1LT9C

Crystal structure of recombinant human fibrinogen fragment d
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lt9C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lt9C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lt9C02
2Z4EA 2J3FA 2H43A 2OYHA 1FZFC 3HUSA 1FZFA 1RE3A 2Z4EC 2HODA 1JY2O 2J0GA 2J64A 2J61B 2A45G 4ZFGA 1FZGC 1Z3UA 2Q9IB 3H32B 1M1JC 1FZAB 3H32C 2OYIC 3H32A 3GHGB 1FICA 2J5ZA 1N73A 2D39A 1FZAA 2J3OA 1FZEA 3GHGA 1FZCA 1LT9B 1RF1C 2GY7A 2JHLF 2J3GA 1FZBB 1LTJB 1W2EA 1FZCB 2XNXB 2FIBA 1FZDA 2A45I 1FIDA 2JHMF 1LWUA 1FZBA 4R9TA 1LWUC 3HUSC 2OYHC 3E1IB 2J3FD 2H43C 1N86C 2HPCB 1N73C 1N86A 2FFDB 2HLOA 4M7FA 1RE3C 1RE4A 1JY2N 2HODB 2HODC 4R9JA 1RF0C 2JHKF 2FFDA 3BVHB 2HLOB 2FFDC 2J60A 1RE4C 1RE4B 4JYOX 4NYTA 4EPUA 2Q9IA 2OYHB 3E1IC 2H43B 3HUSB 4JZCA 1RE3B 1Z3SA 1FZEC 2HPCC 2J61A 1FZCC 2J0YA 1JY3P 1FZEB 2HLOC 1LT9A 3BVHC 1M1JA 1LTJC 1FZBC 1LTJA 3FIBA 2XNXA 1RF1B 1N73B 1M1JB 1FZAC 2JHIF 2WNPF 1RF0B 2J2PA 1JC9A 2J1GA 1JY3O 1RF1A 1FIBA 3GHGC 1FZGB 2HPCA 2J3UA 1RF0A 2JHHC 2OYIB 1N86B 1JY3N 1JY2P 2A45H 4M7HA 2Z4EB 1FZGA 1LWUB 2J0HA 2Q9IC 2OYIA 1LT9C 3BVHA 1FZFB 3E1IA 1T3UA 2XNXC
chains in the Genus database with same CATH superfamily
1FZFC 3L74J 4ASWA 5KAFH 2Q3EA 2HODA 2JWAA 3KYQA 2J64A 2WSSH 2O3JA 2K88A 1PP9D 1J1EB 3L36A 3Q5PA 1USEA 1FZAB 4WBAA 1VQ7P 3V2NA 3GF7A 3JCUH 3AEGC 2OQQA 1ZR4A 3L37A 1HGZA 3IFMA 1FZDA 3CXHH 2H43C 2VRSA 1XTGB 1KFNA 4ZKPA 3ITKA 3CMEP 1N7SB 2QJKC 2N9YB 2HG5D 3V6IA 1KB9I 4JYOX 4YTPC 2Q9IA 1SQVJ 2IYPA 1G1JA 3AEAC 2Y0CA 4IOIH 1FZCC 1GL2D 3PJSK 2KS1A 1VF5D 3A5TA 1KB9D 3PP5A 4C46A 1LTJA 1LGHB 3JSVC 3L71J 1RQVA 3L72D 2AXTH 2D2CD 2PP6A 2W6AA 4H13C 1OVUA 4Y99B 3AEDC 2NRGA 2WSCH 3CWBD 3CXHD 2SPZA 4L76A 2A06E 5AVRB 4DZOA 3G3ZA 4L74A 1S5LE 1J2JB 4OGQB 1PL5A 2YO3A 2KS1B 4W7ZA 1Z3UA 1NOHA 1NU1J 3F5HA 4Y28J 5CCHD 1DIPA 1BGYE 5E79E 4K3AA 4GT1A 1MZ9A 1KQGB 2AXCA 2C9LY 1BCCJ 1SQQG 3CCUP 2CPSA 1NTZJ 1OVRA 4EI2A 2A45I 1NU1D 2WSEH 3HE5B 3TGUD 1JO5A 1OW6A 4D6TE 1N86C 1BCCE 1ZN5A 1NVOA 1S3JA 4R9JA 2JHKF 1HJBA 2HLOB 2GM4A 2KLVA 1KILB 2H43B 4JZCA 4Z1MH 3TGUJ 4CPGA 2C0WA 3Q5RA 1G2CA 1LT9A 5KLVD 2M5AA 3RL0B 1E5WA 3PHLA 3FIBA 2JHIF 2WNPF 2WPSA 4PV1B 2CK3H 4AYCA 1RF1A 3L75J 1FZGB 2HPCA 3H1IJ 1FZGA 2OYIA 3V4QA 3CC4P 3BRVB 2BEZF 4W7YA 2Y9YA 3VOPA 2FXOA 5KLVE 3L72E 1RE3A 3H6PA 4IFMA 1FOSE 3MTUE 1DEEG 1EQ7A 2FYNB 3GHGB 5BVZA 1SQQK 2N1TA 3E1RA 1KORA 1ZXGA 3PLNA 2N1TB 3W68A 3OJAB 2QVAA 3G4SP 2RKLA 3VTPC 1PP9E 3BRTB 1MKMA 3GF3A 1N73C 3AE7C 4IFDK 1QVGO 3CCEP 1LTAC 3B5ND 5B66E 1X0TA 1JNMA 5AW3B 2KUBA 4ZNCA 1R5SA 2QJKB 4GOFA 4DOJA 3VMXA 5AVQB 3HD7A 3FWNA 2ZAEB 1PV3A 3L74E 2R32A 2KB7P 2J59M 4XFJA 3L73G 2WVRA 1ZP0C 3EFFK 3TK1A 4JYBA 4N78D 5APWA 1D7MA 1KZUB 2E74B 4PD4I 2NPSD 4C7RA 3M9QA 1EDKA 1JTHA 1IC2A 4N6JA 1NJIQ 1FS0E 3TGUG 3L73E 1L0LD 3AE3C 3GMAA 3VN0A 3CCRP 1FC2C 1W2BO 2G8YA 3AE1C 3H1JD 1ZV8A 1FZGC 3TGUE 1K8AQ 4H0LB 3TSIA 5AVUB 1KILE 1WMKA 5CBOA 5CMZA 1ZOYC 3U59A 2B87A 2FYUE 1LTSC 2JHLF 2K9YA 1HBWA 2AXTE 2K1AA 1M57D 1AV1A 2WQYC 3M91A 3C8VA 2GA1A 1LTTC 1SQPJ 2YKPA 2G3AA 3HRNA 1NTME 3H1KJ 2E74D 3V2PA 2Z5HA 1RE4A 3JC22 3EFGA 2FFDA 5KAFE 1JMBA 4EIJA 4HKZH 4EPUA 2Z5IA 3D6YA 3E1IC 2QA4P 1RE3B 2Q5UA 4W80A 1L4AB 2WITA 3NTNA 3P7KA 2KYVA 1S4XA 3W67A 3HE4B 1S5LH 5CCGA 3CXHE 1M1JA 1GK4A 4H0LD 1S72P 1RF1B 5KTBA 4D6TJ 2KNCB 3AE6C 1M1JB 3MUDA 3SWYA 3CCJP 3CXHI 5BU5A 1NU1K 1YQ3C 4OGQC 1S1CX 3GLMA 3H1KE 3BVHA 3A0HE 2WT7B 5CJ0A 1EDIA 2JWDA 2OYHA 1CSBA 3CMAP 3G9RA 1HWTC 2Z4EC 1NU1E 3V2QA 1HF9A 3L71D 3H1KG 2YIUB 2M0BA 1SQPG 1NTMK 3S4RA 1SP4A 3TF5A 2L5GB 4JQ0D 1N2DC 2HYNA 2QJPC 5DJUB 1VPCA 1LTJB 1FZCB 2IFNA 3H1HG 3RK3D 2WSEJ 1FIDA 4WVZA 1FU1A 1LWUC 1NTKK 1X8YA 2WT7A 1RY3A 3HTKB 5H2FE 1H0TB 4UB8H 4U3FD 3H1HE 1CI6A 4OH8B 2YO2A 1VQ6P 3IF4A 2H7HA 3Q5SA 1NTZD 4KHXA 1OMIA 5CCGD 1EZVE 1GW4A 1Q7YQ 4N3YB 1PFIA 1PP9J 1FZAC 2ZT9C 1JY3O 1FBMA 2M3BA 1FIBA 1N86B 5CBNA 2OARA 3RK3E 5APYA 1FZFB 1IFJA 2ZXXA 1IJDB 4DCKA 2FY8A 1DH3A 3HUSA 1FZFA 4N78E 5TISH 4TLFA 3H1IG 3SSUA 2W83C 2KOGA 1HUCA 3H32B 3N4XA 2KZJA 2YMYA 1PP9G 5KKZC 1L0NK 3H1ID 1T6AA 3RK2B 2LXBA 1OX3A 1FZEA 2FYZA 3CC7P 1LT9B 1VQOP 2BCCD 2DW3A 1S5LX 4ZKUA 3HD7D 2LXCB 2QIWA 1VQ5P 1EDLA 1FZBA 4R9TA 1M7LA 3P8MC 2YKOA 1P84E 4H13B 1LTIC 3MZWB 2FFDB 2O1KA 5KJ7C 2HLOA 1AQTA 4M7FA 1RE3C 2BCCE 2PGDA 2Y9ZA 1Q81Q 1YIJP 1RE4C 2N1TD 4NYTA 2J58A 2NPSA 4HYTB 2J5UA 3G6EP 4H44C 1SQPK 2QG4A 1Y47A 1P84H 1NAFA 1GU4A 2B87B 4WWIA 1JUNA 1FZBC 3L70G 2E43A 1QLED 1Q2NA 4PD4H 1N8RQ 1FE6A 4K35A 1H88A 2ZT9D 4ASVA 1QVFO 2OYIB 1FAVA 1SQXK 2LR2A 5CCGC 1OXZA 1QL1A 1GDTA 2FYUD 3B8EB 2WTYA 5AVTB 4GKGA 3RL0g 3FX0A 1N7SA 2IBZG 4ZFGA 2FYUG 1T3JA 3WU2H 2PAJA 2WPRA 5APTA 4WY4A 1JB0J 3D71A 1JMMA 1X79B 2OYIC 1XTCC 1Q82Q 1GW3A 3PTZA 5KAIE 1IFIA 3LIEA 1NKNA 5L8RJ 3S9OA 3L73D 2XNXB 2FIBA 2QE7H 2JDIH 3VYIA 3HTKA 1L4AD 3GG2A 3H1JJ 1AVYA 5AW0B 4Y99C 3KDPB 2QJYC 4PJ0H 1Q90D 1IFPA 1RH5B 3A7OA 5CHXA 2YNYA 1M56D 1SS1A 4IL6H 2WMMA 3R2PA 3RK3C 2Y0EA 5AW2B 2QJPB 3RK3B 1PZQA 2R3CA 1YHQP 3FXDA 3T97B 3CI9A 3EQ2A 3SWFA 1SFCC 1KTMA 1LTBC 1J1DB 1RF0B 1JC9A 1ZLLA 4H44D 3NXSA 4XA4A 2JHHC 1X9VA 1ZRTE 3P32A 1NTKD 2FXPA 4EOTA 2Q9IC 1SQVK 3IR9A 5AW1B 3VP9A 2XNXC 1MFTA 5KKZB 1NKZB 1HGVA 5M1BA 1KYOH 3M9HA 2M8RA 5BU8B 1M1JC 3L75D 3K5BA 3H32A 1FICA 2J5ZA 1GTWA 2J3OA 1PPJG 3BATA 1FZBB 2B9BA 3CX5D 1AQ5A 3B5NA 1T8ZA 3HUSC 4HJGH 2J3FD 3VMZA 2ZVNB 1KB9E 4EDFA 1OWAA 2BASA 3BCCD 4PV1D 4YXDC 3A0BE 1URQA 4OWFA 2NZ2A 4JF7A 2KSEA 1YBKA 4BRYA 2HLOC 2D2CB 2JP3A 1P84I 4RESB 3LIDA 3R4YA 1DD3A 1VQ8P 2J2PA 1SQXJ 1FJPA 3H1JG 3H1IE 4BXLA 3E7KA 3AE2C 3P8CE 3CX5H 1BE3G 2AEFA 3TNUB 1AJYA 1CW5A 1NTZE 1DD4A 3FWLA 4GIFA 5AW4B 3F89A 2FYUK 3QH9A 3CCQP 1J1EC 1GK6A 2QM8A 1OVVA 1GD2E 3CCLP 1L0NE 2OTKE 1BSNA 1GMJA 2IPPA 3H32C 2FYUJ 2H88C 4I2LC 1KFMA 1NTKE 4IL6X 1YQ4C 1FZAA 1W5CE 1VQLP 2O01N 3CWBG 2J3GA 4HB1A 3L70D 2D2CC 3TYYA 2XKMA 2ZVOB 1NWQA 1NTKG 4GDOA 2OYHC 1H0TA 1LJ2A 1CI6B 3D70A 3RBZA 2J60A 3L73J 1K73Q 3PH0A 1JCCA 1SQPE 2ZYAA 1JOCA 3Q3DA 3AECC 4MN4C 1VQKP 5AVZB 3WU2E 2J0YA 2YMKA 1KV4A 2IZ1A 1YITP 2RH0A 3OW2O 2WPVB 1OFCX 3A3YB 3Q2YA 3UIAA 3P8CD 2OTJP 1SQBJ 1IO4A 2J3UA 3CL3D 5AVSB 4YPCA 1SLQA 2P10A 1BDCA 1LWUB 1JTHB 1VF5C 3A0BH 3ABVC 2P1JA 3I5CA 2WSCJ 1KB9H 5H2FH 3ZDMA 2V7QJ 1SQPD 1U7MA 1EZVI 3H1KD 3L71G 3FXEA 4I7ZC 1RF1C 1ZMEC 3WUTA 2RMZA 1URQC 2PRRA 4NPDA 2Q1KA 3B5NB 3H1HJ 1L4AC 4WB4A 5APUA 1EC5A 2HODC 4PD4D 5APXA 3BVHB 3MHVA 2A06D 2OYHB 4H44B 3A0HH 1AVOA 1GL2A 5GTHE 4L73A 2GUVA 2E75B 1QEXA 4O9BA 4HH2A 1NH4A 1N73B 3CPWO 3AEBC 3GHGC 1Y8AA 1JY3N 3VP8A 2A45H 3CX5I 2BCCG 2Z4EB 5KLVJ 1LT9C 2IZ0A 3JCUE 1URQB 3AE8C 5CJ4A 2OTLP 1BCCG 1SQQJ 2E76D 2KSJA 1DX7A 1PPJE 2JJLA 4WY4C 5GTIE 1A02J 3USSA 3OA7A 2W6BA 1YJ9P 2V7QH 3MUDC 3L70E 1H8AA 3BCCJ 3HD7B 2MKVA 1FZCA 2O01H 2C0XA 1W2EA 3V5BA 1L0LG 2E76C 1LP1A 1VDFA 2L91A 3E1IB 3AE5C 1N86A 4RJTA 1YJNP 2HODB 2AEMA 1RF0C 4IL6E 4I1LA 4B86A 4C7NB 2NPSC 4I6MC 5KLVG 3H1LD 1PGJA 2E5YA 4GODA 3O8ZA 4U3FG 4UB6H 5KLIB 4DJGA 1VQNP 1SQVG 1EXIA 2WSFJ 3GW6A 2Q7CA 3C1LA 4DT0A 5B5EE 1URQD 1R8EA 1YJWP 4U3FE 3B4SA 3KZIE 3PRJA 2QRXA 3I55P 4M7HA 2QSIA 2IYOA 2KZIA 1L0NG 1Z56A 3L70J 2J3FA 5APSA 1PPJD 5B66H 3O6QA 3MD0A 2J61B 2A45G 5APVA 3O6QB 2FYNC 1RHZB 2BEQD 3SFEC 2E74C 1EZVD 1J1DC 3CD6P 3M0AA 1L4AA 2WPQA 3TDKA 3Q1MA 2E75C 2P7JA 2H89C 5AVWB 2GY7A 5K5GB 2KNCA 1RQUA 1EXJA 3KXDA 3V2RA 1PGQA 4R4LA 3CCVP 1VQMP 1N7LA 2NPSB 2YXQB 5AVYB 2W8ZA 1QGKB 3S1KA 3B5NC 2KIKA 1SFCA 2E5TA 1FZEC 2K37A 4WY4D 3H1HD 1FZEB 5B5EH 1USDA 1G1IA 5CCHA 4BRYB 1LTJC 1G2CB 3B71A 1H89A 1L0LK 1IK9A 1HVVA 1M1KQ 3EWKA 3L75G 2R3SA 4KJMA 4H13D 2B88A 3II6A 4U7JA 2AEJA 1L2PA 1NTMG 4I7ZB 3CLQA 1T3UA 2Z4EA 4AUWA 2H43A 1HTLC 2IDBA 1YI2P 2E75D 2OGUA 1JY2O 3VMYA 3U1CA 3L75E 4UB8E 3WUUA 2ZFCA 3HD7C 2UWJE 5AW6B 2Q9IB 2C9NY 3A2AA 5APQA 1EZVG 1MV8A 5AW9B 1WT6A 2GUSA 3CX5E 4WY4B 1KC8Q 3M9BA 3KPEA 2IBZD 3CWBJ 3KQGA 2K9JA 3WUVA 4U3FJ 1KQFB 1KN7A 2I1KA 3RL0D 1LP1B 2K9JB 3H1JE 4XE5B 1L0ND 4OGQD 2H8PD 2ZJSE 2JR8A 4UB6E 5AW8B 2CPBA 2N9BA 2MJZA 2PFXA 3H1LE 2ZT9B 1SVFA 2A06G 1LT1A 2FFDC 4LGDE 1S9KE 1DEBA 1L0NJ 3VMAA 2W27A 4QMAA 3HUSB 1MUUA 5KLIC 1NU1G 1FDIA 2J61A 5TISE 2ZXEB 2KK7A 3H1LG 1FJKA 1KYOD 3NFQA 4R4MA 1BGYG 2XNXA 3KHUA 1Y9BA 2XV5A 3KZIH 1SQQE 1YTZT 1T2KD 1SQXE 1RF0A 1OZHA 3M06A 2KP8A 3HE5A 1Q86Q 3N7NA 4BWNA 4D6TG 1VQ4P 3H25A 1QX8A 2FKWB 1KYOE 3AE9C 5DJTB 1AFOA 2BCCJ 5GTIH 3OAKA 5C39A 2W6JH 1S2EA 1LTGC 4TT3H 1L0LJ 3V4WA 1BGYJ 2ZYDA 1YYCA 1SQVD 3HE4A 2JKVA 3IAOA 1IFMA 3H1LJ 1NO4A 3WMM0 3RL0C 2B89A 2XZRA 1IFDA 1VF5B 2IBZI 4LC1A 3MGNA 4M3LA 4GOEA 2WSFH 2FBWC 1FDOA 1BGYD 3RBXA 1S9KD 1TU3F 1JY2N 3U1AA 3SFDC 2IBZE 5GTHH 2Y0DA 1ZW0A 1RE4B 1SFCB 2POHA 1SQBD 1SQVE 1KMIZ 3D6ZA 5KLVK 3G71P 4NPFX 2P58A 1GL2B 1KD1Q 1GL2C 2HPCC 3CCMP 1HJ0A 3L71E 2Q6QA 4JYCA 1X22A 1NGMB 2XDJA 3QWOC 3IN6A 3LW5J 3L74D 1OW7A 2R5DA 2J1GA 2FXMA 2KXPB 3BASA 2O01J 3NMDA 3TNUA 2IX7C 2J0HA 2XU6A 3AEFC 3E1IA 1UIXA 1NYHA 2ITAA 4ZMDA 1IFNA 5EFWB 4D6TD 2N1TC 2WZ7A 1T2KC 1FDMA 1M8OB 2I8DA 4C7NA 2W90A 1IZNB 2YXRB 2HR3A 1A02F 1BDDA 2OYOA 5AW7B 1IK7A 1N73A 4PJ0E 2K3RA 3SWKA 3GHGA 4RKUJ 1EDJA 1WRGA 3L74G 1P84D 3T97A 2V4HA 4JBZA 4KT0J 4PD4E 3AE4C 3CC2P 5AW5B 2JEEA 1CZQA 1SQBE 2QJYB 5KAIH 1VL2A 1YTZI 4PV1C 3MP7B 1KILC 3M0DA 3L72J 4RO0A 2IFMA 1U57A 2KI7B 1N7SC 2I1JA 1OIPA 1QL2A 1SQBK 3RGUA 1SQBG 4NPEA 1JM0A 3I56P 2QEXP 1SQQD 3AEEC 3RK2C 3LW5H 1M90Q 1L0LE 4H0LC 4OVNF 1BSHA 2KLUA 2R5BA 3C9IA 4YXWH 4A7PA 1JY2P 2JO1A 2M3EA 5AVVB 2YIUC 1NTZK 2P67A 4LLHA 1BE3J 1PIXA 2QM7A 1JCDA 1K9MQ 2R44A 1ZR2A 1BCCD 5KJ7A 4AQRD 2J0GA 4L75A 1R5LA 1U7JA 1NTMD 2RN0A 1NTKJ 1AA0A 3L4FA 1K05A 1JEKA 3L72G 1LNQA 1BE3D 1OW8A 2D39A 3CCSP 1PGOA 2ZYGA 2M5AB 1KILD 2WWWA 5AVXB 1KYOI 1NTMJ 1KQLA 2E42A 1VQ9P 2JHMF 1LWUA 1N7SD 1NAYA 1BE3E 4EYYQ 2HPCB 1GZLA 2P2UA 1NTZG 5TJHA 3L35A 1KILA 3M0DC 3MIWA 1K04A 1E79H 3RK2D 2Q3IA 1KQSO 2O1JA 3BCCE 1Z3SA 1SQXD 2LKMA 1FOSF 1PGPA 1UIIA 1HH0A 1JY3P 1SQXG 3BVHC 3CWBE 5KJ7D 1ZRTD 1MFZA 3BCCG 4IFFA 1SFCD 1GU5A 1NHLA 2XNDH 1VQPP 4JPZB 5E79H 5CCHC 2HFED 2E76B 2YKQA 3FGAD
chains in the Genus database with same CATH topology
3TNUB 2Z4EA 1CW5A 4AUWA 2H43A 2OYHA 1CSBA 1FZFC 2WT7B 1HTLC 1HWTC 2Z4EC 2HODA 4GIFA 1JY2O 3KYQA 5AW4B 3V2QA 3VMYA 2FYUK 3U1CA 2J64A 2ZFCA 3HD7C 1J1EC 1J1EB 1GK6A 3L36A 5AW6B 2Q9IB 2C9NY 2QM8A 1GD2E 3A2AA 5APQA 1MV8A 1FZAB 5AW9B 2IPPA 3H32C 1WT6A 1NTMK 4WBAA 1SP4A 3V2NA 4I2LC 1KFMA 2GUSA 4WY4B 3M9BA 3KPEA 1FZAA 2L5GB 3KQGA 1N2DC 2HYNA 1ZR4A 2J3GA 2I1KA 1VPCA 3L37A 1HGZA 3RL0D 3IFMA 1LTJB 1FZCB 2IFNA 4XE5B 3RK3D 1FZDA 1FIDA 3TYYA 1FU1A 2H8PD 2XKMA 1LWUC 1NTKK 1NWQA 1X8YA 2WT7A 2OYHC 2H43C 2VRSA 1XTGB 1KFNA 1RY3A 4ZKPA 3HTKB 1N7SB 5AW8B 1CI6B 2CPBA 2N9BA 2MJZA 1SVFA 2HG5D 2FFDC 2J60A 4LGDE 1CI6A 4JYOX 1S9KE 1DEBA 4OH8B 2Q9IA 2W27A 1JCCA 3HUSB 2YO2A 1JOCA 1MUUA 1G1JA 2H7HA 5AVZB 2J61A 1FZCC 2J0YA 1GL2D 4KHXA 2ZXEB 3A5TA 1FJKA 3PP5A 5CCGD 1GW4A 3NFQA 4C46A 1LTJA 1LGHB 4N3YB 2XNXA 2XV5A 1PFIA 1FZAC 3A3YB 2PP6A 3UIAA 1JY3O 1FBMA 1YTZT 2M3BA 2W6AA 1T2KD 1FIBA 3P8CD 1IO4A 1RF0A 2J3UA 3CL3D 5AVSB 1N86B 4Y99B 2OARA 1SLQA 3M06A 2WSCH 2KP8A 5APYA 1LWUB 3HE5A 3N7NA 1JTHB 1FZFB 1IFJA 5AVRB 4DZOA 1IJDB 2FKWB 3G3ZA 1DH3A 3HUSA 1FZFA 2P1JA 1J2JB 3I5CA 1AFOA 4N78E 3OAKA 2YO3A 4W7ZA 2KOGA 1Z3UA 1NOHA 1HUCA 1LTGC 3H32B 3N4XA 5CCHD 2YMYA 1L0NK 3V4WA 4GT1A 1YYCA 3RK2B 1MZ9A 1FZEA 3HE4A 2FYZA 2C9LY 1LT9B 2CPSA 1RF1C 1IFMA 4ZKUA 3HD7D 1NO4A 1URQC 3WMM0 3RL0C 2XZRA 2A45I 1IFDA 2WSEH 4LC1A 3HE5B 1JO5A 1FZBA 3MGNA 4M3LA 4R9TA 1M7LA 2WSFH 3P8MC 3B5NB 1L4AC 2YKOA 4WB4A 1N86C 1LTIC 5APUA 2O1KA 5KJ7C 2FFDB 2HLOA 4M7FA 1RE3C 1ZN5A 1S9KD 1JY2N 3U1AA 2HODC 4R9JA 2JHKF 5APXA 1HJBA 3BVHB 2HLOB 1RE4C 2GM4A 2KLVA 1RE4B 1SFCB 2POHA 2N1TD 4NYTA 2J58A 1KILB 2NPSA 4HYTB 2OYHB 2H43B 5KLVK 4JZCA 1GL2B 1GL2C 2C0WA 2HPCC 1SQPK 1GL2A 4JYCA 1NAFA 1GU4A 1G2CA 2GUVA 1LT9A 4O9BA 1JUNA 2XDJA 3RL0B 4HH2A 1E5WA 1FZBC 1NH4A 3FIBA 2E43A 1N73B 2JHIF 2R5DA 2WNPF 2WPSA 2J1GA 1H88A 2FXMA 4AYCA 1RF1A 3GHGC 1FZGB 3BASA 2HPCA 2OYIB 1JY3N 3VP8A 2A45H 1FAVA 3NMDA 1SQXK 3TNUA 2IX7C 1FZGA 5CCGC 2J0HA 1OXZA 2XU6A 2Z4EB 2OYIA 1LT9C 3V4QA 1QL1A 3E1IA 3BRVB 1GDTA 4W7YA 3B8EB 1URQB 5AVTB 2WTYA 4GKGA 1IFNA 3VOPA 2N1TC 5CJ4A 1RE3A 1N7SA 2WZ7A 2KSJA 1DX7A 3H6PA 1T2KC 1FDMA 4IFMA 2JJLA 4ZFGA 4WY4C 1T3JA 1A02J 1FOSE 2PAJA 4C7NA 3MTUE 2WPRA 3OA7A 2W6BA 5APTA 4WY4A 1A02F 1JMMA 1EQ7A 1X79B 2OYIC 1XTCC 3GHGB 1H8AA 5AW7B 5BVZA 3HD7B 1GW3A 1N73A 1SQQK 2N1TA 1IFIA 3LIEA 3GHGA 1FZCA 1NKNA 2O01H 1WRGA 2C0XA 2N1TB 3OJAB 3T97A 1W2EA 3V5BA 2XNXB 2FIBA 3VTPC 3VYIA 3BRTB 1VDFA 3HTKA 1L4AD 3E1IB 5AW0B 4Y99C 1N73C 5AW5B 2JEEA 1N86A 1CZQA 3KDPB 4IFDK 2HODB 1YTZI 1RF0C 1KILC 3M0DA 3A7OA 4I1LA 1LTAC 5CHXA 4B86A 3B5ND 2YNYA 4C7NB 1JNMA 5AW3B 2IFMA 2NPSC 4I6MC 1N7SC 2I1JA 4DOJA 3VMXA 5AVQB 3R2PA 3RK3C 1QL2A 1SQBK 5AW2B 3HD7A 3O8ZA 3RK3B 2R3CA 2R32A 2KB7P 3RK2C 3LW5H 2J59M 3CI9A 3EQ2A 3SWFA 1SFCC 1LTBC 3TK1A 1J1DB 4JYBA 4N78D 2Q7CA 1RF0B 5APWA 1JC9A 1KZUB 1ZLLA 2R5BA 3C9IA 2NPSD 3NXSA 4XA4A 4C7RA 3M9QA 1URQD 2JHHC 1X9VA 3P32A 1JTHA 1JY2P 1IC2A 4N6JA 4M7HA 5AVVB 4EOTA 2Q9IC 1SQVK 1NTZK 2P67A 1Z56A 3IR9A 5AW1B 3VP9A 2XNXC 4LLHA 3VN0A 2J3FA 2QM7A 1JCDA 5APSA 1NKZB 1ZR2A 1HGVA 3MD0A 5KJ7A 4AQRD 2J0GA 2J61B 2A45G 5APVA 1ZV8A 1FZGC 3M9HA 2M8RA 3L4FA 5BU8B 1M1JC 1J1DC 3M0AA 3H32A 1L4AA 3TSIA 5AVUB 1FICA 2WPQA 2J5ZA 2D39A 1GTWA 5CMZA 3U59A 2J3OA 2P7JA 1LTSC 1KILD 5AVWB 2GY7A 2JHLF 2WWWA 5AVXB 3BATA 1HBWA 1FZBB 1AQ5A 3B5NA 1KQLA 1T8ZA 3M91A 2E42A 2JHMF 1LWUA 3V2RA 1N7SD 1LTTC 2YKPA 3HUSC 3HRNA 2J3FD 3V2PA 2Z5HA 2HPCB 1GZLA 2P2UA 3VMZA 1RE4A 3L35A 1N7LA 1KILA 2NPSB 3M0DC 3MIWA 3EFGA 1OWAA 5AVYB 2FFDA 2BASA 3RK2D 2Q3IA 1URQA 4EIJA 4EPUA 2Z5IA 3B5NC 3E1IC 2O1JA 4JF7A 1RE3B 1SFCA 2Q5UA 1Z3SA 1FZEC 2LKMA 4WY4D 4W80A 1FOSF 1L4AB 2WITA 3NTNA 3P7KA 1HH0A 1JY3P 2KYVA 3HE4B 1FZEB 5CCGA 2HLOC 1G1IA 3BVHC 5CCHA 5KJ7D 1M1JA 1LTJC 1GK4A 1G2CB 1MFZA 4RESB 3LIDA 1RF1B 4IFFA 5KTBA 1M1JB 1SFCD 1GU5A 3MUDA 2J2PA 1H89A 1L0LK 3SWYA 1NHLA 1IK9A 1HVVA 5BU5A 1NU1K 1FJPA 3II6A 3P8CE 5CCHC 3BVHA 2HFED 2YKQA 5CJ0A 3CLQA 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E A;  2J3F A;  2H43 A;  2OYH A;  1FZF C;  3HUS A;  1FZF A;  1RE3 A;  2Z4E C;  2HOD A;  1JY2 O;  2J0G A;  2J64 A;  2J61 B;  2A45 G;  4ZFG A;  1FZG C;  1Z3U A;  2Q9I B;  3H32 B;  1M1J C;  1FZA B;  3H32 C;  2OYI C;  3H32 A;  3GHG B;  1FIC A;  2J5Z A;  1N73 A;  2D39 A;  1FZA A;  2J3O A;  1FZE A;  3GHG A;  1FZC A;  1LT9 B;  1RF1 C;  2GY7 A;  2JHL F;  2J3G A;  1FZB B;  1LTJ B;  1W2E A;  1FZC B;  2XNX B;  2FIB A;  1FZD A;  2A45 I;  1FID A;  2JHM F;  1LWU A;  1FZB A;  4R9T A;  1LWU C;  3HUS C;  2OYH C;  3E1I B;  2J3F D;  2H43 C;  1N86 C;  2HPC B;  1N73 C;  1N86 A;  2FFD B;  2HLO A;  4M7F A;  1RE3 C;  1RE4 A;  1JY2 N;  2HOD B;  2HOD C;  4R9J A;  1RF0 C;  2JHK F;  2FFD A;  3BVH B;  2HLO B;  2FFD C;  2J60 A;  1RE4 C;  1RE4 B;  4JYO X;  4NYT A;  4EPU A;  2Q9I A;  2OYH B;  3E1I C;  2H43 B;  3HUS B;  4JZC A;  1RE3 B;  1Z3S A;  1FZE C;  2HPC C;  2J61 A;  1FZC C;  2J0Y A;  1JY3 P;  1FZE B;  2HLO C;  1LT9 A;  3BVH C;  1M1J A;  1LTJ C;  1FZB C;  1LTJ A;  3FIB A;  2XNX A;  1RF1 B;  1N73 B;  1M1J B;  1FZA C;  2JHI F;  2WNP F;  1RF0 B;  2J2P A;  1JC9 A;  2J1G A;  1JY3 O;  1RF1 A;  1FIB A;  3GHG C;  1FZG B;  2HPC A;  2J3U A;  1RF0 A;  2JHH C;  2OYI B;  1N86 B;  1JY3 N;  1JY2 P;  2A45 H;  4M7H A;  2Z4E B;  1FZG A;  1LWU B;  2J0H A;  2Q9I C;  2OYI A;  1LT9 C;  3BVH A;  1FZF B;  3E1I A;  1T3U A;  2XNX C; 
#chains in the Genus database with same CATH topology
 1FZF C;  3L74 J;  4ASW A;  5KAF H;  2Q3E A;  2HOD A;  2JWA A;  3KYQ A;  2J64 A;  2WSS H;  2O3J A;  2K88 A;  1PP9 D;  1J1E B;  3L36 A;  3Q5P A;  1USE A;  1FZA B;  4WBA A;  1VQ7 P;  3V2N A;  3GF7 A;  3JCU H;  3AEG C;  2OQQ A;  1ZR4 A;  3L37 A;  1HGZ A;  3IFM A;  1FZD A;  3CXH H;  2H43 C;  2VRS A;  1XTG B;  1KFN A;  4ZKP A;  3ITK A;  3CME P;  1N7S B;  2QJK C;  2N9Y B;  2HG5 D;  3V6I A;  1KB9 I;  4JYO X;  4YTP C;  2Q9I A;  1SQV J;  2IYP A;  1G1J A;  3AEA C;  2Y0C A;  4IOI H;  1FZC C;  1GL2 D;  3PJS K;  2KS1 A;  1VF5 D;  3A5T A;  1KB9 D;  3PP5 A;  4C46 A;  1LTJ A;  1LGH B;  3JSV C;  3L71 J;  1RQV A;  3L72 D;  2AXT H;  2D2C D;  2PP6 A;  2W6A A;  4H13 C;  1OVU A;  4Y99 B;  3AED C;  2NRG A;  2WSC H;  3CWB D;  3CXH D;  2SPZ A;  4L76 A;  2A06 E;  5AVR B;  4DZO A;  3G3Z A;  4L74 A;  1S5L E;  1J2J B;  4OGQ B;  1PL5 A;  2YO3 A;  2KS1 B;  4W7Z A;  1Z3U A;  1NOH A;  1NU1 J;  3F5H A;  4Y28 J;  5CCH D;  1DIP A;  1BGY E;  5E79 E;  4K3A A;  4GT1 A;  1MZ9 A;  1KQG B;  2AXC A;  2C9L Y;  1BCC J;  1SQQ G;  3CCU P;  2CPS A;  1NTZ J;  1OVR A;  4EI2 A;  2A45 I;  1NU1 D;  2WSE H;  3HE5 B;  3TGU D;  1JO5 A;  1OW6 A;  4D6T E;  1N86 C;  1BCC E;  1ZN5 A;  1NVO A;  1S3J A;  4R9J A;  2JHK F;  1HJB A;  2HLO B;  2GM4 A;  2KLV A;  1KIL B;  2H43 B;  4JZC A;  4Z1M H;  3TGU J;  4CPG A;  2C0W A;  3Q5R A;  1G2C A;  1LT9 A;  5KLV D;  2M5A A;  3RL0 B;  1E5W A;  3PHL A;  3FIB A;  2JHI F;  2WNP F;  2WPS A;  4PV1 B;  2CK3 H;  4AYC A;  1RF1 A;  3L75 J;  1FZG B;  2HPC A;  3H1I J;  1FZG A;  2OYI A;  3V4Q A;  3CC4 P;  3BRV B;  2BEZ F;  4W7Y A;  2Y9Y A;  3VOP A;  2FXO A;  5KLV E;  3L72 E;  1RE3 A;  3H6P A;  4IFM A;  1FOS E;  3MTU E;  1DEE G;  1EQ7 A;  2FYN B;  3GHG B;  5BVZ A;  1SQQ K;  2N1T A;  3E1R A;  1KOR A;  1ZXG A;  3PLN A;  2N1T B;  3W68 A;  3OJA B;  2QVA A;  3G4S P;  2RKL A;  3VTP C;  1PP9 E;  3BRT B;  1MKM A;  3GF3 A;  1N73 C;  3AE7 C;  4IFD K;  1QVG O;  3CCE P;  1LTA C;  3B5N D;  5B66 E;  1X0T A;  1JNM A;  5AW3 B;  2KUB A;  4ZNC A;  1R5S A;  2QJK B;  4GOF A;  4DOJ A;  3VMX A;  5AVQ B;  3HD7 A;  3FWN A;  2ZAE B;  1PV3 A;  3L74 E;  2R32 A;  2KB7 P;  2J59 M;  4XFJ A;  3L73 G;  2WVR A;  1ZP0 C;  3EFF K;  3TK1 A;  4JYB A;  4N78 D;  5APW A;  1D7M A;  1KZU B;  2E74 B;  4PD4 I;  2NPS D;  4C7R A;  3M9Q A;  1EDK A;  1JTH A;  1IC2 A;  4N6J A;  1NJI Q;  1FS0 E;  3TGU G;  3L73 E;  1L0L D;  3AE3 C;  3GMA A;  3VN0 A;  3CCR P;  1FC2 C;  1W2B O;  2G8Y A;  3AE1 C;  3H1J D;  1ZV8 A;  1FZG C;  3TGU E;  1K8A Q;  4H0L B;  3TSI A;  5AVU B;  1KIL E;  1WMK A;  5CBO A;  5CMZ A;  1ZOY C;  3U59 A;  2B87 A;  2FYU E;  1LTS C;  2JHL F;  2K9Y A;  1HBW A;  2AXT E;  2K1A A;  1M57 D;  1AV1 A;  2WQY C;  3M91 A;  3C8V A;  2GA1 A;  1LTT C;  1SQP J;  2YKP A;  2G3A A;  3HRN A;  1NTM E;  3H1K J;  2E74 D;  3V2P A;  2Z5H A;  1RE4 A;  3JC2 2;  3EFG A;  2FFD A;  5KAF E;  1JMB A;  4EIJ A;  4HKZ H;  4EPU A;  2Z5I A;  3D6Y A;  3E1I C;  2QA4 P;  1RE3 B;  2Q5U A;  4W80 A;  1L4A B;  2WIT A;  3NTN A;  3P7K A;  2KYV A;  1S4X A;  3W67 A;  3HE4 B;  1S5L H;  5CCG A;  3CXH E;  1M1J A;  1GK4 A;  4H0L D;  1S72 P;  1RF1 B;  5KTB A;  4D6T J;  2KNC B;  3AE6 C;  1M1J B;  3MUD A;  3SWY A;  3CCJ P;  3CXH I;  5BU5 A;  1NU1 K;  1YQ3 C;  4OGQ C;  1S1C X;  3GLM A;  3H1K E;  3BVH A;  3A0H E;  2WT7 B;  5CJ0 A;  1EDI A;  2JWD A;  2OYH A;  1CSB A;  3CMA P;  3G9R A;  1HWT C;  2Z4E C;  1NU1 E;  3V2Q A;  1HF9 A;  3L71 D;  3H1K G;  2YIU B;  2M0B A;  1SQP G;  1NTM K;  3S4R A;  1SP4 A;  3TF5 A;  2L5G B;  4JQ0 D;  1N2D C;  2HYN A;  2QJP C;  5DJU B;  1VPC A;  1LTJ B;  1FZC B;  2IFN A;  3H1H G;  3RK3 D;  2WSE J;  1FID A;  4WVZ A;  1FU1 A;  1LWU C;  1NTK K;  1X8Y A;  2WT7 A;  1RY3 A;  3HTK B;  5H2F E;  1H0T B;  4UB8 H;  4U3F D;  3H1H E;  1CI6 A;  4OH8 B;  2YO2 A;  1VQ6 P;  3IF4 A;  2H7H A;  3Q5S A;  1NTZ D;  4KHX A;  1OMI A;  5CCG D;  1EZV E;  1GW4 A;  1Q7Y Q;  4N3Y B;  1PFI A;  1PP9 J;  1FZA C;  2ZT9 C;  1JY3 O;  1FBM A;  2M3B A;  1FIB A;  1N86 B;  5CBN A;  2OAR A;  3RK3 E;  5APY A;  1FZF B;  1IFJ A;  2ZXX A;  1IJD B;  4DCK A;  2FY8 A;  1DH3 A;  3HUS A;  1FZF A;  4N78 E;  5TIS H;  4TLF A;  3H1I G;  3SSU A;  2W83 C;  2KOG A;  1HUC A;  3H32 B;  3N4X A;  2KZJ A;  2YMY A;  1PP9 G;  5KKZ C;  1L0N K;  3H1I D;  1T6A A;  3RK2 B;  2LXB A;  1OX3 A;  1FZE A;  2FYZ A;  3CC7 P;  1LT9 B;  1VQO P;  2BCC D;  2DW3 A;  1S5L X;  4ZKU A;  3HD7 D;  2LXC B;  2QIW A;  1VQ5 P;  1EDL A;  1FZB A;  4R9T A;  1M7L A;  3P8M C;  2YKO A;  1P84 E;  4H13 B;  1LTI C;  3MZW B;  2FFD B;  2O1K A;  5KJ7 C;  2HLO A;  1AQT A;  4M7F A;  1RE3 C;  2BCC E;  2PGD A;  2Y9Z A;  1Q81 Q;  1YIJ P;  1RE4 C;  2N1T D;  4NYT A;  2J58 A;  2NPS A;  4HYT B;  2J5U A;  3G6E P;  4H44 C;  1SQP K;  2QG4 A;  1Y47 A;  1P84 H;  1NAF A;  1GU4 A;  2B87 B;  4WWI A;  1JUN A;  1FZB C;  3L70 G;  2E43 A;  1QLE D;  1Q2N A;  4PD4 H;  1N8R Q;  1FE6 A;  4K35 A;  1H88 A;  2ZT9 D;  4ASV A;  1QVF O;  2OYI B;  1FAV A;  1SQX K;  2LR2 A;  5CCG C;  1OXZ A;  1QL1 A;  1GDT A;  2FYU D;  3B8E B;  2WTY A;  5AVT B;  4GKG A;  3RL0 g;  3FX0 A;  1N7S A;  2IBZ G;  4ZFG A;  2FYU G;  1T3J A;  3WU2 H;  2PAJ A;  2WPR A;  5APT A;  4WY4 A;  1JB0 J;  3D71 A;  1JMM A;  1X79 B;  2OYI C;  1XTC C;  1Q82 Q;  1GW3 A;  3PTZ A;  5KAI E;  1IFI A;  3LIE A;  1NKN A;  5L8R J;  3S9O A;  3L73 D;  2XNX B;  2FIB A;  2QE7 H;  2JDI H;  3VYI A;  3HTK A;  1L4A D;  3GG2 A;  3H1J J;  1AVY A;  5AW0 B;  4Y99 C;  3KDP B;  2QJY C;  4PJ0 H;  1Q90 D;  1IFP A;  1RH5 B;  3A7O A;  5CHX A;  2YNY A;  1M56 D;  1SS1 A;  4IL6 H;  2WMM A;  3R2P A;  3RK3 C;  2Y0E A;  5AW2 B;  2QJP B;  3RK3 B;  1PZQ A;  2R3C A;  1YHQ P;  3FXD A;  3T97 B;  3CI9 A;  3EQ2 A;  3SWF A;  1SFC C;  1KTM A;  1LTB C;  1J1D B;  1RF0 B;  1JC9 A;  1ZLL A;  4H44 D;  3NXS A;  4XA4 A;  2JHH C;  1X9V A;  1ZRT E;  3P32 A;  1NTK D;  2FXP A;  4EOT A;  2Q9I C;  1SQV K;  3IR9 A;  5AW1 B;  3VP9 A;  2XNX C;  1MFT A;  5KKZ B;  1NKZ B;  1HGV A;  5M1B A;  1KYO H;  3M9H A;  2M8R A;  5BU8 B;  1M1J C;  3L75 D;  3K5B A;  3H32 A;  1FIC A;  2J5Z A;  1GTW A;  2J3O A;  1PPJ G;  3BAT A;  1FZB B;  2B9B A;  3CX5 D;  1AQ5 A;  3B5N A;  1T8Z A;  3HUS C;  4HJG H;  2J3F D;  3VMZ A;  2ZVN B;  1KB9 E;  4EDF A;  1OWA A;  2BAS A;  3BCC D;  4PV1 D;  4YXD C;  3A0B E;  1URQ A;  4OWF A;  2NZ2 A;  4JF7 A;  2KSE A;  1YBK A;  4BRY A;  2HLO C;  2D2C B;  2JP3 A;  1P84 I;  4RES B;  3LID A;  3R4Y A;  1DD3 A;  1VQ8 P;  2J2P A;  1SQX J;  1FJP A;  3H1J G;  3H1I E;  4BXL A;  3E7K A;  3AE2 C;  3P8C E;  3CX5 H;  1BE3 G;  2AEF A;  3TNU B;  1AJY A;  1CW5 A;  1NTZ E;  1DD4 A;  3FWL A;  4GIF A;  5AW4 B;  3F89 A;  2FYU K;  3QH9 A;  3CCQ P;  1J1E C;  1GK6 A;  2QM8 A;  1OVV A;  1GD2 E;  3CCL P;  1L0N E;  2OTK E;  1BSN A;  1GMJ A;  2IPP A;  3H32 C;  2FYU J;  2H88 C;  4I2L C;  1KFM A;  1NTK E;  4IL6 X;  1YQ4 C;  1FZA A;  1W5C E;  1VQL P;  2O01 N;  3CWB G;  2J3G A;  4HB1 A;  3L70 D;  2D2C C;  3TYY A;  2XKM A;  2ZVO B;  1NWQ A;  1NTK G;  4GDO A;  2OYH C;  1H0T A;  1LJ2 A;  1CI6 B;  3D70 A;  3RBZ A;  2J60 A;  3L73 J;  1K73 Q;  3PH0 A;  1JCC A;  1SQP E;  2ZYA A;  1JOC A;  3Q3D A;  3AEC C;  4MN4 C;  1VQK P;  5AVZ B;  3WU2 E;  2J0Y A;  2YMK A;  1KV4 A;  2IZ1 A;  1YIT P;  2RH0 A;  3OW2 O;  2WPV B;  1OFC X;  3A3Y B;  3Q2Y A;  3UIA A;  3P8C D;  2OTJ P;  1SQB J;  1IO4 A;  2J3U A;  3CL3 D;  5AVS B;  4YPC A;  1SLQ A;  2P10 A;  1BDC A;  1LWU B;  1JTH B;  1VF5 C;  3A0B H;  3ABV C;  2P1J A;  3I5C A;  2WSC J;  1KB9 H;  5H2F H;  3ZDM A;  2V7Q J;  1SQP D;  1U7M A;  1EZV I;  3H1K D;  3L71 G;  3FXE A;  4I7Z C;  1RF1 C;  1ZME C;  3WUT A;  2RMZ A;  1URQ C;  2PRR A;  4NPD A;  2Q1K A;  3B5N B;  3H1H J;  1L4A C;  4WB4 A;  5APU A;  1EC5 A;  2HOD C;  4PD4 D;  5APX A;  3BVH B;  3MHV A;  2A06 D;  2OYH B;  4H44 B;  3A0H H;  1AVO A;  1GL2 A;  5GTH E;  4L73 A;  2GUV A;  2E75 B;  1QEX A;  4O9B A;  4HH2 A;  1NH4 A;  1N73 B;  3CPW O;  3AEB C;  3GHG C;  1Y8A A;  1JY3 N;  3VP8 A;  2A45 H;  3CX5 I;  2BCC G;  2Z4E B;  5KLV J;  1LT9 C;  2IZ0 A;  3JCU E;  1URQ B;  3AE8 C;  5CJ4 A;  2OTL P;  1BCC G;  1SQQ J;  2E76 D;  2KSJ A;  1DX7 A;  1PPJ E;  2JJL A;  4WY4 C;  5GTI E;  1A02 J;  3USS A;  3OA7 A;  2W6B A;  1YJ9 P;  2V7Q H;  3MUD C;  3L70 E;  1H8A A;  3BCC J;  3HD7 B;  2MKV A;  1FZC A;  2O01 H;  2C0X A;  1W2E A;  3V5B A;  1L0L G;  2E76 C;  1LP1 A;  1VDF A;  2L91 A;  3E1I B;  3AE5 C;  1N86 A;  4RJT A;  1YJN P;  2HOD B;  2AEM A;  1RF0 C;  4IL6 E;  4I1L A;  4B86 A;  4C7N B;  2NPS C;  4I6M C;  5KLV G;  3H1L D;  1PGJ A;  2E5Y A;  4GOD A;  3O8Z A;  4U3F G;  4UB6 H;  5KLI B;  4DJG A;  1VQN P;  1SQV G;  1EXI A;  2WSF J;  3GW6 A;  2Q7C A;  3C1L A;  4DT0 A;  5B5E E;  1URQ D;  1R8E A;  1YJW P;  4U3F E;  3B4S A;  3KZI E;  3PRJ A;  2QRX A;  3I55 P;  4M7H A;  2QSI A;  2IYO A;  2KZI A;  1L0N G;  1Z56 A;  3L70 J;  2J3F A;  5APS A;  1PPJ D;  5B66 H;  3O6Q A;  3MD0 A;  2J61 B;  2A45 G;  5APV A;  3O6Q B;  2FYN C;  1RHZ B;  2BEQ D;  3SFE C;  2E74 C;  1EZV D;  1J1D C;  3CD6 P;  3M0A A;  1L4A A;  2WPQ A;  3TDK A;  3Q1M A;  2E75 C;  2P7J A;  2H89 C;  5AVW B;  2GY7 A;  5K5G B;  2KNC A;  1RQU A;  1EXJ A;  3KXD A;  3V2R A;  1PGQ A;  4R4L A;  3CCV P;  1VQM P;  1N7L A;  2NPS B;  2YXQ B;  5AVY B;  2W8Z A;  1QGK B;  3S1K A;  3B5N C;  2KIK A;  1SFC A;  2E5T A;  1FZE C;  2K37 A;  4WY4 D;  3H1H D;  1FZE B;  5B5E H;  1USD A;  1G1I A;  5CCH A;  4BRY B;  1LTJ C;  1G2C B;  3B71 A;  1H89 A;  1L0L K;  1IK9 A;  1HVV A;  1M1K Q;  3EWK A;  3L75 G;  2R3S A;  4KJM A;  4H13 D;  2B88 A;  3II6 A;  4U7J A;  2AEJ A;  1L2P A;  1NTM G;  4I7Z B;  3CLQ A;  1T3U A;  2Z4E A;  4AUW A;  2H43 A;  1HTL C;  2IDB A;  1YI2 P;  2E75 D;  2OGU A;  1JY2 O;  3VMY A;  3U1C A;  3L75 E;  4UB8 E;  3WUU A;  2ZFC A;  3HD7 C;  2UWJ E;  5AW6 B;  2Q9I B;  2C9N Y;  3A2A A;  5APQ A;  1EZV G;  1MV8 A;  5AW9 B;  1WT6 A;  2GUS A;  3CX5 E;  4WY4 B;  1KC8 Q;  3M9B A;  3KPE A;  2IBZ D;  3CWB J;  3KQG A;  2K9J A;  3WUV A;  4U3F J;  1KQF B;  1KN7 A;  2I1K A;  3RL0 D;  1LP1 B;  2K9J B;  3H1J E;  4XE5 B;  1L0N D;  4OGQ D;  2H8P D;  2ZJS E;  2JR8 A;  4UB6 E;  5AW8 B;  2CPB A;  2N9B A;  2MJZ A;  2PFX A;  3H1L E;  2ZT9 B;  1SVF A;  2A06 G;  1LT1 A;  2FFD C;  4LGD E;  1S9K E;  1DEB A;  1L0N J;  3VMA A;  2W27 A;  4QMA A;  3HUS B;  1MUU A;  5KLI C;  1NU1 G;  1FDI A;  2J61 A;  5TIS E;  2ZXE B;  2KK7 A;  3H1L G;  1FJK A;  1KYO D;  3NFQ A;  4R4M A;  1BGY G;  2XNX A;  3KHU A;  1Y9B A;  2XV5 A;  3KZI H;  1SQQ E;  1YTZ T;  1T2K D;  1SQX E;  1RF0 A;  1OZH A;  3M06 A;  2KP8 A;  3HE5 A;  1Q86 Q;  3N7N A;  4BWN A;  4D6T G;  1VQ4 P;  3H25 A;  1QX8 A;  2FKW B;  1KYO E;  3AE9 C;  5DJT B;  1AFO A;  2BCC J;  5GTI H;  3OAK A;  5C39 A;  2W6J H;  1S2E A;  1LTG C;  4TT3 H;  1L0L J;  3V4W A;  1BGY J;  2ZYD A;  1YYC A;  1SQV D;  3HE4 A;  2JKV A;  3IAO A;  1IFM A;  3H1L J;  1NO4 A;  3WMM 0;  3RL0 C;  2B89 A;  2XZR A;  1IFD A;  1VF5 B;  2IBZ I;  4LC1 A;  3MGN A;  4M3L A;  4GOE A;  2WSF H;  2FBW C;  1FDO A;  1BGY D;  3RBX A;  1S9K D;  1TU3 F;  1JY2 N;  3U1A A;  3SFD C;  2IBZ E;  5GTH H;  2Y0D A;  1ZW0 A;  1RE4 B;  1SFC B;  2POH A;  1SQB D;  1SQV E;  1KMI Z;  3D6Z A;  5KLV K;  3G71 P;  4NPF X;  2P58 A;  1GL2 B;  1KD1 Q;  1GL2 C;  2HPC C;  3CCM P;  1HJ0 A;  3L71 E;  2Q6Q A;  4JYC A;  1X22 A;  1NGM B;  2XDJ A;  3QWO C;  3IN6 A;  3LW5 J;  3L74 D;  1OW7 A;  2R5D A;  2J1G A;  2FXM A;  2KXP B;  3BAS A;  2O01 J;  3NMD A;  3TNU A;  2IX7 C;  2J0H A;  2XU6 A;  3AEF C;  3E1I A;  1UIX A;  1NYH A;  2ITA A;  4ZMD A;  1IFN A;  5EFW B;  4D6T D;  2N1T C;  2WZ7 A;  1T2K C;  1FDM A;  1M8O B;  2I8D A;  4C7N A;  2W90 A;  1IZN B;  2YXR B;  2HR3 A;  1A02 F;  1BDD A;  2OYO A;  5AW7 B;  1IK7 A;  1N73 A;  4PJ0 E;  2K3R A;  3SWK A;  3GHG A;  4RKU J;  1EDJ A;  1WRG A;  3L74 G;  1P84 D;  3T97 A;  2V4H A;  4JBZ A;  4KT0 J;  4PD4 E;  3AE4 C;  3CC2 P;  5AW5 B;  2JEE A;  1CZQ A;  1SQB E;  2QJY B;  5KAI H;  1VL2 A;  1YTZ I;  4PV1 C;  3MP7 B;  1KIL C;  3M0D A;  3L72 J;  4RO0 A;  2IFM A;  1U57 A;  2KI7 B;  1N7S C;  2I1J A;  1OIP A;  1QL2 A;  1SQB K;  3RGU A;  1SQB G;  4NPE A;  1JM0 A;  3I56 P;  2QEX P;  1SQQ D;  3AEE C;  3RK2 C;  3LW5 H;  1M90 Q;  1L0L E;  4H0L C;  4OVN F;  1BSH A;  2KLU A;  2R5B A;  3C9I A;  4YXW H;  4A7P A;  1JY2 P;  2JO1 A;  2M3E A;  5AVV B;  2YIU C;  1NTZ K;  2P67 A;  4LLH A;  1BE3 J;  1PIX A;  2QM7 A;  1JCD A;  1K9M Q;  2R44 A;  1ZR2 A;  1BCC D;  5KJ7 A;  4AQR D;  2J0G A;  4L75 A;  1R5L A;  1U7J A;  1NTM D;  2RN0 A;  1NTK J;  1AA0 A;  3L4F A;  1K05 A;  1JEK A;  3L72 G;  1LNQ A;  1BE3 D;  1OW8 A;  2D39 A;  3CCS P;  1PGO A;  2ZYG A;  2M5A B;  1KIL D;  2WWW A;  5AVX B;  1KYO I;  1NTM J;  1KQL A;  2E42 A;  1VQ9 P;  2JHM F;  1LWU A;  1N7S D;  1NAY A;  1BE3 E;  4EYY Q;  2HPC B;  1GZL A;  2P2U A;  1NTZ G;  5TJH A;  3L35 A;  1KIL A;  3M0D C;  3MIW A;  1K04 A;  1E79 H;  3RK2 D;  2Q3I A;  1KQS O;  2O1J A;  3BCC E;  1Z3S A;  1SQX D;  2LKM A;  1FOS F;  1PGP A;  1UII A;  1HH0 A;  1JY3 P;  1SQX G;  3BVH C;  3CWB E;  5KJ7 D;  1ZRT D;  1MFZ A;  3BCC G;  4IFF A;  1SFC D;  1GU5 A;  1NHL A;  2XND H;  1VQP P;  4JPZ B;  5E79 H;  5CCH C;  2HFE D;  2E76 B;  2YKQ A;  3FGA D; 
#chains in the Genus database with same CATH homology
 3TNU B;  2Z4E A;  1CW5 A;  4AUW A;  2H43 A;  2OYH A;  1CSB A;  1FZF C;  2WT7 B;  1HTL C;  1HWT C;  2Z4E C;  2HOD A;  4GIF A;  1JY2 O;  3KYQ A;  5AW4 B;  3V2Q A;  3VMY A;  2FYU K;  3U1C A;  2J64 A;  2ZFC A;  3HD7 C;  1J1E C;  1J1E B;  1GK6 A;  3L36 A;  5AW6 B;  2Q9I B;  2C9N Y;  2QM8 A;  1GD2 E;  3A2A A;  5APQ A;  1MV8 A;  1FZA B;  5AW9 B;  2IPP A;  3H32 C;  1WT6 A;  1NTM K;  4WBA A;  1SP4 A;  3V2N A;  4I2L C;  1KFM A;  2GUS A;  4WY4 B;  3M9B A;  3KPE A;  1FZA A;  2L5G B;  3KQG A;  1N2D C;  2HYN A;  1ZR4 A;  2J3G A;  2I1K A;  1VPC A;  3L37 A;  1HGZ A;  3RL0 D;  3IFM A;  1LTJ B;  1FZC B;  2IFN A;  4XE5 B;  3RK3 D;  1FZD A;  1FID A;  3TYY A;  1FU1 A;  2H8P D;  2XKM A;  1LWU C;  1NTK K;  1NWQ A;  1X8Y A;  2WT7 A;  2OYH C;  2H43 C;  2VRS A;  1XTG B;  1KFN A;  1RY3 A;  4ZKP A;  3HTK B;  1N7S B;  5AW8 B;  1CI6 B;  2CPB A;  2N9B A;  2MJZ A;  1SVF A;  2HG5 D;  2FFD C;  2J60 A;  4LGD E;  1CI6 A;  4JYO X;  1S9K E;  1DEB A;  4OH8 B;  2Q9I A;  2W27 A;  1JCC A;  3HUS B;  2YO2 A;  1JOC A;  1MUU A;  1G1J A;  2H7H A;  5AVZ B;  2J61 A;  1FZC C;  2J0Y A;  1GL2 D;  4KHX A;  2ZXE B;  3A5T A;  1FJK A;  3PP5 A;  5CCG D;  1GW4 A;  3NFQ A;  4C46 A;  1LTJ A;  1LGH B;  4N3Y B;  2XNX A;  2XV5 A;  1PFI A;  1FZA C;  3A3Y B;  2PP6 A;  3UIA A;  1JY3 O;  1FBM A;  1YTZ T;  2M3B A;  2W6A A;  1T2K D;  1FIB A;  3P8C D;  1IO4 A;  1RF0 A;  2J3U A;  3CL3 D;  5AVS B;  1N86 B;  4Y99 B;  2OAR A;  1SLQ A;  3M06 A;  2WSC H;  2KP8 A;  5APY A;  1LWU B;  3HE5 A;  3N7N A;  1JTH B;  1FZF B;  1IFJ A;  5AVR B;  4DZO A;  1IJD B;  2FKW B;  3G3Z A;  1DH3 A;  3HUS A;  1FZF A;  2P1J A;  1J2J B;  3I5C A;  1AFO A;  4N78 E;  3OAK A;  2YO3 A;  4W7Z A;  2KOG A;  1Z3U A;  1NOH A;  1HUC A;  1LTG C;  3H32 B;  3N4X A;  5CCH D;  2YMY A;  1L0N K;  3V4W A;  4GT1 A;  1YYC A;  3RK2 B;  1MZ9 A;  1FZE A;  3HE4 A;  2FYZ A;  2C9L Y;  1LT9 B;  2CPS A;  1RF1 C;  1IFM A;  4ZKU A;  3HD7 D;  1NO4 A;  1URQ C;  3WMM 0;  3RL0 C;  2XZR A;  2A45 I;  1IFD A;  2WSE H;  4LC1 A;  3HE5 B;  1JO5 A;  1FZB A;  3MGN A;  4M3L A;  4R9T A;  1M7L A;  2WSF H;  3P8M C;  3B5N B;  1L4A C;  2YKO A;  4WB4 A;  1N86 C;  1LTI C;  5APU A;  2O1K A;  5KJ7 C;  2FFD B;  2HLO A;  4M7F A;  1RE3 C;  1ZN5 A;  1S9K D;  1JY2 N;  3U1A A;  2HOD C;  4R9J A;  2JHK F;  5APX A;  1HJB A;  3BVH B;  2HLO B;  1RE4 C;  2GM4 A;  2KLV A;  1RE4 B;  1SFC B;  2POH A;  2N1T D;  4NYT A;  2J58 A;  1KIL B;  2NPS A;  4HYT B;  2OYH B;  2H43 B;  5KLV K;  4JZC A;  1GL2 B;  1GL2 C;  2C0W A;  2HPC C;  1SQP K;  1GL2 A;  4JYC A;  1NAF A;  1GU4 A;  1G2C A;  2GUV A;  1LT9 A;  4O9B A;  1JUN A;  2XDJ A;  3RL0 B;  4HH2 A;  1E5W A;  1FZB C;  1NH4 A;  3FIB A;  2E43 A;  1N73 B;  2JHI F;  2R5D A;  2WNP F;  2WPS A;  2J1G A;  1H88 A;  2FXM A;  4AYC A;  1RF1 A;  3GHG C;  1FZG B;  3BAS A;  2HPC A;  2OYI B;  1JY3 N;  3VP8 A;  2A45 H;  1FAV A;  3NMD A;  1SQX K;  3TNU A;  2IX7 C;  1FZG A;  5CCG C;  2J0H A;  1OXZ A;  2XU6 A;  2Z4E B;  2OYI A;  1LT9 C;  3V4Q A;  1QL1 A;  3E1I A;  3BRV B;  1GDT A;  4W7Y A;  3B8E B;  1URQ B;  5AVT B;  2WTY A;  4GKG A;  1IFN A;  3VOP A;  2N1T C;  5CJ4 A;  1RE3 A;  1N7S A;  2WZ7 A;  2KSJ A;  1DX7 A;  3H6P A;  1T2K C;  1FDM A;  4IFM A;  2JJL A;  4ZFG A;  4WY4 C;  1T3J A;  1A02 J;  1FOS E;  2PAJ A;  4C7N A;  3MTU E;  2WPR A;  3OA7 A;  2W6B A;  5APT A;  4WY4 A;  1A02 F;  1JMM A;  1EQ7 A;  1X79 B;  2OYI C;  1XTC C;  3GHG B;  1H8A A;  5AW7 B;  5BVZ A;  3HD7 B;  1GW3 A;  1N73 A;  1SQQ K;  2N1T A;  1IFI A;  3LIE A;  3GHG A;  1FZC A;  1NKN A;  2O01 H;  1WRG A;  2C0X A;  2N1T B;  3OJA B;  3T97 A;  1W2E A;  3V5B A;  2XNX B;  2FIB A;  3VTP C;  3VYI A;  3BRT B;  1VDF A;  3HTK A;  1L4A D;  3E1I B;  5AW0 B;  4Y99 C;  1N73 C;  5AW5 B;  2JEE A;  1N86 A;  1CZQ A;  3KDP B;  4IFD K;  2HOD B;  1YTZ I;  1RF0 C;  1KIL C;  3M0D A;  3A7O A;  4I1L A;  1LTA C;  5CHX A;  4B86 A;  3B5N D;  2YNY A;  4C7N B;  1JNM A;  5AW3 B;  2IFM A;  2NPS C;  4I6M C;  1N7S C;  2I1J A;  4DOJ A;  3VMX A;  5AVQ B;  3R2P A;  3RK3 C;  1QL2 A;  1SQB K;  5AW2 B;  3HD7 A;  3O8Z A;  3RK3 B;  2R3C A;  2R32 A;  2KB7 P;  3RK2 C;  3LW5 H;  2J59 M;  3CI9 A;  3EQ2 A;  3SWF A;  1SFC C;  1LTB C;  3TK1 A;  1J1D B;  4JYB A;  4N78 D;  2Q7C A;  1RF0 B;  5APW A;  1JC9 A;  1KZU B;  1ZLL A;  2R5B A;  3C9I A;  2NPS D;  3NXS A;  4XA4 A;  4C7R A;  3M9Q A;  1URQ D;  2JHH C;  1X9V A;  3P32 A;  1JTH A;  1JY2 P;  1IC2 A;  4N6J A;  4M7H A;  5AVV B;  4EOT A;  2Q9I C;  1SQV K;  1NTZ K;  2P67 A;  1Z56 A;  3IR9 A;  5AW1 B;  3VP9 A;  2XNX C;  4LLH A;  3VN0 A;  2J3F A;  2QM7 A;  1JCD A;  5APS A;  1NKZ B;  1ZR2 A;  1HGV A;  3MD0 A;  5KJ7 A;  4AQR D;  2J0G A;  2J61 B;  2A45 G;  5APV A;  1ZV8 A;  1FZG C;  3M9H A;  2M8R A;  3L4F A;  5BU8 B;  1M1J C;  1J1D C;  3M0A A;  3H32 A;  1L4A A;  3TSI A;  5AVU B;  1FIC A;  2WPQ A;  2J5Z A;  2D39 A;  1GTW A;  5CMZ A;  3U59 A;  2J3O A;  2P7J A;  1LTS C;  1KIL D;  5AVW B;  2GY7 A;  2JHL F;  2WWW A;  5AVX B;  3BAT A;  1HBW A;  1FZB B;  1AQ5 A;  3B5N A;  1KQL A;  1T8Z A;  3M91 A;  2E42 A;  2JHM F;  1LWU A;  3V2R A;  1N7S D;  1LTT C;  2YKP A;  3HUS C;  3HRN A;  2J3F D;  3V2P A;  2Z5H A;  2HPC B;  1GZL A;  2P2U A;  3VMZ A;  1RE4 A;  3L35 A;  1N7L A;  1KIL A;  2NPS B;  3M0D C;  3MIW A;  3EFG A;  1OWA A;  5AVY B;  2FFD A;  2BAS A;  3RK2 D;  2Q3I A;  1URQ A;  4EIJ A;  4EPU A;  2Z5I A;  3B5N C;  3E1I C;  2O1J A;  4JF7 A;  1RE3 B;  1SFC A;  2Q5U A;  1Z3S A;  1FZE C;  2LKM A;  4WY4 D;  4W80 A;  1FOS F;  1L4A B;  2WIT A;  3NTN A;  3P7K A;  1HH0 A;  1JY3 P;  2KYV A;  3HE4 B;  1FZE B;  5CCG A;  2HLO C;  1G1I A;  3BVH C;  5CCH A;  5KJ7 D;  1M1J A;  1LTJ C;  1GK4 A;  1G2C B;  1MFZ A;  4RES B;  3LID A;  1RF1 B;  4IFF A;  5KTB A;  1M1J B;  1SFC D;  1GU5 A;  3MUD A;  2J2P A;  1H89 A;  1L0L K;  3SWY A;  1NHL A;  1IK9 A;  1HVV A;  5BU5 A;  1NU1 K;  1FJP A;  3II6 A;  3P8C E;  5CCH C;  3BVH A;  2HFE D;  2YKQ A;  5CJ0 A;  3CLQ A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...