1LTBD

2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1993-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltbD00
2G9HD 2O2LD 1D5XC 2AQ3B 2CHBD 1LT5D 5FK9C 4RGMA 1V1PA 3BVGA 3V05A 1EEFD 2AQ2B 1PTOB 2TSSA 1JWMD 4UDUC 2XRQD 1LT3D 1HA5A 4BWGB 1L0XB 1PRTC 3EFXD 1FD7D 5ELCA 1PZID 1I4QA 1SE3A 1D5ZC 1UUPA 4L63B 4RCOA 1TS3A 4RGOS 2NTTA 1RD9D 3BVZA 5ELEA 1PZJD 1LTGD 3TSSA 4K6LA 5ELBA 4DXGA 1LTTD 1PTOC 2AQ1B 1SE4A 1I4PA 3MFGA 2XN9C 1SJHD 1ENFA 1PRTF 3DWQA 3KLSX 2NTSA 1JR0D 1FNWA 1PYWD 1S5ED 1XXGA 1RDPD 1B44D 2QILA 4RFBA 1EEID 1KLGD 1LT6D 1SE2A 1EWCA 1L0YB 1F77A 2QEJC 4ZYSA 1SBBB 1AW7A 1G8ZD 1PTOF 2RDHA 1V1OA 1I4RA 4DXFA 1S5CD 5FKAC 3BYYB 1PTOH 4RGNA 3W2DA 1TY2A 1BCPB 1LO5D 3OWEB 1I4HA 2IJ0A 4RGTA 3BYTB 1EFID 3R8BA 1KLUD 1I4GA 1LLRD 1TY0A 1XTCD 2XRSD 1SJED 3BZDB 3DWPA 1LTAD 5I4DA 1RF2D 5D3DA 1HQRD 4L6TB 1LTID 1KTKA 2XNAC 1GOZA 1LTSD 1PTOD 3DWAA 5ELDA 1S5DD 1STEA 4OHJA 1MD2D 1S5FD 1ET9A 3O13A 1SEBD 4Z9CB 1PZKD 2RDGA 1HTLD 3CHBD 1D5MC 2ICIA 1DYQA 1M4VA 1FNUA 1PRTD 1AN8A 1SXTA 1TS2A 4RHRA 4O1NA 1CQVA 1BCPF 1EU3A 1CT1D 1DJRD 1ESFA 1RCVD 1FNVA 3BVMA 1EU4A 2Z8LA 3MC0B 4RH6A 1B1ZA 1ET6A 1LTBD 1LT4D 1CHQD 1V1PB 2SEBD 5ELFA 1D6EC 2R61A 1CK1A 1CHPD 1I4XA 3URYA 1JWSD 1BXTA 1LTRD 2WV6D 1TS5A 1JWUD 3EA6A 1BCPD 1QILA 4TSSA 1JQYD 1BCPC 1T5XD 1PRTB 3R2IA 1TS4A 3R2TA 4RHSA 1HXYD 5TSSA 2J4XA 1JCKB 1S5BD 3GP7A 4C56C 3SEBA 2IPKD 5D3IB 1FGBD 1UNSA
chains in the Genus database with same CATH superfamily
1CQFA 1I3QH 4LJZC 2Y0SE 2F0UA 1ZXTA 5IYCH 3EFXD 1SFOH 4GOPA 1NR4A 3M4YA 4DK6C 1SN8A 1WVLA 3HGBA 4HMJA 3WOFA 1JOQA 1RD9D 4CJ0B 1BQQT 1EYAA 1LYLA 2UXDL 2ZTEA 4JI2L 4YWMA 4IN3A 4K8JA 2C5CA 1UEAB 3KLSX 3GTGB 2Z1CA 4WFN3 1VF5C 4Y7NH 1K28A 4YCVA 1VQPA 1MBYA 2B2YC 3PO2G 3NENA 1X3PA 3DHQA 5CGKA 2MUYA 5IP7H 2RVLA 3TP5A 1TWGH 1L1OC 2AWNA 3G7LA 1STHA 4LFCL 3Q0AA 2R7ZB 1LO5D 3KK7A 2JXMB 2K5DA 3S1MH 4DV5L 4QGUA 1I94Q 4KTAA 3A74A 3SVMA 5C5MA 2F0TA 1J6QA 2KHIA 3K5NA 1TT2A 1IKMA 5IYBG 1Y14B 4A3LG 2D2CC 4BBSH 5FLXL 4HIDA 2D0PA 4C3HG 2QEXA 5KNBA 1BR9A 3T1YL 2R7FA 3QO2A 1T5EA 1RHPA 1SYGA 2OXPA 2EJGC 1G91A 4PZ8A 3I4MB 1X9NA 2FHTA 2SEBD 1YNXA 2R92B 1H9JA 4X66L 1HZCA 1S3OA 2PMZE 1JWSD 4C3JG 3ULLA 2O5IC 2DUDA 3U58A 3PUYA 2SDFA 5M3MH 4BBSB 1IYJB 3CAMA 1WFQA 5G3LF 3HOUB 4RKLA 3T4AC 1KIXA 2CQAA 2JA8H 2PZWA 3SEBA 1Y8OB 3DEOA 1UNSA 2N49A 3A7LA 3HFZB 3VYTA 4V0BA 1KNAA 1LT5D 1Q1BA 3JAMi 4UHVA 3ER0A 2E8GA 3KYHC 2F3IA 2KVMA 5C4JH 3HOVH 2Y0SB 4ZRZA 1YNND 3HKZE 4KY5A 4TVAB 4LF8Q 4X64L 1D5ZC 3E9IA 2E2DC 4CGYB 3EN2A 1VQAA 2LXJA 5LMUL 2X69A 1MKHA 2EJFC 4DR5Q 5JEAJ 3CC2A 3BZKA 1GO3E 1ENFA 1I6VC 4OWWB 2UUBQ 1JR0D 5FLXE 2Z6KC 1I50B 4F88A 4J8QA 1EQRA 1IBKQ 4F8MA 1RDPD 5C4XB 3R3OA 3CRKC 3IL8A 1G8ZD 3CMEA 1XPRA 2MQHA 1BO0A 1KQSA 2IHFA 1CTMA 1JJ2A 1T9HA 1QNUA 4LF4L 4FXDA 1EIGA 1K0RA 2F0HA 2FMCA 4ID6A 5CORA 3NELA 1ILQA 5I6WA 2A5HA 4DAVA 3GTKH 4P73A 5M5YH 4DAPA 1LUZA 1GHJA 3OOCA 4F7XA 1X3FA 3HOWH 3LWEA 3KLWA 4BY7H 4DV4Q 4K5WA 3U4ZA 4IUUA 4DR3L 1V43A 5JOBA 4DV4L 3KLSA 2MJ8A 2WIIB 1BNZA 1VQCA 2KEEA 5IT9c 2YU9H 4DR7L 1SAPA 2EXDA 3FPPA 4RHRA 1S40A 1IXRA 1A2TA 2H1EA 4CKBA 3MC0B 2VL6A 4B9WA 1B1ZA 3J7AF 1I6HB 5ELFA 4PNYA 4B3RL 2PNHA 2VQFQ 3ICEA 2CFMA 3QOLA 3E6ZX 4B3TQ 4C3JB 3U4VA 3K58A 4A93G 3RN5A 5M3FB 1XMOL 3NBHA 3FP9A 3SK8A 4KN4C 2E2JB 2A69C 3SK5A 2JA8B 1HNWL 2E2HB 4X65L 1EZ6A 3E0EA 3V05A 5M3MB 2BDNA 2YU9B 1TWGB 3MTSA 1LT3D 4KK7A 3S2HH 2GN5A 1V9PA 1H9SB 2ZM6L 2KQ3A 3S15H 2Y0SG 2CH4A 4K0KQ 1NUCA 2MO1A 3A8IE 2JA7G 5FJ8H 4A3MG 1EY6A 2JE6I 1D8LA 2XSCA 5M5YB 3PO3H 1H9KA 4JI5Q 1ENAA 5IGCA 3GTGH 2A69D 1H95A 4A3GG 3RUZA 2MPMA 4BXXG 3H0GG 2PMZB 1HZAA 1UE7A 1B44D 2RCNA 1SMXA 3TDQA 4HR7B 2F0VA 5ELOA 4JV5L 2IX0A 1ONLA 3PUWA 4AYBG 5LMNW 4ABNA 2A73B 4JI7L 2VQFL 1V1OA 3S1NH 1G51A 2A1AA 3J7ZC 2D0OA 2VUMB 3BYYB 4KHPL 1LV9A 2BA0A 5IGBA 5FLMG 3H0GH 2AHOB 1F9QA 3K7AH 1NBWA 1F2MA 4KV6A 1GUGA 2DGYA 5M5WH 3NTKA 1TQOA 4ZLTF 3HG9A 1MIUA 2JA6G 1K9MC 4KMUC 5CR3A 3ND8A 3GTJH 2K14A 5IY0A 1AE2A 2B39A 1STEA 5KIXA 1XMQL 1WOCA 3HP3A 4FNFA 1JJGA 1WI5A 5IWAQ 3M9BA 3HRZC 2JP1A 4J6HA 1A3TA 2EYHA 5ISRA 4OO1I 4LF9L 1DJRD 4DK1A 1RCVD 2D62A 4WJ3M 4A3BG 4DR5L 1SMYD 3A7AB 5C4JB 1II3A 1KDCA 1D6EC 1TIID 2JSOA 4XIGS 3S15B 5IP9G 2NVYH 1KDBA 3A8KE 3T1YQ 1X3QA 2IX3A 2G5DA 1B7YB 4LW1A 1T5XD 5AJ3Q 3HOUH 2B63G 5TSSA 1DOLA 3K5OA 3A0JA 2E74C 4A3IG 4FF1A 2IPKD 2CWAA 4KHPQ 4B3TL 5I2YA 1VF7A 1PTOB 3I4MH 3H09A 3HOZB 1IBMQ 4M8AA 1WCMB 4BBRG 4ZUJA 1PH1A 2F0GA 3I55A 1QE6A 2PZTA 3PO2H 1J5EQ 4PZ7A 4U673 2K28A 2FMMA 3MXNB 1WTXA 4JBWA 4LFCQ 1C7YA 1PTOC 3E9HA 5K5PA 3GTOB 3I4OA 2KCMA 2RKSA 1U0LA 1JOOA 1PH7A 1K8MA 3AQQA 1NCVA 2ENBA 2A6HD 2F0SA 4GLAC 3K0XA 1IYVA 4GKJQ 2CH4W 1B50A 2NVYB 4ME3A 2OCEA 1IL2A 1GM5A 3KUPA 4R8NA 4UPAA 4DXFA 4A3EH 2OT2A 5IODA 4B3SQ 3AMUA 4JK1C 1BCPB 4J1MA 3J80c 2ICEC 5HY6A 1I4HA 2BDOA 5C4ZA 2IWHA 2J7ZA 3R8BA 5EJWA 2R93B 3DWPA 3NPPA 4C1NK 3C1EA 5CV8A 1HQRD 1YNJC 5C0XJ 3KF6A 3RZOB 1BUVT 2OTLA 3NQIA 1HR0L 4FF4A 1BKBA 2M9VA 5JEAG 1S5FD 1BDOA 5CV7A 2VXWA 1MJEA 4A93B 1CSPA 5CV5A 2FINB 4YY3Q 4GNXC 3T16A 4X62Q 1PRTD 4NXNL 1SLJA 1SXTA 1HR0W 1EIFA 1ESRA 1N9WA 4O1NA 1YEZA 4BY7B 4R4TA 1PH5A 2DNEA 2RSNA 1HZ9A 1QWYA 2UXDQ 1P8LA 3K57A 2R7DA 1STGA 3M4PA 5HGQA 4A3KG 3URYA 3D4RA 1HFGA 3PSIA 1WTHA 2HQEA 5J39A 1BCPD 3D4DA 1MJCA 1U9RA 4GOPC 5KEEA 4RHSA 2F0QA 3TMEA 2Q2HA 1E24A 5ELNA 2UUCQ 4YHHL 4B3RQ 1JOKA 1WJJA 3KBXA 2N78A 1E2ZA 2JA9A 3HOYH 1K73C 1Q81C 4R4CA 4JI1Q 1BBXC 2AQ2B 2E5LL 3M4QA 2K04A 1DONA 4BWGB 3KF8B 1P16A 1SYFA 1Y8PB 4O0AA 4MNOA 1Q8KA 1NMFA 4CJ1B 3KJPA 4LF6L 4IOCA 1UUPA 3HS0C 4IURA 2I5MX 1YNNC 5G3LD 4JI0Q 2K32A 4MTKA 4KI0A 1Z6HA 3CPFA 5K36H 3MFGA 3HOVG 2A68C 3CCVA 2NTSA 5EKLA 3RR5A 3T13A 1HNXL 3I70A 4IPGA 1B2TA 4YY3L 2F0KA 2XTIA 1WTVA 2M00A 2F0FA 2IT1A 3G6EA 2Q2TA 3S1RB 3UDXA 5EAYA 4X66Q 5FJ8G 2KJXA 2B2UC 4A3JH 5IGGA 4UAIA 5I2XA 2B2TA 2E2HH 2F4VQ 1DM0B 2Z4HA 4UP7A 5I4DA 5A2QL 3CQZH 4N8FA 3WDNA 1VQ7A 2XNAC 1SNMA 5FO7B 3G71A 3GV6A 1J8IA 2KCCA 1L1OA 3LNNA 4QUFA 4LF5Q 3TS2A 2F0MA 4DV6Q 4BBSG 1Q46A 2NB0A 3GDEA 3WWVA 3JAMc 4DKAC 4HCEA 4KD3A 5CV6A 5AJ3L 1LTLA 1M4VA 3MXUA 5C3EH 2K5HA 1HNWQ 3FMCA 4A3MH 1QCBD 1CT1D 1GUNA 3PUVA 4R4OA 3MFYA 3CCMA 2L12A 3HEJA 4AH6A 3PF4A 3QIAA 3KDFB 1TXYA 2F52A 3D6WA 4QY7A 5IYDG 2WV6D 1N32L 1PH3A 4HIMA 2BCOA 3MEFA 1IBML 3OPOA 2OQKA 4A76A 2WB1E 3H3VC 1EY0A 1JCKB 2UUAL 3N6RA 2NN6G 4IFDG 4JI2Q 4K14A 2EZVA 2F4VL 1GUTA 2K05A 1EY9A 3UDGA 3AFPA 1IKLA 1EUJA 2R6GA 2F0PA 4DV3L 4R4QA 1Q86C 3I4MG 4L5QA 1E3PA 2Z4IA 3SK4A 2VW9A 4CKCA 4DUYQ 1NSNS 1PMRA 3QB3A 3AEVA 2DJGC 1PH6A 2NTTA 1UE1A 3TS0A 1EYDA 1EYGA 1CKMA 1PV4A 3VR2A 5A2QE 4A3JG 4UP8A 4OWTB 1G6ZA 4IFDH 2QA4A 5IYCG 2AWOA 1N33Q 1IYUA 5C0XG 1FNWA 1PYWD 2GVAA 1B53A 3PF5A 1M8AA 1I94L 1VQ5A 3J7AV 1HHVA 1HCZA 2N88A 4IPHA 1SE2A 1AZQA 1PH8A 2K5NA 3FKIH 2F0JA 4A75A 4X3UA 2N8NA 2KEDA 3NSWA 4RKBA 3C46A 1CKNA 3P20A 3UDFA 2FXQA 4QIWB 2ZXRA 2YTVA 4GS3A 4KHZA 3BJUA 4RGTA 2IJ0A 5JPMC 5E3FA 5C3EB 4G7HC 4DV6L 2RBMA 1KLUD 2TMPA 4NXNQ 4DR6L 4MHEA 1TU2B 2L11A 2PQEA 2XGTA 1TWHH 4DR6Q 2E2IB 4PG3A 1LTAD 4NW2A 1U4PA 2UUCL 4FXGC 5M5XB 2F03A 2E76C 1KTKA 2B3GA 3NBHB 1SNOA 4DF7A 3W1GA 3J7YW 1CKOA 4X65Q 1UE6A 1IZ6A 4L8JA 5C44B 2VNUD 5D65A 4DV3Q 4G57A 3CKIB 3CHBD 3VYUA 2YYZA 3S2HB 2ICIA 1SNPA 1N34L 1K83H 2WB1G 1EYCA 1N33L 1UWVA 2KENA 3PUXA 5K36G 4RG1A 2DJFC 2I07B 4RH6A 2LMCB 1CHQD 1VQ6A 2B2TC 3GTQB 3MAQA 4LFBL 4HN7A 4XDXA 3CCUA 5C4XG 1HNXQ 1ILPA 1KD1C 3Q22A 3A5ZB 4B9XA 4QIWE 3OMCA 1HQMC 5AFWA 2IY5B 4DR7Q 2K01A 4FF2A 4RMFA 1TS4A 3NUCA 4WJWA 4EQPA 3NWTA 4XQNA 4ZKCB 2WB1B 1KL9A 1EOTA 3S1MB 3S1QH 2GA4B 4DR2Q 2NVTB 2JN4A 2XRQD 4A3KH 1GD7A 2A8VA 1C4QA 3A56A 5CBEE 4JOIA 1I4QA 1MSGA 1O78A 1QVCA 1GUWA 1TKWB 4IUNA 2QDLA 1FJGL 1VMCA 2I0QA 2KHJA 3SDZA 3I91A 3F1ZA 1RL2A 2K03A 4IUVA 2RF4A 3I4LA 3P7JA 5IWAL 1PH9A 5EPJA 1K0SA 5GAGC 3NQTA 4B08A 3HOWB 4A3LH 2EY6A 3BDOA 4L5RC 3MA2B 3RLOA 1ML0D 4H44C 3C3LA 3KF6B 3KLRA 1YIJA 2Z0SA 1STNA 2JA5H 2QEJC 1CA6A 3PIP3 1I4RA 1R9TB 4P71A 2OQ0A 3BDCA 2DY7A 3C1FA 3N52A 1SMYC 2I46A 3PGZA 2NUCA 2ZXPA 1A6XA 2CVRA 4QCLA 3IKJA 1AP0A 2WAQE 3CCSA 3J81j 1CSQA 2LKVA 2LS01 4H7BA 1KXLA 1YJ9A 1IBLQ 1EIHA 1N36L 1S5DD 2EPBA 5T1GA 3MEHA 5LMNQ 2F0NA 1XNQL 2ZT9C 3EQLC 4HJ9A 3CQZB 3D6CA 4LFBQ 3HOUG 1DYQA 5FLXc 1IW7C 4DV2L 5IE8A 1XNRQ 3TP8A 4BY1B 3F8TA 1JB3A 2Z6BA 3S1QB 4K5VA 1CA5A 3BVMA 5DLQE 3P75A 2ATWA 1G2SA 1V1PB 4DV1Q 3FVQA 3CMAA 4ZK9B 1NMGA 3S1RH 1LTRD 3SXHA 4DR3Q 1X56A 2K5WA 2PW5A 1Y1WB 4CDDC 4HEDA 3M3YH 2Z6KA 2EY2A 1G291 3CPWA 1E1TA 4ZKBB 2J4XA 2B2YA 3HOXH 3DMUA 1JB7A 2IX1A 1VQ9A 2ALYB 2BA1A 1TR5A 2WKCA 3MWYW 5D3IB 4LAAA 1AFPA 3PIOA 5GQOA 3Q24A 4JI4L 1RTNA 1PRTC 4BA2I 3M4OB 1FD7D 1K3RA 3GTOH 4JV5Q 3U9OA 1LM0A 3F2BA 1R4QB 2EJMA 4L63B 5IT9E 3K5MA 1XNQQ 2VB3X 4GNXB 4JBKA 4OXPA 1RODA 2EYLA 3H3VH 4FDBA 1SE8A 1VQEA 5FLMH 1Y1VH 4DPGA 2JA5B 2IL8A 1H9SA 1PRTF 4DNTB 4LWCA 5IGDA 3AB9A 1EWHA 3UE1A 3T56B 3PIO3 4G7OC 1L0YB 1F77A 4AYBB 1WCMG 4LF9Q 3NE5B 3FKIG 5IOCA 4LFAL 4HIOA 4GOPB 1M90C 3S17B 1U4RA 4GN4B 4RGNA 2R7ZH 1PFMA 1OXSC 4MZ9A 5C4XH 2PI2A 1KAAA 1VQGA 1N34Q 2A6HC 3EBEA 4DK0A 4RWSC 4XQJA 4JYAL 3CW2C 2WAQB 5BN5A 1NAPA 2E5LQ 3WOEA 1QZGA 4JI8L 4HJ8A 5DNFA 4N8X1 1YVCA 3FEWX 2QGQA 2HIVA 3T1HQ 4JI4Q 2L0CA 1PA6A 4PV1C 1Y1VG 3MZ5A 2KECA 2N3SA 1AN8A 2MGSA 5IT9L 4AIMA 3SE0A 4WJ4A 5I6YA 1EOVA 5DM63 1ESFA 5LMNL 1EQTA 4HJ5A 2JJQA 2B8FA 2F4IA 4KY6A 4KY7A 4WRDA 2WAQG 3OIPA 1OXTA 2C9OA 1LT4D 2I5HA 3CC7A 4DK3C 2R92H 3GO5A 3K7AB 4DR1Q 1G6PA 1CHPD 4OEMB 4FO2A 2SNMA 3IAYA 4GLVB 2KCTA 3I4NH 1JQYD 1YJNA 3D31A 3QJYA 3B6YA 4XT1B 4IFDJ 3NHHA 1W2BA 3PO3G 3GP7A 1FGBD 3HOWG 3TZDA 3NTIA 1WTWA 3I8ZA 4PZ6A 1AEXA 4LUZA 3LWUA 4HCSA 3TN2A 4BBRH 3HKZG 3JAME 3I4NB 1TWHB 4H0LC 4C3HB 1VQMA 1PZJD 4K6LA 5T1IA 3RNUA 4DV0Q 3OYYA 1Q3LA 3QWNA 3W5OA 3OMGA 1C0AA 2PNRC 4UY8C 2LXKA 3H6MA 4DV2Q 4NXMQ 3ONAB 1X3GA 5EPLA 3MXNA 2X6GA 3X3NA 3GD7A 5C44G 3DEPA 4JI7Q 1B8AA 4X3SA 1CZGA 2NVXB 1ASZA 1Z47A 4DR1L 1O7LA 1Y1WG 4AYBE 4BY1H 4A3EG 3ZYYX 1S5CD 1PFSA 5E4WC 1QJOA 1IBLL 4OX9Q 3QR8A 1QOHA 3OWEB 3TRZA 2A74C 2QCPX 1CUKA 5D14A 5EGTA 1X32A 2RHSB 2XRSD 5J3BA 3SK6A 1WTRA 3M7NA 3ULJA 4NPSA 1OTCA 3J7A5 1E7ZA 4YHHQ 4L6TB 4ZAIA 5F2DA 1PTOD 3DWAA 3PMFA 3QG1A 4QB4A 3FRPB 3D3RA 3C2PA 1MD2D 2F0EA 3I3CA 1R4PB 2B8GA 2PW7A 1PZKD 4Z9CB 1TVXA 3GTLB 1MSHA 4GLXA 4EQOA 1XPUA 2HUGA 4IO9A 4GKKQ 2ZTDA 1E2VA 2Z8LA 4YCWA 1O7YA 4GN5A 1B9MA 3L0OA 4DFAA 5KYIA 1VQ4A 3OW2A 5EQ0A 3KJOA 1SFOB 5JJLA 2YTXA 4JVZA 2MFIA 2OF1A 1JWUD 4I7AA 3J80E 4C2MH 4TSSA 3OSOA 4N9PA 2GVBA 5FO8B 1F2LA 3M4OH 2C35B 5LL6S 4OX9L 1VQJA 4A3DG 2JA8G 3HOYG 1KHIA 1WYDA 2RA4A 3U9SA 4EX5A 4A3BH 3G6JB 2KBNA 1I50H 1F9PA 3PQIA 2ZJQA 5CBAE 3AU7A 1STAA 3TP6A 1VDZA 1B3QA 3RZOH 1L0XB 2HCCA 4P74A 1GUOA 2Q8RE 1HA6A 2K4KA 2KCNA 2WP8J 2PYKA 3H15A 2B29A 4RGOS 2L9HA 1SYCA 1LTGD 3EROA 1SYDA 1QZHA 3OHXC 1ZEQX 4A4IA 2ZM6Q 3KF8A 2NZOA 3S14B 1GKHA 1KAWA 4H02A 3H91A 4K8IA 2R93H 4LF8L 1RIPA 2CW0D 1K8GA 1EY5A 1SRUA 1UE5A 4CDEC 2EQSA 2ZTCA 4A3FH 3STBC 4C3IG 4LF6Q 3RLFA 2RDHA 1K83B 1YHQA 1Q82C 1Q12A 2PPBC 4HTHA 1IW7D 1CFMA 4OELB 1XNRL 3J80i 2P5ZX 2NVQB 4POGA 3D8GA 1STBA 3HOYB 4C1NI 2L15A 1VQLA 3DXJC 3R93A 5DM73 1QUQB 4KN7C 4JPBW 4ME5A 1STYA 3FKIB 4O42A 2DY8A 3A55A 3K59A 4S3SA 4IUPA 1FL0A 3VA5A 3RD4A 3GTMB 3S2DB 4A3IB 2PQAB 4YWKA 3SR1A 1PHJA 3I7FA 1KDAA 1W6JA 1EU3A 4NB3A 5KNDA 3T1HL 1EU4A 3P1HA 2Q2UA 1WTOA 2R92G 1Z7TA 3BG3A 3J81c 3STBD 1PLFA 2R61A 3A54A 4U68A 4I65A 4DAYB 1BVSA 3VYRA 4JI3Q 2WKDA 4Q0FA 2F1MA 3K0YA 2UXBQ 3L2PA 4HJ7A 4A93H 1EQVA 3GTJB 3NWSA 2F0DA 4HSVA 1X65A 1JORA 2IW3A 4A3GB 4RA8A 2O2LD 5IYDH 1D5XC 2AQ3B 5FK9C 3BVGA 3ITPA 1F2YA 2ZJRA 1QB5D 4BS9A 2NN6I 1U5KA 1KC8C 2VS1A 4A3FG 4V190 3VR3A 1YJWA 4MN3A 2K5VA 2AKWB 4A3EB 5ELEA 3J81L 1UAPA 1A0IA 1E2WA 2R7ZG 1X55A 1D7QA 3Q8DA 4N9TA 5JPNC 3X3MA 2XN9C 2H4OA 3DUZA 4E6IA 5M5WB 3S17H 4IPDA 5L37A 2DNCA 4IZ8A 1F9RA 1XXGA 5M3MG 2QILA 3S2DH 1PYBA 2L1BA 5C0XI 1PFBA 1YHBA 3J81i 5LHY1 1ZYRD 2EE1A 2WFWA 2BE5D 5CV4A 2F0LA 2UXCQ 2EVBA 2Q8TA 4EQNA 1L2FA 4A3DH 2LSSA 1HFNA 5CC4A 4GKJL 1I4GA 1XTCD 4FXKC 3ERQA 3I2ZA 5D3DA 4JI0L 4YIJA 1JJCB 3PV0A 1WCMH 2HQLA 3HOXB 4R8IA 1DOKA 4C3JH 2J0TD 4A3JB 4OONA 5GADC 1G2TA 4HJAA 2O5JC 5COYA 4OWXB 2NBFA 3S24A 1UEBA 1Y69U 1QUQA 1DGSA 3S16B 2EYOA 1U4LA 1HPCA 2QW7A 3CCLA 1D1KA 1VQBA 4NMZA 1ZYRC 1J9OA 5C44H 4DUYL 4OIKA 2D5DA 1HZBA 3G48A 3DM3A 3E3XA 4UP9A 2A6EC 1RKNA 1F2ZA 4BA1I 3A5UA 2HHHQ 3OTOL 1HXYD 1YZ6A 3BU2A 4M1UB 2JQOA 3L7ZC 3RN2A 4DNIA 1PH2A 5HURA 4LNQA 1HTPA 4IFDI 3VYSA 1YBYA 1HH2P 1TWCH 1FGUA 1N8RC 1EEFD 2Q2IA 3PIPA 2ASBA 1SROA 1I5FA 4DGZA 1O7ZA 2KOLA 4FF3A 2NN6H 3ND9A 4HMIA 4RCOA 2B63B 2EIFA 3U50C 2VUMH 4KJOA 5CV9A 1BOSA 2F0OA 3VR5A 4HIKA 1N36Q 1I4PA 3PCOB 1SJHD 4XXEA 4OO1G 1MI2A 4FP5D 1B4OA 4A3CG 3CCJA 4NKLA 2UUBL 4L5SA 1XMOQ 3F2CA 5M9OA 2VZAA 1GUSA 4HSPA 1PTOF 4R4IA 4C3IH 2VUMG 2MHVA 4DV7Q 1OXXK 3VR4A 1LABA 1ASYA 5IP7G 3S16H 2N55A 1IHZA 3VR6A 3CRLC 1JE5A 4MTNA 4I7ZC 1PXUA 1E0BA 1LLRD 5E7NA 3BDLA 3BZDB 2NVTH 3PUZA 2D9UA 2JA6B 1DD2A 1RJTA 5A35A 1LTSD 4PMWA 1CI3M 3K7UC 3TREA 3GTPH 1JICA 4DR4L 4JI6Q 1YHAA 4KKTA 1WTQA 3MVVA 3EJIA 4LF7Q 2BH8A 4K2KA 1E22A 4XQQA 3KOJA 4K0KL 4JW0A 5KRUA 1FNUA 4GN3B 1VMPA 2HIXA 2Z9HA 1BCPF 4DV0L 3T51B 2HHHL 5KGUA 4KKSA 2VQEQ 3LX0A 1JC7A 4DA2A 2VQEL 4KD4A 5BN4A 3GTQH 4K5XA 1BXTA 1VQFA 3TBIB 2CQOA 1DXMA 1Y8NB 2NVQH 4JI1L 1J5EL 1BCPC 4F87A 1PRTB 3KBGA 1SYEA 3F2DA 1HUMA 4ZCKA 2CWPA 3D0FA 1YI2A 3K81C 1VCIA 4C56C 1NTGA 4LF4Q 4IUQA 3GTKB 2R93G 3HOZH 4UDUC 3MXPA 1HA5A 2VY3A 3RMHA 5JVH3 2KHSA 4POFA 5ELCA 5CMDA 3W3AA 4X3KA 5EPKA 2HT1A 2K6AA 1EWIA 1TS3A 3AFQA 5DAUA 1IBKL 1SNCA 2QF7A 5JAVA 4JCVE 1HJPA 3TSSA 4DXGA 1XPOA 2AQ1B 2K7VA 2HD3A 3DWQA 4Y7NB 1NY4A 1A15A 4Q5VA 1C8CA 4YCUA 4X6AH 2NZHA 4LK1C 2UXCL 5JJIA 1Q90A 4PQXA 4B3ML 2WINB 1KLGD 1LT6D 4GNXA 2B2VA 4CKEA 4ZYSA 4R9WA 4X64Q 1JT8A 4C3IB 3EVQA 1V1QA 1HNZQ 1KABA 1TY2A 1NNXA 2F0IA 1C48A 3NXWA 2IHEA 1A62A 2JEBI 3BYTB 3E0JA 2UU9L 4RCNA 5JEAH 1TY0A 1C9OA 1KRSA 3Q23A 4DAMA 5LL6X 5C3XA 1B9NA 1YITA 3MHBA 2DN8A 1GOZA 4K6DA 1X3EA 4LFAQ 2R3ZA 2EYPA 2MNAA 3T53B 3O13A 1MGSA 2BOSA 3Q6SA 3HKZB 2KA7A 5IYBH 1XMQQ 5C0XH 4FYDA 4XTCS 1D5MC 1VQ8A 1B3AA 4G4KA 4QQBX 1VQHA 1CKNB 2A19A 4Y52H 4KHVA 1NE3A 2OWOA 3UE0A 3I56A 3S1NB 1XX8A 3SHLA 2PCFB 4ODGA 2BE5C 4NDXA 2RQXA 1A63A 3DM1A 3NBIA 1K8AC 4ZUIA 3VA7A 1TS5A 1GVPA 4DUZQ 3ERSX 4EQ5A 1QILA 3DLLA 5E4XA 4CBVA 4JOIC 5LMUQ 4XYOA 4DV5Q 2XWJB 3CCRA 4P75A 1Q1EA 2V1CC 2B2WA 3M7GA 1F9SA 1H9MA 1OXUA 5JJKA 2G9HD 1K3BC 3K6OA 4RGMA 2JK8A 4CJ2C 1H9RA 2QDBA 3SGIA 2AUKA 3GV3A 3QOJA 1PDQA 2JA7B 2CKZB 1JMCA 2XIWA 1Q8IA 4IOAA 1SE4A 3S14H 2LFNA 5DEHA 4JI6L 2CCZA 1Z9FA 3J81E 1BBUA 3GTPB 5IIFA 2EY1A 2V4DA 4ILWA 4RAUC 1EEID 2G9DA 1EWCA 3D4WA 3VDYA 5IGEA 1PVOA 1SBBB 4GKKL 1AW7A 2ES2A 1L1OB 1VQIA 3L9AX 5IGFA 2ZJPA 1EIYB 1U4MA 2FFKB 3I4NG 4NP5A 5E1FA 3I90A 2FJ2A 4OO1H 1QVFA 4JG2A 3OW7A 4KJNA 2K1BA 1SJED 3CD6A 3JAML 1RF2D 1OO9B 4IQZA 1W3SA 3HOZG 2YTYA 4OIJA 4APVA 1ET9A 5C6AA 5M3FG 5J22A 2X6LA 5BR8L 4P2CB 5I9PA 3BZCA 3M85A 2EYMA 1ENCA 4MIUA 4X62L 1TS2A 3HKSA 2UUAQ 5FOBB 3G4SA 4XT3B 3UI2A 1SNQA 2B63H 4IJHA 4OL7A 1L0WA 4DR4Q 1Q7YC 2L4NA 4H13C 5H1SE 4LF7L 1LTBD 1B70B 1AZPA 4CHTB 2NVXH 5JJZA 1A2UA 4A3GH 4OGQC 2HCIA 3CP0A 2VB2X 2CW0C 2RSOA 1QVGA 5GROA 3NP8A 3LGJA 3ULPA 4FVMA 1EY4A 3V2TA 3CCQA 2L55A 2L5TA 3CF5A 5EBDA 3GQBA 1S5BD 4JI5L 4DU9A 3J80L 1VS0A 2JA7H 1AE3A 2RDFA 2OTJA 4QL5A 2CHBD 1V1PA 3HZXA 3K80C 4QF4A 5C5LA 3GTMH 3I72A 3H0GB 4TKOB 4HAEA 4NXML 3IFTA 2MP1A 4CDCC 4BXXH 2K52A 5KYLA 2ZXOA 4TQUS 2B2VC 3BVZA 1EFWA 3MXGA 1Y1VB 5KNCA 3H94A 2SOBA 2K33A 1V8QA 1DCZA 2PZUA 2B2UA 2LY7A 4ZQ3A 4IJLA 3RZDB 5BR8Q 4JBMA 4G7ZC 4LMQD 1GHKA 1S5ED 5GAHC 5M5XH 1PFNA 1XWEA 2E75C 3BS1A 1PYSB 2AMCB 1FJGQ 3CCEA 3OWFA 5C4HA 4DNRB 1O80A 1AH9A 1E1OA 5FKAC 3FHWA 1A8VA 1W6KA 3W2DA 3UDIA 1WD0A 1NR2A 2K50A 4A3DB 1NJIC 4BY7G 1VQDA 5C3EG 3KDFA 4QJFA 4BY1G 2NYZD 1Y1WH 2PQAA 3IRBA 3OTOQ 1ZKOA 2A68D 2EYJA 1EY8A 2E2JH 2HDLA 1PH4A 1EL0A 4YWLA 2EXZA 2NZ1D 4JI3L 1SEBD 2EY5A 3TQYA 1A3VA 1HTLD 2F0WA 4DAYA 2K5QA 4KLKA 4JBJA 4A3CH 4DUZL 3TP7A 2EDGA 4IALA 1CQVA 2O4XA 2KUMA 3OIQA 4ULLA 1S4ZA 5C3WA 1FNVA 2JEAI 2B2WC 3K5LA 4JI8Q 3S9WA 4A3KB 5EKIA 1CK1A 1XTDA 2OEOA 4DR2L 2SNSA 1X54A 2AUJD 1HNZL 1HRJA 5EBCA 3V96A 1GJXA 1BBWA 4QMGA 1SSOA 4XYQA 2XWBB 4WORA 3HOVB 2JA5G 1D1IA 4DV1L 4JC0A 1ICWA 4TRDA 2F3VA 4DV7L 3I73A 1R9TH 4EVOA 5JVG3 1FVIA 2TSSA 1JWMD 3AYHB 4AQYL 3GTLH 3E5SA 4KKUA 5FO9B 3JC66 5IP9H 1DZ1A 2JYOA 1EZ8A 4J15A 1PZID 2K75A 1S72A 4A3MB 4X3TA 2RCFA 3IFDA 1SE3A 1CZWA 3TZUA 2MO0A 3NTHA 1TWCB 1I3QB 1WD1A 4ALPA 4LUVA 5CYUA 3ZJYC 5ELBA 1LTTD 2M2LA 1QNKA 4A3IH 1SYBA 1SDFA 1TWFH 4K2LA 1YNJD 4PMCA 1SNDA 1FYCA 3W1BA 1FR3A 1XJVA 4B3SL 4EGVA 4IUTA 3FPUB 1D2BA 5J1ZA 2I5LX 1VQNA 2UXBL 1KRTA 4B3MQ 4RFBA 2A6ED 1CM9A 1MHWC 3PO2B 4PMBA 2BH2A 5HGTA 4LF5L 3RZDH 1DOMA 2EOTA 2PO4A 1PTOH 4O2DA 3M3YB 1X6OA 1ICFB 1KNEA 1QG7A 2UU9Q 5BN3A 3PO3B 5NUCA 1TWAH 3NK9A 1EFID 4L5TA 3CC4A 1EY7A 1HUNA 5GAEC 3TEHB 3HOXG 1JE4A 1LTID 1I6HH 4A3FB 1M1KC 5ELDA 2EYFA 4OHJA 3KFUA 4BBRB 2HDMA 1N32Q 4P72A 5I9OA 5M3FH 2NWGA 2WACA 4AQYQ 2JA6H 2ID0A 2RDGA 4C3HH 2PI2E 2XVSA 1WTPA 1A3UA 1VQKA 1BF4A 1TWAB 2Q8IB 4A3BB 2RHQB 4JYAQ 4LUOA 1OXVA 4DN4M 2QKIC 3F2UA 1EQQA 4GZYC 3RLNA 3EIVA 1IL8A 1RTOA 1ET6A 1SR3A 3NEMA 1K8OA 1XYIA 3H3VI 2YV5A 3K8AA 1I4XA 1LACA 3CXCA 1VQOA 4C2MB 4QUCA 5EKKA 3EA6A 2E2IH 3L3OC 4R1JA 1GXDC 3R2IA 4CDFC 3R2TA 1O7IA 3FDTA 3CU7A 4IPCA 3A8JE 1TWFB 2H5XA 1HR0Q 2F3WA
chains in the Genus database with same CATH topology
1CQFA 4LJZC 2F0UA 1ZXTA 3EFXD 1NR4A 3M4YA 1WVLA 3HGBA 4HMJA 3WOFA 1JOQA 1RD9D 4CJ0B 1BQQT 1EYAA 4IN3A 4K8JA 2C5CA 1UEAB 3KLSX 3GTGB 2Z1CA 4WFN3 1VF5C 1MBYA 2B2YC 1X3PA 3DHQA 5CGKA 2MUYA 2RVLA 3TP5A 2AWNA 3G7LA 1STHA 3Q0AA 2R7ZB 1LO5D 3KK7A 2JXMB 2K5DA 4KTAA 3SVMA 5C5MA 2F0TA 3K5NA 1TT2A 1IKMA 2D2CC 5FLXL 4C3HG 5KNBA 1BR9A 3QO2A 1T5EA 1RHPA 1SYGA 2OXPA 2EJGC 1G91A 3I4MB 2FHTA 2SEBD 2R92B 1H9JA 1JWSD 4C3JG 2O5IC 3PUYA 2SDFA 4BBSB 5G3LF 3HOUB 4RKLA 3T4AC 2CQAA 2PZWA 3SEBA 1Y8OB 3DEOA 1UNSA 3A7LA 3VYTA 4V0BA 1KNAA 1LT5D 1Q1BA 2KVMA 2Y0SB 4ZRZA 1YNND 4KY5A 1D5ZC 2E2DC 4CGYB 2X69A 2EJFC 5JEAJ 1ENFA 1I6VC 1JR0D 5FLXE 1I50B 4F88A 4J8QA 4F8MA 1RDPD 5C4XB 3R3OA 3CRKC 3IL8A 1G8ZD 1BO0A 1CTMA 1QNUA 4FXDA 1EIGA 2F0HA 2FMCA 4ID6A 5CORA 1ILQA 5I6WA 2A5HA 4DAVA 4DAPA 3OOCA 1GHJA 4F7XA 3LWEA 4K5WA 4IUUA 1V43A 5JOBA 3KLSA 2MJ8A 2WIIB 1BNZA 2KEEA 1SAPA 3FPPA 4RHRA 1A2TA 2H1EA 4CKBA 3MC0B 4B9WA 1B1ZA 3J7AF 1I6HB 5ELFA 4PNYA 3QOLA 3E6ZX 4C3JB 3K58A 5M3FB 3NBHA 3SK8A 4KN4C 2E2JB 2A69C 3SK5A 2JA8B 2E2HB 1EZ6A 3V05A 5M3MB 2BDNA 2YU9B 1TWGB 3MTSA 1LT3D 4KK7A 1H9SB 2KQ3A 1NUCA 3A8IE 1EY6A 2JE6I 2XSCA 5M5YB 1H9KA 1ENAA 5IGCA 2A69D 3RUZA 2MPMA 2PMZB 3TDQA 1B44D 4HR7B 2F0VA 2IX0A 1ONLA 3PUWA 4ABNA 2A73B 1V1OA 2VUMB 3BYYB 1LV9A 2BA0A 5IGBA 1F9QA 1F2MA 4KV6A 1GUGA 3NTKA 1TQOA 4ZLTF 3HG9A 4KMUC 5CR3A 3ND8A 2B39A 1STEA 5KIXA 3HP3A 4FNFA 3HRZC 2JP1A 4J6HA 1A3TA 2EYHA 5ISRA 4OO1I 1DJRD 4DK1A 1RCVD 2D62A 1SMYD 3A7AB 5C4JB 1II3A 1KDCA 1D6EC 1TIID 2JSOA 4XIGS 3S15B 1KDBA 3A8KE 1X3QA 2IX3A 1T5XD 5TSSA 1DOLA 3K5OA 2E74C 4FF1A 2IPKD 5I2YA 1VF7A 1PTOB 3H09A 3HOZB 4M8AA 1WCMB 4ZUJA 2F0GA 1QE6A 2PZTA 4U673 2K28A 2FMMA 1WTXA 4JBWA 1PTOC 5K5PA 3GTOB 2RKSA 1JOOA 1K8MA 1NCVA 2ENBA 2A6HD 2F0SA 1IYVA 1B50A 2NVYB 3KUPA 4R8NA 4DXFA 2OT2A 5IODA 3AMUA 4JK1C 1BCPB 4J1MA 2ICEC 1I4HA 2BDOA 5C4ZA 2IWHA 2J7ZA 3R8BA 5EJWA 2R93B 3DWPA 3NPPA 4C1NK 3C1EA 5CV8A 1HQRD 1YNJC 5C0XJ 3RZOB 1BUVT 3NQIA 4FF4A 5JEAG 2M9VA 1S5FD 1BDOA 5CV7A 2VXWA 4A93B 5CV5A 2FINB 3T16A 1PRTD 1SXTA 1ESRA 4O1NA 4BY7B 2DNEA 2RSNA 1QWYA 3K57A 1STGA 3URYA 3D4RA 1HFGA 2HQEA 5J39A 1BCPD 3D4DA 1U9RA 5KEEA 4RHSA 2F0QA 3TMEA 1JOKA 3KBXA 1E2ZA 1BBXC 2AQ2B 2K04A 1DONA 4BWGB 1SYFA 1Y8PB 4CJ1B 1UUPA 3HS0C 4IURA 1YNNC 5G3LD 2K32A 4KI0A 1Z6HA 5K36H 3MFGA 2A68C 2NTSA 5EKLA 3T13A 3I70A 1B2TA 2F0KA 1WTVA 2M00A 2F0FA 2IT1A 3S1RB 2KJXA 2B2UC 5IGGA 4UAIA 5I2XA 2B2TA 1DM0B 2Z4HA 5I4DA 5A2QL 3WDNA 2XNAC 1SNMA 5FO7B 3GV6A 1J8IA 2KCCA 3LNNA 4QUFA 2F0MA 2NB0A 4HCEA 4KD3A 5CV6A 1M4VA 3MXUA 3FMCA 1QCBD 1CT1D 1GUNA 3PUVA 3MFYA 2L12A 3HEJA 3QIAA 3D6WA 2WV6D 2BCOA 3OPOA 3H3VC 1EY0A 1JCKB 3N6RA 2NN6G 4IFDG 4K14A 2EZVA 1GUTA 2K05A 1EY9A 1IKLA 2R6GA 2F0PA 2Z4IA 3SK4A 4CKCA 1NSNS 1PMRA 3QB3A 2NTTA 1EYDA 3VR2A 5A2QE 1G6ZA 4IFDH 2AWOA 1IYUA 5C0XG 1FNWA 1PYWD 1B53A 1M8AA 3J7AV 1HHVA 1HCZA 2N88A 1SE2A 1AZQA 2F0JA 4X3UA 2KEDA 3NSWA 4RKBA 3C46A 3P20A 4QIWB 2ZXRA 4KHZA 4RGTA 2IJ0A 5JPMC 5E3FA 5C3EB 4G7HC 2RBMA 1KLUD 2TMPA 1TU2B 2L11A 2PQEA 4MHEA 2E2IB 1LTAD 4NW2A 1U4PA 4FXGC 5M5XB 2F03A 2E76C 1KTKA 1SNOA 4DF7A 3J7YW 5C44B 4L8JA 2VNUD 5D65A 4G57A 3CKIB 3CHBD 3VYUA 2YYZA 3S2HB 2ICIA 1SNPA 1EYCA 3PUXA 5K36G 2I07B 4RH6A 2LMCB 3GTQB 1CHQD 2B2TC 3MAQA 4HN7A 4XDXA 1ILPA 3Q22A 4B9XA 3OMCA 1HQMC 5AFWA 2K01A 4FF2A 1TS4A 3NUCA 4WJWA 4EQPA 3NWTA 4XQNA 4ZKCB 2WB1B 1EOTA 3S1MB 2GA4B 2NVTB 2XRQD 1C4QA 3A56A 5CBEE 1I4QA 1MSGA 1O78A 1GUWA 1TKWB 4IUNA 1VMCA 3SDZA 3I91A 2K03A 3I4LA 3P7JA 4IUVA 5EPJA 3NQTA 4B08A 3HOWB 2EY6A 3BDOA 3MA2B 1ML0D 4H44C 3C3LA 3KLRA 1STNA 2QEJC 1CA6A 3PIP3 1I4RA 1R9TB 3BDCA 2DY7A 3C1FA 3N52A 1SMYC 2I46A 2NUCA 2ZXPA 1A6XA 2CVRA 4QCLA 3IKJA 1AP0A 2LKVA 2LS01 4H7BA 1EIHA 1S5DD 2EPBA 5T1GA 3MEHA 2F0NA 2ZT9C 3EQLC 3CQZB 3D6CA 1DYQA 1IW7C 3TP8A 4BY1B 1JB3A 3S1QB 4K5VA 1CA5A 3BVMA 3P75A 1G2SA 1V1PB 3FVQA 4ZK9B 1LTRD 3SXHA 2K5WA 2PW5A 1Y1WB 4HEDA 2EY2A 1G291 4ZKBB 2J4XA 2B2YA 3DMUA 2IX1A 2BA1A 1TR5A 2WKCA 3MWYW 5D3IB 4LAAA 1AFPA 3Q24A 1RTNA 1PRTC 4BA2I 3M4OB 1FD7D 3U9OA 1R4QB 2EJMA 4L63B 5IT9E 3K5MA 2VB3X 1RODA 2EYLA 2JA5B 2IL8A 1H9SA 1PRTF 4DNTB 5IGDA 3AB9A 1EWHA 3T56B 3PIO3 4G7OC 1L0YB 1F77A 4AYBB 3NE5B 5IOCA 3S17B 1U4RA 4RGNA 1PFMA 1OXSC 1KAAA 2A6HC 4DK0A 4RWSC 4XQJA 2WAQB 5BN5A 1NAPA 3WOEA 5DNFA 3FEWX 2L0CA 4PV1C 3MZ5A 2KECA 1AN8A 2MGSA 5IT9L 3SE0A 5I6YA 5DM63 1ESFA 1EQTA 2B8FA 2F4IA 4KY6A 4KY7A 4WRDA 3OIPA 1OXTA 2C9OA 1LT4D 3GO5A 3K7AB 1CHPD 3IAYA 4FO2A 2SNMA 1JQYD 3D31A 3QJYA 4XT1B 4IFDJ 3NHHA 3GP7A 1FGBD 3TZDA 3NTIA 1WTWA 3I8ZA 1AEXA 3LWUA 4HCSA 3TN2A 3JAME 3I4NB 1TWHB 4H0LC 4C3HB 1PZJD 4K6LA 5T1IA 1Q3LA 3QWNA 3OMGA 2PNRC 3H6MA 3ONAB 5EPLA 3MXNA 2X6GA 3X3NA 3GD7A 3DEPA 4X3SA 1CZGA 2NVXB 1Z47A 1O7LA 3ZYYX 1S5CD 5E4WC 1QJOA 1QOHA 3OWEB 2A74C 2QCPX 5D14A 5EGTA 1X32A 2XRSD 3M7NA 3SK6A 1WTRA 4L6TB 4ZAIA 5F2DA 1PTOD 3DWAA 3PMFA 3QG1A 4QB4A 3FRPB 3D3RA 3C2PA 1MD2D 2F0EA 3I3CA 1R4PB 2B8GA 2PW7A 1PZKD 4Z9CB 1TVXA 3GTLB 1MSHA 4EQOA 2HUGA 1E2VA 2Z8LA 1O7YA 1B9MA 4DFAA 5KYIA 5EQ0A 1SFOB 2OF1A 1JWUD 3J80E 4TSSA 3OSOA 4N9PA 5FO8B 1F2LA 5LL6S 2RA4A 3U9SA 3G6JB 1F9PA 5CBAE 3AU7A 1STAA 3TP6A 1VDZA 1L0XB 2HCCA 1GUOA 2Q8RE 1HA6A 2KCNA 2WP8J 2PYKA 4RGOS 2L9HA 1SYCA 1LTGD 3EROA 1SYDA 3OHXC 1ZEQX 3KF8A 3S14B 4K8IA 3H91A 2CW0D 1EY5A 4C3IG 3RLFA 2RDHA 1K83B 1Q12A 2PPBC 4HTHA 1IW7D 1CFMA 2NVQB 3D8GA 1STBA 3HOYB 4C1NI 3DXJC 3R93A 5DM73 4KN7C 4ME5A 1STYA 3FKIB 4O42A 2DY8A 3A55A 3K59A 4S3SA 4IUPA 3VA5A 3RD4A 3GTMB 3S2DB 4A3IB 3SR1A 1KDAA 1W6JA 1EU3A 5KNDA 1EU4A 3P1HA 1WTOA 1Z7TA 3BG3A 1PLFA 2R61A 3A54A 4U68A 4I65A 3VYRA 2WKDA 4Q0FA 2F1MA 3K0YA 1EQVA 3GTJB 3NWSA 2F0DA 4HSVA 1JORA 2IW3A 4A3GB 4RA8A 2O2LD 1D5XC 2AQ3B 5FK9C 3BVGA 3ITPA 1F2YA 4BS9A 1QB5D 2NN6I 4V190 3VR3A 4MN3A 4A3EB 5ELEA 3J81L 1UAPA 1E2WA 4N9TA 5JPNC 3X3MA 2XN9C 2H4OA 3DUZA 4E6IA 5M5WB 2DNCA 4IZ8A 1F9RA 1XXGA 2QILA 2L1BA 5C0XI 1PFBA 5LHY1 1ZYRD 2EE1A 2BE5D 5CV4A 2F0LA 2EVBA 2Q8TA 4EQNA 1HFNA 5CC4A 1I4GA 1XTCD 4FXKC 3ERQA 5D3DA 4YIJA 3PV0A 3HOXB 4R8IA 1DOKA 2J0TD 4A3JB 1G2TA 2O5JC 5COYA 2NBFA 1Y69U 3S16B 2EYOA 1U4LA 1HPCA 1D1KA 4NMZA 1ZYRC 1J9OA 4OIKA 2D5DA 2A6EC 1RKNA 1F2ZA 4BA1I 1HXYD 4M1UB 3L7ZC 5HURA 1HTPA 4IFDI 3VYSA 1EEFD 4DGZA 1O7ZA 2KOLA 4FF3A 2NN6H 3ND9A 4HMIA 4RCOA 2B63B 4KJOA 5CV9A 1BOSA 2F0OA 3VR5A 1I4PA 1SJHD 4XXEA 4OO1G 1MI2A 4FP5D 1B4OA 4NKLA 5M9OA 1GUSA 4HSPA 1PTOF 2MHVA 1OXXK 3VR4A 1LABA 2N55A 1IHZA 3VR6A 3CRLC 4I7ZC 1PXUA 1E0BA 1LLRD 3BDLA 3BZDB 3PUZA 2D9UA 2JA6B 1DD2A 1RJTA 5A35A 1LTSD 4PMWA 1CI3M 1JICA 4KKTA 1WTQA 3MVVA 3EJIA 4K2KA 4XQQA 5KRUA 1FNUA 1VMPA 1BCPF 3T51B 5KGUA 4KKSA 3LX0A 1JC7A 4DA2A 4KD4A 5BN4A 4K5XA 1BXTA 3TBIB 1DXMA 1Y8NB 1BCPC 4F87A 1PRTB 3KBGA 1SYEA 1HUMA 1VCIA 4C56C 4IUQA 3GTKB 4UDUC 3MXPA 1HA5A 3RMHA 5JVH3 2KHSA 5ELCA 5CMDA 3W3AA 4X3KA 5EPKA 2K6AA 1TS3A 5DAUA 1SNCA 2QF7A 5JAVA 3TSSA 4DXGA 2AQ1B 2K7VA 3DWQA 4Y7NB 1A15A 4Q5VA 1C8CA 4LK1C 1Q90A 4PQXA 2WINB 1KLGD 1LT6D 2B2VA 4CKEA 4ZYSA 4R9WA 4C3IB 3EVQA 1KABA 1TY2A 2F0IA 1C48A 3NXWA 2JEBI 3BYTB 3E0JA 4RCNA 5JEAH 1TY0A 3Q23A 5LL6X 5C3XA 1B9NA 3MHBA 2DN8A 1GOZA 4K6DA 2R3ZA 2EYPA 3T53B 3O13A 1MGSA 2BOSA 3Q6SA 3HKZB 2KA7A 5C0XH 4FYDA 4XTCS 1D5MC 1B3AA 4G4KA 4KHVA 3S1NB 1XX8A 3SHLA 2PCFB 4ODGA 2BE5C 4NDXA 2RQXA 3DM1A 3NBIA 4ZUIA 3VA7A 1TS5A 1QILA 5E4XA 4CBVA 4XYOA 2XWJB 1Q1EA 2B2WA 3M7GA 1F9SA 1H9MA 1OXUA 2G9HD 3K6OA 4RGMA 4CJ2C 1H9RA 2QDBA 2AUKA 3GV3A 3QOJA 1PDQA 2JA7B 2XIWA 1Q8IA 1SE4A 2LFNA 5DEHA 3J81E 3GTPB 5IIFA 2EY1A 2V4DA 4ILWA 4RAUC 1EEID 2G9DA 1EWCA 3D4WA 5IGEA 1SBBB 1AW7A 3L9AX 5IGFA 1U4MA 2FFKB 4NP5A 5E1FA 3I90A 2FJ2A 4OO1H 3OW7A 4KJNA 2K1BA 1SJED 3JAML 1RF2D 1OO9B 4IQZA 4OIJA 1ET9A 5C6AA 5J22A 2X6LA 4P2CB 5I9PA 3M85A 2EYMA 1ENCA 4MIUA 1TS2A 5FOBB 4XT3B 3UI2A 1SNQA 4OL7A 2L4NA 4H13C 1LTBD 1AZPA 4CHTB 5JJZA 1A2UA 4OGQC 2HCIA 2VB2X 2CW0C 2RSOA 3NP8A 4FVMA 1EY4A 3V2TA 2L55A 2L5TA 5EBDA 3GQBA 1S5BD 4DU9A 3J80L 2RDFA 2CHBD 1V1PA 3HZXA 4QF4A 5C5LA 3I72A 3H0GB 4TKOB 4HAEA 3IFTA 2MP1A 5KYLA 2ZXOA 4TQUS 2B2VC 3BVZA 3MXGA 1Y1VB 5KNCA 3H94A 2SOBA 2K33A 1V8QA 1DCZA 2PZUA 2B2UA 2LY7A 4ZQ3A 3RZDB 4G7ZC 4LMQD 1GHKA 1S5ED 1PFNA 1XWEA 2E75C 3BS1A 3OWFA 5C4HA 4DNRB 1O80A 5FKAC 1W6KA 3W2DA 1WD0A 1NR2A 4A3DB 2NYZD 1ZKOA 2A68D 2EYJA 1EY8A 2HDLA 1EL0A 2EXZA 2NZ1D 1SEBD 2EY5A 1A3VA 1HTLD 2F0WA 4DAYA 2K5QA 3TP7A 2EDGA 4IALA 1CQVA 2O4XA 2KUMA 3OIQA 4ULLA 1S4ZA 5C3WA 1FNVA 2JEAI 2B2WC 3K5LA 3S9WA 4A3KB 5EKIA 1CK1A 2OEOA 2SNSA 2AUJD 1HRJA 5EBCA 3V96A 1GJXA 4QMGA 1SSOA 4XYQA 2XWBB 4WORA 3HOVB 1D1IA 1ICWA 4TRDA 2F3VA 3I73A 4EVOA 5JVG3 2TSSA 1JWMD 3E5SA 4KKUA 5FO9B 1DZ1A 2JYOA 1EZ8A 1PZID 4A3MB 4X3TA 3IFDA 1SE3A 1CZWA 3TZUA 3NTHA 1TWCB 1WD1A 1I3QB 5CYUA 5ELBA 1LTTD 2M2LA 1QNKA 1SYBA 1SDFA 1YNJD 4K2LA 4PMCA 1SNDA 1FYCA 1FR3A 4EGVA 4IUTA 3FPUB 1D2BA 5J1ZA 4RFBA 2A6ED 1CM9A 3PO2B 4PMBA 5HGTA 1DOMA 2EOTA 2PO4A 1PTOH 3M3YB 1KNEA 1QG7A 3PO3B 5BN3A 5NUCA 3NK9A 1EFID 1EY7A 1HUNA 1JE4A 1LTID 4A3FB 5ELDA 2EYFA 4OHJA 4BBRB 2HDMA 5I9OA 2NWGA 2WACA 2ID0A 2RDGA 2XVSA 1WTPA 1A3UA 1BF4A 1TWAB 2Q8IB 4A3BB 1OXVA 4DN4M 2QKIC 3F2UA 4GZYC 1RTOA 1IL8A 1ET6A 1K8OA 1XYIA 1I4XA 1LACA 4C2MB 4QUCA 5EKKA 3EA6A 3L3OC 1GXDC 3R2IA 3R2TA 3FDTA 3CU7A 3A8JE 1TWFB 2F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G9H D;  2O2L D;  1D5X C;  2AQ3 B;  2CHB D;  1LT5 D;  5FK9 C;  4RGM A;  1V1P A;  3BVG A;  3V05 A;  1EEF D;  2AQ2 B;  1PTO B;  2TSS A;  1JWM D;  4UDU C;  2XRQ D;  1LT3 D;  1HA5 A;  4BWG B;  1L0X B;  1PRT C;  3EFX D;  1FD7 D;  5ELC A;  1PZI D;  1I4Q A;  1SE3 A;  1D5Z C;  1UUP A;  4L63 B;  4RCO A;  1TS3 A;  4RGO S;  2NTT A;  1RD9 D;  3BVZ A;  5ELE A;  1PZJ D;  1LTG D;  3TSS A;  4K6L A;  5ELB A;  4DXG A;  1LTT D;  1PTO C;  2AQ1 B;  1SE4 A;  1I4P A;  3MFG A;  2XN9 C;  1SJH D;  1ENF A;  1PRT F;  3DWQ A;  3KLS X;  2NTS A;  1JR0 D;  1FNW A;  1PYW D;  1S5E D;  1XXG A;  1RDP D;  1B44 D;  2QIL A;  4RFB A;  1EEI D;  1KLG D;  1LT6 D;  1SE2 A;  1EWC A;  1L0Y B;  1F77 A;  2QEJ C;  4ZYS A;  1SBB B;  1AW7 A;  1G8Z D;  1PTO F;  2RDH A;  1V1O A;  1I4R A;  4DXF A;  1S5C D;  5FKA C;  3BYY B;  1PTO H;  4RGN A;  3W2D A;  1TY2 A;  1BCP B;  1LO5 D;  3OWE B;  1I4H A;  2IJ0 A;  4RGT A;  3BYT B;  1EFI D;  3R8B A;  1KLU D;  1I4G A;  1LLR D;  1TY0 A;  1XTC D;  2XRS D;  1SJE D;  3BZD B;  3DWP A;  1LTA D;  5I4D A;  1RF2 D;  5D3D A;  1HQR D;  4L6T B;  1LTI D;  1KTK A;  2XNA C;  1GOZ A;  1LTS D;  1PTO D;  3DWA A;  5ELD A;  1S5D D;  1STE A;  4OHJ A;  1MD2 D;  1S5F D;  1ET9 A;  3O13 A;  1SEB D;  4Z9C B;  1PZK D;  2RDG A;  1HTL D;  3CHB D;  1D5M C;  2ICI A;  1DYQ A;  1M4V A;  1FNU A;  1PRT D;  1AN8 A;  1SXT A;  1TS2 A;  4RHR A;  4O1N A;  1CQV A;  1BCP F;  1EU3 A;  1CT1 D;  1DJR D;  1ESF A;  1RCV D;  1FNV A;  3BVM A;  1EU4 A;  2Z8L A;  3MC0 B;  4RH6 A;  1B1Z A;  1ET6 A;  1LTB D;  1LT4 D;  1CHQ D;  1V1P B;  2SEB D;  5ELF A;  1D6E C;  2R61 A;  1CK1 A;  1CHP D;  1I4X A;  3URY A;  1JWS D;  1BXT A;  1LTR D;  2WV6 D;  1TS5 A;  1JWU D;  3EA6 A;  1BCP D;  1QIL A;  4TSS A;  1JQY D;  1BCP C;  1T5X D;  1PRT B;  3R2I A;  1TS4 A;  3R2T A;  4RHS A;  1HXY D;  5TSS A;  2J4X A;  1JCK B;  1S5B D;  3GP7 A;  4C56 C;  3SEB A;  2IPK D;  5D3I B;  1FGB D;  1UNS A; 
#chains in the Genus database with same CATH topology
 1CQF A;  1I3Q H;  4LJZ C;  2Y0S E;  2F0U A;  1ZXT A;  5IYC H;  3EFX D;  1SFO H;  4GOP A;  1NR4 A;  3M4Y A;  4DK6 C;  1SN8 A;  1WVL A;  3HGB A;  4HMJ A;  3WOF A;  1JOQ A;  1RD9 D;  4CJ0 B;  1BQQ T;  1EYA A;  1LYL A;  2UXD L;  2ZTE A;  4JI2 L;  4YWM A;  4IN3 A;  4K8J A;  2C5C A;  1UEA B;  3KLS X;  3GTG B;  2Z1C A;  4WFN 3;  1VF5 C;  4Y7N H;  1K28 A;  4YCV A;  1VQP A;  1MBY A;  2B2Y C;  3PO2 G;  3NEN A;  1X3P A;  3DHQ A;  5CGK A;  2MUY A;  5IP7 H;  2RVL A;  3TP5 A;  1TWG H;  1L1O C;  2AWN A;  3G7L A;  1STH A;  4LFC L;  3Q0A A;  2R7Z B;  1LO5 D;  3KK7 A;  2JXM B;  2K5D A;  3S1M H;  4DV5 L;  4QGU A;  1I94 Q;  4KTA A;  3A74 A;  3SVM A;  5C5M A;  2F0T A;  1J6Q A;  2KHI A;  3K5N A;  1TT2 A;  1IKM A;  5IYB G;  1Y14 B;  4A3L G;  2D2C C;  4BBS H;  5FLX L;  4HID A;  2D0P A;  4C3H G;  2QEX A;  5KNB A;  1BR9 A;  3T1Y L;  2R7F A;  3QO2 A;  1T5E A;  1RHP A;  1SYG A;  2OXP A;  2EJG C;  1G91 A;  4PZ8 A;  3I4M B;  1X9N A;  2FHT A;  2SEB D;  1YNX A;  2R92 B;  1H9J A;  4X66 L;  1HZC A;  1S3O A;  2PMZ E;  1JWS D;  4C3J G;  3ULL A;  2O5I C;  2DUD A;  3U58 A;  3PUY A;  2SDF A;  5M3M H;  4BBS B;  1IYJ B;  3CAM A;  1WFQ A;  5G3L F;  3HOU B;  4RKL A;  3T4A C;  1KIX A;  2CQA A;  2JA8 H;  2PZW A;  3SEB A;  1Y8O B;  3DEO A;  1UNS A;  2N49 A;  3A7L A;  3HFZ B;  3VYT A;  4V0B A;  1KNA A;  1LT5 D;  1Q1B A;  3JAM i;  4UHV A;  3ER0 A;  2E8G A;  3KYH C;  2F3I A;  2KVM A;  5C4J H;  3HOV H;  2Y0S B;  4ZRZ A;  1YNN D;  3HKZ E;  4KY5 A;  4TVA B;  4LF8 Q;  4X64 L;  1D5Z C;  3E9I A;  2E2D C;  4CGY B;  3EN2 A;  1VQA A;  2LXJ A;  5LMU L;  2X69 A;  1MKH A;  2EJF C;  4DR5 Q;  5JEA J;  3CC2 A;  3BZK A;  1GO3 E;  1ENF A;  1I6V C;  4OWW B;  2UUB Q;  1JR0 D;  5FLX E;  2Z6K C;  1I50 B;  4F88 A;  4J8Q A;  1EQR A;  1IBK Q;  4F8M A;  1RDP D;  5C4X B;  3R3O A;  3CRK C;  3IL8 A;  1G8Z D;  3CME A;  1XPR A;  2MQH A;  1BO0 A;  1KQS A;  2IHF A;  1CTM A;  1JJ2 A;  1T9H A;  1QNU A;  4LF4 L;  4FXD A;  1EIG A;  1K0R A;  2F0H A;  2FMC A;  4ID6 A;  5COR A;  3NEL A;  1ILQ A;  5I6W A;  2A5H A;  4DAV A;  3GTK H;  4P73 A;  5M5Y H;  4DAP A;  1LUZ A;  1GHJ A;  3OOC A;  4F7X A;  1X3F A;  3HOW H;  3LWE A;  3KLW A;  4BY7 H;  4DV4 Q;  4K5W A;  3U4Z A;  4IUU A;  4DR3 L;  1V43 A;  5JOB A;  4DV4 L;  3KLS A;  2MJ8 A;  2WII B;  1BNZ A;  1VQC A;  2KEE A;  5IT9 c;  2YU9 H;  4DR7 L;  1SAP A;  2EXD A;  3FPP A;  4RHR A;  1S40 A;  1IXR A;  1A2T A;  2H1E A;  4CKB A;  3MC0 B;  2VL6 A;  4B9W A;  1B1Z A;  3J7A F;  1I6H B;  5ELF A;  4PNY A;  4B3R L;  2PNH A;  2VQF Q;  3ICE A;  2CFM A;  3QOL A;  3E6Z X;  4B3T Q;  4C3J B;  3U4V A;  3K58 A;  4A93 G;  3RN5 A;  5M3F B;  1XMO L;  3NBH A;  3FP9 A;  3SK8 A;  4KN4 C;  2E2J B;  2A69 C;  3SK5 A;  2JA8 B;  1HNW L;  2E2H B;  4X65 L;  1EZ6 A;  3E0E A;  3V05 A;  5M3M B;  2BDN A;  2YU9 B;  1TWG B;  3MTS A;  1LT3 D;  4KK7 A;  3S2H H;  2GN5 A;  1V9P A;  1H9S B;  2ZM6 L;  2KQ3 A;  3S15 H;  2Y0S G;  2CH4 A;  4K0K Q;  1NUC A;  2MO1 A;  3A8I E;  2JA7 G;  5FJ8 H;  4A3M G;  1EY6 A;  2JE6 I;  1D8L A;  2XSC A;  5M5Y B;  3PO3 H;  1H9K A;  4JI5 Q;  1ENA A;  5IGC A;  3GTG H;  2A69 D;  1H95 A;  4A3G G;  3RUZ A;  2MPM A;  4BXX G;  3H0G G;  2PMZ B;  1HZA A;  1UE7 A;  1B44 D;  2RCN A;  1SMX A;  3TDQ A;  4HR7 B;  2F0V A;  5ELO A;  4JV5 L;  2IX0 A;  1ONL A;  3PUW A;  4AYB G;  5LMN W;  4ABN A;  2A73 B;  4JI7 L;  2VQF L;  1V1O A;  3S1N H;  1G51 A;  2A1A A;  3J7Z C;  2D0O A;  2VUM B;  3BYY B;  4KHP L;  1LV9 A;  2BA0 A;  5IGB A;  5FLM G;  3H0G H;  2AHO B;  1F9Q A;  3K7A H;  1NBW A;  1F2M A;  4KV6 A;  1GUG A;  2DGY A;  5M5W H;  3NTK A;  1TQO A;  4ZLT F;  3HG9 A;  1MIU A;  2JA6 G;  1K9M C;  4KMU C;  5CR3 A;  3ND8 A;  3GTJ H;  2K14 A;  5IY0 A;  1AE2 A;  2B39 A;  1STE A;  5KIX A;  1XMQ L;  1WOC A;  3HP3 A;  4FNF A;  1JJG A;  1WI5 A;  5IWA Q;  3M9B A;  3HRZ C;  2JP1 A;  4J6H A;  1A3T A;  2EYH A;  5ISR A;  4OO1 I;  4LF9 L;  1DJR D;  4DK1 A;  1RCV D;  2D62 A;  4WJ3 M;  4A3B G;  4DR5 L;  1SMY D;  3A7A B;  5C4J B;  1II3 A;  1KDC A;  1D6E C;  1TII D;  2JSO A;  4XIG S;  3S15 B;  5IP9 G;  2NVY H;  1KDB A;  3A8K E;  3T1Y Q;  1X3Q A;  2IX3 A;  2G5D A;  1B7Y B;  4LW1 A;  1T5X D;  5AJ3 Q;  3HOU H;  2B63 G;  5TSS A;  1DOL A;  3K5O A;  3A0J A;  2E74 C;  4A3I G;  4FF1 A;  2IPK D;  2CWA A;  4KHP Q;  4B3T L;  5I2Y A;  1VF7 A;  1PTO B;  3I4M H;  3H09 A;  3HOZ B;  1IBM Q;  4M8A A;  1WCM B;  4BBR G;  4ZUJ A;  1PH1 A;  2F0G A;  3I55 A;  1QE6 A;  2PZT A;  3PO2 H;  1J5E Q;  4PZ7 A;  4U67 3;  2K28 A;  2FMM A;  3MXN B;  1WTX A;  4JBW A;  4LFC Q;  1C7Y A;  1PTO C;  3E9H A;  5K5P A;  3GTO B;  3I4O A;  2KCM A;  2RKS A;  1U0L A;  1JOO A;  1PH7 A;  1K8M A;  3AQQ A;  1NCV A;  2ENB A;  2A6H D;  2F0S A;  4GLA C;  3K0X A;  1IYV A;  4GKJ Q;  2CH4 W;  1B50 A;  2NVY B;  4ME3 A;  2OCE A;  1IL2 A;  1GM5 A;  3KUP A;  4R8N A;  4UPA A;  4DXF A;  4A3E H;  2OT2 A;  5IOD A;  4B3S Q;  3AMU A;  4JK1 C;  1BCP B;  4J1M A;  3J80 c;  2ICE C;  5HY6 A;  1I4H A;  2BDO A;  5C4Z A;  2IWH A;  2J7Z A;  3R8B A;  5EJW A;  2R93 B;  3DWP A;  3NPP A;  4C1N K;  3C1E A;  5CV8 A;  1HQR D;  1YNJ C;  5C0X J;  3KF6 A;  3RZO B;  1BUV T;  2OTL A;  3NQI A;  1HR0 L;  4FF4 A;  1BKB A;  2M9V A;  5JEA G;  1S5F D;  1BDO A;  5CV7 A;  2VXW A;  1MJE A;  4A93 B;  1CSP A;  5CV5 A;  2FIN B;  4YY3 Q;  4GNX C;  3T16 A;  4X62 Q;  1PRT D;  4NXN L;  1SLJ A;  1SXT A;  1HR0 W;  1EIF A;  1ESR A;  1N9W A;  4O1N A;  1YEZ A;  4BY7 B;  4R4T A;  1PH5 A;  2DNE A;  2RSN A;  1HZ9 A;  1QWY A;  2UXD Q;  1P8L A;  3K57 A;  2R7D A;  1STG A;  3M4P A;  5HGQ A;  4A3K G;  3URY A;  3D4R A;  1HFG A;  3PSI A;  1WTH A;  2HQE A;  5J39 A;  1BCP D;  3D4D A;  1MJC A;  1U9R A;  4GOP C;  5KEE A;  4RHS A;  2F0Q A;  3TME A;  2Q2H A;  1E24 A;  5ELN A;  2UUC Q;  4YHH L;  4B3R Q;  1JOK A;  1WJJ A;  3KBX A;  2N78 A;  1E2Z A;  2JA9 A;  3HOY H;  1K73 C;  1Q81 C;  4R4C A;  4JI1 Q;  1BBX C;  2AQ2 B;  2E5L L;  3M4Q A;  2K04 A;  1DON A;  4BWG B;  3KF8 B;  1P16 A;  1SYF A;  1Y8P B;  4O0A A;  4MNO A;  1Q8K A;  1NMF A;  4CJ1 B;  3KJP A;  4LF6 L;  4IOC A;  1UUP A;  3HS0 C;  4IUR A;  2I5M X;  1YNN C;  5G3L D;  4JI0 Q;  2K32 A;  4MTK A;  4KI0 A;  1Z6H A;  3CPF A;  5K36 H;  3MFG A;  3HOV G;  2A68 C;  3CCV A;  2NTS A;  5EKL A;  3RR5 A;  3T13 A;  1HNX L;  3I70 A;  4IPG A;  1B2T A;  4YY3 L;  2F0K A;  2XTI A;  1WTV A;  2M00 A;  2F0F A;  2IT1 A;  3G6E A;  2Q2T A;  3S1R B;  3UDX A;  5EAY A;  4X66 Q;  5FJ8 G;  2KJX A;  2B2U C;  4A3J H;  5IGG A;  4UAI A;  5I2X A;  2B2T A;  2E2H H;  2F4V Q;  1DM0 B;  2Z4H A;  4UP7 A;  5I4D A;  5A2Q L;  3CQZ H;  4N8F A;  3WDN A;  1VQ7 A;  2XNA C;  1SNM A;  5FO7 B;  3G71 A;  3GV6 A;  1J8I A;  2KCC A;  1L1O A;  3LNN A;  4QUF A;  4LF5 Q;  3TS2 A;  2F0M A;  4DV6 Q;  4BBS G;  1Q46 A;  2NB0 A;  3GDE A;  3WWV A;  3JAM c;  4DKA C;  4HCE A;  4KD3 A;  5CV6 A;  5AJ3 L;  1LTL A;  1M4V A;  3MXU A;  5C3E H;  2K5H A;  1HNW Q;  3FMC A;  4A3M H;  1QCB D;  1CT1 D;  1GUN A;  3PUV A;  4R4O A;  3MFY A;  3CCM A;  2L12 A;  3HEJ A;  4AH6 A;  3PF4 A;  3QIA A;  3KDF B;  1TXY A;  2F52 A;  3D6W A;  4QY7 A;  5IYD G;  2WV6 D;  1N32 L;  1PH3 A;  4HIM A;  2BCO A;  3MEF A;  1IBM L;  3OPO A;  2OQK A;  4A76 A;  2WB1 E;  3H3V C;  1EY0 A;  1JCK B;  2UUA L;  3N6R A;  2NN6 G;  4IFD G;  4JI2 Q;  4K14 A;  2EZV A;  2F4V L;  1GUT A;  2K05 A;  1EY9 A;  3UDG A;  3AFP A;  1IKL A;  1EUJ A;  2R6G A;  2F0P A;  4DV3 L;  4R4Q A;  1Q86 C;  3I4M G;  4L5Q A;  1E3P A;  2Z4I A;  3SK4 A;  2VW9 A;  4CKC A;  4DUY Q;  1NSN S;  1PMR A;  3QB3 A;  3AEV A;  2DJG C;  1PH6 A;  2NTT A;  1UE1 A;  3TS0 A;  1EYD A;  1EYG A;  1CKM A;  1PV4 A;  3VR2 A;  5A2Q E;  4A3J G;  4UP8 A;  4OWT B;  1G6Z A;  4IFD H;  2QA4 A;  5IYC G;  2AWO A;  1N33 Q;  1IYU A;  5C0X G;  1FNW A;  1PYW D;  2GVA A;  1B53 A;  3PF5 A;  1M8A A;  1I94 L;  1VQ5 A;  3J7A V;  1HHV A;  1HCZ A;  2N88 A;  4IPH A;  1SE2 A;  1AZQ A;  1PH8 A;  2K5N A;  3FKI H;  2F0J A;  4A75 A;  4X3U A;  2N8N A;  2KED A;  3NSW A;  4RKB A;  3C46 A;  1CKN A;  3P20 A;  3UDF A;  2FXQ A;  4QIW B;  2ZXR A;  2YTV A;  4GS3 A;  4KHZ A;  3BJU A;  4RGT A;  2IJ0 A;  5JPM C;  5E3F A;  5C3E B;  4G7H C;  4DV6 L;  2RBM A;  1KLU D;  2TMP A;  4NXN Q;  4DR6 L;  4MHE A;  1TU2 B;  2L11 A;  2PQE A;  2XGT A;  1TWH H;  4DR6 Q;  2E2I B;  4PG3 A;  1LTA D;  4NW2 A;  1U4P A;  2UUC L;  4FXG C;  5M5X B;  2F03 A;  2E76 C;  1KTK A;  2B3G A;  3NBH B;  1SNO A;  4DF7 A;  3W1G A;  3J7Y W;  1CKO A;  4X65 Q;  1UE6 A;  1IZ6 A;  4L8J A;  5C44 B;  2VNU D;  5D65 A;  4DV3 Q;  4G57 A;  3CKI B;  3CHB D;  3VYU A;  2YYZ A;  3S2H B;  2ICI A;  1SNP A;  1N34 L;  1K83 H;  2WB1 G;  1EYC A;  1N33 L;  1UWV A;  2KEN A;  3PUX A;  5K36 G;  4RG1 A;  2DJF C;  2I07 B;  4RH6 A;  2LMC B;  1CHQ D;  1VQ6 A;  2B2T C;  3GTQ B;  3MAQ A;  4LFB L;  4HN7 A;  4XDX A;  3CCU A;  5C4X G;  1HNX Q;  1ILP A;  1KD1 C;  3Q22 A;  3A5Z B;  4B9X A;  4QIW E;  3OMC A;  1HQM C;  5AFW A;  2IY5 B;  4DR7 Q;  2K01 A;  4FF2 A;  4RMF A;  1TS4 A;  3NUC A;  4WJW A;  4EQP A;  3NWT A;  4XQN A;  4ZKC B;  2WB1 B;  1KL9 A;  1EOT A;  3S1M B;  3S1Q H;  2GA4 B;  4DR2 Q;  2NVT B;  2JN4 A;  2XRQ D;  4A3K H;  1GD7 A;  2A8V A;  1C4Q A;  3A56 A;  5CBE E;  4JOI A;  1I4Q A;  1MSG A;  1O78 A;  1QVC A;  1GUW A;  1TKW B;  4IUN A;  2QDL A;  1FJG L;  1VMC A;  2I0Q A;  2KHJ A;  3SDZ A;  3I91 A;  3F1Z A;  1RL2 A;  2K03 A;  4IUV A;  2RF4 A;  3I4L A;  3P7J A;  5IWA L;  1PH9 A;  5EPJ A;  1K0S A;  5GAG C;  3NQT A;  4B08 A;  3HOW B;  4A3L H;  2EY6 A;  3BDO A;  4L5R C;  3MA2 B;  3RLO A;  1ML0 D;  4H44 C;  3C3L A;  3KF6 B;  3KLR A;  1YIJ A;  2Z0S A;  1STN A;  2JA5 H;  2QEJ C;  1CA6 A;  3PIP 3;  1I4R A;  1R9T B;  4P71 A;  2OQ0 A;  3BDC A;  2DY7 A;  3C1F A;  3N52 A;  1SMY C;  2I46 A;  3PGZ A;  2NUC A;  2ZXP A;  1A6X A;  2CVR A;  4QCL A;  3IKJ A;  1AP0 A;  2WAQ E;  3CCS A;  3J81 j;  1CSQ A;  2LKV A;  2LS0 1;  4H7B A;  1KXL A;  1YJ9 A;  1IBL Q;  1EIH A;  1N36 L;  1S5D D;  2EPB A;  5T1G A;  3MEH A;  5LMN Q;  2F0N A;  1XNQ L;  2ZT9 C;  3EQL C;  4HJ9 A;  3CQZ B;  3D6C A;  4LFB Q;  3HOU G;  1DYQ A;  5FLX c;  1IW7 C;  4DV2 L;  5IE8 A;  1XNR Q;  3TP8 A;  4BY1 B;  3F8T A;  1JB3 A;  2Z6B A;  3S1Q B;  4K5V A;  1CA5 A;  3BVM A;  5DLQ E;  3P75 A;  2ATW A;  1G2S A;  1V1P B;  4DV1 Q;  3FVQ A;  3CMA A;  4ZK9 B;  1NMG A;  3S1R H;  1LTR D;  3SXH A;  4DR3 Q;  1X56 A;  2K5W A;  2PW5 A;  1Y1W B;  4CDD C;  4HED A;  3M3Y H;  2Z6K A;  2EY2 A;  1G29 1;  3CPW A;  1E1T A;  4ZKB B;  2J4X A;  2B2Y A;  3HOX H;  3DMU A;  1JB7 A;  2IX1 A;  1VQ9 A;  2ALY B;  2BA1 A;  1TR5 A;  2WKC A;  3MWY W;  5D3I B;  4LAA A;  1AFP A;  3PIO A;  5GQO A;  3Q24 A;  4JI4 L;  1RTN A;  1PRT C;  4BA2 I;  3M4O B;  1FD7 D;  1K3R A;  3GTO H;  4JV5 Q;  3U9O A;  1LM0 A;  3F2B A;  1R4Q B;  2EJM A;  4L63 B;  5IT9 E;  3K5M A;  1XNQ Q;  2VB3 X;  4GNX B;  4JBK A;  4OXP A;  1ROD A;  2EYL A;  3H3V H;  4FDB A;  1SE8 A;  1VQE A;  5FLM H;  1Y1V H;  4DPG A;  2JA5 B;  2IL8 A;  1H9S A;  1PRT F;  4DNT B;  4LWC A;  5IGD A;  3AB9 A;  1EWH A;  3UE1 A;  3T56 B;  3PIO 3;  4G7O C;  1L0Y B;  1F77 A;  4AYB B;  1WCM G;  4LF9 Q;  3NE5 B;  3FKI G;  5IOC A;  4LFA L;  4HIO A;  4GOP B;  1M90 C;  3S17 B;  1U4R A;  4GN4 B;  4RGN A;  2R7Z H;  1PFM A;  1OXS C;  4MZ9 A;  5C4X H;  2PI2 A;  1KAA A;  1VQG A;  1N34 Q;  2A6H C;  3EBE A;  4DK0 A;  4RWS C;  4XQJ A;  4JYA L;  3CW2 C;  2WAQ B;  5BN5 A;  1NAP A;  2E5L Q;  3WOE A;  1QZG A;  4JI8 L;  4HJ8 A;  5DNF A;  4N8X 1;  1YVC A;  3FEW X;  2QGQ A;  2HIV A;  3T1H Q;  4JI4 Q;  2L0C A;  1PA6 A;  4PV1 C;  1Y1V G;  3MZ5 A;  2KEC A;  2N3S A;  1AN8 A;  2MGS A;  5IT9 L;  4AIM A;  3SE0 A;  4WJ4 A;  5I6Y A;  1EOV A;  5DM6 3;  1ESF A;  5LMN L;  1EQT A;  4HJ5 A;  2JJQ A;  2B8F A;  2F4I A;  4KY6 A;  4KY7 A;  4WRD A;  2WAQ G;  3OIP A;  1OXT A;  2C9O A;  1LT4 D;  2I5H A;  3CC7 A;  4DK3 C;  2R92 H;  3GO5 A;  3K7A B;  4DR1 Q;  1G6P A;  1CHP D;  4OEM B;  4FO2 A;  2SNM A;  3IAY A;  4GLV B;  2KCT A;  3I4N H;  1JQY D;  1YJN A;  3D31 A;  3QJY A;  3B6Y A;  4XT1 B;  4IFD J;  3NHH A;  1W2B A;  3PO3 G;  3GP7 A;  1FGB D;  3HOW G;  3TZD A;  3NTI A;  1WTW A;  3I8Z A;  4PZ6 A;  1AEX A;  4LUZ A;  3LWU A;  4HCS A;  3TN2 A;  4BBR H;  3HKZ G;  3JAM E;  3I4N B;  1TWH B;  4H0L C;  4C3H B;  1VQM A;  1PZJ D;  4K6L A;  5T1I A;  3RNU A;  4DV0 Q;  3OYY A;  1Q3L A;  3QWN A;  3W5O A;  3OMG A;  1C0A A;  2PNR C;  4UY8 C;  2LXK A;  3H6M A;  4DV2 Q;  4NXM Q;  3ONA B;  1X3G A;  5EPL A;  3MXN A;  2X6G A;  3X3N A;  3GD7 A;  5C44 G;  3DEP A;  4JI7 Q;  1B8A A;  4X3S A;  1CZG A;  2NVX B;  1ASZ A;  1Z47 A;  4DR1 L;  1O7L A;  1Y1W G;  4AYB E;  4BY1 H;  4A3E G;  3ZYY X;  1S5C D;  1PFS A;  5E4W C;  1QJO A;  1IBL L;  4OX9 Q;  3QR8 A;  1QOH A;  3OWE B;  3TRZ A;  2A74 C;  2QCP X;  1CUK A;  5D14 A;  5EGT A;  1X32 A;  2RHS B;  2XRS D;  5J3B A;  3SK6 A;  1WTR A;  3M7N A;  3ULJ A;  4NPS A;  1OTC A;  3J7A 5;  1E7Z A;  4YHH Q;  4L6T B;  4ZAI A;  5F2D A;  1PTO D;  3DWA A;  3PMF A;  3QG1 A;  4QB4 A;  3FRP B;  3D3R A;  3C2P A;  1MD2 D;  2F0E A;  3I3C A;  1R4P B;  2B8G A;  2PW7 A;  1PZK D;  4Z9C B;  1TVX A;  3GTL B;  1MSH A;  4GLX A;  4EQO A;  1XPU A;  2HUG A;  4IO9 A;  4GKK Q;  2ZTD A;  1E2V A;  2Z8L A;  4YCW A;  1O7Y A;  4GN5 A;  1B9M A;  3L0O A;  4DFA A;  5KYI A;  1VQ4 A;  3OW2 A;  5EQ0 A;  3KJO A;  1SFO B;  5JJL A;  2YTX A;  4JVZ A;  2MFI A;  2OF1 A;  1JWU D;  4I7A A;  3J80 E;  4C2M H;  4TSS A;  3OSO A;  4N9P A;  2GVB A;  5FO8 B;  1F2L A;  3M4O H;  2C35 B;  5LL6 S;  4OX9 L;  1VQJ A;  4A3D G;  2JA8 G;  3HOY G;  1KHI A;  1WYD A;  2RA4 A;  3U9S A;  4EX5 A;  4A3B H;  3G6J B;  2KBN A;  1I50 H;  1F9P A;  3PQI A;  2ZJQ A;  5CBA E;  3AU7 A;  1STA A;  3TP6 A;  1VDZ A;  1B3Q A;  3RZO H;  1L0X B;  2HCC A;  4P74 A;  1GUO A;  2Q8R E;  1HA6 A;  2K4K A;  2KCN A;  2WP8 J;  2PYK A;  3H15 A;  2B29 A;  4RGO S;  2L9H A;  1SYC A;  1LTG D;  3ERO A;  1SYD A;  1QZH A;  3OHX C;  1ZEQ X;  4A4I A;  2ZM6 Q;  3KF8 A;  2NZO A;  3S14 B;  1GKH A;  1KAW A;  4H02 A;  3H91 A;  4K8I A;  2R93 H;  4LF8 L;  1RIP A;  2CW0 D;  1K8G A;  1EY5 A;  1SRU A;  1UE5 A;  4CDE C;  2EQS A;  2ZTC A;  4A3F H;  3STB C;  4C3I G;  4LF6 Q;  3RLF A;  2RDH A;  1K83 B;  1YHQ A;  1Q82 C;  1Q12 A;  2PPB C;  4HTH A;  1IW7 D;  1CFM A;  4OEL B;  1XNR L;  3J80 i;  2P5Z X;  2NVQ B;  4POG A;  3D8G A;  1STB A;  3HOY B;  4C1N I;  2L15 A;  1VQL A;  3DXJ C;  3R93 A;  5DM7 3;  1QUQ B;  4KN7 C;  4JPB W;  4ME5 A;  1STY A;  3FKI B;  4O42 A;  2DY8 A;  3A55 A;  3K59 A;  4S3S A;  4IUP A;  1FL0 A;  3VA5 A;  3RD4 A;  3GTM B;  3S2D B;  4A3I B;  2PQA B;  4YWK A;  3SR1 A;  1PHJ A;  3I7F A;  1KDA A;  1W6J A;  1EU3 A;  4NB3 A;  5KND A;  3T1H L;  1EU4 A;  3P1H A;  2Q2U A;  1WTO A;  2R92 G;  1Z7T A;  3BG3 A;  3J81 c;  3STB D;  1PLF A;  2R61 A;  3A54 A;  4U68 A;  4I65 A;  4DAY B;  1BVS A;  3VYR A;  4JI3 Q;  2WKD A;  4Q0F A;  2F1M A;  3K0Y A;  2UXB Q;  3L2P A;  4HJ7 A;  4A93 H;  1EQV A;  3GTJ B;  3NWS A;  2F0D A;  4HSV A;  1X65 A;  1JOR A;  2IW3 A;  4A3G B;  4RA8 A;  2O2L D;  5IYD H;  1D5X C;  2AQ3 B;  5FK9 C;  3BVG A;  3ITP A;  1F2Y A;  2ZJR A;  1QB5 D;  4BS9 A;  2NN6 I;  1U5K A;  1KC8 C;  2VS1 A;  4A3F G;  4V19 0;  3VR3 A;  1YJW A;  4MN3 A;  2K5V A;  2AKW B;  4A3E B;  5ELE A;  3J81 L;  1UAP A;  1A0I A;  1E2W A;  2R7Z G;  1X55 A;  1D7Q A;  3Q8D A;  4N9T A;  5JPN C;  3X3M A;  2XN9 C;  2H4O A;  3DUZ A;  4E6I A;  5M5W B;  3S17 H;  4IPD A;  5L37 A;  2DNC A;  4IZ8 A;  1F9R A;  1XXG A;  5M3M G;  2QIL A;  3S2D H;  1PYB A;  2L1B A;  5C0X I;  1PFB A;  1YHB A;  3J81 i;  5LHY 1;  1ZYR D;  2EE1 A;  2WFW A;  2BE5 D;  5CV4 A;  2F0L A;  2UXC Q;  2EVB A;  2Q8T A;  4EQN A;  1L2F A;  4A3D H;  2LSS A;  1HFN A;  5CC4 A;  4GKJ L;  1I4G A;  1XTC D;  4FXK C;  3ERQ A;  3I2Z A;  5D3D A;  4JI0 L;  4YIJ A;  1JJC B;  3PV0 A;  1WCM H;  2HQL A;  3HOX B;  4R8I A;  1DOK A;  4C3J H;  2J0T D;  4A3J B;  4OON A;  5GAD C;  1G2T A;  4HJA A;  2O5J C;  5COY A;  4OWX B;  2NBF A;  3S24 A;  1UEB A;  1Y69 U;  1QUQ A;  1DGS A;  3S16 B;  2EYO A;  1U4L A;  1HPC A;  2QW7 A;  3CCL A;  1D1K A;  1VQB A;  4NMZ A;  1ZYR C;  1J9O A;  5C44 H;  4DUY L;  4OIK A;  2D5D A;  1HZB A;  3G48 A;  3DM3 A;  3E3X A;  4UP9 A;  2A6E C;  1RKN A;  1F2Z A;  4BA1 I;  3A5U A;  2HHH Q;  3OTO L;  1HXY D;  1YZ6 A;  3BU2 A;  4M1U B;  2JQO A;  3L7Z C;  3RN2 A;  4DNI A;  1PH2 A;  5HUR A;  4LNQ A;  1HTP A;  4IFD I;  3VYS A;  1YBY A;  1HH2 P;  1TWC H;  1FGU A;  1N8R C;  1EEF D;  2Q2I A;  3PIP A;  2ASB A;  1SRO A;  1I5F A;  4DGZ A;  1O7Z A;  2KOL A;  4FF3 A;  2NN6 H;  3ND9 A;  4HMI A;  4RCO A;  2B63 B;  2EIF A;  3U50 C;  2VUM H;  4KJO A;  5CV9 A;  1BOS A;  2F0O A;  3VR5 A;  4HIK A;  1N36 Q;  1I4P A;  3PCO B;  1SJH D;  4XXE A;  4OO1 G;  1MI2 A;  4FP5 D;  1B4O A;  4A3C G;  3CCJ A;  4NKL A;  2UUB L;  4L5S A;  1XMO Q;  3F2C A;  5M9O A;  2VZA A;  1GUS A;  4HSP A;  1PTO F;  4R4I A;  4C3I H;  2VUM G;  2MHV A;  4DV7 Q;  1OXX K;  3VR4 A;  1LAB A;  1ASY A;  5IP7 G;  3S16 H;  2N55 A;  1IHZ A;  3VR6 A;  3CRL C;  1JE5 A;  4MTN A;  4I7Z C;  1PXU A;  1E0B A;  1LLR D;  5E7N A;  3BDL A;  3BZD B;  2NVT H;  3PUZ A;  2D9U A;  2JA6 B;  1DD2 A;  1RJT A;  5A35 A;  1LTS D;  4PMW A;  1CI3 M;  3K7U C;  3TRE A;  3GTP H;  1JIC A;  4DR4 L;  4JI6 Q;  1YHA A;  4KKT A;  1WTQ A;  3MVV A;  3EJI A;  4LF7 Q;  2BH8 A;  4K2K A;  1E22 A;  4XQQ A;  3KOJ A;  4K0K L;  4JW0 A;  5KRU A;  1FNU A;  4GN3 B;  1VMP A;  2HIX A;  2Z9H A;  1BCP F;  4DV0 L;  3T51 B;  2HHH L;  5KGU A;  4KKS A;  2VQE Q;  3LX0 A;  1JC7 A;  4DA2 A;  2VQE L;  4KD4 A;  5BN4 A;  3GTQ H;  4K5X A;  1BXT A;  1VQF A;  3TBI B;  2CQO A;  1DXM A;  1Y8N B;  2NVQ H;  4JI1 L;  1J5E L;  1BCP C;  4F87 A;  1PRT B;  3KBG A;  1SYE A;  3F2D A;  1HUM A;  4ZCK A;  2CWP A;  3D0F A;  1YI2 A;  3K81 C;  1VCI A;  4C56 C;  1NTG A;  4LF4 Q;  4IUQ A;  3GTK B;  2R93 G;  3HOZ H;  4UDU C;  3MXP A;  1HA5 A;  2VY3 A;  3RMH A;  5JVH 3;  2KHS A;  4POF A;  5ELC A;  5CMD A;  3W3A A;  4X3K A;  5EPK A;  2HT1 A;  2K6A A;  1EWI A;  1TS3 A;  3AFQ A;  5DAU A;  1IBK L;  1SNC A;  2QF7 A;  5JAV A;  4JCV E;  1HJP A;  3TSS A;  4DXG A;  1XPO A;  2AQ1 B;  2K7V A;  2HD3 A;  3DWQ A;  4Y7N B;  1NY4 A;  1A15 A;  4Q5V A;  1C8C A;  4YCU A;  4X6A H;  2NZH A;  4LK1 C;  2UXC L;  5JJI A;  1Q90 A;  4PQX A;  4B3M L;  2WIN B;  1KLG D;  1LT6 D;  4GNX A;  2B2V A;  4CKE A;  4ZYS A;  4R9W A;  4X64 Q;  1JT8 A;  4C3I B;  3EVQ A;  1V1Q A;  1HNZ Q;  1KAB A;  1TY2 A;  1NNX A;  2F0I A;  1C48 A;  3NXW A;  2IHE A;  1A62 A;  2JEB I;  3BYT B;  3E0J A;  2UU9 L;  4RCN A;  5JEA H;  1TY0 A;  1C9O A;  1KRS A;  3Q23 A;  4DAM A;  5LL6 X;  5C3X A;  1B9N A;  1YIT A;  3MHB A;  2DN8 A;  1GOZ A;  4K6D A;  1X3E A;  4LFA Q;  2R3Z A;  2EYP A;  2MNA A;  3T53 B;  3O13 A;  1MGS A;  2BOS A;  3Q6S A;  3HKZ B;  2KA7 A;  5IYB H;  1XMQ Q;  5C0X H;  4FYD A;  4XTC S;  1D5M C;  1VQ8 A;  1B3A A;  4G4K A;  4QQB X;  1VQH A;  1CKN B;  2A19 A;  4Y52 H;  4KHV A;  1NE3 A;  2OWO A;  3UE0 A;  3I56 A;  3S1N B;  1XX8 A;  3SHL A;  2PCF B;  4ODG A;  2BE5 C;  4NDX A;  2RQX A;  1A63 A;  3DM1 A;  3NBI A;  1K8A C;  4ZUI A;  3VA7 A;  1TS5 A;  1GVP A;  4DUZ Q;  3ERS X;  4EQ5 A;  1QIL A;  3DLL A;  5E4X A;  4CBV A;  4JOI C;  5LMU Q;  4XYO A;  4DV5 Q;  2XWJ B;  3CCR A;  4P75 A;  1Q1E A;  2V1C C;  2B2W A;  3M7G A;  1F9S A;  1H9M A;  1OXU A;  5JJK A;  2G9H D;  1K3B C;  3K6O A;  4RGM A;  2JK8 A;  4CJ2 C;  1H9R A;  2QDB A;  3SGI A;  2AUK A;  3GV3 A;  3QOJ A;  1PDQ A;  2JA7 B;  2CKZ B;  1JMC A;  2XIW A;  1Q8I A;  4IOA A;  1SE4 A;  3S14 H;  2LFN A;  5DEH A;  4JI6 L;  2CCZ A;  1Z9F A;  3J81 E;  1BBU A;  3GTP B;  5IIF A;  2EY1 A;  2V4D A;  4ILW A;  4RAU C;  1EEI D;  2G9D A;  1EWC A;  3D4W A;  3VDY A;  5IGE A;  1PVO A;  1SBB B;  4GKK L;  1AW7 A;  2ES2 A;  1L1O B;  1VQI A;  3L9A X;  5IGF A;  2ZJP A;  1EIY B;  1U4M A;  2FFK B;  3I4N G;  4NP5 A;  5E1F A;  3I90 A;  2FJ2 A;  4OO1 H;  1QVF A;  4JG2 A;  3OW7 A;  4KJN A;  2K1B A;  1SJE D;  3CD6 A;  3JAM L;  1RF2 D;  1OO9 B;  4IQZ A;  1W3S A;  3HOZ G;  2YTY A;  4OIJ A;  4APV A;  1ET9 A;  5C6A A;  5M3F G;  5J22 A;  2X6L A;  5BR8 L;  4P2C B;  5I9P A;  3BZC A;  3M85 A;  2EYM A;  1ENC A;  4MIU A;  4X62 L;  1TS2 A;  3HKS A;  2UUA Q;  5FOB B;  3G4S A;  4XT3 B;  3UI2 A;  1SNQ A;  2B63 H;  4IJH A;  4OL7 A;  1L0W A;  4DR4 Q;  1Q7Y C;  2L4N A;  4H13 C;  5H1S E;  4LF7 L;  1LTB D;  1B70 B;  1AZP A;  4CHT B;  2NVX H;  5JJZ A;  1A2U A;  4A3G H;  4OGQ C;  2HCI A;  3CP0 A;  2VB2 X;  2CW0 C;  2RSO A;  1QVG A;  5GRO A;  3NP8 A;  3LGJ A;  3ULP A;  4FVM A;  1EY4 A;  3V2T A;  3CCQ A;  2L55 A;  2L5T A;  3CF5 A;  5EBD A;  3GQB A;  1S5B D;  4JI5 L;  4DU9 A;  3J80 L;  1VS0 A;  2JA7 H;  1AE3 A;  2RDF A;  2OTJ A;  4QL5 A;  2CHB D;  1V1P A;  3HZX A;  3K80 C;  4QF4 A;  5C5L A;  3GTM H;  3I72 A;  3H0G B;  4TKO B;  4HAE A;  4NXM L;  3IFT A;  2MP1 A;  4CDC C;  4BXX H;  2K52 A;  5KYL A;  2ZXO A;  4TQU S;  2B2V C;  3BVZ A;  1EFW A;  3MXG A;  1Y1V B;  5KNC A;  3H94 A;  2SOB A;  2K33 A;  1V8Q A;  1DCZ A;  2PZU A;  2B2U A;  2LY7 A;  4ZQ3 A;  4IJL A;  3RZD B;  5BR8 Q;  4JBM A;  4G7Z C;  4LMQ D;  1GHK A;  1S5E D;  5GAH C;  5M5X H;  1PFN A;  1XWE A;  2E75 C;  3BS1 A;  1PYS B;  2AMC B;  1FJG Q;  3CCE A;  3OWF A;  5C4H A;  4DNR B;  1O80 A;  1AH9 A;  1E1O A;  5FKA C;  3FHW A;  1A8V A;  1W6K A;  3W2D A;  3UDI A;  1WD0 A;  1NR2 A;  2K50 A;  4A3D B;  1NJI C;  4BY7 G;  1VQD A;  5C3E G;  3KDF A;  4QJF A;  4BY1 G;  2NYZ D;  1Y1W H;  2PQA A;  3IRB A;  3OTO Q;  1ZKO A;  2A68 D;  2EYJ A;  1EY8 A;  2E2J H;  2HDL A;  1PH4 A;  1EL0 A;  4YWL A;  2EXZ A;  2NZ1 D;  4JI3 L;  1SEB D;  2EY5 A;  3TQY A;  1A3V A;  1HTL D;  2F0W A;  4DAY A;  2K5Q A;  4KLK A;  4JBJ A;  4A3C H;  4DUZ L;  3TP7 A;  2EDG A;  4IAL A;  1CQV A;  2O4X A;  2KUM A;  3OIQ A;  4ULL A;  1S4Z A;  5C3W A;  1FNV A;  2JEA I;  2B2W C;  3K5L A;  4JI8 Q;  3S9W A;  4A3K B;  5EKI A;  1CK1 A;  1XTD A;  2OEO A;  4DR2 L;  2SNS A;  1X54 A;  2AUJ D;  1HNZ L;  1HRJ A;  5EBC A;  3V96 A;  1GJX A;  1BBW A;  4QMG A;  1SSO A;  4XYQ A;  2XWB B;  4WOR A;  3HOV B;  2JA5 G;  1D1I A;  4DV1 L;  4JC0 A;  1ICW A;  4TRD A;  2F3V A;  4DV7 L;  3I73 A;  1R9T H;  4EVO A;  5JVG 3;  1FVI A;  2TSS A;  1JWM D;  3AYH B;  4AQY L;  3GTL H;  3E5S A;  4KKU A;  5FO9 B;  3JC6 6;  5IP9 H;  1DZ1 A;  2JYO A;  1EZ8 A;  4J15 A;  1PZI D;  2K75 A;  1S72 A;  4A3M B;  4X3T A;  2RCF A;  3IFD A;  1SE3 A;  1CZW A;  3TZU A;  2MO0 A;  3NTH A;  1TWC B;  1I3Q B;  1WD1 A;  4ALP A;  4LUV A;  5CYU A;  3ZJY C;  5ELB A;  1LTT D;  2M2L A;  1QNK A;  4A3I H;  1SYB A;  1SDF A;  1TWF H;  4K2L A;  1YNJ D;  4PMC A;  1SND A;  1FYC A;  3W1B A;  1FR3 A;  1XJV A;  4B3S L;  4EGV A;  4IUT A;  3FPU B;  1D2B A;  5J1Z A;  2I5L X;  1VQN A;  2UXB L;  1KRT A;  4B3M Q;  4RFB A;  2A6E D;  1CM9 A;  1MHW C;  3PO2 B;  4PMB A;  2BH2 A;  5HGT A;  4LF5 L;  3RZD H;  1DOM A;  2EOT A;  2PO4 A;  1PTO H;  4O2D A;  3M3Y B;  1X6O A;  1ICF B;  1KNE A;  1QG7 A;  2UU9 Q;  5BN3 A;  3PO3 B;  5NUC A;  1TWA H;  3NK9 A;  1EFI D;  4L5T A;  3CC4 A;  1EY7 A;  1HUN A;  5GAE C;  3TEH B;  3HOX G;  1JE4 A;  1LTI D;  1I6H H;  4A3F B;  1M1K C;  5ELD A;  2EYF A;  4OHJ A;  3KFU A;  4BBR B;  2HDM A;  1N32 Q;  4P72 A;  5I9O A;  5M3F H;  2NWG A;  2WAC A;  4AQY Q;  2JA6 H;  2ID0 A;  2RDG A;  4C3H H;  2PI2 E;  2XVS A;  1WTP A;  1A3U A;  1VQK A;  1BF4 A;  1TWA B;  2Q8I B;  4A3B B;  2RHQ B;  4JYA Q;  4LUO A;  1OXV A;  4DN4 M;  2QKI C;  3F2U A;  1EQQ A;  4GZY C;  3RLN A;  3EIV A;  1IL8 A;  1RTO A;  1ET6 A;  1SR3 A;  3NEM A;  1K8O A;  1XYI A;  3H3V I;  2YV5 A;  3K8A A;  1I4X A;  1LAC A;  3CXC A;  1VQO A;  4C2M B;  4QUC A;  5EKK A;  3EA6 A;  2E2I H;  3L3O C;  4R1J A;  1GXD C;  3R2I A;  4CDF C;  3R2T A;  1O7I A;  3FDT A;  3CU7 A;  4IPC A;  3A8J E;  1TWF B;  2H5X A;  1HR0 Q;  2F3W A; 
#chains in the Genus database with same CATH homology
 1CQF A;  4LJZ C;  2F0U A;  1ZXT A;  3EFX D;  1NR4 A;  3M4Y A;  1WVL A;  3HGB A;  4HMJ A;  3WOF A;  1JOQ A;  1RD9 D;  4CJ0 B;  1BQQ T;  1EYA A;  4IN3 A;  4K8J A;  2C5C A;  1UEA B;  3KLS X;  3GTG B;  2Z1C A;  4WFN 3;  1VF5 C;  1MBY A;  2B2Y C;  1X3P A;  3DHQ A;  5CGK A;  2MUY A;  2RVL A;  3TP5 A;  2AWN A;  3G7L A;  1STH A;  3Q0A A;  2R7Z B;  1LO5 D;  3KK7 A;  2JXM B;  2K5D A;  4KTA A;  3SVM A;  5C5M A;  2F0T A;  3K5N A;  1TT2 A;  1IKM A;  2D2C C;  5FLX L;  4C3H G;  5KNB A;  1BR9 A;  3QO2 A;  1T5E A;  1RHP A;  1SYG A;  2OXP A;  2EJG C;  1G91 A;  3I4M B;  2FHT A;  2SEB D;  2R92 B;  1H9J A;  1JWS D;  4C3J G;  2O5I C;  3PUY A;  2SDF A;  4BBS B;  5G3L F;  3HOU B;  4RKL A;  3T4A C;  2CQA A;  2PZW A;  3SEB A;  1Y8O B;  3DEO A;  1UNS A;  3A7L A;  3VYT A;  4V0B A;  1KNA A;  1LT5 D;  1Q1B A;  2KVM A;  2Y0S B;  4ZRZ A;  1YNN D;  4KY5 A;  1D5Z C;  2E2D C;  4CGY B;  2X69 A;  2EJF C;  5JEA J;  1ENF A;  1I6V C;  1JR0 D;  5FLX E;  1I50 B;  4F88 A;  4J8Q A;  4F8M A;  1RDP D;  5C4X B;  3R3O A;  3CRK C;  3IL8 A;  1G8Z D;  1BO0 A;  1CTM A;  1QNU A;  4FXD A;  1EIG A;  2F0H A;  2FMC A;  4ID6 A;  5COR A;  1ILQ A;  5I6W A;  2A5H A;  4DAV A;  4DAP A;  3OOC A;  1GHJ A;  4F7X A;  3LWE A;  4K5W A;  4IUU A;  1V43 A;  5JOB A;  3KLS A;  2MJ8 A;  2WII B;  1BNZ A;  2KEE A;  1SAP A;  3FPP A;  4RHR A;  1A2T A;  2H1E A;  4CKB A;  3MC0 B;  4B9W A;  1B1Z A;  3J7A F;  1I6H B;  5ELF A;  4PNY A;  3QOL A;  3E6Z X;  4C3J B;  3K58 A;  5M3F B;  3NBH A;  3SK8 A;  4KN4 C;  2E2J B;  2A69 C;  3SK5 A;  2JA8 B;  2E2H B;  1EZ6 A;  3V05 A;  5M3M B;  2BDN A;  2YU9 B;  1TWG B;  3MTS A;  1LT3 D;  4KK7 A;  1H9S B;  2KQ3 A;  1NUC A;  3A8I E;  1EY6 A;  2JE6 I;  2XSC A;  5M5Y B;  1H9K A;  1ENA A;  5IGC A;  2A69 D;  3RUZ A;  2MPM A;  2PMZ B;  3TDQ A;  1B44 D;  4HR7 B;  2F0V A;  2IX0 A;  1ONL A;  3PUW A;  4ABN A;  2A73 B;  1V1O A;  2VUM B;  3BYY B;  1LV9 A;  2BA0 A;  5IGB A;  1F9Q A;  1F2M A;  4KV6 A;  1GUG A;  3NTK A;  1TQO A;  4ZLT F;  3HG9 A;  4KMU C;  5CR3 A;  3ND8 A;  2B39 A;  1STE A;  5KIX A;  3HP3 A;  4FNF A;  3HRZ C;  2JP1 A;  4J6H A;  1A3T A;  2EYH A;  5ISR A;  4OO1 I;  1DJR D;  4DK1 A;  1RCV D;  2D62 A;  1SMY D;  3A7A B;  5C4J B;  1II3 A;  1KDC A;  1D6E C;  1TII D;  2JSO A;  4XIG S;  3S15 B;  1KDB A;  3A8K E;  1X3Q A;  2IX3 A;  1T5X D;  5TSS A;  1DOL A;  3K5O A;  2E74 C;  4FF1 A;  2IPK D;  5I2Y A;  1VF7 A;  1PTO B;  3H09 A;  3HOZ B;  4M8A A;  1WCM B;  4ZUJ A;  2F0G A;  1QE6 A;  2PZT A;  4U67 3;  2K28 A;  2FMM A;  1WTX A;  4JBW A;  1PTO C;  5K5P A;  3GTO B;  2RKS A;  1JOO A;  1K8M A;  1NCV A;  2ENB A;  2A6H D;  2F0S A;  1IYV A;  1B50 A;  2NVY B;  3KUP A;  4R8N A;  4DXF A;  2OT2 A;  5IOD A;  3AMU A;  4JK1 C;  1BCP B;  4J1M A;  2ICE C;  1I4H A;  2BDO A;  5C4Z A;  2IWH A;  2J7Z A;  3R8B A;  5EJW A;  2R93 B;  3DWP A;  3NPP A;  4C1N K;  3C1E A;  5CV8 A;  1HQR D;  1YNJ C;  5C0X J;  3RZO B;  1BUV T;  3NQI A;  4FF4 A;  5JEA G;  2M9V A;  1S5F D;  1BDO A;  5CV7 A;  2VXW A;  4A93 B;  5CV5 A;  2FIN B;  3T16 A;  1PRT D;  1SXT A;  1ESR A;  4O1N A;  4BY7 B;  2DNE A;  2RSN A;  1QWY A;  3K57 A;  1STG A;  3URY A;  3D4R A;  1HFG A;  2HQE A;  5J39 A;  1BCP D;  3D4D A;  1U9R A;  5KEE A;  4RHS A;  2F0Q A;  3TME A;  1JOK A;  3KBX A;  1E2Z A;  1BBX C;  2AQ2 B;  2K04 A;  1DON A;  4BWG B;  1SYF A;  1Y8P B;  4CJ1 B;  1UUP A;  3HS0 C;  4IUR A;  1YNN C;  5G3L D;  2K32 A;  4KI0 A;  1Z6H A;  5K36 H;  3MFG A;  2A68 C;  2NTS A;  5EKL A;  3T13 A;  3I70 A;  1B2T A;  2F0K A;  1WTV A;  2M00 A;  2F0F A;  2IT1 A;  3S1R B;  2KJX A;  2B2U C;  5IGG A;  4UAI A;  5I2X A;  2B2T A;  1DM0 B;  2Z4H A;  5I4D A;  5A2Q L;  3WDN A;  2XNA C;  1SNM A;  5FO7 B;  3GV6 A;  1J8I A;  2KCC A;  3LNN A;  4QUF A;  2F0M A;  2NB0 A;  4HCE A;  4KD3 A;  5CV6 A;  1M4V A;  3MXU A;  3FMC A;  1QCB D;  1CT1 D;  1GUN A;  3PUV A;  3MFY A;  2L12 A;  3HEJ A;  3QIA A;  3D6W A;  2WV6 D;  2BCO A;  3OPO A;  3H3V C;  1EY0 A;  1JCK B;  3N6R A;  2NN6 G;  4IFD G;  4K14 A;  2EZV A;  1GUT A;  2K05 A;  1EY9 A;  1IKL A;  2R6G A;  2F0P A;  2Z4I A;  3SK4 A;  4CKC A;  1NSN S;  1PMR A;  3QB3 A;  2NTT A;  1EYD A;  3VR2 A;  5A2Q E;  1G6Z A;  4IFD H;  2AWO A;  1IYU A;  5C0X G;  1FNW A;  1PYW D;  1B53 A;  1M8A A;  3J7A V;  1HHV A;  1HCZ A;  2N88 A;  1SE2 A;  1AZQ A;  2F0J A;  4X3U A;  2KED A;  3NSW A;  4RKB A;  3C46 A;  3P20 A;  4QIW B;  2ZXR A;  4KHZ A;  4RGT A;  2IJ0 A;  5JPM C;  5E3F A;  5C3E B;  4G7H C;  2RBM A;  1KLU D;  2TMP A;  1TU2 B;  2L11 A;  2PQE A;  4MHE A;  2E2I B;  1LTA D;  4NW2 A;  1U4P A;  4FXG C;  5M5X B;  2F03 A;  2E76 C;  1KTK A;  1SNO A;  4DF7 A;  3J7Y W;  5C44 B;  4L8J A;  2VNU D;  5D65 A;  4G57 A;  3CKI B;  3CHB D;  3VYU A;  2YYZ A;  3S2H B;  2ICI A;  1SNP A;  1EYC A;  3PUX A;  5K36 G;  2I07 B;  4RH6 A;  2LMC B;  3GTQ B;  1CHQ D;  2B2T C;  3MAQ A;  4HN7 A;  4XDX A;  1ILP A;  3Q22 A;  4B9X A;  3OMC A;  1HQM C;  5AFW A;  2K01 A;  4FF2 A;  1TS4 A;  3NUC A;  4WJW A;  4EQP A;  3NWT A;  4XQN A;  4ZKC B;  2WB1 B;  1EOT A;  3S1M B;  2GA4 B;  2NVT B;  2XRQ D;  1C4Q A;  3A56 A;  5CBE E;  1I4Q A;  1MSG A;  1O78 A;  1GUW A;  1TKW B;  4IUN A;  1VMC A;  3SDZ A;  3I91 A;  2K03 A;  3I4L A;  3P7J A;  4IUV A;  5EPJ A;  3NQT A;  4B08 A;  3HOW B;  2EY6 A;  3BDO A;  3MA2 B;  1ML0 D;  4H44 C;  3C3L A;  3KLR A;  1STN A;  2QEJ C;  1CA6 A;  3PIP 3;  1I4R A;  1R9T B;  3BDC A;  2DY7 A;  3C1F A;  3N52 A;  1SMY C;  2I46 A;  2NUC A;  2ZXP A;  1A6X A;  2CVR A;  4QCL A;  3IKJ A;  1AP0 A;  2LKV A;  2LS0 1;  4H7B A;  1EIH A;  1S5D D;  2EPB A;  5T1G A;  3MEH A;  2F0N A;  2ZT9 C;  3EQL C;  3CQZ B;  3D6C A;  1DYQ A;  1IW7 C;  3TP8 A;  4BY1 B;  1JB3 A;  3S1Q B;  4K5V A;  1CA5 A;  3BVM A;  3P75 A;  1G2S A;  1V1P B;  3FVQ A;  4ZK9 B;  1LTR D;  3SXH A;  2K5W A;  2PW5 A;  1Y1W B;  4HED A;  2EY2 A;  1G29 1;  4ZKB B;  2J4X A;  2B2Y A;  3DMU A;  2IX1 A;  2BA1 A;  1TR5 A;  2WKC A;  3MWY W;  5D3I B;  4LAA A;  1AFP A;  3Q24 A;  1RTN A;  1PRT C;  4BA2 I;  3M4O B;  1FD7 D;  3U9O A;  1R4Q B;  2EJM A;  4L63 B;  5IT9 E;  3K5M A;  2VB3 X;  1ROD A;  2EYL A;  2JA5 B;  2IL8 A;  1H9S A;  1PRT F;  4DNT B;  5IGD A;  3AB9 A;  1EWH A;  3T56 B;  3PIO 3;  4G7O C;  1L0Y B;  1F77 A;  4AYB B;  3NE5 B;  5IOC A;  3S17 B;  1U4R A;  4RGN A;  1PFM A;  1OXS C;  1KAA A;  2A6H C;  4DK0 A;  4RWS C;  4XQJ A;  2WAQ B;  5BN5 A;  1NAP A;  3WOE A;  5DNF A;  3FEW X;  2L0C A;  4PV1 C;  3MZ5 A;  2KEC A;  1AN8 A;  2MGS A;  5IT9 L;  3SE0 A;  5I6Y A;  5DM6 3;  1ESF A;  1EQT A;  2B8F A;  2F4I A;  4KY6 A;  4KY7 A;  4WRD A;  3OIP A;  1OXT A;  2C9O A;  1LT4 D;  3GO5 A;  3K7A B;  1CHP D;  3IAY A;  4FO2 A;  2SNM A;  1JQY D;  3D31 A;  3QJY A;  4XT1 B;  4IFD J;  3NHH A;  3GP7 A;  1FGB D;  3TZD A;  3NTI A;  1WTW A;  3I8Z A;  1AEX A;  3LWU A;  4HCS A;  3TN2 A;  3JAM E;  3I4N B;  1TWH B;  4H0L C;  4C3H B;  1PZJ D;  4K6L A;  5T1I A;  1Q3L A;  3QWN A;  3OMG A;  2PNR C;  3H6M A;  3ONA B;  5EPL A;  3MXN A;  2X6G A;  3X3N A;  3GD7 A;  3DEP A;  4X3S A;  1CZG A;  2NVX B;  1Z47 A;  1O7L A;  3ZYY X;  1S5C D;  5E4W C;  1QJO A;  1QOH A;  3OWE B;  2A74 C;  2QCP X;  5D14 A;  5EGT A;  1X32 A;  2XRS D;  3M7N A;  3SK6 A;  1WTR A;  4L6T B;  4ZAI A;  5F2D A;  1PTO D;  3DWA A;  3PMF A;  3QG1 A;  4QB4 A;  3FRP B;  3D3R A;  3C2P A;  1MD2 D;  2F0E A;  3I3C A;  1R4P B;  2B8G A;  2PW7 A;  1PZK D;  4Z9C B;  1TVX A;  3GTL B;  1MSH A;  4EQO A;  2HUG A;  1E2V A;  2Z8L A;  1O7Y A;  1B9M A;  4DFA A;  5KYI A;  5EQ0 A;  1SFO B;  2OF1 A;  1JWU D;  3J80 E;  4TSS A;  3OSO A;  4N9P A;  5FO8 B;  1F2L A;  5LL6 S;  2RA4 A;  3U9S A;  3G6J B;  1F9P A;  5CBA E;  3AU7 A;  1STA A;  3TP6 A;  1VDZ A;  1L0X B;  2HCC A;  1GUO A;  2Q8R E;  1HA6 A;  2KCN A;  2WP8 J;  2PYK A;  4RGO S;  2L9H A;  1SYC A;  1LTG D;  3ERO A;  1SYD A;  3OHX C;  1ZEQ X;  3KF8 A;  3S14 B;  4K8I A;  3H91 A;  2CW0 D;  1EY5 A;  4C3I G;  3RLF A;  2RDH A;  1K83 B;  1Q12 A;  2PPB C;  4HTH A;  1IW7 D;  1CFM A;  2NVQ B;  3D8G A;  1STB A;  3HOY B;  4C1N I;  3DXJ C;  3R93 A;  5DM7 3;  4KN7 C;  4ME5 A;  1STY A;  3FKI B;  4O42 A;  2DY8 A;  3A55 A;  3K59 A;  4S3S A;  4IUP A;  3VA5 A;  3RD4 A;  3GTM B;  3S2D B;  4A3I B;  3SR1 A;  1KDA A;  1W6J A;  1EU3 A;  5KND A;  1EU4 A;  3P1H A;  1WTO A;  1Z7T A;  3BG3 A;  1PLF A;  2R61 A;  3A54 A;  4U68 A;  4I65 A;  3VYR A;  2WKD A;  4Q0F A;  2F1M A;  3K0Y A;  1EQV A;  3GTJ B;  3NWS A;  2F0D A;  4HSV A;  1JOR A;  2IW3 A;  4A3G B;  4RA8 A;  2O2L D;  1D5X C;  2AQ3 B;  5FK9 C;  3BVG A;  3ITP A;  1F2Y A;  4BS9 A;  1QB5 D;  2NN6 I;  4V19 0;  3VR3 A;  4MN3 A;  4A3E B;  5ELE A;  3J81 L;  1UAP A;  1E2W A;  4N9T A;  5JPN C;  3X3M A;  2XN9 C;  2H4O A;  3DUZ A;  4E6I A;  5M5W B;  2DNC A;  4IZ8 A;  1F9R A;  1XXG A;  2QIL A;  2L1B A;  5C0X I;  1PFB A;  5LHY 1;  1ZYR D;  2EE1 A;  2BE5 D;  5CV4 A;  2F0L A;  2EVB A;  2Q8T A;  4EQN A;  1HFN A;  5CC4 A;  1I4G A;  1XTC D;  4FXK C;  3ERQ A;  5D3D A;  4YIJ A;  3PV0 A;  3HOX B;  4R8I A;  1DOK A;  2J0T D;  4A3J B;  1G2T A;  2O5J C;  5COY A;  2NBF A;  1Y69 U;  3S16 B;  2EYO A;  1U4L A;  1HPC A;  1D1K A;  4NMZ A;  1ZYR C;  1J9O A;  4OIK A;  2D5D A;  2A6E C;  1RKN A;  1F2Z A;  4BA1 I;  1HXY D;  4M1U B;  3L7Z C;  5HUR A;  1HTP A;  4IFD I;  3VYS A;  1EEF D;  4DGZ A;  1O7Z A;  2KOL A;  4FF3 A;  2NN6 H;  3ND9 A;  4HMI A;  4RCO A;  2B63 B;  4KJO A;  5CV9 A;  1BOS A;  2F0O A;  3VR5 A;  1I4P A;  1SJH D;  4XXE A;  4OO1 G;  1MI2 A;  4FP5 D;  1B4O A;  4NKL A;  5M9O A;  1GUS A;  4HSP A;  1PTO F;  2MHV A;  1OXX K;  3VR4 A;  1LAB A;  2N55 A;  1IHZ A;  3VR6 A;  3CRL C;  4I7Z C;  1PXU A;  1E0B A;  1LLR D;  3BDL A;  3BZD B;  3PUZ A;  2D9U A;  2JA6 B;  1DD2 A;  1RJT A;  5A35 A;  1LTS D;  4PMW A;  1CI3 M;  1JIC A;  4KKT A;  1WTQ A;  3MVV A;  3EJI A;  4K2K A;  4XQQ A;  5KRU A;  1FNU A;  1VMP A;  1BCP F;  3T51 B;  5KGU A;  4KKS A;  3LX0 A;  1JC7 A;  4DA2 A;  4KD4 A;  5BN4 A;  4K5X A;  1BXT A;  3TBI B;  1DXM A;  1Y8N B;  1BCP C;  4F87 A;  1PRT B;  3KBG A;  1SYE A;  1HUM A;  1VCI A;  4C56 C;  4IUQ A;  3GTK B;  4UDU C;  3MXP A;  1HA5 A;  3RMH A;  5JVH 3;  2KHS A;  5ELC A;  5CMD A;  3W3A A;  4X3K A;  5EPK A;  2K6A A;  1TS3 A;  5DAU A;  1SNC A;  2QF7 A;  5JAV A;  3TSS A;  4DXG A;  2AQ1 B;  2K7V A;  3DWQ A;  4Y7N B;  1A15 A;  4Q5V A;  1C8C A;  4LK1 C;  1Q90 A;  4PQX A;  2WIN B;  1KLG D;  1LT6 D;  2B2V A;  4CKE A;  4ZYS A;  4R9W A;  4C3I B;  3EVQ A;  1KAB A;  1TY2 A;  2F0I A;  1C48 A;  3NXW A;  2JEB I;  3BYT B;  3E0J A;  4RCN A;  5JEA H;  1TY0 A;  3Q23 A;  5LL6 X;  5C3X A;  1B9N A;  3MHB A;  2DN8 A;  1GOZ A;  4K6D A;  2R3Z A;  2EYP A;  3T53 B;  3O13 A;  1MGS A;  2BOS A;  3Q6S A;  3HKZ B;  2KA7 A;  5C0X H;  4FYD A;  4XTC S;  1D5M C;  1B3A A;  4G4K A;  4KHV A;  3S1N B;  1XX8 A;  3SHL A;  2PCF B;  4ODG A;  2BE5 C;  4NDX A;  2RQX A;  3DM1 A;  3NBI A;  4ZUI A;  3VA7 A;  1TS5 A;  1QIL A;  5E4X A;  4CBV A;  4XYO A;  2XWJ B;  1Q1E A;  2B2W A;  3M7G A;  1F9S A;  1H9M A;  1OXU A;  2G9H D;  3K6O A;  4RGM A;  4CJ2 C;  1H9R A;  2QDB A;  2AUK A;  3GV3 A;  3QOJ A;  1PDQ A;  2JA7 B;  2XIW A;  1Q8I A;  1SE4 A;  2LFN A;  5DEH A;  3J81 E;  3GTP B;  5IIF A;  2EY1 A;  2V4D A;  4ILW A;  4RAU C;  1EEI D;  2G9D A;  1EWC A;  3D4W A;  5IGE A;  1SBB B;  1AW7 A;  3L9A X;  5IGF A;  1U4M A;  2FFK B;  4NP5 A;  5E1F A;  3I90 A;  2FJ2 A;  4OO1 H;  3OW7 A;  4KJN A;  2K1B A;  1SJE D;  3JAM L;  1RF2 D;  1OO9 B;  4IQZ A;  4OIJ A;  1ET9 A;  5C6A A;  5J22 A;  2X6L A;  4P2C B;  5I9P A;  3M85 A;  2EYM A;  1ENC A;  4MIU A;  1TS2 A;  5FOB B;  4XT3 B;  3UI2 A;  1SNQ A;  4OL7 A;  2L4N A;  4H13 C;  1LTB D;  1AZP A;  4CHT B;  5JJZ A;  1A2U A;  4OGQ C;  2HCI A;  2VB2 X;  2CW0 C;  2RSO A;  3NP8 A;  4FVM A;  1EY4 A;  3V2T A;  2L55 A;  2L5T A;  5EBD A;  3GQB A;  1S5B D;  4DU9 A;  3J80 L;  2RDF A;  2CHB D;  1V1P A;  3HZX A;  4QF4 A;  5C5L A;  3I72 A;  3H0G B;  4TKO B;  4HAE A;  3IFT A;  2MP1 A;  5KYL A;  2ZXO A;  4TQU S;  2B2V C;  3BVZ A;  3MXG A;  1Y1V B;  5KNC A;  3H94 A;  2SOB A;  2K33 A;  1V8Q A;  1DCZ A;  2PZU A;  2B2U A;  2LY7 A;  4ZQ3 A;  3RZD B;  4G7Z C;  4LMQ D;  1GHK A;  1S5E D;  1PFN A;  1XWE A;  2E75 C;  3BS1 A;  3OWF A;  5C4H A;  4DNR B;  1O80 A;  5FKA C;  1W6K A;  3W2D A;  1WD0 A;  1NR2 A;  4A3D B;  2NYZ D;  1ZKO A;  2A68 D;  2EYJ A;  1EY8 A;  2HDL A;  1EL0 A;  2EXZ A;  2NZ1 D;  1SEB D;  2EY5 A;  1A3V A;  1HTL D;  2F0W A;  4DAY A;  2K5Q A;  3TP7 A;  2EDG A;  4IAL A;  1CQV A;  2O4X A;  2KUM A;  3OIQ A;  4ULL A;  1S4Z A;  5C3W A;  1FNV A;  2JEA I;  2B2W C;  3K5L A;  3S9W A;  4A3K B;  5EKI A;  1CK1 A;  2OEO A;  2SNS A;  2AUJ D;  1HRJ A;  5EBC A;  3V96 A;  1GJX A;  4QMG A;  1SSO A;  4XYQ A;  2XWB B;  4WOR A;  3HOV B;  1D1I A;  1ICW A;  4TRD A;  2F3V A;  3I73 A;  4EVO A;  5JVG 3;  2TSS A;  1JWM D;  3E5S A;  4KKU A;  5FO9 B;  1DZ1 A;  2JYO A;  1EZ8 A;  1PZI D;  4A3M B;  4X3T A;  3IFD A;  1SE3 A;  1CZW A;  3TZU A;  3NTH A;  1TWC B;  1WD1 A;  1I3Q B;  5CYU A;  5ELB A;  1LTT D;  2M2L A;  1QNK A;  1SYB A;  1SDF A;  1YNJ D;  4K2L A;  4PMC A;  1SND A;  1FYC A;  1FR3 A;  4EGV A;  4IUT A;  3FPU B;  1D2B A;  5J1Z A;  4RFB A;  2A6E D;  1CM9 A;  3PO2 B;  4PMB A;  5HGT A;  1DOM A;  2EOT A;  2PO4 A;  1PTO H;  3M3Y B;  1KNE A;  1QG7 A;  3PO3 B;  5BN3 A;  5NUC A;  3NK9 A;  1EFI D;  1EY7 A;  1HUN A;  1JE4 A;  1LTI D;  4A3F B;  5ELD A;  2EYF A;  4OHJ A;  4BBR B;  2HDM A;  5I9O A;  2NWG A;  2WAC A;  2ID0 A;  2RDG A;  2XVS A;  1WTP A;  1A3U A;  1BF4 A;  1TWA B;  2Q8I B;  4A3B B;  1OXV A;  4DN4 M;  2QKI C;  3F2U A;  4GZY C;  1RTO A;  1IL8 A;  1ET6 A;  1K8O A;  1XYI A;  1I4X A;  1LAC A;  4C2M B;  4QUC A;  5EKK A;  3EA6 A;  3L3O C;  1GXD C;  3R2I A;  3R2T A;  3FDT A;  3CU7 A;  3A8J E;  1TWF B;  2F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...