1LT9C

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
b'YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9C02
4R9TA 2J3UA 3FIBA 2HPCC 2HPCA 2A45I 1LT9C 1LT9A 1N86C 1N86A 1RE4C 1RE4A 2Z4EC 1RF1B 1FZGB 2HODC 2HODA 1FZCB 1N73A 1M1JC 1M1JA 1T3UA 3GHGB 1FZBB 2OYHC 2OYHA 2HLOC 2HLOA 3HUSB 1JY2O 2J1GA 1LTJC 1JY3O 1LTJA 2JHKF 2OYIC 2OYIA 2J2PA 3BVHB 3HUSC 2FFDC 2FFDA 1FIDA 2JHHC 2HPCB 2D39A 3H32C 3H32A 1W2EA 4JYOX 1LT9B 1N86B 1RE4B 2XNXC 2XNXA 2HODB 1N73B 1M1JB 2A45H 2OYHB 2HLOB 2H43A 1LTJB 1FZEA 1FZEC 2OYIB 1N73C 2J0GA 2GY7A 2J0YA 1LWUC 1LWUA 2FFDB 4M7HA 3E1IC 3E1IA 3H32B 2J3FA 2J61A 4EPUA 2XNXB 1FZAA 2J0HA 1FZFA 1FZFC 2H43B 1FZEB 2A45G 1JY2N 1JY3N 1LWUB 2JHMF 1JY2P 3E1IB 2H43C 1JY3P 2J61B 1FZAB 2J3GA 1FIBA 1FZFB 3BVHA 4M7FA 1RF0C 1RF0A 4ZFGA 1FZAC 4R9JA 1FICA 2Q9IC 2Q9IA 1Z3UA 1RE3C 1RE3A 1JC9A 2Z4EA 1FZDA 2J5ZA 2J60A 2WNPF 4NYTA 2FIBA 2JHIF 1RF1C 1RF1A 1FZGA 1FZGC 1FZCC 1FZCA 1Z3SA 1RF0B 1FZBC 1FZBA 3GHGA 3GHGC 3HUSA 2JHLF 3BVHC 2Q9IB 4JZCA 1RE3B 2J64A 2J3FD 2J3OA 2Z4EB
chains in the Genus database with same CATH superfamily
4QMAA 3PLNA 1Q7YQ 4B86A 2CK3H 2NRGA 1N86C 2LKMA 2Z4EC 1FZCB 1VQ4P 2IBZD 3W68A 2LXBA 4K35A 1L0NK 2Z5IA 2KZJA 4RJTA 2L91A 2D39A 4DCKA 2IBZE 4Y99B 3D70A 1DD3A 2HLOB 4OGQC 1QGKB 1FC2C 2K9YA 1QVFO 2UWJE 1VQMP 4EDFA 4W7ZA 1NTMD 2Q6QA 3PP5A 5CCGC 5CJ4A 5AVSB 1G1JA 1YQ4C 4GOFA 1X22A 3PH0A 2P1JA 3L70J 3II6A 1QLED 5KLVK 4I1LA 1S5LH 1FOSE 1SQBD 4EYYQ 2V4HA 3M9HA 3CCQP 1KQSO 1FZAC 3HD7A 2Q9IC 3AE7C 1NWQA 1GU5A 2FYUG 1PPJG 1SQXD 1J1DC 1BSNA 2BCCJ 2E5TA 2FIBA 3TNUB 1SVFA 1FZGA 2RMZA 5APXA 2HFED 4Z1MH 4HKZH 1RE3B 3UIAA 3VN0A 1SQXE 3JC22 4PJ0E 2HPCA 3H1KJ 4PV1B 1LT9C 2O01N 3A0BH 1FBMA 3KPEA 3AEDC 1H8AA 3L4FA 3OW2O 3JSVC 3L72D 3L73D 1OW8A 1K04A 3HTKA 1LTJA 3KQGA 1FAVA 4L76A 4W80A 2G8YA 1IFMA 3LIEA 3Q5SA 1RE4B 3F5HA 4GIFA 2XNXA 5AVYB 2V7QJ 1N2DC 2E76B 1GL2B 2QG4A 4PV1D 2NPSB 2GA1A 4WY4A 4GDOA 1L0LD 2N1TB 1H89A 4ZNCA 2E5YA 2FYNC 1ZLLA 3CMAP 1SQPK 2JP3A 1S5LE 1FZFA 1FZEB 3M9BA 1JY2N 1GDTA 1BSHA 1LWUB 2JHMF 1NOHA 3E1IB 1BGYE 3I5CA 2IX7C 2IBZG 2IDBA 1ZP0C 1SS1A 1JMBA 2E76D 2NPSD 1Y8AA 2N1TD 2K3RA 1KZUB 2WSEJ 3M0DA 1FZCC 1GL2A 3A0BE 1VQ9P 1ZV8A 2FYUJ 4UB6H 1NTMG 3A2AA 3TGUJ 1KC8Q 1T2KD 5CBOA 1VQOP 4Y99C 3L35A 2HLOC 2M3BA 1D7MA 5AW7B 3L74D 3AEEC 1HGVA 4DOJA 1SQBG 1BCCE 1EDJA 1P84I 2A45H 5H2FH 1BE3E 5M1BA 3L74E 1KQGB 5CCHD 1SQXG 2FYZA 4WB4A 3JCUH 4DT0A 5B66H 1VPCA 1EDKA 1WRGA 3HE4A 1YTZT 5APVA 1YQ3C 2WSCH 5AW1B 2YKQA 5AVRB 3L72G 1S3JA 2FXPA 3L73G 3TK1A 2ZFCA 2I1JA 5APYA 3Q5RA 3P32A 4I7ZB 2ZYDA 1AFOA 1GMJA 3V2RA 1RE3C 2KZIA 2W8ZA 2J60A 1YYCA 5APQA 4C46A 4PV1C 4UB6E 2KYVA 2QM7A 1M8OB 3AEBC 3AEGC 2ZAEB 5APUA 2D2CB 1BGYG 1NVOA 4LC1A 1L0LG 5EFWB 1RE4C 1MFTA 3CCLP 1HGZA 4U7JA 3GHGB 5KLVJ 1NTMJ 1FDOA 3BASA 4JYCA 2E76C 2K88A 2AEMA 2PRRA 2WSFJ 1GL2C 4N78D 1FIDA 4L75A 4W7YA 1L4AB 1JB0J 1LP1B 2C0WA 3P8CD 3CCMP 2N1TC 2XKMA 2D2CD 3JCUE 3H1LD 1FZEC 1IK9A 1VQ7P 1SQBJ 1LWUC 1HF9A 3N7NA 3SWYA 3E1IC 1NU1D 3VTPC 1PP9D 1RQVA 4JPZB 1Q86Q 3H1LE 1H0TB 1P84D 3B8EB 3L75E 3M91A 1BCCG 1L4AD 1EXJA 3VMYA 3F89A 4C7NB 2XNDH 2ZXXA 3L74G 1RF0A 1IC2A 3H1HE 3L72J 5CCHC 3PJSK 1FZDA 3L73J 1ZW0A 1OWAA 1J1EB 1S5LX 1TU3F 1U7JA 5CBNA 1NTZE 2MJZA 3CX5H 2KS1B 3RBZA 5KLIB 4KHXA 3HE5A 1T8ZA 3IAOA 3MZWB 1N86A 3L71E 2IBZI 5AVTB 1L0LJ 2HR3A 2M5AB 1AA0A 4XE5B 1IFPA 2BEQD 3LIDA 1N73B 1AQ5A 2OYHB 3CCSP 1MFZA 4YTPC 1VQNP 1NTKE 3SSUA 1ZOYC 3LW5H 1KQLA 2ZYAA 1CZQA 1N8RQ 2J3FA 3VMZA 1KILB 5CCGA 2FXOA 1SQQE 1HUCA 4H0LC 3VOPA 4D6TE 2FXMA 4ZKUA 4I7ZC 2A45G 1M56D 3KZIH 2BASA 2YO2A 2WPSA 1KMIZ 3WU2H 3CL3D 1OMIA 3VMAA 1K8AQ 1YI2P 3OAKA 2FYUK 4A7PA 3RGUA 1FU1A 2D2CC 4XA4A 2Q9IA 3H25A 3CX5E 1KILD 2W6JH 1PGJA 2B87A 3H1LG 2G3AA 3S1KA 3C9IA 2JHIF 3D6YA 2QVAA 2POHA 3GHGC 2XZRA 3RK3E 1PP9G 1URQB 3H1IE 1LT9A 1L4AC 4RKUJ 3A7OA 3CMEP 1T3UA 1FZBB 1GU4A 2ITAA 3G6EP 2OGUA 2GM4A 2KNCB 3FXEA 5KJ7D 5AVZB 1JMMA 4U3FJ 2IYPA 2HODB 1M1JB 1NTZG 1YITP 1NYHA 1JNMA 2L5GB 1URQD 2GY7A 4I6MC 1YJ9P 1X9VA 2FFDB 1G2CB 2KXPB 4PJ0H 1IK7A 3CCJP 2J61A 4AYCA 3KZIE 3V4QA 2OTLP 3Q5PA 3CCVP 3WU2E 3AEFC 2PGDA 1G1IA 5APSA 3C8VA 3CXHH 2KOGA 4BXLA 1L0NE 2QJPC 1J1EC 1OXZA 1SFCB 5GTIH 1NTKG 2KNCA 1Y9BA 1VQLP 2C9LY 2O3JA 2XV5A 5TISE 1HH0A 5KLIC 1JC9A 1K05A 3VP9A 1SP4A 3BCCE 1DEEG 4OH8B 1SQQG 2W90A 1NTMK 4D6TG 1FZCA 1Z3SA 2WPVB 2JR8A 1GW4A 3RBXA 1RQUA 1HTLC 2WSCJ 4WVZA 4M3LA 1SFCD 4YPCA 4CPGA 2KLVA 1NU1J 1SQBK 3Q1MA 2OYHC 1R5LA 2HLOA 4RO0A 2Y9ZA 1PP9J 2RKLA 4NPEA 5AVWB 2AEJA 1VQPP 1W2EA 3NFQA 1KILC 1SQXK 2BEZF 2W27A 1BDCA 2YXRB 2KIKA 1JEKA 2OYIB 4LGDE 2W6AA 2E42A 2O01H 3QWOC 2IPPA 2C0XA 1EDIA 5BU8B 4H13B 3BRVB 2O1JA 3CXHE 2XDJA 3Q3DA 1KYOE 3M06A 1JY3N 2JKVA 2YXQB 5AVQB 1MZ9A 4GKGA 5GTIE 2RN0A 1JM0A 4PD4E 2GUVA 1X0TA 3TNUA 2WT7B 3G71P 3RL0g 1SQVD 1BGYD 2H8PD 2QJYB 3V2PA 4JYBA 2OQQA 4IL6E 4DZOA 4R9JA 3T97B 2W6BA 1RE3A 1URQC 1UIXA 2N9YB 4H13D 1NAFA 1OZHA 3K5BA 3O6QB 2WNPF 1SQVE 3MGNA 2LXCB 5GTHH 2JWDA 1OW7A 1L0LK 3E1RA 2N9BA 1FZBC 1GK6A 4RESB 1SQPE 1L0NG 1S2EA 2Y0DA 2M3EA 4HJGH 3FIBA 1AQTA 2A45I 1M7LA 1RE4A 1RF1B 2HODC 1M1JC 2RH0A 1HBWA 1AJYA 1S4XA 3SWKA 2Q7CA 3HUSB 2H88C 1JY2O 3BVHB 4AQRD 3KYQA 4ZKPA 2HG5D 1IFIA 3C1LA 2FFDC 2NPSA 5DJTB 2A06E 3SFEC 2N1TA 1U7MA 1L2PA 1BCCD 1FZEA 3OA7A 1PGPA 5TJHA 3A5TA 1ZR4A 1LWUA 3E1IA 1BE3D 3H32B 2O1KA 1KB9H 4IFMA 1SFCC 4JF7A 2J59M 1GTWA 2QE7H 1YTZI 2KB7P 1OVUA 3PHLA 4BWNA 2QA4P 2AEFA 2YIUB 3ZDMA 3BVHA 4M7FA 3FGAD 1JTHB 3WUVA 3G4SP 1Y47A 3CWBE 2I1KA 3H1JE 2PAJA 1NO4A 3B4SA 2KUBA 5GTHE 1Z3UA 3FWNA 5CCHA 3PRJA 2CPSA 4OVNF 3TSIA 3B5ND 3FXDA 2FY8A 1RHZB 4AUWA 2CPBA 1H88A 3R2PA 1DIPA 5KTBA 1ZMEC 3V4WA 1OVVA 1NH4A 4HB1A 2OYIC 1EZVD 3CI9A 4R4LA 3SFDC 1SQVG 2WWWA 2ZT9B 1A02J 1ZN5A 4H13C 3NTNA 2QJKB 5B5EH 1S1CX 1HJ0A 1EZVE 2E75B 3RL0B 1KB9E 2YKPA 3AE6C 2J58A 3CCRP 4TT3H 5DJUB 1YJWP 1K9MQ 1ZRTE 2IZ0A 2NPSC 3D6ZA 2H43B 1EC5A 2QJYC 3I55P 2PFXA 2ZT9D 2KP8A 2V7QH 3L70D 4WBAA 3U1CA 4H44B 2M8RA 1FJPA 5BVZA 3CX5I 3L75D 3MIWA 2WITA 2E75D 3RL0D 2IYOA 1T2KC 1SQXJ 3L70E 3A0HH 3ABVC 3H1HD 1NU1K 1VL2A 1N7SB 1RF1C 1KV4A 2BCCD 2YKOA 1NHLA 3GHGA 3S4RA 1BE3G 2WMMA 3BVHC 1VQ8P 2Z4EB 1NTZD 4H44D 2BCCE 1L4AA 1HWTC 1LP1A 3CC7P 3CWBG 2JDIH 2FKWB 4HYTB 1OFCX 1E79H 3L71D 5APTA 5AW5B 5KAIH 2WSEH 1NJIQ 1KFMA 5B5EE 3H32C 3H1KE 1N7SD 3AE5C 1H0TA 2QSIA 3AE8C 5AVVB 1PGOA 2J0GA 3TYYA 1DX7A 1BGYJ 1NKZB 4IFDK 4IOIH 1NTKD 3D71A 2YIUC 4C7NA 1JCCA 1BDDA 3W67A 3AEAC 1EDLA 1SQQD 5CJ0A 4OGQD 4D6TD 4KJMA 1HVVA 1FZAB 3A0HE 2ZYGA 1EZVG 3H6PA 3RK3B 3CCUP 1IFNA 3WMM0 3U1AA 2KS1A 3AE2C 3R4YA 4NYTA 1JCDA 2AXCA 1CSBA 2IFNA 1JOCA 3CX5D 2K9JB 3WUTA 1PZQA 1RH5B 2WQYC 1FDIA 2ZVNB 3EFGA 2DW3A 4OWFA 4JZCA 1USDA 1VF5B 2M5AA 1DEBA 1M1KQ 3GF3A 5L8RJ 1BCCJ 3CLQA 2R32A 2ZT9C 3RK3D 1N73A 5KAIE 2QJKC 1BE3J 3QH9A 2OYHA 3L74J 3H1ID 2J1GA 4KT0J 5TISH 5CHXA 3IFMA 1CI6B 2E75C 3RL0C 2FYUE 3L70G 1PGQA 2JHHC 2H7HA 3L75G 3TGUE 2HYNA 1QVGO 1KILA 5E79H 1VF5D 3CXHI 1S9KE 1KYOI 3H1HG 4GOEA 1MUUA 2BCCG 4EPUA 3WUUA 5BU5A 4H44C 2YMKA 4PD4I 2B89A 2WSFH 5CMZA 1WT6A 3RK2B 5AW4B 3V6IA 1JY2P 3OJAB 1IFDA 2WPQA 2JWAA 1PL5A 3AE4C 5KJ7A 3L71G 1N7SC 1L0ND 2P67A 1Q2NA 2Y9YA 1WMKA 1ZXGA 3NMDA 3CD6P 1KFNA 1URQA 1FJKA 4GT1A 2Q5UA 1IFJA 1KYOH 1FZBA 3RK2D 3BCCD 3HD7B 1LTGC 4UB8H 4PD4H 1X79B 1DD4A 3O8ZA 1LGHB 1FZGB 1E5WA 2HODA 5AW6B 4ASWA 1M1JA 3GW6A 1USEA 3V2NA 2PP6A 4IL6H 5AW3B 3L37A 2J2PA 3BATA 4BRYB 1QX8A 3M9QA 5KLVD 5E79E 5AW9B 2FFDA 1G2CA 2HPCB 4JYOX 5KAFH 1R5SA 3H1LJ 4GODA 1LJ2A 3HD7D 3HTKB 1EXIA 1LTJB 1FS0E 5KLVE 1NTME 1N73C 3L75J 3TF5A 1JO5A 1LTAC 4I2LC 2FBWC 2B9BA 2I8DA 2XNXB 3KDPB 1W2BO 2KSJA 1LTSC 4XFJA 1OW6A 1SFCA 3RK3C 3H1HJ 1SQBE 3CXHD 5K5GB 4DJGA 3TGUG 3USSA 1KYOD 4WY4B 1YBKA 3VP8A 1AVYA 3H1IG 2YMYA 1FZFB 4YXWH 1NTZJ 4BRYA 2YNYA 4ZMDA 4PD4D 1GZLA 2ZXEB 5C39A 1VF5C 4K3AA 1A02F 1XTCC 2KI7B 1JUNA 3L71J 4UB8E 3IR9A 2SPZA 4EIJA 2R3CA 2E43A 5KJ7C 2QRXA 3Q2YA 3P8MC 2J64A 3P7KA 4WY4D 2R44A 1M57D 1FOSF 2JO1A 3L72E 2W83C 3MUDA 2E74B 3L73E 1IZNB 1SQPD 4L73A 2P2UA 5KAFE 2MKVA 1EQ7A 1NTKJ 2XU6A 1SQVK 1JY3O 2JHKF 2OYIA 3S9OA 1VQ6P 2OTKE 1UIIA 3AE1C 1EZVI 2WZ7A 4ASVA 1KB9I 2KSEA 2P58A 3E7KA 3V5BA 1HJBA 2QEXP 3ITKA 1SQQJ 4D6TJ 5KKZB 3CC2P 2QIWA 2A06D 1L0LE 3G3ZA 3RK2C 2E74D 1X8YA 3N4XA 2KK7A 3U59A 4LLHA 1QEXA 3BCCG 1GL2D 2WT7A 3FWLA 1AV1A 2Y0CA 1OIPA 1KORA 3T97A 3G9RA 2P7JA 3AECC 4R4MA 3O6QA 3NXSA 3TDKA 2J3GA 1Z56A 3HE4B 5KLVG 1OVRA 3PTZA 3HD7C 4IFFA 3B71A 1YHQP 3CWBD 5AW0B 2J5ZA 3H1IJ 2JEEA 3B5NB 3H1JD 3KHUA 1FZGC 1RF1A 2WPRA 2B88A 1U57A 3HUSA 1YIJP 2OYOA 3IF4A 2HPCC 3LW5J 1NKNA 4L74A 3HRNA 1LTJC 2K1AA 3EQ2A 3H32A 2XNXC 3MUDC 1PV3A 4U3FD 1IO4A 2JJLA 2J0YA 3B5NA 1L0NJ 3A3YB 5AVXB 1Q81Q 4WY4C 4H0LB 1KB9D 4U3FE 1FZFC 3MTUE 1JTHA 4N6JA 1YJNP 4O9BA 1P84H 1ZRTD 3M0AA 1SQPG 1FDMA 3BCCJ 3EFFK 1KTMA 1FIBA 2R5DA 2J5UA 1LTBC 1GD2E 4H0LD 1CW5A 2E74C 3SWFA 2NZ2A 4WWIA 2A06G 3M0DC 1RF0B 3GMAA 5H2FE 2QM8A 2JHLF 1GW3A 3GLMA 1KQFB 4R9TA 4TLFA 1LNQA 2J3UA 3BRTB 3FX0A 1LT1A 4N78E 5B66E 3CC4P 2K37A 1NGMB 2YO3A 5KKZC 2ZVOB 1KD1Q 2ZJSE 3P8CE 3HE5B 3HUSC 1KN7A 4HH2A 1N86B 4JQ0D 3L36A 1LTTC 4C7RA 3MD0A 1NU1E 1VDFA 2H43A 3H1KD 5AVUB 1PP9E 4IL6X 1RY3A 2WSSH 3H1JG 4NPFX 4Y28J 4M7HA 1P84E 1NTZK 2C9NY 2J0HA 1ZR2A 2Y0EA 4OGQB 2QJPB 4N3YB 2GUSA 3AE9C 3MP7B 2KLUA 2WVRA 3B5NC 1SQVJ 1N7SA 2LR2A 2OTJP 4ZFGA 1SQPJ 3I56P 3GF7A 2AXTH 1PIXA 2Z4EA 2WTYA 5AW8B 4NPDA 1NAYA 3EWKA 1M90Q 2M0BA 4U3FG 3AE3C 1NTKK 3CPWO 2Q3IA 2Q9IB 2VRSA 1Q82Q 2J3FD 2J3OA 1GK4A 5CCGD 1J1DB 1SQQK 2B87B 2Q3EA 2O01J 1S72P 2Q1KA 4JBZA 1J2JB 1Q90D 1OX3A 3VMXA 2OARA 3GG2A 4EI2A 1LT9B 4YXDC 1W5CE 2R3SA 2FYUD 1PPJD 1QL2A 5APWA 3MHVA 3IN6A 3TGUD 2P10A 1QL1A 3CCEP 1VQ5P 2IFMA 1LTIC 1PFIA 1S9KD 1PPJE 3VYIA 1FZAA 1MV8A 3CWBJ 1VQKP 3H1JJ 1T3JA 1N7LA 2H43C 1JY3P 2J61B 1FE6A 2IZ1A 1XTGB 2AXTE 2FYNB 1NU1G 3V2QA 1RF0C 1KILE 2K9JA 4MN4C 2Z5HA 5AW2B 1FICA 1IJDB 1T6AA 1K73Q 1SLQA 1R8EA 1AVOA 2R5BA 1DH3A 3H1KG 3KXDA 2H89C 4EOTA 1CI6A 1MKMA
chains in the Genus database with same CATH topology
1FOSF 3HE5A 4AUWA 2CPBA 3MUDA 1T8ZA 1H88A 4B86A 3R2PA 1N86C 1N86A 2LKMA 2Z4EC 1FZCB 5KTBA 2P2UA 1EQ7A 3V4WA 1NH4A 2XU6A 1SQVK 1JY3O 5AVTB 2JHKF 2OYIC 2OYIA 1L0NK 2Z5IA 3CI9A 2WZ7A 2D39A 4XE5B 3V5BA 2WWWA 1HJBA 1A02J 1ZN5A 3LIDA 4Y99B 1N73B 3NTNA 1AQ5A 2OYHB 2HLOB 1MFZA 3RL0B 3LW5H 3G3ZA 2YKPA 3RK2C 1KQLA 1X8YA 2J58A 3N4XA 1CZQA 3U59A 2J3FA 4W7ZA 4LLHA 3VMZA 3PP5A 5CCGC 1KILB 5CCGA 5CJ4A 5AVSB 1GL2D 1G1JA 2NPSC 1HUCA 2WT7A 3VOPA 2H43B 2FXMA 4ZKUA 2A45G 2P1JA 3T97A 2BASA 2YO2A 2P7JA 3II6A 2KP8A 5KLVK 2WPSA 4I1LA 4WBAA 3U1CA 2M8RA 3CL3D 3NXSA 1FOSE 1FJPA 2J3GA 5BVZA 3OAKA 1Z56A 3MIWA 3HE4B 2WITA 2FYUK 3RL0D 3M9HA 1FU1A 1FZAC 4XA4A 1T2KC 3HD7C 3HD7A 2Q9IC 2Q9IA 1NWQA 3P7KA 4IFFA 1GU5A 5AW0B 1KILD 2J5ZA 2JEEA 1J1DC 3B5NB 1NU1K 2FIBA 3TNUB 3C9IA 1N7SB 2JHIF 1SVFA 1RF1A 1FZGA 1RF1C 1FZGC 2WPRA 2YKOA 1NHLA 2POHA 5APXA 3GHGC 2HFED 3GHGA 2XZRA 3HUSA 3BVHC 1RE3B 3UIAA 3VN0A 2Z4EB 1URQB 2HPCC 2HPCA 1LT9C 1LT9A 1NKNA 1FBMA 1L4AC 1L4AA 1HWTC 3KPEA 3HRNA 1H8AA 2FKWB 3A7OA 3L4FA 4HYTB 1T3UA 1FZBB 1GU4A 3HTKA 1LTJC 1LTJA 2GM4A 5APTA 3KQGA 1FAVA 5AW5B 2WSEH 4W80A 1KFMA 3EQ2A 1IFMA 5KJ7D 3LIEA 3H32A 3H32C 1N7SD 1RE4B 4GIFA 5AVZB 1JMMA 2XNXC 2XNXA 2HODB 1M1JB 5AVYB 1IO4A 2JJLA 1JNMA 2L5GB 5AVVB 1N2DC 1URQD 2J0GA 2GY7A 3TYYA 4I6MC 1DX7A 1GL2B 2J0YA 1X9VA 3B5NA 2FFDB 1G2CB 1NKZB 4IFDK 3A3YB 5AVXB 2NPSB 4WY4C 4WY4A 2J61A 4AYCA 3V4QA 2N1TB 1H89A 4C7NA 1JCCA 1ZLLA 1SQPK 3MTUE 1FZFA 1FZFC 1JTHA 4N6JA 1FZEB 3M9BA 4O9BA 1G1IA 5APSA 1JY2N 1GDTA 1LWUB 3M0AA 1NOHA 2JHMF 3E1IB 2KOGA 5CJ0A 3I5CA 2IX7C 1FDMA 1HVVA 1J1EC 1FZAB 1FIBA 1OXZA 1SFCB 3H6PA 3RK3B 1IFNA 3WMM0 3U1AA 2C9LY 2R5DA 2XV5A 1HH0A 2NPSD 1LTBC 1GD2E 1JC9A 1CW5A 3VP9A 1SP4A 3SWFA 2N1TD 4OH8B 4NYTA 1JCDA 1KZUB 1CSBA 2IFNA 1NTMK 3M0DC 3M0DA 1FZCC 1FZCA 1Z3SA 1JOCA 1RF0B 1GL2A 2QM8A 1GW4A 2JHLF 1HTLC 1ZV8A 3EFGA 4JZCA 1GW3A 1DEBA 4R9TA 2J3UA 3A2AA 4M3LA 3CLQA 1T2KD 2R32A 1SFCD 3RK3D 3BRTB 4Y99C 1N73A 4N78E 2KLVA 3L35A 1SQBK 2OYHA 2YO3A 2OYHC 2HLOC 2HLOA 2M3BA 2J1GA 5CHXA 3IFMA 5AW7B 1CI6B 3RL0C 5AVWB 3P8CE 3HE5B 1HGVA 4DOJA 3HUSC 2H7HA 2JHHC 4HH2A 1W2EA 1N86B 2HYNA 3L36A 1LTTC 3NFQA 1KILC 1KILA 1SQXK 2W27A 4C7RA 2A45H 3MD0A 1VDFA 2H43A 5AVUB 2OYIB 4LGDE 1RY3A 5CCHD 1S9KE 2W6AA 2E42A 2FYZA 4WB4A 2O01H 4M7HA 2IPPA 1MUUA 2C0XA 4EPUA 5BU8B 1NTZK 5BU5A 3BRVB 2O1JA 2XDJA 1VPCA 1WRGA 2C9NY 2J0HA 1ZR2A 2WSFH 3HE4A 3M06A 1YTZT 5CMZA 5APVA 4N3YB 1WT6A 1JY3N 3RK2B 5AVQB 1MZ9A 4GKGA 2WSCH 2GUSA 5AW4B 1JY2P 3OJAB 5AW1B 1IFDA 2YKQA 2WPQA 5AVRB 2GUVA 3B5NC 5KJ7A 3TK1A 3TNUA 2ZFCA 2WT7B 2I1JA 1N7SC 1N7SA 5APYA 2H8PD 3P32A 2P67A 3V2PA 4JYBA 4ZFGA 4DZOA 4R9JA 1AFOA 3V2RA 3NMDA 2W6BA 1RE3C 1RE3A 1KFNA 2Z4EA 1URQC 1URQA 5AW8B 2WTYA 1NAFA 2J60A 1YYCA 5APQA 4C46A 1FJKA 2WNPF 2KYVA 4GT1A 2QM7A 3MGNA 1NTKK 2Q5UA 1IFJA 5APUA 1L0LK 2N9BA 1FZBC 1FZBA 3RK2D 1GK6A 2Q3IA 4RESB 3HD7B 2Q9IB 1LTGC 2VRSA 4LC1A 2J3FD 2J3OA 1GK4A 5CCGD 3FIBA 1J1DB 1X79B 1SQQK 4KHXA 2A45I 3O8ZA 1M7LA 1RE4C 1RE4A 1LGHB 1RF1B 1E5WA 2HODC 2HODA 1HGZA 5AW6B 1M1JC 1M1JA 1HBWA 1FZGB 3V2NA 2PP6A 3GHGB 1J2JB 3HUSB 2Q7CA 1JY2O 5AW3B 3L37A 3BVHB 3BASA 4AQRD 4JYCA 3BATA 2J2PA 3KYQA 4ZKPA 2HG5D 3M9QA 3VMXA 1IFIA 2OARA 1GL2C 4N78D 5AW9B 2FFDC 2FFDA 1FIDA 1G2CA 2HPCB 4JYOX 1LT9B 2NPSA 4W7YA 1L4AB 2C0WA 3P8CD 2N1TC 2N1TA 2XKMA 3HD7D 3HTKB 1QL2A 1LTJB 1FZEA 3OA7A 5APWA 1FZEC 1N73C 3A5TA 1IK9A 1QL1A 1ZR4A 1LWUC 1LWUA 1LTAC 1JO5A 3N7NA 3E1IA 4I2LC 3SWYA 3E1IC 2IFMA 3H32B 1LTIC 3VTPC 2O1KA 1PFIA 2XNXB 3KDPB 1S9KD 3VYIA 2KSJA 1LTSC 1FZAA 1MV8A 4IFMA 1SFCC 1SFCA 4JF7A 3RK3C 1T3JA 2J59M 1GTWA 3B8EB 1N7LA 2H43C 1JY3P 1YTZI 3M91A 1L4AD 2KB7P 4WY4B 2J61B 3VMYA 3VP8A 1XTGB 2YMYA 4C7NB 1FZFB 3BVHA 4M7FA 1JTHB 2YNYA 3V2QA 1RF0C 1RF0A 1GZLA 2ZXEB 1IC2A 2I1KA 2PAJA 2Z5HA 5AW2B 1FICA 1NO4A 1Z3UA 1IJDB 1A02F 1XTCC 5CCHC 5CCHA 1FZDA 1SLQA 2CPSA 1JUNA 2R5BA 1DH3A 1OWAA 1J1EB 3IR9A 4EIJA 2R3CA 2MJZA 2E43A 3TSIA 5KJ7C 3B5ND 4EOTA 3P8MC 2J64A 1CI6A 4WY4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9T A;  2J3U A;  3FIB A;  2HPC C;  2HPC A;  2A45 I;  1LT9 C;  1LT9 A;  1N86 C;  1N86 A;  1RE4 C;  1RE4 A;  2Z4E C;  1RF1 B;  1FZG B;  2HOD C;  2HOD A;  1FZC B;  1N73 A;  1M1J C;  1M1J A;  1T3U A;  3GHG B;  1FZB B;  2OYH C;  2OYH A;  2HLO C;  2HLO A;  3HUS B;  1JY2 O;  2J1G A;  1LTJ C;  1JY3 O;  1LTJ A;  2JHK F;  2OYI C;  2OYI A;  2J2P A;  3BVH B;  3HUS C;  2FFD C;  2FFD A;  1FID A;  2JHH C;  2HPC B;  2D39 A;  3H32 C;  3H32 A;  1W2E A;  4JYO X;  1LT9 B;  1N86 B;  1RE4 B;  2XNX C;  2XNX A;  2HOD B;  1N73 B;  1M1J B;  2A45 H;  2OYH B;  2HLO B;  2H43 A;  1LTJ B;  1FZE A;  1FZE C;  2OYI B;  1N73 C;  2J0G A;  2GY7 A;  2J0Y A;  1LWU C;  1LWU A;  2FFD B;  4M7H A;  3E1I C;  3E1I A;  3H32 B;  2J3F A;  2J61 A;  4EPU A;  2XNX B;  1FZA A;  2J0H A;  1FZF A;  1FZF C;  2H43 B;  1FZE B;  2A45 G;  1JY2 N;  1JY3 N;  1LWU B;  2JHM F;  1JY2 P;  3E1I B;  2H43 C;  1JY3 P;  2J61 B;  1FZA B;  2J3G A;  1FIB A;  1FZF B;  3BVH A;  4M7F A;  1RF0 C;  1RF0 A;  4ZFG A;  1FZA C;  4R9J A;  1FIC A;  2Q9I C;  2Q9I A;  1Z3U A;  1RE3 C;  1RE3 A;  1JC9 A;  2Z4E A;  1FZD A;  2J5Z A;  2J60 A;  2WNP F;  4NYT A;  2FIB A;  2JHI F;  1RF1 C;  1RF1 A;  1FZG A;  1FZG C;  1FZC C;  1FZC A;  1Z3S A;  1RF0 B;  1FZB C;  1FZB A;  3GHG A;  3GHG C;  3HUS A;  2JHL F;  3BVH C;  2Q9I B;  4JZC A;  1RE3 B;  2J64 A;  2J3F D;  2J3O A;  2Z4E B; 
#chains in the Genus database with same CATH topology
 4QMA A;  3PLN A;  1Q7Y Q;  4B86 A;  2CK3 H;  2NRG A;  1N86 C;  2LKM A;  2Z4E C;  1FZC B;  1VQ4 P;  2IBZ D;  3W68 A;  2LXB A;  4K35 A;  1L0N K;  2Z5I A;  2KZJ A;  4RJT A;  2L91 A;  2D39 A;  4DCK A;  2IBZ E;  4Y99 B;  3D70 A;  1DD3 A;  2HLO B;  4OGQ C;  1QGK B;  1FC2 C;  2K9Y A;  1QVF O;  2UWJ E;  1VQM P;  4EDF A;  4W7Z A;  1NTM D;  2Q6Q A;  3PP5 A;  5CCG C;  5CJ4 A;  5AVS B;  1G1J A;  1YQ4 C;  4GOF A;  1X22 A;  3PH0 A;  2P1J A;  3L70 J;  3II6 A;  1QLE D;  5KLV K;  4I1L A;  1S5L H;  1FOS E;  1SQB D;  4EYY Q;  2V4H A;  3M9H A;  3CCQ P;  1KQS O;  1FZA C;  3HD7 A;  2Q9I C;  3AE7 C;  1NWQ A;  1GU5 A;  2FYU G;  1PPJ G;  1SQX D;  1J1D C;  1BSN A;  2BCC J;  2E5T A;  2FIB A;  3TNU B;  1SVF A;  1FZG A;  2RMZ A;  5APX A;  2HFE D;  4Z1M H;  4HKZ H;  1RE3 B;  3UIA A;  3VN0 A;  1SQX E;  3JC2 2;  4PJ0 E;  2HPC A;  3H1K J;  4PV1 B;  1LT9 C;  2O01 N;  3A0B H;  1FBM A;  3KPE A;  3AED C;  1H8A A;  3L4F A;  3OW2 O;  3JSV C;  3L72 D;  3L73 D;  1OW8 A;  1K04 A;  3HTK A;  1LTJ A;  3KQG A;  1FAV A;  4L76 A;  4W80 A;  2G8Y A;  1IFM A;  3LIE A;  3Q5S A;  1RE4 B;  3F5H A;  4GIF A;  2XNX A;  5AVY B;  2V7Q J;  1N2D C;  2E76 B;  1GL2 B;  2QG4 A;  4PV1 D;  2NPS B;  2GA1 A;  4WY4 A;  4GDO A;  1L0L D;  2N1T B;  1H89 A;  4ZNC A;  2E5Y A;  2FYN C;  1ZLL A;  3CMA P;  1SQP K;  2JP3 A;  1S5L E;  1FZF A;  1FZE B;  3M9B A;  1JY2 N;  1GDT A;  1BSH A;  1LWU B;  2JHM F;  1NOH A;  3E1I B;  1BGY E;  3I5C A;  2IX7 C;  2IBZ G;  2IDB A;  1ZP0 C;  1SS1 A;  1JMB A;  2E76 D;  2NPS D;  1Y8A A;  2N1T D;  2K3R A;  1KZU B;  2WSE J;  3M0D A;  1FZC C;  1GL2 A;  3A0B E;  1VQ9 P;  1ZV8 A;  2FYU J;  4UB6 H;  1NTM G;  3A2A A;  3TGU J;  1KC8 Q;  1T2K D;  5CBO A;  1VQO P;  4Y99 C;  3L35 A;  2HLO C;  2M3B A;  1D7M A;  5AW7 B;  3L74 D;  3AEE C;  1HGV A;  4DOJ A;  1SQB G;  1BCC E;  1EDJ A;  1P84 I;  2A45 H;  5H2F H;  1BE3 E;  5M1B A;  3L74 E;  1KQG B;  5CCH D;  1SQX G;  2FYZ A;  4WB4 A;  3JCU H;  4DT0 A;  5B66 H;  1VPC A;  1EDK A;  1WRG A;  3HE4 A;  1YTZ T;  5APV A;  1YQ3 C;  2WSC H;  5AW1 B;  2YKQ A;  5AVR B;  3L72 G;  1S3J A;  2FXP A;  3L73 G;  3TK1 A;  2ZFC A;  2I1J A;  5APY A;  3Q5R A;  3P32 A;  4I7Z B;  2ZYD A;  1AFO A;  1GMJ A;  3V2R A;  1RE3 C;  2KZI A;  2W8Z A;  2J60 A;  1YYC A;  5APQ A;  4C46 A;  4PV1 C;  4UB6 E;  2KYV A;  2QM7 A;  1M8O B;  3AEB C;  3AEG C;  2ZAE B;  5APU A;  2D2C B;  1BGY G;  1NVO A;  4LC1 A;  1L0L G;  5EFW B;  1RE4 C;  1MFT A;  3CCL P;  1HGZ A;  4U7J A;  3GHG B;  5KLV J;  1NTM J;  1FDO A;  3BAS A;  4JYC A;  2E76 C;  2K88 A;  2AEM A;  2PRR A;  2WSF J;  1GL2 C;  4N78 D;  1FID A;  4L75 A;  4W7Y A;  1L4A B;  1JB0 J;  1LP1 B;  2C0W A;  3P8C D;  3CCM P;  2N1T C;  2XKM A;  2D2C D;  3JCU E;  3H1L D;  1FZE C;  1IK9 A;  1VQ7 P;  1SQB J;  1LWU C;  1HF9 A;  3N7N A;  3SWY A;  3E1I C;  1NU1 D;  3VTP C;  1PP9 D;  1RQV A;  4JPZ B;  1Q86 Q;  3H1L E;  1H0T B;  1P84 D;  3B8E B;  3L75 E;  3M91 A;  1BCC G;  1L4A D;  1EXJ A;  3VMY A;  3F89 A;  4C7N B;  2XND H;  2ZXX A;  3L74 G;  1RF0 A;  1IC2 A;  3H1H E;  3L72 J;  5CCH C;  3PJS K;  1FZD A;  3L73 J;  1ZW0 A;  1OWA A;  1J1E B;  1S5L X;  1TU3 F;  1U7J A;  5CBN A;  1NTZ E;  2MJZ A;  3CX5 H;  2KS1 B;  3RBZ A;  5KLI B;  4KHX A;  3HE5 A;  1T8Z A;  3IAO A;  3MZW B;  1N86 A;  3L71 E;  2IBZ I;  5AVT B;  1L0L J;  2HR3 A;  2M5A B;  1AA0 A;  4XE5 B;  1IFP A;  2BEQ D;  3LID A;  1N73 B;  1AQ5 A;  2OYH B;  3CCS P;  1MFZ A;  4YTP C;  1VQN P;  1NTK E;  3SSU A;  1ZOY C;  3LW5 H;  1KQL A;  2ZYA A;  1CZQ A;  1N8R Q;  2J3F A;  3VMZ A;  1KIL B;  5CCG A;  2FXO A;  1SQQ E;  1HUC A;  4H0L C;  3VOP A;  4D6T E;  2FXM A;  4ZKU A;  4I7Z C;  2A45 G;  1M56 D;  3KZI H;  2BAS A;  2YO2 A;  2WPS A;  1KMI Z;  3WU2 H;  3CL3 D;  1OMI A;  3VMA A;  1K8A Q;  1YI2 P;  3OAK A;  2FYU K;  4A7P A;  3RGU A;  1FU1 A;  2D2C C;  4XA4 A;  2Q9I A;  3H25 A;  3CX5 E;  1KIL D;  2W6J H;  1PGJ A;  2B87 A;  3H1L G;  2G3A A;  3S1K A;  3C9I A;  2JHI F;  3D6Y A;  2QVA A;  2POH A;  3GHG C;  2XZR A;  3RK3 E;  1PP9 G;  1URQ B;  3H1I E;  1LT9 A;  1L4A C;  4RKU J;  3A7O A;  3CME P;  1T3U A;  1FZB B;  1GU4 A;  2ITA A;  3G6E P;  2OGU A;  2GM4 A;  2KNC B;  3FXE A;  5KJ7 D;  5AVZ B;  1JMM A;  4U3F J;  2IYP A;  2HOD B;  1M1J B;  1NTZ G;  1YIT P;  1NYH A;  1JNM A;  2L5G B;  1URQ D;  2GY7 A;  4I6M C;  1YJ9 P;  1X9V A;  2FFD B;  1G2C B;  2KXP B;  4PJ0 H;  1IK7 A;  3CCJ P;  2J61 A;  4AYC A;  3KZI E;  3V4Q A;  2OTL P;  3Q5P A;  3CCV P;  3WU2 E;  3AEF C;  2PGD A;  1G1I A;  5APS A;  3C8V A;  3CXH H;  2KOG A;  4BXL A;  1L0N E;  2QJP C;  1J1E C;  1OXZ A;  1SFC B;  5GTI H;  1NTK G;  2KNC A;  1Y9B A;  1VQL P;  2C9L Y;  2O3J A;  2XV5 A;  5TIS E;  1HH0 A;  5KLI C;  1JC9 A;  1K05 A;  3VP9 A;  1SP4 A;  3BCC E;  1DEE G;  4OH8 B;  1SQQ G;  2W90 A;  1NTM K;  4D6T G;  1FZC A;  1Z3S A;  2WPV B;  2JR8 A;  1GW4 A;  3RBX A;  1RQU A;  1HTL C;  2WSC J;  4WVZ A;  4M3L A;  1SFC D;  4YPC A;  4CPG A;  2KLV A;  1NU1 J;  1SQB K;  3Q1M A;  2OYH C;  1R5L A;  2HLO A;  4RO0 A;  2Y9Z A;  1PP9 J;  2RKL A;  4NPE A;  5AVW B;  2AEJ A;  1VQP P;  1W2E A;  3NFQ A;  1KIL C;  1SQX K;  2BEZ F;  2W27 A;  1BDC A;  2YXR B;  2KIK A;  1JEK A;  2OYI B;  4LGD E;  2W6A A;  2E42 A;  2O01 H;  3QWO C;  2IPP A;  2C0X A;  1EDI A;  5BU8 B;  4H13 B;  3BRV B;  2O1J A;  3CXH E;  2XDJ A;  3Q3D A;  1KYO E;  3M06 A;  1JY3 N;  2JKV A;  2YXQ B;  5AVQ B;  1MZ9 A;  4GKG A;  5GTI E;  2RN0 A;  1JM0 A;  4PD4 E;  2GUV A;  1X0T A;  3TNU A;  2WT7 B;  3G71 P;  3RL0 g;  1SQV D;  1BGY D;  2H8P D;  2QJY B;  3V2P A;  4JYB A;  2OQQ A;  4IL6 E;  4DZO A;  4R9J A;  3T97 B;  2W6B A;  1RE3 A;  1URQ C;  1UIX A;  2N9Y B;  4H13 D;  1NAF A;  1OZH A;  3K5B A;  3O6Q B;  2WNP F;  1SQV E;  3MGN A;  2LXC B;  5GTH H;  2JWD A;  1OW7 A;  1L0L K;  3E1R A;  2N9B A;  1FZB C;  1GK6 A;  4RES B;  1SQP E;  1L0N G;  1S2E A;  2Y0D A;  2M3E A;  4HJG H;  3FIB A;  1AQT A;  2A45 I;  1M7L A;  1RE4 A;  1RF1 B;  2HOD C;  1M1J C;  2RH0 A;  1HBW A;  1AJY A;  1S4X A;  3SWK A;  2Q7C A;  3HUS B;  2H88 C;  1JY2 O;  3BVH B;  4AQR D;  3KYQ A;  4ZKP A;  2HG5 D;  1IFI A;  3C1L A;  2FFD C;  2NPS A;  5DJT B;  2A06 E;  3SFE C;  2N1T A;  1U7M A;  1L2P A;  1BCC D;  1FZE A;  3OA7 A;  1PGP A;  5TJH A;  3A5T A;  1ZR4 A;  1LWU A;  3E1I A;  1BE3 D;  3H32 B;  2O1K A;  1KB9 H;  4IFM A;  1SFC C;  4JF7 A;  2J59 M;  1GTW A;  2QE7 H;  1YTZ I;  2KB7 P;  1OVU A;  3PHL A;  4BWN A;  2QA4 P;  2AEF A;  2YIU B;  3ZDM A;  3BVH A;  4M7F A;  3FGA D;  1JTH B;  3WUV A;  3G4S P;  1Y47 A;  3CWB E;  2I1K A;  3H1J E;  2PAJ A;  1NO4 A;  3B4S A;  2KUB A;  5GTH E;  1Z3U A;  3FWN A;  5CCH A;  3PRJ A;  2CPS A;  4OVN F;  3TSI A;  3B5N D;  3FXD A;  2FY8 A;  1RHZ B;  4AUW A;  2CPB A;  1H88 A;  3R2P A;  1DIP A;  5KTB A;  1ZME C;  3V4W A;  1OVV A;  1NH4 A;  4HB1 A;  2OYI C;  1EZV D;  3CI9 A;  4R4L A;  3SFD C;  1SQV G;  2WWW A;  2ZT9 B;  1A02 J;  1ZN5 A;  4H13 C;  3NTN A;  2QJK B;  5B5E H;  1S1C X;  1HJ0 A;  1EZV E;  2E75 B;  3RL0 B;  1KB9 E;  2YKP A;  3AE6 C;  2J58 A;  3CCR P;  4TT3 H;  5DJU B;  1YJW P;  1K9M Q;  1ZRT E;  2IZ0 A;  2NPS C;  3D6Z A;  2H43 B;  1EC5 A;  2QJY C;  3I55 P;  2PFX A;  2ZT9 D;  2KP8 A;  2V7Q H;  3L70 D;  4WBA A;  3U1C A;  4H44 B;  2M8R A;  1FJP A;  5BVZ A;  3CX5 I;  3L75 D;  3MIW A;  2WIT A;  2E75 D;  3RL0 D;  2IYO A;  1T2K C;  1SQX J;  3L70 E;  3A0H H;  3ABV C;  3H1H D;  1NU1 K;  1VL2 A;  1N7S B;  1RF1 C;  1KV4 A;  2BCC D;  2YKO A;  1NHL A;  3GHG A;  3S4R A;  1BE3 G;  2WMM A;  3BVH C;  1VQ8 P;  2Z4E B;  1NTZ D;  4H44 D;  2BCC E;  1L4A A;  1HWT C;  1LP1 A;  3CC7 P;  3CWB G;  2JDI H;  2FKW B;  4HYT B;  1OFC X;  1E79 H;  3L71 D;  5APT A;  5AW5 B;  5KAI H;  2WSE H;  1NJI Q;  1KFM A;  5B5E E;  3H32 C;  3H1K E;  1N7S D;  3AE5 C;  1H0T A;  2QSI A;  3AE8 C;  5AVV B;  1PGO A;  2J0G A;  3TYY A;  1DX7 A;  1BGY J;  1NKZ B;  4IFD K;  4IOI H;  1NTK D;  3D71 A;  2YIU C;  4C7N A;  1JCC A;  1BDD A;  3W67 A;  3AEA C;  1EDL A;  1SQQ D;  5CJ0 A;  4OGQ D;  4D6T D;  4KJM A;  1HVV A;  1FZA B;  3A0H E;  2ZYG A;  1EZV G;  3H6P A;  3RK3 B;  3CCU P;  1IFN A;  3WMM 0;  3U1A A;  2KS1 A;  3AE2 C;  3R4Y A;  4NYT A;  1JCD A;  2AXC A;  1CSB A;  2IFN A;  1JOC A;  3CX5 D;  2K9J B;  3WUT A;  1PZQ A;  1RH5 B;  2WQY C;  1FDI A;  2ZVN B;  3EFG A;  2DW3 A;  4OWF A;  4JZC A;  1USD A;  1VF5 B;  2M5A A;  1DEB A;  1M1K Q;  3GF3 A;  5L8R J;  1BCC J;  3CLQ A;  2R32 A;  2ZT9 C;  3RK3 D;  1N73 A;  5KAI E;  2QJK C;  1BE3 J;  3QH9 A;  2OYH A;  3L74 J;  3H1I D;  2J1G A;  4KT0 J;  5TIS H;  5CHX A;  3IFM A;  1CI6 B;  2E75 C;  3RL0 C;  2FYU E;  3L70 G;  1PGQ A;  2JHH C;  2H7H A;  3L75 G;  3TGU E;  2HYN A;  1QVG O;  1KIL A;  5E79 H;  1VF5 D;  3CXH I;  1S9K E;  1KYO I;  3H1H G;  4GOE A;  1MUU A;  2BCC G;  4EPU A;  3WUU A;  5BU5 A;  4H44 C;  2YMK A;  4PD4 I;  2B89 A;  2WSF H;  5CMZ A;  1WT6 A;  3RK2 B;  5AW4 B;  3V6I A;  1JY2 P;  3OJA B;  1IFD A;  2WPQ A;  2JWA A;  1PL5 A;  3AE4 C;  5KJ7 A;  3L71 G;  1N7S C;  1L0N D;  2P67 A;  1Q2N A;  2Y9Y A;  1WMK A;  1ZXG A;  3NMD A;  3CD6 P;  1KFN A;  1URQ A;  1FJK A;  4GT1 A;  2Q5U A;  1IFJ A;  1KYO H;  1FZB A;  3RK2 D;  3BCC D;  3HD7 B;  1LTG C;  4UB8 H;  4PD4 H;  1X79 B;  1DD4 A;  3O8Z A;  1LGH B;  1FZG B;  1E5W A;  2HOD A;  5AW6 B;  4ASW A;  1M1J A;  3GW6 A;  1USE A;  3V2N A;  2PP6 A;  4IL6 H;  5AW3 B;  3L37 A;  2J2P A;  3BAT A;  4BRY B;  1QX8 A;  3M9Q A;  5KLV D;  5E79 E;  5AW9 B;  2FFD A;  1G2C A;  2HPC B;  4JYO X;  5KAF H;  1R5S A;  3H1L J;  4GOD A;  1LJ2 A;  3HD7 D;  3HTK B;  1EXI A;  1LTJ B;  1FS0 E;  5KLV E;  1NTM E;  1N73 C;  3L75 J;  3TF5 A;  1JO5 A;  1LTA C;  4I2L C;  2FBW C;  2B9B A;  2I8D A;  2XNX B;  3KDP B;  1W2B O;  2KSJ A;  1LTS C;  4XFJ A;  1OW6 A;  1SFC A;  3RK3 C;  3H1H J;  1SQB E;  3CXH D;  5K5G B;  4DJG A;  3TGU G;  3USS A;  1KYO D;  4WY4 B;  1YBK A;  3VP8 A;  1AVY A;  3H1I G;  2YMY A;  1FZF B;  4YXW H;  1NTZ J;  4BRY A;  2YNY A;  4ZMD A;  4PD4 D;  1GZL A;  2ZXE B;  5C39 A;  1VF5 C;  4K3A A;  1A02 F;  1XTC C;  2KI7 B;  1JUN A;  3L71 J;  4UB8 E;  3IR9 A;  2SPZ A;  4EIJ A;  2R3C A;  2E43 A;  5KJ7 C;  2QRX A;  3Q2Y A;  3P8M C;  2J64 A;  3P7K A;  4WY4 D;  2R44 A;  1M57 D;  1FOS F;  2JO1 A;  3L72 E;  2W83 C;  3MUD A;  2E74 B;  3L73 E;  1IZN B;  1SQP D;  4L73 A;  2P2U A;  5KAF E;  2MKV A;  1EQ7 A;  1NTK J;  2XU6 A;  1SQV K;  1JY3 O;  2JHK F;  2OYI A;  3S9O A;  1VQ6 P;  2OTK E;  1UII A;  3AE1 C;  1EZV I;  2WZ7 A;  4ASV A;  1KB9 I;  2KSE A;  2P58 A;  3E7K A;  3V5B A;  1HJB A;  2QEX P;  3ITK A;  1SQQ J;  4D6T J;  5KKZ B;  3CC2 P;  2QIW A;  2A06 D;  1L0L E;  3G3Z A;  3RK2 C;  2E74 D;  1X8Y A;  3N4X A;  2KK7 A;  3U59 A;  4LLH A;  1QEX A;  3BCC G;  1GL2 D;  2WT7 A;  3FWL A;  1AV1 A;  2Y0C A;  1OIP A;  1KOR A;  3T97 A;  3G9R A;  2P7J A;  3AEC C;  4R4M A;  3O6Q A;  3NXS A;  3TDK A;  2J3G A;  1Z56 A;  3HE4 B;  5KLV G;  1OVR A;  3PTZ A;  3HD7 C;  4IFF A;  3B71 A;  1YHQ P;  3CWB D;  5AW0 B;  2J5Z A;  3H1I J;  2JEE A;  3B5N B;  3H1J D;  3KHU A;  1FZG C;  1RF1 A;  2WPR A;  2B88 A;  1U57 A;  3HUS A;  1YIJ P;  2OYO A;  3IF4 A;  2HPC C;  3LW5 J;  1NKN A;  4L74 A;  3HRN A;  1LTJ C;  2K1A A;  3EQ2 A;  3H32 A;  2XNX C;  3MUD C;  1PV3 A;  4U3F D;  1IO4 A;  2JJL A;  2J0Y A;  3B5N A;  1L0N J;  3A3Y B;  5AVX B;  1Q81 Q;  4WY4 C;  4H0L B;  1KB9 D;  4U3F E;  1FZF C;  3MTU E;  1JTH A;  4N6J A;  1YJN P;  4O9B A;  1P84 H;  1ZRT D;  3M0A A;  1SQP G;  1FDM A;  3BCC J;  3EFF K;  1KTM A;  1FIB A;  2R5D A;  2J5U A;  1LTB C;  1GD2 E;  4H0L D;  1CW5 A;  2E74 C;  3SWF A;  2NZ2 A;  4WWI A;  2A06 G;  3M0D C;  1RF0 B;  3GMA A;  5H2F E;  2QM8 A;  2JHL F;  1GW3 A;  3GLM A;  1KQF B;  4R9T A;  4TLF A;  1LNQ A;  2J3U A;  3BRT B;  3FX0 A;  1LT1 A;  4N78 E;  5B66 E;  3CC4 P;  2K37 A;  1NGM B;  2YO3 A;  5KKZ C;  2ZVO B;  1KD1 Q;  2ZJS E;  3P8C E;  3HE5 B;  3HUS C;  1KN7 A;  4HH2 A;  1N86 B;  4JQ0 D;  3L36 A;  1LTT C;  4C7R A;  3MD0 A;  1NU1 E;  1VDF A;  2H43 A;  3H1K D;  5AVU B;  1PP9 E;  4IL6 X;  1RY3 A;  2WSS H;  3H1J G;  4NPF X;  4Y28 J;  4M7H A;  1P84 E;  1NTZ K;  2C9N Y;  2J0H A;  1ZR2 A;  2Y0E A;  4OGQ B;  2QJP B;  4N3Y B;  2GUS A;  3AE9 C;  3MP7 B;  2KLU A;  2WVR A;  3B5N C;  1SQV J;  1N7S A;  2LR2 A;  2OTJ P;  4ZFG A;  1SQP J;  3I56 P;  3GF7 A;  2AXT H;  1PIX A;  2Z4E A;  2WTY A;  5AW8 B;  4NPD A;  1NAY A;  3EWK A;  1M90 Q;  2M0B A;  4U3F G;  3AE3 C;  1NTK K;  3CPW O;  2Q3I A;  2Q9I B;  2VRS A;  1Q82 Q;  2J3F D;  2J3O A;  1GK4 A;  5CCG D;  1J1D B;  1SQQ K;  2B87 B;  2Q3E A;  2O01 J;  1S72 P;  2Q1K A;  4JBZ A;  1J2J B;  1Q90 D;  1OX3 A;  3VMX A;  2OAR A;  3GG2 A;  4EI2 A;  1LT9 B;  4YXD C;  1W5C E;  2R3S A;  2FYU D;  1PPJ D;  1QL2 A;  5APW A;  3MHV A;  3IN6 A;  3TGU D;  2P10 A;  1QL1 A;  3CCE P;  1VQ5 P;  2IFM A;  1LTI C;  1PFI A;  1S9K D;  1PPJ E;  3VYI A;  1FZA A;  1MV8 A;  3CWB J;  1VQK P;  3H1J J;  1T3J A;  1N7L A;  2H43 C;  1JY3 P;  2J61 B;  1FE6 A;  2IZ1 A;  1XTG B;  2AXT E;  2FYN B;  1NU1 G;  3V2Q A;  1RF0 C;  1KIL E;  2K9J A;  4MN4 C;  2Z5H A;  5AW2 B;  1FIC A;  1IJD B;  1T6A A;  1K73 Q;  1SLQ A;  1R8E A;  1AVO A;  2R5B A;  1DH3 A;  3H1K G;  3KXD A;  2H89 C;  4EOT A;  1CI6 A;  1MKM A; 
#chains in the Genus database with same CATH homology
 1FOS F;  3HE5 A;  4AUW A;  2CPB A;  3MUD A;  1T8Z A;  1H88 A;  4B86 A;  3R2P A;  1N86 C;  1N86 A;  2LKM A;  2Z4E C;  1FZC B;  5KTB A;  2P2U A;  1EQ7 A;  3V4W A;  1NH4 A;  2XU6 A;  1SQV K;  1JY3 O;  5AVT B;  2JHK F;  2OYI C;  2OYI A;  1L0N K;  2Z5I A;  3CI9 A;  2WZ7 A;  2D39 A;  4XE5 B;  3V5B A;  2WWW A;  1HJB A;  1A02 J;  1ZN5 A;  3LID A;  4Y99 B;  1N73 B;  3NTN A;  1AQ5 A;  2OYH B;  2HLO B;  1MFZ A;  3RL0 B;  3LW5 H;  3G3Z A;  2YKP A;  3RK2 C;  1KQL A;  1X8Y A;  2J58 A;  3N4X A;  1CZQ A;  3U59 A;  2J3F A;  4W7Z A;  4LLH A;  3VMZ A;  3PP5 A;  5CCG C;  1KIL B;  5CCG A;  5CJ4 A;  5AVS B;  1GL2 D;  1G1J A;  2NPS C;  1HUC A;  2WT7 A;  3VOP A;  2H43 B;  2FXM A;  4ZKU A;  2A45 G;  2P1J A;  3T97 A;  2BAS A;  2YO2 A;  2P7J A;  3II6 A;  2KP8 A;  5KLV K;  2WPS A;  4I1L A;  4WBA A;  3U1C A;  2M8R A;  3CL3 D;  3NXS A;  1FOS E;  1FJP A;  2J3G A;  5BVZ A;  3OAK A;  1Z56 A;  3MIW A;  3HE4 B;  2WIT A;  2FYU K;  3RL0 D;  3M9H A;  1FU1 A;  1FZA C;  4XA4 A;  1T2K C;  3HD7 C;  3HD7 A;  2Q9I C;  2Q9I A;  1NWQ A;  3P7K A;  4IFF A;  1GU5 A;  5AW0 B;  1KIL D;  2J5Z A;  2JEE A;  1J1D C;  3B5N B;  1NU1 K;  2FIB A;  3TNU B;  3C9I A;  1N7S B;  2JHI F;  1SVF A;  1RF1 A;  1FZG A;  1RF1 C;  1FZG C;  2WPR A;  2YKO A;  1NHL A;  2POH A;  5APX A;  3GHG C;  2HFE D;  3GHG A;  2XZR A;  3HUS A;  3BVH C;  1RE3 B;  3UIA A;  3VN0 A;  2Z4E B;  1URQ B;  2HPC C;  2HPC A;  1LT9 C;  1LT9 A;  1NKN A;  1FBM A;  1L4A C;  1L4A A;  1HWT C;  3KPE A;  3HRN A;  1H8A A;  2FKW B;  3A7O A;  3L4F A;  4HYT B;  1T3U A;  1FZB B;  1GU4 A;  3HTK A;  1LTJ C;  1LTJ A;  2GM4 A;  5APT A;  3KQG A;  1FAV A;  5AW5 B;  2WSE H;  4W80 A;  1KFM A;  3EQ2 A;  1IFM A;  5KJ7 D;  3LIE A;  3H32 A;  3H32 C;  1N7S D;  1RE4 B;  4GIF A;  5AVZ B;  1JMM A;  2XNX C;  2XNX A;  2HOD B;  1M1J B;  5AVY B;  1IO4 A;  2JJL A;  1JNM A;  2L5G B;  5AVV B;  1N2D C;  1URQ D;  2J0G A;  2GY7 A;  3TYY A;  4I6M C;  1DX7 A;  1GL2 B;  2J0Y A;  1X9V A;  3B5N A;  2FFD B;  1G2C B;  1NKZ B;  4IFD K;  3A3Y B;  5AVX B;  2NPS B;  4WY4 C;  4WY4 A;  2J61 A;  4AYC A;  3V4Q A;  2N1T B;  1H89 A;  4C7N A;  1JCC A;  1ZLL A;  1SQP K;  3MTU E;  1FZF A;  1FZF C;  1JTH A;  4N6J A;  1FZE B;  3M9B A;  4O9B A;  1G1I A;  5APS A;  1JY2 N;  1GDT A;  1LWU B;  3M0A A;  1NOH A;  2JHM F;  3E1I B;  2KOG A;  5CJ0 A;  3I5C A;  2IX7 C;  1FDM A;  1HVV A;  1J1E C;  1FZA B;  1FIB A;  1OXZ A;  1SFC B;  3H6P A;  3RK3 B;  1IFN A;  3WMM 0;  3U1A A;  2C9L Y;  2R5D A;  2XV5 A;  1HH0 A;  2NPS D;  1LTB C;  1GD2 E;  1JC9 A;  1CW5 A;  3VP9 A;  1SP4 A;  3SWF A;  2N1T D;  4OH8 B;  4NYT A;  1JCD A;  1KZU B;  1CSB A;  2IFN A;  1NTM K;  3M0D C;  3M0D A;  1FZC C;  1FZC A;  1Z3S A;  1JOC A;  1RF0 B;  1GL2 A;  2QM8 A;  1GW4 A;  2JHL F;  1HTL C;  1ZV8 A;  3EFG A;  4JZC A;  1GW3 A;  1DEB A;  4R9T A;  2J3U A;  3A2A A;  4M3L A;  3CLQ A;  1T2K D;  2R32 A;  1SFC D;  3RK3 D;  3BRT B;  4Y99 C;  1N73 A;  4N78 E;  2KLV A;  3L35 A;  1SQB K;  2OYH A;  2YO3 A;  2OYH C;  2HLO C;  2HLO A;  2M3B A;  2J1G A;  5CHX A;  3IFM A;  5AW7 B;  1CI6 B;  3RL0 C;  5AVW B;  3P8C E;  3HE5 B;  1HGV A;  4DOJ A;  3HUS C;  2H7H A;  2JHH C;  4HH2 A;  1W2E A;  1N86 B;  2HYN A;  3L36 A;  1LTT C;  3NFQ A;  1KIL C;  1KIL A;  1SQX K;  2W27 A;  4C7R A;  2A45 H;  3MD0 A;  1VDF A;  2H43 A;  5AVU B;  2OYI B;  4LGD E;  1RY3 A;  5CCH D;  1S9K E;  2W6A A;  2E42 A;  2FYZ A;  4WB4 A;  2O01 H;  4M7H A;  2IPP A;  1MUU A;  2C0X A;  4EPU A;  5BU8 B;  1NTZ K;  5BU5 A;  3BRV B;  2O1J A;  2XDJ A;  1VPC A;  1WRG A;  2C9N Y;  2J0H A;  1ZR2 A;  2WSF H;  3HE4 A;  3M06 A;  1YTZ T;  5CMZ A;  5APV A;  4N3Y B;  1WT6 A;  1JY3 N;  3RK2 B;  5AVQ B;  1MZ9 A;  4GKG A;  2WSC H;  2GUS A;  5AW4 B;  1JY2 P;  3OJA B;  5AW1 B;  1IFD A;  2YKQ A;  2WPQ A;  5AVR B;  2GUV A;  3B5N C;  5KJ7 A;  3TK1 A;  3TNU A;  2ZFC A;  2WT7 B;  2I1J A;  1N7S C;  1N7S A;  5APY A;  2H8P D;  3P32 A;  2P67 A;  3V2P A;  4JYB A;  4ZFG A;  4DZO A;  4R9J A;  1AFO A;  3V2R A;  3NMD A;  2W6B A;  1RE3 C;  1RE3 A;  1KFN A;  2Z4E A;  1URQ C;  1URQ A;  5AW8 B;  2WTY A;  1NAF A;  2J60 A;  1YYC A;  5APQ A;  4C46 A;  1FJK A;  2WNP F;  2KYV A;  4GT1 A;  2QM7 A;  3MGN A;  1NTK K;  2Q5U A;  1IFJ A;  5APU A;  1L0L K;  2N9B A;  1FZB C;  1FZB A;  3RK2 D;  1GK6 A;  2Q3I A;  4RES B;  3HD7 B;  2Q9I B;  1LTG C;  2VRS A;  4LC1 A;  2J3F D;  2J3O A;  1GK4 A;  5CCG D;  3FIB A;  1J1D B;  1X79 B;  1SQQ K;  4KHX A;  2A45 I;  3O8Z A;  1M7L A;  1RE4 C;  1RE4 A;  1LGH B;  1RF1 B;  1E5W A;  2HOD C;  2HOD A;  1HGZ A;  5AW6 B;  1M1J C;  1M1J A;  1HBW A;  1FZG B;  3V2N A;  2PP6 A;  3GHG B;  1J2J B;  3HUS B;  2Q7C A;  1JY2 O;  5AW3 B;  3L37 A;  3BVH B;  3BAS A;  4AQR D;  4JYC A;  3BAT A;  2J2P A;  3KYQ A;  4ZKP A;  2HG5 D;  3M9Q A;  3VMX A;  1IFI A;  2OAR A;  1GL2 C;  4N78 D;  5AW9 B;  2FFD C;  2FFD A;  1FID A;  1G2C A;  2HPC B;  4JYO X;  1LT9 B;  2NPS A;  4W7Y A;  1L4A B;  2C0W A;  3P8C D;  2N1T C;  2N1T A;  2XKM A;  3HD7 D;  3HTK B;  1QL2 A;  1LTJ B;  1FZE A;  3OA7 A;  5APW A;  1FZE C;  1N73 C;  3A5T A;  1IK9 A;  1QL1 A;  1ZR4 A;  1LWU C;  1LWU A;  1LTA C;  1JO5 A;  3N7N A;  3E1I A;  4I2L C;  3SWY A;  3E1I C;  2IFM A;  3H32 B;  1LTI C;  3VTP C;  2O1K A;  1PFI A;  2XNX B;  3KDP B;  1S9K D;  3VYI A;  2KSJ A;  1LTS C;  1FZA A;  1MV8 A;  4IFM A;  1SFC C;  1SFC A;  4JF7 A;  3RK3 C;  1T3J A;  2J59 M;  1GTW A;  3B8E B;  1N7L A;  2H43 C;  1JY3 P;  1YTZ I;  3M91 A;  1L4A D;  2KB7 P;  4WY4 B;  2J61 B;  3VMY A;  3VP8 A;  1XTG B;  2YMY A;  4C7N B;  1FZF B;  3BVH A;  4M7F A;  1JTH B;  2YNY A;  3V2Q A;  1RF0 C;  1RF0 A;  1GZL A;  2ZXE B;  1IC2 A;  2I1K A;  2PAJ A;  2Z5H A;  5AW2 B;  1FIC A;  1NO4 A;  1Z3U A;  1IJD B;  1A02 F;  1XTC C;  5CCH C;  5CCH A;  1FZD A;  1SLQ A;  2CPS A;  1JUN A;  2R5B A;  1DH3 A;  1OWA A;  1J1E B;  3IR9 A;  4EIJ A;  2R3C A;  2MJZ A;  2E43 A;  3TSI A;  5KJ7 C;  3B5N D;  4EOT A;  3P8M C;  2J64 A;  1CI6 A;  4WY4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...