2JHL F;  4Y99 C;  1W2B O;  4C7N B;  1NAY A;  1GL2 C;  1SQQ D;  2YIU B;  3Q5S A;  4H44 C;  1L0N J;  4ZFG A;  2OYH A;  1SFC A;  2W27 A;  1NTK K;  2JP3 A;  2Q5U A;  2KS1 B;  3L72 G;  2WPR A;  1KIL A;  2FYU D;  2J61 B;  5CCG C;  1N73 C;  1HTL C;  3PLN A;  3L71 G;  2I1J A;  2OAR A;  2YKO A;  2KSE A;  5AW2 B;  5KJ7 A;  4MN4 C;  4N78 E;  1HVV A;  3PP5 A;  1KYO I;  2FYU K;  2KNC A;  3BCC J;  2YXR B;  1VQK P;  2WPV B;  2PFX A;  1FZF A;  3CWB J;  5AW9 B;  3CCR P;  1AVO A;  3MP7 B;  3K5B A;  3GMA A;  3RK2 D;  2G8Y A;  3BCC E;  4WY4 C;  1BSN A;  3L37 A;  4HKZ H;  3CWB E;  1MFT A;  2Z5I A;  5AW4 B;  1RE3 B;  2IYP A;  5KAF H;  3IAO A;  1NTM D;  2ZFC A;  4PV1 D;  1NAF A;  1M57 D;  5AW3 B;  1NKN A;  5AVQ B;  3B8E B;  3P8C D;  1QL1 A;  3PTZ A;  3ABV C;  2IPP A;  1SQB D;  2XU6 A;  4D6T J;  3FWL A;  1GL2 A;  3E1I C;  2AEF A;  1R5S A;  2K37 A;  5AVU B;  1NTM K;  3LW5 H;  1FBM A;  2P67 A;  1KOR A;  3BRV B;  3M91 A;  3AEC C;  1VF5 D;  2ZVN B;  1SQB K;  5CCG A;  1N73 A;  4D6T E;  2IDB A;  1S5L X;  1BCC D;  2M0B A;  4GDO A;  1SQX J;  2NPS D;  1LTJ C;  1VF5 B;  1FZC C;  1M7L A;  2XV5 A;  3CPW O;  5AW1 B;  3L75 J;  1DH3 A;  1LTS C;  2YKP A;  2QJY C;  1FZB B;  3V5B A;  1ZRT E;  3A7O A;  2M5A B;  1VQL P;  4L75 A;  3PRJ A;  1A02 J;  3SWF A;  1K05 A;  1SQX E;  1P84 H;  1OZH A;  5C39 A;  3CCU P;  1VQ5 P;  3P7K A;  1GW3 A;  4U3F J;  2W6A A;  5AVV B;  2E75 D;  4PD4 E;  1JC9 A;  1L0L G;  3HTK B;  1OWA A;  2KZI A;  3RK3 D;  1SQV J;  1H89 A;  2Y0D A;  1URQ D;  1H0T A;  1PP9 J;  3G71 P;  1LT9 B;  1L0N D;  2E75 B;  1K8A Q;  4AQR D;  1FZG C;  2G3A A;  1M1J B;  4U3F E;  2FIB A;  3O8Z A;  4N78 D;  2KYV A;  2D2C D;  3AE4 C;  1FDM A;  2GM4 A;  3E1I A;  3V2R A;  1SQV E;  1BDD A;  1ZR2 A;  2Z4E C;  1PFI A;  1L0N K;  2H7H A;  2HR3 A;  1PPJ E;  5AW5 B;  1YQ4 C;  1U57 A;  1Z3S A;  1P84 D;  5BU8 B;  4JYC A;  5AVX B;  3BCC D;  3CME P;  2D39 A;  4JYB A;  2C0X A;  4C7N A;  1OVV A;  3LIE A;  3AED C;  1LTJ A;  5KLV G;  1FZC A;  1NTZ G;  1VQ4 P;  1RE4 C;  4PV1 C;  2N1T D;  3AE1 C;  4IL6 E;  4YTP C;  1FDI A;  2KS1 A;  3MIW A;  1W5C E;  1NJI Q;  1S4X A;  1S5L E;  1FJP A;  5AW8 B;  3GG2 A;  2WSE J;  1R8E A;  3G6E P;  2R44 A;  1DX7 A;  1AFO A;  3L74 G;  1AQT A;  4AUW A;  1KB9 E;  1SFC B;  2Y9Y A;  3B5N D;  1N7S D;  4W7Y A;  1RHZ B;  3EFG A;  1LTA C;  2J5U A;  1VF5 C;  3CX5 E;  3VP8 A;  3NTN A;  2J3O A;  2M3E A;  1NO4 A;  2W6J H;  2LR2 A;  1JTH B;  1M8O B;  1NU1 J;  1FZB C;  4D6T D;  1FIC A;  2GUV A;  3B5N B;  3MD0 A;  3SFD C;  1PGQ A;  2E74 B;  1OFC X;  3MGN A;  1KQS O;  1FZG A;  1NTK J;  4W7Z A;  3H1I J;  2KNC B;  1BE3 G;  2WVR A;  4XA4 A;  3AE6 C;  1FC2 C;  4UB8 H;  1AVY A;  1NVO A;  4HYT B;  1ZRT D;  2IBZ D;  3VMY A;  2Z4E A;  3W67 A;  1SQX D;  3L73 E;  2CPS A;  2OQQ A;  2A45 I;  3O6Q A;  3CXH I;  2OGU A;  1LT9 C;  2ZAE B;  3H1I E;  2RH0 A;  2Q1K A;  2E75 C;  4R9J A;  2FYU J;  4I7Z C;  3L75 D;  1M1J C;  3U59 A;  3E1R A;  4PD4 D;  4ZKP A;  2O01 J;  4AYC A;  1KN7 A;  1JCD A;  3KZI E;  5B66 E;  1IK9 A;  2WIT A;  2WSC J;  2GA1 A;  1GK6 A;  2GUS A;  5CBO A;  1URQ C;  1Y47 A;  3VMA A;  3WU2 H;  1LP1 A;  5M1B A;  3L70 J;  1RE4 A;  3HD7 D;  1IFJ A;  2W90 A;  1KV4 A;  4Y99 B;  1YHQ P;  3MTU E;  4U3F D;  2FYU E;  2L91 A;  2JDI H;  1PGJ A;  1E79 H;  1SP4 A;  2OTK E;  2KOG A;  3CCJ P;  1SQV D;  3NXS A;  5GTH E;  2QE7 H;  4Y28 J;  3V2P A;  1A02 F;  1PP9 D;  2OYO A;  2HPC C;  2PGD A;  2BEZ F;  1YTZ T;  1PPJ D;  2XZR A;  1GD2 E;  1LTG C;  2E5Y A;  5TIS H;  4JYO X;  1ZXG A;  3VOP A;  3CC2 P;  1FZB A;  1SQP G;  2M5A A;  2NPS A;  1VPC A;  1NTM J;  3Q3D A;  1KZU B;  2N1T C;  2POH A;  3MUD C;  1VQ7 P;  2ZYD A;  2BCC J;  3F5H A;  1VQ8 P;  2YNY A;  1SQB J;  4DCK A;  5AW7 B;  2QJK C;  1KTM A;  3VP9 A;  1FE6 A;  2R32 A;  2P1J A;  2JKV A;  2A45 G;  1IFM A;  1Q7Y Q;  2V7Q H;  1NTM E;  1OX3 A;  2IZ0 A;  3B5N C;  1N7S C;  2R3S A;  2QM8 A;  1LT9 A;  1YJW P;  3HE4 A;  4WWI A;  1SQB E;  3QWO C;  1URQ A;  3S1K A;  1H0T B;  5APT A;  2N9B A;  2QJP C;  2KLU A;  1N7L A;  1OW6 A;  1S2E A;  1R5L A;  1TU3 F;  2JWD A;  2JWA A;  2P2U A;  1T2K D;  2SPZ A;  3CCS P;  3FX0 A;  3TNU A;  5H2F H;  3H1K G;  1KB9 I;  2J5Z A;  3LID A;  1BCC E;  1FZA B;  3Q5R A;  1ZN5 A;  4EI2 A;  1NU1 D;  3CX5 I;  2VRS A;  4JBZ A;  3H1L J;  2HPC A;  5AVR B;  2IFN A;  1NTK D;  1J1E B;  4K35 A;  3H1I D;  5KAF E;  3LW5 J;  3L35 A;  1QEX A;  1JM0 A;  1Q86 Q;  1Y8A A;  3M9H A;  3N4X A;  2RKL A;  3H1H G;  3NFQ A;  1NU1 K;  1GTW A;  1MKM A;  1LTJ B;  1DIP A;  1FZC B;  4R4M A;  2H8P D;  3H1J J;  3HD7 C;  2N1T A;  3MUD A;  1RF0 C;  2P10 A;  3JCU H;  4M3L A;  3Q2Y A;  4YPC A;  2QJY B;  5CMZ A;  2C9L Y;  1LTT C;  2ITA A;  4I2L C;  1LJ2 A;  5AVW B;  2J2P A;  5AVS B;  4LC1 A;  4DT0 A;  3TDK A;  3RK3 E;  1JTH A;  1HBW A;  3UIA A;  1L0N E;  2WWW A;  3B5N A;  1N7S A;  1FID A;  1QL2 A;  3H1J E;  2QSI A;  1PL5 A;  3L70 D;  1BGY G;  1M56 D;  1G1J A;  5K5G B;  1YTZ I;  2JEE A;  1AV1 A;  4BWN A;  4H13 D;  4WVZ A;  2JR8 A;  3G3Z A;  1FZG B;  4JPZ B;  5CHX A;  3CCM P;  1YQ3 C;  3V2N A;  1P84 E;  2IZ1 A;  1J1D B;  2A06 E;  4H13 B;  3D6Y A;  2Z4E B;  2WT7 A;  2QA4 P;  4R9T A;  3O6Q B;  1Q82 Q;  1L0L K;  3AEG C;  1OMI A;  4TLF A;  3RK2 B;  3WUU A;  2QEX P;  4EIJ A;  1YJN P;  2J1G A;  3CI9 A;  2WSS H;  1VDF A;  1IFI A;  4GIF A;  5AW6 B;  2WZ7 A;  2BCC D;  2WSF H;  5KAI H;  4DJG A;  3II6 A;  3TGU J;  4BRY B;  1LP1 B;  4LLH A;  1X22 A;  1FZA C;  4PV1 B;  5KLI C;  2KZJ A;  3HD7 A;  1RE4 B;  1RF0 A;  1H8A A;  1KFM A;  1T2K C;  1D7M A;  1JY2 N;  3B71 A;  3OW2 O;  3L73 G;  3KXD A;  4Z1M H;  3D71 A;  2ZT9 D;  1J1E C;  3BVH B;  3A0H H;  2FFD B;  1LWU C;  2KXP B;  2C0W A;  3FXE A;  2FXM A;  1SQQ G;  2HOD B;  1WT6 A;  2ZT9 B;  1PV3 A;  2J0G A;  1EDK A;  3AE2 C;  5KLV K;  2IBZ E;  2NPS B;  1N86 C;  1JY3 N;  3TYY A;  3GW6 A;  3AE8 C;  1VQ9 P;  3KPE A;  1HWT C;  3HUS B;  1GU4 A;  1HGZ A;  1DEB A;  4TT3 H;  4PJ0 H;  1EDJ A;  3H1L D;  1GDT A;  3L75 E;  1XTG B;  2HG5 D;  2J58 A;  1GK4 A;  3AEE C;  1K04 A;  1LTB C;  2OYI C;  4U7J A;  1S3J A;  3B4S A;  1KQF B;  2IFM A;  1BE3 D;  1NOH A;  4JZC A;  3N7N A;  2R5D A;  2JHI F;  4L76 A;  2NZ2 A;  3HE4 B;  1SVF A;  3H1J D;  4I7Z B;  3HE5 A;  3RL0 D;  4YXD C;  1YJ9 P;  3EWK A;  3RK3 B;  1URQ B;  4BXL A;  1J1D C;  2OTJ P;  2FBW C;  4H13 C;  3L72 J;  1UII A;  1GMJ A;  1FZA A;  4H0L D;  2W6B A;  1PP9 E;  3TSI A;  3RBZ A;  4UB8 E;  3IFM A;  3RL0 B;  3L71 J;  2D2C B;  2PP6 A;  1ZR4 A;  3RK2 C;  4XE5 B;  3TNU B;  5APQ A;  2Q9I C;  2A06 D;  3L72 E;  3CXH H;  2J59 M;  2QIW A;  5AW0 B;  1LWU A;  1SQB G;  1JCC A;  2HPC B;  3QH9 A;  3A0B H;  3D6Z A;  5DJT B;  2R3C A;  2K9Y A;  2KUB A;  3WU2 E;  5AVT B;  3CC4 P;  1N86 A;  3CCV P;  4W80 A;  4L74 A;  2Q3E A;  1VQO P;  1DEE G;  1Z3U A;  1NYH A;  5APX A;  3BVH C;  1S9K D;  1P84 I;  1CI6 A;  2N1T B;  3L36 A;  1BCC G;  2FFD C;  4IFD K;  3G4S P;  2HOD C;  2QJK B;  3G9R A;  3A3Y B;  2ZT9 C;  3PJS K;  1M1K Q;  4HH2 A;  2HYN A;  3BAS A;  2OYI A;  4CPG A;  1NHL A;  4NYT A;  1IFD A;  3RGU A;  2NPS C;  1N7S B;  5TIS E;  1OW8 A;  3S9O A;  3TGU D;  2I1K A;  1HF9 A;  4M7F A;  1SQP K;  3HUS C;  3BAT A;  1H88 A;  1LTI C;  1EZV D;  4RJT A;  4K3A A;  1VL2 A;  2V7Q J;  1USD A;  3KYQ A;  2ZXE B;  2QJP B;  1NU1 E;  2P7J A;  1OXZ A;  1RH5 B;  2LKM A;  4ASW A;  1ZME C;  2QRX A;  4EOT A;  1NTK E;  3CL3 D;  4HB1 A;  4C7R A;  1RY3 A;  1LGH B;  2Q9I A;  1L0N G;  2W8Z A;  3V4Q A;  1SLQ A;  1JY2 O;  2WT7 B;  3NMD A;  1JUN A;  3RK3 C;  3T97 A;  1EC5 A;  3L4F A;  3H32 C;  1T3J A;  4BRY A;  1J2J B;  1LNQ A;  1YI2 P;  1YYC A;  2IBZ I;  2KB7 P;  3VMX A;  2JJL A;  3RL0 C;  2O1K A;  2D2C C;  4N3Y B;  1Z56 A;  2K9J A;  5GTI H;  5APV A;  4H44 D;  3BVH A;  1L0L J;  3HD7 B;  3FWN A;  1RF0 B;  4JF7 A;  1JY3 O;  1T6A A;  5H2F E;  3BCC G;  3I56 P;  2K3R A;  3L70 E;  4PD4 I;  2FFD A;  2O3J A;  2LXB A;  4OGQ D;  3CWB G;  2HOD A;  2AXC A;  2AXT H;  2V4H A;  1K73 Q;  1G1I A;  2Y9Z A;  4IFF A;  1EDL A;  3CCL P;  1L0L E;  3L72 D;  2K1A A;  2C9N Y;  5APS A;  3HUS A;  1N8R Q;  3IR9 A;  2B9B A;  3RL0 g;  3L71 D;  3VMZ A;  1PZQ A;  1ZOY C;  3Q1M A;  1QVG O;  3JCU E;  1L4A D;  3CLQ A;  4DOJ A;  1WMK A;  1ZW0 A;  3W68 A;  2J3U A;  4D6T G;  5APY A;  1FZE C;  1L4A B;  5KLV J;  2BCC E;  1KQG B;  2M8R A;  4WY4 D;  1NTZ J;  2WPQ A;  1NH4 A;  5KKZ B;  2L5G B;  3SWY A;  2E76 D;  3H32 A;  3OA7 A;  1EXI A;  2BAS A;  3P8M C;  3V4W A;  1K9M Q;  3HE5 B;  1KYO H;  3L74 J;  1SQX G;  4ZMD A;  1SS1 A;  1DD4 A;  5KLV E;  1HGV A;  2Y0E A;  5AVY B;  3GHG C;  2E76 B;  1QGK B;  2Q3I A;  5B5E H;  2KI7 B;  1JY2 P;  3L75 G;  5KLI B;  3M0D A;  1CZQ A;  2WSF J;  3USS A;  2HFE D;  3PHL A;  3L74 E;  2Y0C A;  4RO0 A;  2WPS A;  4IFM A;  1PIX A;  3EFF K;  4U3F G;  1RQV A;  2XKM A;  1BE3 J;  1LWU B;  4LGD E;  2J3G A;  1OW7 A;  5KAI E;  3H1L E;  1JY3 P;  4GOE A;  1SQV G;  2W83 C;  1PP9 G;  2E43 A;  1KD1 Q;  1N86 B;  3CMA P;  4IOI H;  1GZL A;  1PPJ G;  1YBK A;  5DJU B;  3C1L A;  1BE3 E;  2O1J A;  1KYO D;  2H43 B;  1CI6 B;  2DW3 A;  1IO4 A;  3U1A A;  1FZE A;  4OGQ C;  2IX7 C;  3A0H E;  2OYI B;  1SQQ K;  1OIP A;  1QVF O;  1IC2 A;  2NRG A;  5E79 H;  3VYI A;  1L0L D;  1RQU A;  4UB6 H;  1E5W A;  1IFN A;  3IN6 A;  3GHG A;  2CPB A;  3AE3 C;  4PJ0 E;  2YKQ A;  1L4A C;  1IZN B;  5KKZ C;  1FOS F;  3JSV C;  1SQP J;  1IJD B;  2J3F D;  2Q9I B;  3KHU A;  1EXJ A;  4O9B A;  4ASV A;  1GW4 A;  2RMZ A;  3T97 B;  5CCH D;  1JB0 J;  3WMM 0;  2E76 C;  1BDC A;  3A2A A;  1S9K E;  1RF1 C;  1BSH A;  1KQL A;  1SQP E;  2MKV A;  1NWQ A;  1NU1 G;  3V6I A;  2BEQ D;  3WUT A;  1KIL E;  3AE9 C;  2FY8 A;  3M0A A;  4N6J A;  3FXD A;  5KLV D;  2K9J B;  1EQ7 A;  1NTZ D;  1NTK G;  1S1C X;  1KFN A;  3H1I G;  3AE7 C;  3TGU E;  1AA0 A;  1HH0 A;  4I6M C;  2HLO C;  2XNX B;  2YMK A;  1EZV E;  4IL6 X;  1YIJ P;  3CXH E;  4ZNC A;  2KLV A;  3L74 D;  3A0B E;  1NTZ K;  1T8Z A;  4NPF X;  4KT0 J;  1JMM A;  4M7H A;  4GT1 A;  2I8D A;  1HJ0 A;  2YIU C;  2FYU G;  3TF5 A;  3H1K J;  3AEF C;  4DZO A;  2H43 C;  1PGO A;  5BU5 A;  1FIB A;  2J0Y A;  1QLE D;  3L70 G;  1L4A A;  3WUV A;  2JO1 A;  3I5C A;  3VN0 A;  3H1K E;  3ITK A;  3SFE C;  4RES B;  5CJ0 A;  1FDO A;  1EDI A;  2M3B A;  3H1H J;  1KC8 Q;  4OWF A;  4WY4 A;  3Q5P A;  4KJM A;  2RN0 A;  3ZDM A;  2MJZ A;  3H32 B;  1M90 Q;  1RF1 A;  3CD6 P;  3CCQ P;  3M9B A;  4EDF A;  4C46 A;  5KTB A;  2J0H A;  2WTY A;  1DD3 A;  4B86 A;  2WMM A;  4OH8 B;  3H1H E;  2E5T A;  5BVZ A;  3OJA B;  2YMY A;  3GLM A;  3KQG A;  1FU1 A;  2XDJ A;  1Y9B A;  1HJB A;  1WRG A;  1NTM G;  3AEA C;  2B87 A;  2KIK A;  2FYZ A;  1BGY J;  2H89 C;  4H0L B;  2Q7C A;  3RBX A;  3SSU A;  2A45 H;  2WQY C;  2BCC G;  1QX8 A;  4NPE A;  2HLO A;  1RE3 C;  2FXP A;  2XND H;  2ZVO B;  3L71 E;  1G2C B;  2O01 N;  3GF7 A;  4WB4 A;  4HJG H;  4EPU A;  1IFP A;  1CSB A;  1BGY E;  5TJH A;  5CCH C;  3CWB D;  2WNP F;  2OTL P;  2H43 A;  3P32 A;  4GKG A;  1SFC D;  2H88 C;  5GTI E;  1SQP D;  2XNX C;  2ZYA A;  3H6P A;  4OVN F;  5AVZ B;  1KIL D;  3CC7 P;  3FGA D;  2J61 A;  2ZJS E;  1ZP0 C;  2JHH C;  1X0T A;  2OYH B;  4PD4 H;  5KJ7 D;  2AXT E;  2B88 A;  3BRT B;  1GU5 A;  1FZE B;  2YO2 A;  1USE A;  2E74 D;  1FZD A;  1KIL B;  3CXH D;  1NGM B;  1JEK A;  2PRR A;  3H1L G;  2ZYG A;  4L73 A;  1LT1 A;  3L73 J;  1Q90 D;  3A5T A;  4JQ0 D;  1FAV A;  3E7K A;  2KSJ A;  3KDP B;  3H25 A;  5EFW B;  2J64 A;  1VQP P;  3GHG B;  2CK3 H;  3V2Q A;  1FZF B;  2FXO A;  1SQQ J;  4EYY Q;  3H1J G;  3R2P A;  4NPD A;  1MZ9 A;  3IF4 A;  1EZV I;  1RE3 A;  2Q6Q A;  2J3F A;  3OAK A;  3H1K D;  3F89 A;  1UIX A;  4ZKU A;  4QMA A;  2B89 A;  2KP8 A;  1AQ5 A;  2PAJ A;  1SQQ E;  4YXW H;  3MHV A;  5APU A;  5CCH A;  1GL2 D;  2UWJ E;  1KYO E;  4IL6 H;  2FYN B;  1MUU A;  1SQX K;  5L8R J;  5APW A;  3M06 A;  2AEM A;  1MFZ A;  1L2P A;  4RKU J;  4H0L C;  1U7J A;  2QG4 A;  2A06 G;  3M0D C;  3U1C A;  4R4L A;  1JNM A;  2QM7 A;  1S5L H;  1OVU A;  2XNX A;  5B5E E;  2GY7 A;  3H1H D;  1VQM P;  1KB9 H;  1VQ6 P;  3TK1 A;  1GL2 B;  3AEB C;  2P58 A;  4A7P A;  1JO5 A;  4KHX A;  4H44 B;  5CCG D;  3PH0 A;  4WBA A;  3VTP C;  4I1L A;  1FOS E;  3CX5 H;  3AE5 C;  1JOC A;  3C8V A;  2JHK F;  4GOD A;  4OGQ B;  2WSE H;  4XFJ A;  1N73 B;  2K88 A;  1XTC C;  1SQV K;  2KK7 A;  3CCE P;  1ZV8 A;  1BGY D;  1U7M A;  2IYO A;  2J60 A;  2LXC B;  2YXQ B;  2OYH C;  1SFC C;  2QVA A;  3HRN A;  1FS0 E;  5CJ4 A;  1S72 P;  3TGU G;  2E42 A;  3S4R A;  4GOF A;  1KIL C;  1FJK A;  3EQ2 A;  1T3U A;  1NKZ B;  3HTK A;  1N2D C;  2AEJ A;  1EZV G;  1AJY A;  2ZXX A;  3JC2 2;  1X79 B;  5KJ7 C;  1Q81 Q;  1IK7 A;  1KMI Z;  1KB9 D;  5CBN A;  1W2E A;  1OVR A;  2R5B A;  5B66 H;  3KZI H;  3SWK A;  3D70 A;  2E74 C;  2IBZ G;  2YO3 A;  3P8C E;  4WY4 B;  1M1J A;  3CX5 D;  2FKW B;  5E79 E;  1PGP A;  1BCC J;  1NTZ E;  1FZF C;  2N9Y B;  1RF1 B;  3MZW B;  4UB6 E;  1Q2N A;  1X8Y A; 
#chains in the Genus database with same CATH homology
 1FZA A;  1X9V A;  1ZLL A;  2W6B A;  1M1J C;  3U59 A;  4O9B A;  3TSI A;  2O01 H;  4ZKP A;  4AYC A;  3IFM A;  1JCD A;  3RL0 B;  1IK9 A;  1GW4 A;  2WIT A;  2WSC H;  1CW5 A;  5CCH D;  2PP6 A;  1GK6 A;  1ZR4 A;  2GUS A;  3WMM 0;  1URQ C;  3RK2 C;  4XE5 B;  2Z5H A;  3A2A A;  3TNU B;  1S9K E;  5APQ A;  1RF1 C;  3E1I B;  2Q9I C;  1G2C A;  3FIB A;  1KQL A;  3C9I A;  1RE4 A;  3HD7 D;  1NWQ A;  1IFJ A;  4Y99 B;  2J59 M;  3MTU E;  5AW0 B;  2HLO B;  1LWU A;  1JCC A;  2HPC B;  3M0A A;  4N6J A;  1MV8 A;  1EQ7 A;  2R3C A;  1HUC A;  1SP4 A;  3M9Q A;  1KFN A;  2KOG A;  3NXS A;  2JHM F;  2JHL F;  5AVT B;  1HH0 A;  4Y99 C;  4I6M C;  3V2P A;  1A02 F;  4C7N B;  2HLO C;  2XNX B;  1N86 A;  4W80 A;  2HPC C;  1GL2 C;  1YTZ T;  2XZR A;  1Z3U A;  1GD2 E;  1LTG C;  5APX A;  3BVH C;  2KLV A;  1S9K D;  4JYO X;  1CI6 A;  2N1T B;  3VOP A;  2OYH A;  4ZFG A;  1SFC A;  3L36 A;  2W27 A;  1NTZ K;  1FZB A;  1NTK K;  2FFD C;  1T8Z A;  2NPS A;  4IFD K;  1JMM A;  2Q5U A;  4M7H A;  4GT1 A;  2HOD C;  2WPR A;  1VPC A;  1KIL A;  3A3Y B;  2J61 B;  4DZO A;  2H43 C;  5CCG C;  1N73 C;  4HH2 A;  2HYN A;  3BAS A;  1HTL C;  2OYI A;  1KZU B;  2N1T C;  2POH A;  2I1J A;  2OAR A;  1NHL A;  2YKO A;  5BU5 A;  4NYT A;  1FIB A;  5AW2 B;  1IFD A;  5KJ7 A;  2J0Y A;  2NPS C;  1N7S B;  2YNY A;  2I1K A;  5AW7 B;  1L4A A;  4M7F A;  3VP9 A;  1SQP K;  4N78 E;  3HUS C;  2R32 A;  2P1J A;  3BAT A;  2A45 G;  1H88 A;  1HVV A;  1LTI C;  3I5C A;  3PP5 A;  1IFM A;  2FYU K;  3VN0 A;  3KYQ A;  3B5N C;  1N7S C;  4RES B;  5CJ0 A;  1FZF A;  2ZXE B;  2QM8 A;  2M3B A;  1LT9 A;  2P7J A;  3HE4 A;  1OXZ A;  2LKM A;  4WY4 A;  4EOT A;  5AW9 B;  1URQ A;  2MJZ A;  3CL3 D;  3H32 B;  3RK2 D;  4C7R A;  5APT A;  1RY3 A;  1RF1 A;  1LGH B;  2Q9I A;  2N9B A;  3M9B A;  4C46 A;  5KTB A;  2J0H A;  2WTY A;  1N7L A;  4B86 A;  4WY4 C;  4OH8 B;  3V4Q A;  1SLQ A;  1JY2 O;  3L37 A;  2WT7 B;  3NMD A;  2P2U A;  1JUN A;  1T2K D;  3RK3 C;  3T97 A;  5BVZ A;  3OJA B;  2YMY A;  3L4F A;  2Z5I A;  3KQG A;  5AW4 B;  1RE3 B;  1FU1 A;  3H32 C;  1T3J A;  2XDJ A;  3TNU A;  1HJB A;  1WRG A;  1J2J B;  2J5Z A;  3LID A;  2ZFC A;  2FYZ A;  2Q7C A;  1FZA B;  1NAF A;  1YYC A;  1ZN5 A;  5AW3 B;  2A45 H;  1NKN A;  2KB7 P;  3VMX A;  5AVQ B;  2JJL A;  3RL0 C;  3B8E B;  3P8C D;  2O1K A;  1QL1 A;  4N3Y B;  1Z56 A;  2HLO A;  2VRS A;  2IPP A;  1RE3 C;  2XU6 A;  2HPC A;  1GL2 A;  5AVR B;  3E1I C;  2IFN A;  5APV A;  1G2C B;  3BVH A;  4WB4 A;  1J1E B;  5AVU B;  3HD7 B;  1RF0 B;  4JF7 A;  1JY3 O;  1NTM K;  4EPU A;  3LW5 H;  1FBM A;  3L35 A;  2FFD A;  2P67 A;  3M9H A;  1CSB A;  3BRV B;  3N4X A;  5CCH C;  3M91 A;  3NFQ A;  1NU1 K;  1GTW A;  2HOD A;  1LTJ B;  2WNP F;  1FZC B;  2H43 A;  1SQB K;  5CCG A;  1N73 A;  2H8P D;  3P32 A;  4GKG A;  3HD7 C;  2N1T A;  3MUD A;  1RF0 C;  4M3L A;  1G1I A;  1SFC D;  2XNX C;  5CMZ A;  3H6P A;  2C9L Y;  1LTT C;  4IFF A;  2NPS D;  5AVZ B;  4I2L C;  1LTJ C;  5AVW B;  2C9N Y;  1KIL D;  2J2P A;  5AVS B;  4LC1 A;  1FZC C;  5APS A;  2J61 A;  3HUS A;  1M7L A;  1JTH A;  2XV5 A;  3IR9 A;  1HBW A;  5AW1 B;  2JHH C;  3UIA A;  1DH3 A;  1LTS C;  2YKP A;  2OYH B;  5KJ7 D;  3VMZ A;  2WWW A;  1FZB B;  3B5N A;  1N7S A;  3BRT B;  1QL2 A;  3A7O A;  3V5B A;  1GU5 A;  1FID A;  1FZE B;  2YO2 A;  1A02 J;  1L4A D;  3SWF A;  1FZD A;  1KIL B;  3CLQ A;  1G1J A;  4DOJ A;  3P7K A;  1YTZ I;  2J3U A;  1GW3 A;  5APY A;  1FZE C;  2JEE A;  2W6A A;  3G3Z A;  5AVV B;  1L4A B;  1JC9 A;  3A5T A;  1FAV A;  2M8R A;  4WY4 D;  2KSJ A;  3HTK B;  1FZG B;  3KDP B;  2WPQ A;  1NH4 A;  1OWA A;  5CHX A;  2J64 A;  2L5G B;  3RK3 D;  1H89 A;  3SWY A;  3V2N A;  1URQ D;  3H32 A;  3GHG B;  1J1D B;  3OA7 A;  3V2Q A;  1FZF B;  1LT9 B;  2BAS A;  3P8M C;  3V4W A;  4AQR D;  3R2P A;  1FZG C;  3HE5 B;  1M1J B;  2Z4E B;  2FIB A;  2WT7 A;  1MZ9 A;  3O8Z A;  4R9T A;  4N78 D;  2KYV A;  1L0L K;  1HGV A;  1RE3 A;  5AVY B;  3GHG C;  3RK2 B;  1FDM A;  2J3F A;  2GM4 A;  3E1I A;  3OAK A;  4EIJ A;  2Q3I A;  3V2R A;  2J1G A;  4ZKU A;  3CI9 A;  1VDF A;  1JY2 P;  1IFI A;  3M0D A;  4GIF A;  2KP8 A;  1AQ5 A;  1ZR2 A;  2Z4E C;  1PFI A;  1CZQ A;  5AW6 B;  1L0N K;  2WZ7 A;  2H7H A;  2WSF H;  2PAJ A;  2HFE D;  5APU A;  5CCH A;  5AW5 B;  1GL2 D;  3II6 A;  1Z3S A;  1MUU A;  1SQX K;  5APW A;  3M06 A;  1MFZ A;  5BU8 B;  4JYC A;  4LLH A;  1FZA C;  1RE4 B;  2WPS A;  3HD7 A;  3M0D C;  4IFM A;  3U1C A;  1JNM A;  1RF0 A;  2QM7 A;  1H8A A;  1KFM A;  5AVX B;  2D39 A;  4JYB A;  1T2K C;  2C0X A;  4C7N A;  2XNX A;  1JY2 N;  2XKM A;  2GY7 A;  1LWU B;  3LIE A;  3TK1 A;  1GL2 B;  4LGD E;  1LTJ A;  2J3G A;  1FZC A;  1JO5 A;  4KHX A;  5CCG D;  1J1E C;  4WBA A;  3VTP C;  3BVH B;  1RE4 C;  1JY3 P;  2N1T D;  4I1L A;  1FOS E;  1JOC A;  2E43 A;  2FFD B;  2JHK F;  1LWU C;  1N86 B;  2C0W A;  3MIW A;  2FXM A;  1FJP A;  2HOD B;  5AW8 B;  1GZL A;  2WSE H;  1WT6 A;  1DX7 A;  1AFO A;  2O1J A;  2H43 B;  1N73 B;  2J0G A;  4AUW A;  1CI6 B;  1IO4 A;  5KLV K;  1SFC B;  3B5N D;  3U1A A;  1N7S D;  4W7Y A;  2NPS B;  1N86 C;  1JY3 N;  1FZE A;  3EFG A;  1XTC C;  1LTA C;  1SQV K;  3TYY A;  2IX7 C;  3VP8 A;  3NTN A;  1ZV8 A;  2J3O A;  1NO4 A;  3KPE A;  1HWT C;  3HUS B;  1GU4 A;  1HGZ A;  2J60 A;  1JTH B;  1DEB A;  2OYI B;  1SQQ K;  2OYH C;  1SFC C;  3HRN A;  1FZB C;  1GDT A;  1FIC A;  5CJ4 A;  2GUV A;  3B5N B;  3MD0 A;  2E42 A;  1XTG B;  2HG5 D;  2J58 A;  1IC2 A;  1GK4 A;  1KIL C;  1FJK A;  3EQ2 A;  3MGN A;  3VYI A;  1T3U A;  1NKZ B;  3HTK A;  1FZG A;  1N2D C;  4W7Z A;  1LTB C;  2OYI C;  1E5W A;  1IFN A;  1X79 B;  2IFM A;  5KJ7 C;  1NOH A;  3GHG A;  4JZC A;  1W2E A;  4XA4 A;  2CPB A;  2R5B A;  3N7N A;  2R5D A;  2YKQ A;  1L4A C;  4HYT B;  2JHI F;  3HE4 B;  1SVF A;  2YO3 A;  3P8C E;  4WY4 B;  3HE5 A;  1M1J A;  3VMY A;  2Z4E A;  3RL0 D;  2CPS A;  2A45 I;  2FKW B;  3RK3 B;  1FOS F;  1URQ B;  1IJD B;  1J1D C;  2J3F D;  1FZF C;  1RF1 B;  1LT9 C;  2Q9I B;  4R9J A;  1X8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...