1LTBD

2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1993-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltbD00
1PTOD 2WV6D 1XTCD 1LTAD 2AQ2B 2QEJC 4TSSA 1DYQA 1PRTC 1EFID 1KLUD 1D5ZC 1BCPB 1LT3D 3SEBA 1LTBD 4ZYSA 3CHBD 1KTKA 3DWQA 1AN8A 1V1PB 1ESFA 3OWEB 3DWAA 1LTID 1S5ED 1SEBD 1LT6D 1G8ZD 1EWCA 5FKAC 1QILA 4K6LA 3MC0B 1HTLD 1I4GA 1M4VA 1BCPF 4L6TB 1JR0D 2R61A 3MFGA 1SXTA 1HA5A 1TY0A 1L0XB 1FNWA 2XRSD 3O13A 1PZKD 1FNUA 1S5DD 3EA6A 4RGOS 1BCPC 2XN9C 4DXFA 1D6EC 2QILA 3BZDB 1S5FD 3BYYB 1LTTD 4RGMA 3URYA 2G9HD 4O1NA 3R8BA 5D3DA 1CT1D 1D5MC 5ELDA 4C56C 4UDUC 1PZID 3V05A 1PRTD 1TS4A 1I4QA 5ELFA 1ET9A 1I4RA 1CQVA 2XNAC 5ELCA 1SBBB 1I4PA 1I4XA 4L63B 1V1PA 1D5XC 1RD9D 1TS5A 1EU3A 3GP7A 1T5XD 1LTGD 2J4XA 1TY2A 1PTOB 4RH6A 3W2DA 1LT4D 1I4HA 1LLRD 1ET6A 1LT5D 2TSSA 5D3IB 4RHRA 1CHQD 4RGNA 1BCPD 1PTOH 3DWPA 5I4DA 4BWGB 1KLGD 1UUPA 1V1OA 1DJRD 1XXGA 2AQ3B 3TSSA 4RHSA 2NTSA 1PTOF 1S5BD 1PZJD 1JQYD 1JWUD 1UNSA 5TSSA 1LTRD 1STEA 1F77A 5ELEA 2SEBD 3KLSX 1TS2A 3R2IA 1AW7A 1ENFA 1TS3A 2RDGA 1PYWD 1MD2D 4RFBA 1FNVA 1CHPD 5ELBA 1L0YB 1BXTA 3EFXD 1SE4A 1LTSD 1CK1A 1RF2D 1S5CD 4DXGA 2IJ0A 2AQ1B 5FK9C 1FGBD 3BVGA 1SJHD 4Z9CB 1SE3A 1GOZA 1PRTB 1SJED 2CHBD 1EEID 1JWSD 2XRQD 3R2TA 1JWMD 4RGTA 1RCVD 1SE2A 1RDPD 1FD7D 4RCOA 1B44D 2NTTA 1HQRD 3BYTB 2Z8LA 3BVMA 4OHJA 1JCKB 1HXYD 1PRTF 1EEFD 1PTOC 1LO5D 2IPKD 2RDHA 3BVZA 2O2LD 2ICIA 1B1ZA 1EU4A
chains in the Genus database with same CATH superfamily
1A3UA 5M3FH 4A3BG 4K0KL 2QEJC 3HOYB 2YTYA 2XSCA 5K36H 3H0GH 4K14A 4DV3Q 1JC7A 2L4NA 2LXJA 1AN8A 2FMCA 2SNSA 1S5ED 5JVH3 3VYSA 3K57A 1HNXL 2B2UC 4IUQA 1QILA 1FL0A 3F8TA 5FOBB 3QR8A 4TKOB 5E1FA 1N34Q 1EWHA 3KF6B 1HCZA 1SYFA 1RTOA 2OWOA 1Q1BA 1GUSA 2Z4HA 4DV0L 3I4NB 2A19A 2WFWA 4JI8L 2UUCL 1AZPA 1QUQA 2DN8A 1S5FD 2BA1A 3LWEA 3HOXH 1EQVA 1F2ZA 1STNA 4YCUA 3NTIA 4NPSA 4LF9L 1CQVA 3DLLA 5LL6X 1DOMA 1E24A 3A0JA 2XWBB 1KRTA 4UPAA 2PNRC 5IGEA 1Y8PB 4DV6L 4IUPA 2X69A 2F0MA 5FLXE 3G4SA 2HHHQ 5JOBA 2D5DA 1CQFA 4JC0A 3AEVA 3RZOB 2A6EC 3ER0A 1SNOA 2EYOA 5D3IB 3S1QH 5J22A 3S2HH 1X3GA 3GTGB 5GAGC 1S5BD 1SN8A 2ZTDA 5FLXL 3E3XA 1N33L 5C44B 2IX3A 4HJ5A 3T1HL 1TS3A 2OQKA 4B3ML 2M9VA 3CXCA 2QW7A 3F2BA 4DV1L 4X62L 4Q0FA 1GUGA 2NVXH 1EQRA 2DY8A 3LGJA 1VQLA 1WCMB 5CV6A 2DJGC 1H9JA 1IKLA 1IZ6A 1SNDA 4DXGA 5IODA 1F2YA 3OMGA 3DUZA 2CHBD 1VQAA 3UI2A 4RGTA 4LW1A 4IUUA 1UWVA 4BXXG 2JA6B 2B39A 2F0DA 2KENA 4BBRB 4KK7A 1HRJA 2JEBI 1YNJD 4OHJA 2A69C 1PRTF 3N6RA 3BVZA 3P20A 4OWXB 2ZTEA 5HY6A 2K14A 1DYQA 2OQ0A 3NQIA 4KHZA 3CMAA 1TWGB 4QJFA 4C2MH 2F3IA 5C0XG 4ZYSA 3IRBA 1HR0W 2R92G 1A62A 4JI3Q 1V1PB 1YZ6A 3ULJA 4KY5A 2A74C 4EQPA 4HIKA 3NQTA 1OXTA 1SNPA 2HDMA 4DK0A 5C0XJ 4A93B 3OHXC 4KTAA 2F0OA 4OX9L 1GD7A 4IFDH 2JA5H 2KCMA 4R4OA 4IOCA 3PO3B 2QILA 2UUBL 3OMCA 5KRUA 2HIVA 3FP9A 1F9QA 4LUVA 4UDUC 5M3MH 3GTKB 4IURA 1LACA 1E1OA 3A7AB 2NYZD 2FMMA 3CCMA 1RJTA 3UDIA 2RF4A 3S14H 1KXLA 2WINB 3H91A 3IFTA 4N8X1 4H0LC 1TS5A 4BBSB 3ERQA 3HG9A 1S40A 1GUOA 2F0NA 5FO7B 5EKIA 1EQQA 1STYA 3W2DA 4BY1B 2UXDQ 1QVCA 1BBXC 1V43A 2GN5A 1Z6HA 3PUZA 3WOFA 1GO3E 1CI3M 4X66Q 3CAMA 4XDXA 4DV5L 2K5QA 1ZYRD 4CJ2C 1Q12A 5DNFA 2WAQG 1PYBA 3R2IA 1KRSA 3ERSX 5JPNC 1IW7C 4IALA 3M7GA 3NENA 2F52A 4DV7Q 1S5CD 4HR7B 4DV2L 2R6GA 1WD1A 1X3EA 2HCCA 2Z6KC 1OXVA 1SNCA 2VY3A 2EPBA 5FLMH 1TR5A 1CKMA 1DD2A 1IHZA 3H15A 3RN2A 2K52A 2ENBA 5COYA 3L7ZC 1NY4A 2VQFL 1B7YB 1NR2A 2KHSA 2XIWA 3T51B 1DGSA 1VQ4A 4K5XA 1LTAD 3MWYW 5LHY1 2IX0A 4K5WA 3HOVH 1L2FA 5IWAL 2UUAQ 3I3CA 1KLUD 5JJIA 2PPBC 4J6HA 1NNXA 4A3CG 2WP8J 3ND9A 1P16A 3GV3A 1ESFA 3S1NH 1B4OA 3T16A 5JAVA 4JI5Q 2B8GA 5FKAC 4LAAA 4A3BH 1LYLA 1VQDA 1K83H 3U4VA 1J9OA 3J81i 4LF5L 2VS1A 4YCVA 1PYSB 1S5DD 3A8IE 4GS3A 4XTCS 3D0FA 3GTLB 3RN5A 2EXDA 1UE7A 3R8BA 5ELNA 2HDLA 1L0WA 1PZID 1KC8C 5KNCA 2CVRA 2F4VQ 1XJVA 2N55A 1O7IA 4KKUA 4A3EG 5C4XB 1AEXA 4X64Q 1NE3A 3S2DB 2ZJQA 2A6HC 1EU3A 3BDLA 5E7NA 4HN7A 1U4LA 5HGQA 2E76C 2BH8A 3OIPA 2K1BA 4DUZL 2NVYH 2VXWA 1HFGA 4KMUC 4UHVA 3GTQH 4K2LA 2Y0SB 1W2BA 1UNSA 3BZKA 3UE0A 1SSOA 4MNOA 1SR3A 1HNWQ 5T1IA 3HOYG 1MSHA 1ILQA 3CP0A 3OOCA 2V4DA 1EOVA 1GUWA 1QNUA 1RF2D 5GAEC 4DV3L 4J8QA 1R9TH 2H4OA 2K32A 2K28A 1PMRA 3FKIB 3J81c 1YITA 1EIFA 3SK5A 3NUCA 4V190 4I65A 3I56A 4C1NI 3VDYA 4N9PA 3AB9A 1X6OA 1N34L 2EY5A 4XYOA 3CPWA 3VR5A 1A3VA 1RCVD 2DGYA 3I4NG 1X3PA 4RKBA 3CC2A 1QUQB 1QVGA 1EY0A 1HNZQ 2K5VA 2KVMA 4H02A 1IYJB 2WIIB 2WKDA 1CSPA 2ICIA 1K73C 1PFMA 1MSGA 2NWGA 1F9RA 3MFYA 5EKLA 4BXXH 2UXBQ 1R4PB 1HTPA 3A74A 2HQEA 4B3SQ 4F87A 1XMOL 1X3QA 3SE0A 3HOUB 3PSIA 3GD7A 2NZ1D 5IP9G 1SRUA 4ZUJA 2PO4A 1PVOA 3CKIB 1ILPA 4JBJA 2EIFA 1BO0A 2F0JA 3MC0B 1HTLD 5C5LA 4YIJA 2C5CA 1WOCA 5C0XH 2R92H 1GUTA 3O13A 2YU9H 4X3UA 1FNUA 2Y0SE 3K58A 2DJFC 2GA4B 2I5LX 1BCPC 2M2LA 2JYOA 3SK8A 3BDOA 3URYA 3S16H 3A5UA 2A68C 2E2JH 3MA2B 2K5NA 2JA7H 1VCIA 2K50A 1EY4A 4M1UB 5C44G 2PMZB 2I5HA 2B2TA 1B70B 1YJ9A 3NE5B 2IHEA 5DAUA 4HCEA 4IJHA 1SFOH 1WCMG 1PDQA 4A3LG 3CCRA 2NVQB 3T4AC 4PV1C 2F0KA 3J7A5 3OIQA 4G57A 5IYBH 1B8AA 1LT5D 1JICA 4FF1A 1PH2A 4PNYA 3D4WA 2JA6G 3J81E 4GLXA 2AUKA 5F2DA 4BBRG 2Q2TA 1I50B 4FVMA 2OT2A 1J6QA 1STBA 3V2TA 2UU9Q 3MEHA 3J7AF 1PZJD 1CUKA 1D8LA 2F0UA 2JN4A 2OEOA 1NSNS 2CW0C 2VW9A 1E2WA 2CH4W 4DN4M 4IPDA 2WACA 1FNVA 3J81L 2B2UA 1GKHA 3KLWA 4LF7Q 1E3PA 1A6XA 4JI3L 1KAAA 2L15A 2AQ1B 2B8FA 4YWMA 4Q5VA 4A93G 3S1RH 4Z9CB 1STHA 4CDDC 4NDXA 3UDGA 1PH8A 1C8CA 1HZAA 1F9PA 5FO8B 4DAPA 2JP1A 3PO3G 3M3YB 4GNXA 4OWWB 1PTOC 4GKJQ 2PMZE 4A3FB 1HZCA 2Z6BA 2D9UA 1N8RC 3VA5A 1VQ5A 1BVSA 2V1CC 4XT1B 1ZXTA 3TZUA 1BCPB 2Q2HA 3A7LA 4C3IH 4XXEA 4KHVA 3GTMB 4QCLA 5BR8Q 3VA7A 1EYGA 4BBSG 4OEMB 4YHHL 2YV5A 3FPPA 5M5XB 3MXGA 4BY1G 4A3CH 2R93H 1SNMA 1HA5A 1BOSA 1VQHA 2UXDL 4C3JB 4IPGA 2RCFA 4ABNA 1NR4A 2IY5B 4GN5A 2G9HD 1EIHA 3GTOH 4L5RC 4X66L 1V9PA 3X3NA 1QCBD 3KUPA 1PRTD 1NMGA 4A76A 2PCFB 2RHQB 1C9OA 1ZKOA 2L55A 2H5XA 4B9WA 2N88A 3TZDA 1SE8A 5I6WA 1Q82C 4ME3A 4BY7H 3CQZH 1SBBB 2D2CC 3M7NA 2MHVA 1I4XA 1ENCA 2ATWA 1DXMA 1AE2A 4F8MA 4DV7L 2GVAA 2KCCA 3E9IA 4RH6A 1QWYA 1K8MA 3DMUA 4JCVE 1JOOA 1WYDA 4A3EH 4J15A 3J7AV 3CCSA 1KLGD 3I73A 1SMYD 2AQ3B 2K33A 1XPOA 3G6JB 2EJMA 1I5FA 1JWUD 2JK8A 1YNJC 5TSSA 2B63B 1KDAA 4HMJA 1L1OB 3D6CA 4AYBB 3CCEA 4A75A 3H94A 5CV4A 2EYLA 4DNRB 3FRPB 1MHWC 1HJPA 5JPMC 1NMFA 3NSWA 2B2YC 1MGSA 3KDFA 1BR9A 4KY7A 1LABA 2I0QA 1PFBA 1JWSD 3C2PA 3K81C 4WFN3 5C3EB 1FD7D 4V0BA 1O80A 1I6HH 1RKNA 3H3VC 3BVMA 1LTLA 2NN6I 4G7HC 1Y1VB 1ONLA 2ZTCA 3H09A 3JAMi 1EWIA 1XPRA 1TXYA 5DM73 4HSVA 1WTRA 4AH6A 1FVIA 1Q90A 2F4VL 5C4XG 3DWAA 1KD1C 1VDZA 3CCLA 4X64L 2FFKB 3RNUA 5C4JB 1O7LA 3LNNA 1SXTA 2F4IA 1FNWA 1H9RA 4HJ8A 3I2ZA 4DXFA 4PMCA 3H3VH 4HIDA 2Y0SG 4DR7Q 5C4HA 1N9WA 5D3DA 3RZOH 3ICEA 3R93A 4JG2A 4ZRZA 3RLOA 2I07B 1PH9A 1SYDA 1A2UA 2LFNA 5A35A 4RA8A 3K5NA 3HGBA 3DHQA 4HEDA 4HIOA 2K7VA 1HNWL 4DNTB 3GTGH 4X65Q 4FXGC 3FKIG 1Z7TA 1E7ZA 1QG7A 4A3DH 1KNEA 4LUOA 3F2UA 3IFDA 4BWGB 4DFAA 1LM0A 4A3LH 1ASZA 3P75A 4L5SA 3JAMc 3VYTA 3M4PA 3AFQA 4LF4Q 1HNZL 1PV4A 1C0AA 4UY8C 3OSOA 2JA6H 4MZ9A 4BBRH 2F0FA 2UXBL 3HOUG 4WJ4A 2EOTA 1CHPD 2B29A 2XWJB 3S15H 3IL8A 4ODGA 1SE4A 4B3TQ 3C46A 2JA8B 1G6PA 1GHKA 2MPMA 1OXXK 1HR0Q 1VQ8A 4KN7C 2IJ0A 4JVZA 2ZM6L 2MO0A 3TP7A 2BE5C 1SJHD 1TWGH 4WORA 2Z4IA 4N8FA 3S1MB 2DNCA 1DCZA 2KEDA 1JJ2A 1ICFB 1K8GA 2ZT9C 1U9RA 3D6WA 1H9MA 2N49A 4A93H 1U4MA 1HZBA 2EYHA 5CV7A 2JA9A 3H0GB 2F0QA 3DXJC 4QL5A 2X6GA 2VZAA 1W6KA 4WJ3M 3F2CA 2A1AA 2EY6A 3PO3H 1A3TA 3MXNA 3FDTA 3STBC 2R7ZG 3TP8A 3K7AH 2GVBA 4P72A 3GTKH 3V96A 2IW3A 4EX5A 3CCJA 2IL8A 4R1JA 4PQXA 2L9HA 1W6JA 3CD6A 5C3XA 4BBSH 1YVCA 3RZDH 3HOXB 2D0OA 1RHPA 2RDFA 3Q6SA 3OYYA 4PZ7A 4CDCC 1Q46A 4HCSA 1A0IA 3HZXA 5EQ0A 2UU9L 1S3OA 5I2XA 4C56C 2R7FA 2F03A 3DEOA 3C1EA 5EKKA 1KL9A 3JAME 2XNAC 4K5VA 3HOWB 1AFPA 1U0LA 3X3MA 4LF7L 1Q8KA 1UE1A 2RQXA 1I4HA 3S2HB 1EZ8A 1PHJA 3NXWA 4QGUA 1NTGA 3JAML 4X6AH 2KHIA 1XNRQ 5I4DA 1EYAA 1K9MC 5NUCA 4XQJA 4GNXB 4JI2L 1WVLA 1T9HA 2XVSA 4A3FG 3E0JA 3AYHB 4GKJL 1TS2A 2Z9HA 2EY2A 2QDBA 4L5TA 4R8NA 1QE6A 1G2SA 1W3SA 2FINB 2NZHA 1EY7A 1H9SA 3RUZA 2KQ3A 5K5PA 1L0YB 4OXPA 2BDOA 3KF8A 3CF5A 3WWVA 2F0SA 1Q81C 3I70A 3QOLA 1BF4A 3H6MA 4C3HB 5BR8L 2F0LA 3AMUA 1QZHA 1SJED 4IZ8A 1I3QH 3WDNA 4DAMA 4JBKA 5CV5A 5D65A 4C3JG 2NTTA 4R9WA 2XGTA 3HKZB 3G71A 1HA6A 4U673 5JJZA 3P7JA 4DF7A 4ID6A 5LMUL 1MI2A 2WV6D 4POGA 2HT1A 5KGUA 4A3KB 2R3ZA 4R8IA 1LT3D 3CMEA 1CM9A 4JV5Q 3OW2A 1QVFA 3GTLH 1IYUA 1EWCA 5EBDA 1OO9B 2KUMA 2E8GA 3CCQA 3DM1A 1PZKD 3N52A 3MTSA 3S2DH 2PW5A 2EYPA 1QJOA 4ZAIA 2Q2IA 4X3SA 2KCTA 1NAPA 2I46A 2QDLA 2B63G 4XYQA 4AYBG 3TBIB 4KHPQ 5IT9L 5ELCA 1XTDA 1I4PA 5C4ZA 2B2VC 1TWCB 2OTLA 1XMQQ 2AMCB 1GJXA 3EQLC 3HRZC 4FF4A 2CCZA 3IKJA 3K5OA 2SDFA 3HFZB 1STAA 2HQLA 3EN2A 3HKZE 2A6ED 4QIWB 5C3EG 4LF8Q 3E9HA 1EYDA 4BA2I 3FKIH 1XXGA 4RHSA 2ES2A 2JE6I 2NTSA 1PTOF 3J81j 1Y1VG 4HMIA 4DNIA 3T53B 3I4LA 4LJZC 4GN3B 4OIJA 2PI2A 4DA2A 2ZJPA 3TP6A 1AW7A 1JMCA 2MP1A 3QWNA 1D1IA 1VMPA 3GDEA 1E0BA 3EFXD 3GO5A 1LTSD 5GADC 2UXCQ 1PH5A 1G291 3PQIA 3TREA 3UDFA 4DAYA 5KEEA 2MQHA 2VL6A 4IPCA 2LXKA 3GTJB 4DV4Q 1UEBA 2BH2A 4PG3A 3OTOQ 2L12A 4CKCA 1Y8OB 4RCOA 3VR4A 3W5OA 1X55A 4Y7NB 1PH6A 5A2QE 1IBMQ 2L1BA 3PIO3 5BN4A 3SXHA 5I2YA 4DR7L 2A69D 1SYBA 1XTCD 2E5LQ 3UE1A 1X32A 2X6LA 5M5YH 3PF4A 1EY6A 1OXUA 1PRTC 1UE6A 2WKCA 3PUYA 3T1YQ 4J1MA 4G7ZC 5A2QL 2OTJA 2NZOA 3CRKC 4KY6A 2F0PA 1JOKA 4HIMA 5KIXA 4X65L 3VYRA 2PZTA 2K75A 4GOPA 4QIWE 1SAPA 1KNAA 1TY0A 1KQSA 2A8VA 2N78A 2FJ2A 3S17H 1VQIA 2Q8RE 4RWSC 5LMNQ 2NVQH 4XIGS 3SR1A 2VNUD 4KD3A 4GN4B 4PZ8A 3TDQA 2F3WA 4LF4L 1WTOA 3V05A 4M8AA 3HOZB 4Y52H 5ELFA 1I50H 2JA8G 2NVTH 1JOQA 2PZUA 1K8AC 1RD9D 4DU9A 2K6AA 2HHHL 3GP7A 4KJOA 2F0TA 2F0GA 1E2ZA 3K7UC 1YHQA 4IFDI 1LV9A 2NVYB 5BN5A 1BDOA 4IUNA 3G6EA 4JI4Q 2B2WA 1WI5A 4RHRA 4RGNA 4K8JA 1DJRD 1OTCA 1Y1WB 5J3BA 4A3JB 3I8ZA 1VQ6A 1K28A 3EJIA 4CDFC 4DPGA 5G3LF 2R7ZB 3H0GG 4X3KA 3HS0C 5L37A 5E4XA 4EQNA 2QCPX 4K8IA 4NMZA 1N32Q 2AWOA 4RFBA 3M3YH 2EJGC 3MXNB 4LFAQ 1B3QA 4DR6Q 1BXTA 1IW7D 4HJAA 4LF6Q 1HQMC 3SK4A 3GTPB 1E1TA 5FK9C 3M85A 3AU7A 3KFUA 1VQPA 4OO1G 1PRTB 3U50C 4A3GB 1TT2A 5IYDG 1WTQA 1IKMA 3GTMH 1HQRD 3BYTB 3D3RA 3HOXG 3E0EA 2KJXA 2JXMB 3J7YW 2AKWB 3A5ZB 5CYUA 5M5WB 2Q8TA 3QOJA 2OCEA 1AH9A 4TSSA 4C3JH 3BS1A 2PW7A 5DEHA 1C7YA 1KIXA 1IL2A 1EFID 1VMCA 1D5ZC 4GKKQ 1B9MA 4DUYQ 1KTKA 1PXUA 3HOWG 4L8JA 1L1OC 2CQOA 4R4TA 2YU9B 1I4GA 2DY7A 2EYFA 3C1FA 4L6TB 1JT8A 3L3OC 2R61A 5KYIA 2EDGA 1YJNA 1TQOA 1B9NA 5FJ8G 1QZGA 5IGBA 2JA7B 1CKOA 1XNRL 4ZK9B 4F7XA 3AQQA 4CKBA 4NP5A 1O7ZA 2C9OA 4DK3C 1F2LA 5M9OA 1HUMA 4C1NK 3I7FA 2N3SA 5DLQE 1I4QA 4R4IA 4EVOA 1H9SB 5EJWA 1Z47A 2KBNA 3KF8B 3KOJA 3QIAA 3ULPA 3TMEA 3PO2B 2Z1CA 3PGZA 2E2HH 4C3HG 1EFWA 2A6HD 2VB2X 2XTIA 1G51A 2E2IB 4IN3A 2HIXA 1LLRD 1ET6A 1H9KA 5H1SE 1YNND 1WTWA 1CHQD 4LUZA 1PTOH 2YYZA 2YTVA 4DR1Q 1ICWA 1SLJA 1X3FA 3I72A 3MXPA 3QJYA 2RVLA 1E2VA 4FO2A 4ZCKA 4CHTB 1JB7A 2NBFA 3HKZG 2F0WA 2EYMA 5IYCG 4ZLTF 3BDCA 2SEBD 1BKBA 5C3EH 4ZQ3A 4A3KG 3M9BA 4OELB 3DEPA 1K0SA 2LSSA 1WJJA 3PUXA 1ASYA 1DZ1A 4JV5L 1WTHA 4HSPA 1BUVT 2IWHA 1ESRA 5IIFA 4A3IB 4FXDA 4DV2Q 1FGBD 4DK1A 1VQNA 2OXPA 3ULLA 4ALPA 4R4CA 2VUMB 1K0RA 1B2TA 1S72A 3FPUB 4AQYQ 3A8JE 2IX1A 1JCKB 3NTHA 1CA5A 4CBVA 1EEFD 2RDHA 1TWFH 1Y8NB 2L0CA 2NUCA 5C4JH 1KHIA 4MIUA 2J7ZA 4IUVA 2UUAL 2AQ2B 1CKNA 4A3MB 2KECA 3NTKA 4C3IB 1CZWA 4NB3A 4CJ1B 4K2KA 3VR6A 5IWAQ 5JJKA 4DAVA 4JI5L 3HOYH 5CBAE 4NW2A 1LT6D 1XNQQ 4MTNA 1XMQL 4JBWA 1Q7YC 5EGTA 1M4VA 2FHTA 2K5WA 3I4MB 1B3AA 2D62A 1T5EA 3PIOA 4LF5Q 3NBHA 3CRLC 1U5KA 1YJWA 3KBGA 3A54A 3BZDB 4RGMA 4LF8L 3I4NH 1PLFA 4QUFA 2VQEQ 5JJLA 2A68D 2ZXPA 4UP8A 2EZVA 4UAIA 4JI7Q 2WB1B 1BBWA 3TQYA 4BY7B 1EIYB 3W3AA 4O2DA 1KABA 3SHLA 2EYJA 1SROA 2CQAA 3L9AX 4IJLA 1B50A 4CJ0B 5C0XI 5IP9H 2EVBA 2Z0SA 2UXCL 1LTGD 3K5LA 4DR5Q 3ND8A 4QY7A 2TSSA 2CWPA 1AP0A 2JA8H 4AYBE 3I4OA 4DV4L 1SDFA 4RAUC 5D14A 1G91A 3OTOL 3MVVA 4DUZQ 1ZYRC 3PMFA 4H13C 2D0PA 1KDCA 1TIID 1IBML 1LTRD 3DM3A 3Q22A 1Q3LA 5EPLA 5I9PA 3F2DA 3CC4A 2Z6KA 2E5LL 3U58A 3IAYA 2CW0D 4DR3Q 5C44H 1WTVA 2MGSA 2TMPA 1V1QA 3T1YL 4GZYC 4JI1Q 2KCNA 5IY0A 1F9SA 1WCMH 4E6IA 4KKSA 4GOPB 1SE3A 1C48A 1H95A 2NB0A 1EL0A 1I6HB 3M4OB 5EAYA 1GHJA 1TWAB 5CGKA 1KAWA 3RLNA 2EE1A 5E3FA 2Z8LA 3P1HA 2PI2E 3JC66 3NELA 2WB1E 3NWTA 1XPUA 4OO1H 4HTHA 5LMNL 2O2LD 1PTOD 3M4QA 5IYDH 4B3SL 4MN3A 1XYIA 3NHHA 2F0IA 3HOZG 2KOLA 2LMCB 2B2VA 3PIP3 1VQJA 3OWFA 1P8LA 1GM5A 1IBKQ 4JK1C 2J0TD 3S9WA 4GNXC 2CFMA 1XMOQ 3KJOA 2KEEA 2KHJA 1BQQT 1LTID 4JOIC 5FO9B 1G8ZD 1B53A 1YEZA 3WOEA 3F1ZA 1TWHB 1S4ZA 5CBEE 1PA6A 3MFGA 4CDEC 5M3FB 5GROA 1YI2A 1K8OA 3C3LA 1V8QA 2PQAA 4P71A 3HOWH 2HD3A 4JI4L 4ME5A 5BN3A 3TP5A 4PMBA 1Y1WG 4DR4Q 4A3JG 2F0HA 1IYVA 4JI6Q 4XQQA 5KNDA 4KD4A 3Q23A 2EJFC 5FJ8H 3U4ZA 1VQFA 1I4RA 1UEAB 1SMXA 4APVA 1N32L 4B3RQ 4LFAL 4DR6L 1FR3A 5ELOA 3ZJYC 3QO2A 4A3DB 4LF6L 1T5XD 2J4XA 3BG3A 2AHOB 1IBLQ 4WRDA 1EY5A 3KJPA 1M1KC 1STGA 1LT4D 4OIKA 5AJ3Q 4A3GG 4TQUS 4JI0Q 3TEHB 1CTMA 4BY1H 1JB3A 2NN6G 4NXMQ 2FXQA 3TSSA 4C3HH 4JPBW 2QA4A 1A2TA 2LKVA 2R7DA 1VS0A 2K5DA 2ZXOA 2JEAI 4K6DA 3KLSX 2Q2UA 4MHEA 2PZWA 2MO1A 2K04A 3S15B 5IT9c 3KYHC 1PYWD 4PZ6A 2E74C 2RBMA 5ELBA 4CKEA 3HKSA 4FF2A 3S1QB 1GUNA 4QUCA 5ISRA 4P2CB 4GKKL 5IYCH 4DUYL 2ZXRA 4EQOA 4A3KH 4LWCA 4KI0A 1EEID 2DUDA 3L0OA 4G4KA 1JWMD 4HAEA 5EPJA 4YCWA 1CZGA 4DGZA 5I9OA 3NBIA 3VYUA 1WD0A 3PF5A 2VB3X 1C4QA 2JA7G 2QKIC 2RHSB 3K5MA 4TRDA 2NVXB 1EOTA 4L5QA 1EY8A 1IXRA 3CW2C 3GQBA 2ZJRA 1X54A 3J7ZC 5J39A 3I91A 5G3LD 2RSNA 3SEBA 3K7AB 1PH4A 3PO2G 1VQEA 3CCUA 1WTXA 5IYBG 4DR2Q 1RL2A 2A5HA 3NWSA 1BCPF 2IT1A 4YHHQ 3RZDB 3K59A 3PCOB 1GXDC 1PH3A 1TWCH 1NJIC 2E2DC 1UE5A 4RCNA 4RGOS 3RLFA 1XWEA 2XN9C 4JYAQ 4C2MB 2E75C 4DR1L 2QEXA 3GV6A 2Q8IB 1CT1D 2ALYB 2RCNA 4HJ9A 1D5MC 4GLAC 3EVQA 1EQTA 4EQ5A 1TS4A 1A15A 1PFSA 4XQNA 4IPHA 2AUJD 1J5EQ 3E6ZX 1AZQA 4NXNQ 1PH1A 2F0EA 3VR2A 4P73A 3M4YA 1QNKA 3Q8DA 2JA5B 4IO9A 4A3IG 5IT9E 2LY7A 1TY2A 5C4XH 2B3GA 3K80C 4OWTB 3TS2A 4KJNA 3H3VI 3PUVA 2MNAA 1II3A 3K0YA 4YY3Q 3UDXA 3MEFA 5M3MB 2VUMG 4RKLA 4ZKCB 2IHFA 1RTNA 3DWPA 1X9NA 4WJWA 1N36Q 4FNFA 2PNHA 4AQYL 3SDZA 1DOKA 2F0VA 5KNBA 1AE3A 3S14B 1FJGQ 2CKZB 1VQGA 2EXZA 1STEA 4XT3B 3GTJH 1MJEA 3PUWA 1CKNB 4A3MG 3AFPA 4C3IG 1VQOA 4Y7NH 1L1OA 4KV6A 2EY1A 1I6VC 3KDFB 4H7BA 4LFCQ 1CK1A 1I3QB 1U4RA 1YBYA 2R93G 2K4KA 4QB4A 1XNQL 3A8KE 2O4XA 3R2TA 2BE5D 3RD4A 3I4MG 3NBHB 1VF5C 1ZEQX 5IOCA 1MKHA 4KLKA 1HXYD 4OO1I 2CH4A 2F3VA 1IL8A 2IPKD 5EBCA 4KKTA 3U9SA 1B1ZA 2VQEL 4NKLA 3W1BA 3I55A 1VQKA 2WB1G 4BY7G 5CMDA 4JI7L 2CWAA 1I94Q 5JEAG 2OF1A 2MFIA 3DWQA 1DONA 4EGVA 4AIMA 3STBD 1MJCA 3HOUH 4ULLA 4FYDA 2RA4A 2JSOA 4POFA 4FXKC 5JEAJ 3HOZH 1M90C 1CA6A 4DR5L 5E4WC 5CC4A 1PH7A 3S24A 2AWNA 3HOVB 1YNNC 3EA6A 5IGDA 4LFBQ 2RKSA 1LUZA 1WTPA 3CC7A 3PIPA 4K0KQ 3S1NB 3CPFA 4A3BB 5IP7G 1K83B 4F88A 2RSOA 3K0XA 2MUYA 2K01A 4R4QA 1Y1WH 3B6YA 2SNMA 4A3JH 4U68A 1HNXQ 4L63B 3D4DA 4DR3L 4FP5D 5JVG3 2R7ZH 1A8VA 4JI1L 3KF6A 1SYGA 4DV0Q 1QB5D 3SVMA 4JI8Q 2UUCQ 3MZ5A 4H44C 3TRZA 1A63A 3NEMA 4JW0A 4JBMA 1SMYC 4ZKBB 4MTKA 1R4QB 4I7AA 3GTPH 1V1OA 3K6OA 1JORA 1OXSC 4IOAA 1Y69U 1JQYD 1HUNA 1Z9FA 5HGTA 2ICEC 1DOLA 4A3GH 1BBUA 4UP7A 5IE8A 1EZ6A 2B2YA 4LF9Q 1J8IA 4OGQC 4QF4A 2NN6H 1ML0D 4B3TL 1MBYA 1U4PA 5C5MA 4DV6Q 1HR0L 1IBKL 1PFNA 1Y14B 5C3WA 5I6YA 5M5WH 1G2TA 3G7LA 3W1GA 3A55A 3GTQB 3A56A 4X3TA 3NP8A 3ZYYX 4O42A 1FYCA 3D4RA 2ZM6Q 1BNZA 2XRQD 1CSQA 5J1ZA 2HUGA 5M3FG 3OW7A 2PQAB 2PYKA 5K36G 4S3SA 3TS0A 3FMCA 4TVAB 1N33Q 2MJ8A 1RODA 5M5YB 1YHBA 1LO5D 3KLRA 4DR4L 1D7QA 5CORA 1R9TB 1EIGA 3J80i 3T1HQ 3KBXA 3U9OA 4JI6L 4B3MQ 2P5ZX 3HP3A 4DV1Q 4A3FH 4X62Q 3Q0AA 1YIJA 3CU7A 3CHBD 3G48A 1JJCB 3NK9A 3OWEB 1VQ9A 1G6ZA 2N8NA 4A3DG 4B3RL 2H1EA 4K6LA 5CV8A 5AFWA 3D8GA 3ONAB 4UP9A 1IBLL 3S17B 5IGCA 3R3OA 1L0XB 5EPKA 2XRSD 1M8AA 2KA7A 5AJ3L 2HCIA 3PO2H 4BS9A 5M5XH 1D2BA 4JI0L 1D6EC 3BYYB 2BDNA 4BA1I 4NXML 5LMNW 2E2IH 3BZCA 2A73B 5ELDA 4ILWA 2JQOA 1YHAA 4B9XA 2NVTB 4LMQD 1ET9A 3QB3A 2QF7A 3PV0A 2R92B 4IQZA 5GAHC 1V1PA 2L11A 3EIVA 1SNQA 3LX0A 1K3RA 3S16B 4OX9Q 1VQMA 2E2JB 2JJQA 4IUTA 5IGFA 2UUBQ 1UAPA 2K5HA 3FVQA 1UUPA 4A3IH 3OPOA 4LNQA 4P74A 3J80c 1F2MA 1SFOB 1F77A 4JI2Q 5ELEA 1VQ7A 2VUMH 3I90A 1ENFA 1RIPA 2RDGA 2B63H 2K05A 2O5JC 4JOIA 1ENAA 4QQBX 3FHWA 3LWUA 2BA0A 3KLSA 1XX8A 5C6AA 2BOSA 4A3MH 4DR2L 1TVXA 2I5MX 4FF3A 2M00A 3D31A 5HURA 1TU2B 2SOBA 5GQOA 3EROA 1RDPD 1VQBA 3MAQA 3ITPA 4DV5Q 4YWLA 1WFQA 4QMGA 2G5DA 1SYEA 4ZUIA 1E22A 4JYAL 3RR5A 4B08A 2WAQB 3I4MH 1EYCA 1HHVA 5LMUQ 3BJUA 4O0AA 1Y1VH 4KN4C 1D1KA 2K03A 3S1RB 3T13A 5IGGA 3L2PA 4LK1C 3EBEA 1CFMA 4RG1A 4NXNL 1LTBD 1J5EL 4OL7A 1HFNA 1SEBD 4IFDG 3SGIA 2JA5G 3QG1A 5LL6S 1NCVA 2L5TA 2LS01 1HPCA 1JR0D 5JEAH 4IFDJ 1NBWA 1Q1EA 4CGYB 5M3MG 1VF7A 5DM63 1TKWB 4YY3L 2VQFQ 1LTTD 1N36L 3E5SA 3SK6A 4YWKA 4O1NA 4GOPC 1Q8IA 2PQEA 1MIUA 1HH2P 4GLVB 1FJGL 4KHPL 3HEJA 2ID0A 4DK6C 3MXUA 3TN2A 1JE4A 1K3BC 1HZ9A 4P75A 1YNXA 2R93B 1FGUA 3J80E 2E2HB 2G9DA 1DM0B 1Q86C 1D5XC 4HJ7A 4LFCL 5IP7H 5CR3A 1KDBA 1X65A 3VR3A 3BU2A 2YTXA 1PTOB 3GTOB 2BCOA 5CV9A 3MHBA 4OONA 1QOHA 4N9TA 1BCPD 3FEWX 1VQCA 3J80L 3K8AA 2ASBA 5T1GA 2EQSA 4I7ZC 2WAQE 3CQZB 2O5IC 4PMWA 2C35B 4G7OC 2B2WC 3M4OH 4FDBA 1TWAH 1EUJA 1JJGA 5KYLA 5FLXc 3Q24A 1MD2D 4DAYB 3KK7A 5FLMG 4A3EB 3RMHA 2B2TC 4RMFA 1JE5A 1I94L 1X56A 2QGQA 3BVGA 3CCVA 1GOZA 1O78A 1O7YA 1SE2A 1B44D 3HOVG 3S1MH 4DKAC 1EY9A 1TWFB 1NUCA 1GVPA 1TWHH 1SYCA 2DNEA 4LFBL 3T56B 2F1MA 1EU4A 3NPPA 4A4IA
chains in the Genus database with same CATH topology
1A3UA 2QEJC 3HOYB 2XSCA 5K36H 4K14A 1JC7A 2L4NA 1AN8A 2FMCA 2SNSA 1S5ED 5JVH3 3VYSA 3K57A 2B2UC 4IUQA 1QILA 5FOBB 4TKOB 5E1FA 1EWHA 1HCZA 1SYFA 1RTOA 1Q1BA 1GUSA 2Z4HA 3I4NB 1AZPA 2DN8A 1S5FD 2BA1A 3LWEA 1EQVA 1F2ZA 1STNA 3NTIA 1CQVA 5LL6X 1DOMA 2XWBB 2PNRC 5IGEA 1Y8PB 4IUPA 2X69A 2F0MA 5FLXE 5JOBA 2D5DA 1CQFA 3RZOB 2A6EC 1SNOA 2EYOA 5D3IB 5J22A 3GTGB 1S5BD 5FLXL 5C44B 2IX3A 1TS3A 2M9VA 4Q0FA 1GUGA 2DY8A 1WCMB 5CV6A 1H9JA 1IKLA 4DXGA 1SNDA 5IODA 1F2YA 3OMGA 3DUZA 2CHBD 3UI2A 4RGTA 4IUUA 2JA6B 2B39A 2F0DA 4BBRB 4KK7A 1HRJA 2JEBI 1YNJD 4OHJA 2A69C 1PRTF 3N6RA 3BVZA 3P20A 1DYQA 3NQIA 4KHZA 1TWGB 5C0XG 4ZYSA 1V1PB 4KY5A 2A74C 4EQPA 3NQTA 1OXTA 1SNPA 2HDMA 4DK0A 5C0XJ 4A93B 3OHXC 4KTAA 2F0OA 4IFDH 3PO3B 2QILA 3OMCA 5KRUA 1F9QA 4UDUC 3GTKB 4IURA 1LACA 3A7AB 2NYZD 2FMMA 1RJTA 2WINB 3H91A 3IFTA 4H0LC 1TS5A 4BBSB 3ERQA 3HG9A 1GUOA 2F0NA 5FO7B 5EKIA 1STYA 3W2DA 4BY1B 1BBXC 1V43A 1Z6HA 3WOFA 3PUZA 1CI3M 4XDXA 2K5QA 1ZYRD 4CJ2C 1Q12A 5DNFA 3R2IA 5JPNC 1IW7C 4IALA 3M7GA 1S5CD 4HR7B 2R6GA 1WD1A 2HCCA 1OXVA 1SNCA 2EPBA 1TR5A 1DD2A 1IHZA 2ENBA 5COYA 3L7ZC 1NR2A 2KHSA 2XIWA 3T51B 4K5XA 1LTAD 3MWYW 5LHY1 2IX0A 4K5WA 3I3CA 1KLUD 2PPBC 4J6HA 2WP8J 3ND9A 3GV3A 1ESFA 1B4OA 3T16A 5JAVA 2B8GA 5FKAC 4LAAA 1J9OA 1S5DD 3A8IE 4XTCS 3GTLB 3R8BA 2HDLA 1PZID 5KNCA 2CVRA 2N55A 4KKUA 5C4XB 1AEXA 3S2DB 2A6HC 1EU3A 3BDLA 4HN7A 1U4LA 2E76C 3OIPA 2K1BA 2VXWA 1HFGA 4KMUC 4K2LA 2Y0SB 1UNSA 1SSOA 5T1IA 1MSHA 1ILQA 3OOCA 2V4DA 1GUWA 1QNUA 1RF2D 4J8QA 2H4OA 2K32A 2K28A 1PMRA 3FKIB 3SK5A 3NUCA 4V190 4I65A 4C1NI 4N9PA 3AB9A 2EY5A 4XYOA 3VR5A 1A3VA 1RCVD 1X3PA 4RKBA 1EY0A 2KVMA 2WIIB 2WKDA 2ICIA 1PFMA 1MSGA 2NWGA 1F9RA 3MFYA 5EKLA 1R4PB 1HTPA 2HQEA 4F87A 1X3QA 3SE0A 3HOUB 3GD7A 2NZ1D 4ZUJA 2PO4A 3CKIB 1ILPA 1BO0A 2F0JA 3MC0B 1HTLD 5C5LA 4YIJA 2C5CA 5C0XH 1GUTA 3O13A 4X3UA 1FNUA 3K58A 2GA4B 1BCPC 2M2LA 2JYOA 3SK8A 3BDOA 3URYA 2A68C 3MA2B 1VCIA 1EY4A 4M1UB 2PMZB 2B2TA 3NE5B 5DAUA 4HCEA 1PDQA 2NVQB 3T4AC 4PV1C 2F0KA 3OIQA 4G57A 1LT5D 1JICA 4FF1A 4PNYA 3D4WA 3J81E 2AUKA 5F2DA 1I50B 4FVMA 2OT2A 1STBA 3V2TA 3MEHA 3J7AF 1PZJD 2F0UA 2OEOA 1NSNS 2CW0C 1E2WA 4DN4M 2WACA 1FNVA 3J81L 2B2UA 1A6XA 1KAAA 2AQ1B 2B8FA 4Q5VA 4Z9CB 1STHA 4NDXA 1C8CA 1F9PA 5FO8B 4DAPA 2JP1A 3M3YB 1PTOC 4A3FB 2D9UA 3VA5A 4XT1B 1ZXTA 3TZUA 1BCPB 3A7LA 4XXEA 4KHVA 3GTMB 4QCLA 3VA7A 3FPPA 5M5XB 3MXGA 1SNMA 1HA5A 1BOSA 4C3JB 4ABNA 1NR4A 2G9HD 1EIHA 3X3NA 1QCBD 3KUPA 1PRTD 2PCFB 1ZKOA 2L55A 4B9WA 2N88A 3TZDA 5I6WA 1SBBB 2D2CC 3M7NA 2MHVA 1I4XA 1ENCA 1DXMA 4F8MA 2KCCA 4RH6A 1QWYA 1K8MA 3DMUA 1JOOA 3J7AV 1KLGD 3I73A 1SMYD 2AQ3B 2K33A 3G6JB 2EJMA 1JWUD 1YNJC 5TSSA 2B63B 1KDAA 4HMJA 3D6CA 4AYBB 3H94A 5CV4A 2EYLA 4DNRB 3FRPB 5JPMC 3NSWA 2B2YC 1MGSA 1BR9A 4KY7A 1LABA 1PFBA 1JWSD 3C2PA 4WFN3 5C3EB 1FD7D 4V0BA 1O80A 1RKNA 3H3VC 3BVMA 2NN6I 4G7HC 1Y1VB 1ONLA 3H09A 5DM73 4HSVA 1WTRA 1Q90A 3DWAA 1VDZA 2FFKB 5C4JB 1O7LA 3LNNA 1SXTA 2F4IA 1FNWA 1H9RA 4DXFA 4PMCA 5C4HA 5D3DA 3R93A 4ZRZA 2I07B 1SYDA 1A2UA 2LFNA 5A35A 4RA8A 3K5NA 3HGBA 3DHQA 4HEDA 2K7VA 4DNTB 4FXGC 1Z7TA 1QG7A 1KNEA 3F2UA 3IFDA 4BWGB 4DFAA 3P75A 3VYTA 3OSOA 2F0FA 2EOTA 1CHPD 2XWJB 3IL8A 4ODGA 1SE4A 3C46A 2JA8B 1GHKA 2MPMA 1OXXK 4KN7C 2IJ0A 3TP7A 2BE5C 1SJHD 4WORA 2Z4IA 3S1MB 2DNCA 1DCZA 2KEDA 2ZT9C 1U9RA 3D6WA 1H9MA 1U4MA 2EYHA 5CV7A 3H0GB 2F0QA 3DXJC 2X6GA 1W6KA 2EY6A 1A3TA 3MXNA 3FDTA 3TP8A 3V96A 2IW3A 2IL8A 4PQXA 2L9HA 1W6JA 5C3XA 3HOXB 1RHPA 2RDFA 3Q6SA 4HCSA 3HZXA 5EQ0A 5I2XA 4C56C 2F03A 3DEOA 3C1EA 5EKKA 3JAME 2XNAC 4K5VA 3HOWB 1AFPA 3X3MA 2RQXA 1I4HA 3S2HB 1EZ8A 3NXWA 3JAML 5I4DA 1EYAA 5NUCA 4XQJA 1WVLA 2XVSA 3E0JA 1TS2A 2EY2A 2QDBA 4R8NA 1QE6A 1G2SA 2FINB 1EY7A 1H9SA 3RUZA 2KQ3A 5K5PA 1L0YB 2BDOA 3KF8A 2F0SA 3I70A 3QOLA 1BF4A 3H6MA 4C3HB 2F0LA 3AMUA 1SJED 4IZ8A 3WDNA 5CV5A 5D65A 4C3JG 2NTTA 4R9WA 3HKZB 1HA6A 4U673 5JJZA 3P7JA 4DF7A 4ID6A 1MI2A 2WV6D 5KGUA 4A3KB 2R3ZA 4R8IA 1LT3D 1CM9A 1IYUA 1EWCA 5EBDA 1OO9B 2KUMA 3DM1A 1PZKD 3N52A 3MTSA 2PW5A 2EYPA 1QJOA 4ZAIA 4X3SA 1NAPA 2I46A 4XYQA 3TBIB 5IT9L 5ELCA 1I4PA 5C4ZA 2B2VC 1TWCB 1GJXA 3EQLC 3HRZC 4FF4A 3IKJA 3K5OA 2SDFA 1STAA 2A6ED 4QIWB 1EYDA 4BA2I 1XXGA 4RHSA 2JE6I 2NTSA 1PTOF 4HMIA 3T53B 3I4LA 4LJZC 4OIJA 4DA2A 3TP6A 1AW7A 2MP1A 3QWNA 1D1IA 1VMPA 1E0BA 3EFXD 3GO5A 1LTSD 1G291 4DAYA 5KEEA 3GTJB 2L12A 4CKCA 1Y8OB 4RCOA 3VR4A 4Y7NB 5A2QE 2L1BA 3PIO3 5BN4A 3SXHA 5I2YA 2A69D 1SYBA 1XTCD 1X32A 2X6LA 1EY6A 1OXUA 1PRTC 2WKCA 3PUYA 4J1MA 4G7ZC 5A2QL 3CRKC 4KY6A 2F0PA 1JOKA 5KIXA 3VYRA 2PZTA 1SAPA 1KNAA 1TY0A 2FJ2A 2Q8RE 4RWSC 4XIGS 3SR1A 2VNUD 4KD3A 3TDQA 2F3WA 1WTOA 3V05A 4M8AA 3HOZB 5ELFA 1JOQA 2PZUA 1RD9D 4DU9A 2K6AA 3GP7A 2F0TA 2F0GA 1E2ZA 4IFDI 1LV9A 2NVYB 5BN5A 1BDOA 4IUNA 2B2WA 4RHRA 4RGNA 4K8JA 1DJRD 1Y1WB 4A3JB 3I8ZA 3EJIA 5G3LF 2R7ZB 4X3KA 3HS0C 5E4XA 4EQNA 2QCPX 4K8IA 4NMZA 2AWOA 4RFBA 2EJGC 1BXTA 1IW7D 1HQMC 3SK4A 3GTPB 5FK9C 3M85A 3AU7A 4OO1G 1PRTB 4A3GB 1TT2A 1WTQA 1IKMA 1HQRD 3BYTB 3D3RA 2KJXA 2JXMB 3J7YW 5CYUA 5M5WB 2Q8TA 3QOJA 4TSSA 3BS1A 2PW7A 5DEHA 1EFID 1VMCA 1D5ZC 1B9MA 1KTKA 1PXUA 4L8JA 2YU9B 1I4GA 2DY7A 2EYFA 3C1FA 4L6TB 3L3OC 2R61A 5KYIA 2EDGA 1TQOA 1B9NA 5IGBA 2JA7B 4ZK9B 4F7XA 4CKBA 4NP5A 1O7ZA 2C9OA 1F2LA 5M9OA 1HUMA 4C1NK 1I4QA 4EVOA 1H9SB 5EJWA 1Z47A 3QIAA 3TMEA 3PO2B 2Z1CA 4C3HG 2A6HD 2VB2X 2E2IB 4IN3A 1LLRD 1ET6A 1H9KA 1YNND 1WTWA 1CHQD 1PTOH 2YYZA 1ICWA 3MXPA 3I72A 3QJYA 2RVLA 1E2VA 4FO2A 4CHTB 2NBFA 2F0WA 2EYMA 4ZLTF 3BDCA 2SEBD 4ZQ3A 3DEPA 3PUXA 1DZ1A 4HSPA 1BUVT 2IWHA 1ESRA 5IIFA 4A3IB 4FXDA 1FGBD 4DK1A 2OXPA 2VUMB 1B2TA 3FPUB 3A8JE 2IX1A 1JCKB 3NTHA 1CA5A 4CBVA 1EEFD 2RDHA 1Y8NB 2L0CA 2NUCA 4MIUA 2J7ZA 4IUVA 2AQ2B 4A3MB 2KECA 3NTKA 4C3IB 1CZWA 4CJ1B 4K2KA 3VR6A 4DAVA 5CBAE 4NW2A 1LT6D 4JBWA 5EGTA 1M4VA 2FHTA 2K5WA 3I4MB 1B3AA 2D62A 1T5EA 3NBHA 3CRLC 3KBGA 3A54A 3BZDB 4RGMA 1PLFA 4QUFA 2A68D 2ZXPA 2EZVA 4UAIA 2WB1B 4BY7B 3W3AA 1KABA 3SHLA 2EYJA 2CQAA 3L9AX 1B50A 4CJ0B 5C0XI 2EVBA 1LTGD 3K5LA 3ND8A 2TSSA 1AP0A 1SDFA 4RAUC 5D14A 1G91A 3MVVA 1ZYRC 3PMFA 4H13C 1KDCA 1TIID 1LTRD 3Q22A 1Q3LA 5EPLA 5I9PA 3IAYA 2CW0D 1WTVA 2MGSA 2TMPA 4GZYC 2KCNA 1F9SA 4E6IA 4KKSA 1SE3A 1C48A 2NB0A 1EL0A 1I6HB 3M4OB 1GHJA 1TWAB 5CGKA 2EE1A 5E3FA 2Z8LA 3P1HA 3NWTA 4OO1H 4HTHA 2O2LD 1PTOD 4MN3A 1XYIA 3NHHA 2F0IA 2KOLA 2LMCB 2B2VA 3PIP3 3OWFA 4JK1C 2J0TD 3S9WA 2KEEA 1BQQT 1LTID 5FO9B 1G8ZD 1B53A 3WOEA 1TWHB 1S4ZA 5CBEE 3MFGA 5M3FB 1K8OA 3C3LA 1V8QA 4ME5A 5BN3A 3TP5A 4PMBA 2F0HA 1IYVA 4XQQA 5KNDA 4KD4A 3Q23A 2EJFC 1I4RA 1UEAB 1FR3A 3QO2A 4A3DB 1T5XD 2J4XA 3BG3A 4WRDA 1EY5A 1STGA 4OIKA 1LT4D 4TQUS 1CTMA 1JB3A 2NN6G 3TSSA 1A2TA 2LKVA 2ZXOA 2K5DA 2JEAI 4K6DA 3KLSX 4MHEA 2PZWA 2K04A 3S15B 1PYWD 2E74C 2RBMA 5ELBA 4CKEA 4FF2A 3S1QB 1GUNA 4QUCA 5ISRA 4P2CB 2ZXRA 4EQOA 4KI0A 1EEID 4G4KA 1JWMD 4HAEA 5EPJA 1CZGA 4DGZA 5I9OA 3NBIA 3VYUA 1WD0A 2VB3X 1C4QA 2QKIC 3K5MA 4TRDA 2NVXB 1EOTA 1EY8A 3GQBA 5J39A 3I91A 5G3LD 2RSNA 3SEBA 3K7AB 1WTXA 2A5HA 3NWSA 1BCPF 2IT1A 3RZDB 3K59A 1GXDC 2E2DC 4RCNA 4RGOS 3RLFA 1XWEA 2XN9C 4C2MB 2E75C 3GV6A 2Q8IB 1CT1D 1D5MC 3EVQA 1EQTA 1TS4A 1A15A 4XQNA 2AUJD 3E6ZX 1AZQA 2F0EA 3VR2A 3M4YA 1QNKA 2JA5B 5IT9E 2LY7A 1TY2A 4KJNA 3PUVA 1II3A 3K0YA 5M3MB 4RKLA 4ZKCB 1RTNA 3DWPA 4WJWA 4FNFA 3SDZA 1DOKA 2F0VA 5KNBA 3S14B 2EXZA 1STEA 4XT3B 3PUWA 4C3IG 4KV6A 2EY1A 1I6VC 4H7BA 1CK1A 1I3QB 1U4RA 4QB4A 3A8KE 2O4XA 3R2TA 2BE5D 3RD4A 1VF5C 1ZEQX 5IOCA 1HXYD 4OO1I 2F3VA 1IL8A 2IPKD 5EBCA 4KKTA 3U9SA 1B1ZA 4NKLA 5CMDA 5JEAG 2OF1A 3DWQA 1DONA 4EGVA 4FYDA 4ULLA 2RA4A 2JSOA 4FXKC 5JEAJ 1CA6A 5E4WC 5CC4A 2AWNA 3HOVB 1YNNC 3EA6A 5IGDA 2RKSA 1WTPA 3S1NB 4A3BB 1K83B 4F88A 2RSOA 2MUYA 2K01A 2SNMA 4U68A 4L63B 3D4DA 4FP5D 5JVG3 3NPPA 1SYGA 1QB5D 3SVMA 3MZ5A 4H44C 1SMYC 4ZKBB 1R4QB 1V1OA 3K6OA 1JORA 1OXSC 1Y69U 1JQYD 1HUNA 5HGTA 2ICEC 1DOLA 1EZ6A 2B2YA 1J8IA 4OGQC 4QF4A 2NN6H 1ML0D 1MBYA 1U4PA 5C5MA 1PFNA 5C3WA 5I6YA 1G2TA 3G7LA 3A55A 3GTQB 3A56A 4X3TA 3NP8A 3ZYYX 4O42A 1FYCA 3D4RA 1BNZA 2XRQD 5J1ZA 2HUGA 3OW7A 2PYKA 5K36G 4S3SA 3FMCA 2MJ8A 1RODA 5M5YB 1LO5D 3KLRA 5CORA 1R9TB 1EIGA 3KBXA 3U9OA 3HP3A 3Q0AA 3CU7A 3CHBD 3NK9A 3OWEB 1G6ZA 2H1EA 4K6LA 5CV8A 5AFWA 3D8GA 3ONAB 3S17B 5IGCA 3R3OA 1L0XB 5EPKA 2XRSD 1M8AA 2KA7A 2HCIA 4BS9A 1D2BA 1D6EC 3BYYB 2BDNA 4BA1I 2A73B 5ELDA 4ILWA 4B9XA 2NVTB 4LMQD 1ET9A 3QB3A 2QF7A 3PV0A 2R92B 4IQZA 1V1PA 2L11A 1SNQA 3LX0A 3S16B 2E2JB 4IUTA 5IGFA 1UAPA 3FVQA 1UUPA 3OPOA 1F2MA 1SFOB 1F77A 5ELEA 3I90A 1ENFA 2RDGA 2K05A 2O5JC 1ENAA 3LWUA 2BA0A 3KLSA 1XX8A 5C6AA 2BOSA 1TVXA 4FF3A 2M00A 3D31A 5HURA 1TU2B 2SOBA 3EROA 1RDPD 3MAQA 3ITPA 4QMGA 1SYEA 4ZUIA 4B08A 2WAQB 1HHVA 1EYCA 4KN4C 1D1KA 2K03A 3S1RB 3T13A 5IGGA 4LK1C 1CFMA 1LTBD 4OL7A 1HFNA 1SEBD 4IFDG 3QG1A 5LL6S 1NCVA 2L5TA 2LS01 1HPCA 1JR0D 5JEAH 4IFDJ 4CGYB 1Q1EA 1VF7A 5DM63 1TKWB 1LTTD 3E5SA 3SK6A 4O1NA 1Q8IA 2PQEA 3HEJA 2ID0A 3MXUA 3TN2A 1JE4A 2R93B 3J80E 2E2HB 2G9DA 1DM0B 1D5XC 5CR3A 1KDBA 3VR3A 1PTOB 3GTOB 2BCOA 5CV9A 3MHBA 1QOHA 4N9TA 1BCPD 3FEWX 3J80L 5T1GA 4I7ZC 3CQZB 2O5IC 4PMWA 4G7OC 2B2WC 5KYLA 3Q24A 1MD2D 3KK7A 4A3EB 3RMHA 2B2TC 3BVGA 1GOZA 1O78A 1O7YA 1SE2A 1B44D 1EY9A 1TWFB 1NUCA 1SYCA 2DNEA 3T56B 2F1MA 1EU4A 4KJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO D;  2WV6 D;  1XTC D;  1LTA D;  2AQ2 B;  2QEJ C;  4TSS A;  1DYQ A;  1PRT C;  1EFI D;  1KLU D;  1D5Z C;  1BCP B;  1LT3 D;  3SEB A;  1LTB D;  4ZYS A;  3CHB D;  1KTK A;  3DWQ A;  1AN8 A;  1V1P B;  1ESF A;  3OWE B;  3DWA A;  1LTI D;  1S5E D;  1SEB D;  1LT6 D;  1G8Z D;  1EWC A;  5FKA C;  1QIL A;  4K6L A;  3MC0 B;  1HTL D;  1I4G A;  1M4V A;  1BCP F;  4L6T B;  1JR0 D;  2R61 A;  3MFG A;  1SXT A;  1HA5 A;  1TY0 A;  1L0X B;  1FNW A;  2XRS D;  3O13 A;  1PZK D;  1FNU A;  1S5D D;  3EA6 A;  4RGO S;  1BCP C;  2XN9 C;  4DXF A;  1D6E C;  2QIL A;  3BZD B;  1S5F D;  3BYY B;  1LTT D;  4RGM A;  3URY A;  2G9H D;  4O1N A;  3R8B A;  5D3D A;  1CT1 D;  1D5M C;  5ELD A;  4C56 C;  4UDU C;  1PZI D;  3V05 A;  1PRT D;  1TS4 A;  1I4Q A;  5ELF A;  1ET9 A;  1I4R A;  1CQV A;  2XNA C;  5ELC A;  1SBB B;  1I4P A;  1I4X A;  4L63 B;  1V1P A;  1D5X C;  1RD9 D;  1TS5 A;  1EU3 A;  3GP7 A;  1T5X D;  1LTG D;  2J4X A;  1TY2 A;  1PTO B;  4RH6 A;  3W2D A;  1LT4 D;  1I4H A;  1LLR D;  1ET6 A;  1LT5 D;  2TSS A;  5D3I B;  4RHR A;  1CHQ D;  4RGN A;  1BCP D;  1PTO H;  3DWP A;  5I4D A;  4BWG B;  1KLG D;  1UUP A;  1V1O A;  1DJR D;  1XXG A;  2AQ3 B;  3TSS A;  4RHS A;  2NTS A;  1PTO F;  1S5B D;  1PZJ D;  1JQY D;  1JWU D;  1UNS A;  5TSS A;  1LTR D;  1STE A;  1F77 A;  5ELE A;  2SEB D;  3KLS X;  1TS2 A;  3R2I A;  1AW7 A;  1ENF A;  1TS3 A;  2RDG A;  1PYW D;  1MD2 D;  4RFB A;  1FNV A;  1CHP D;  5ELB A;  1L0Y B;  1BXT A;  3EFX D;  1SE4 A;  1LTS D;  1CK1 A;  1RF2 D;  1S5C D;  4DXG A;  2IJ0 A;  2AQ1 B;  5FK9 C;  1FGB D;  3BVG A;  1SJH D;  4Z9C B;  1SE3 A;  1GOZ A;  1PRT B;  1SJE D;  2CHB D;  1EEI D;  1JWS D;  2XRQ D;  3R2T A;  1JWM D;  4RGT A;  1RCV D;  1SE2 A;  1RDP D;  1FD7 D;  4RCO A;  1B44 D;  2NTT A;  1HQR D;  3BYT B;  2Z8L A;  3BVM A;  4OHJ A;  1JCK B;  1HXY D;  1PRT F;  1EEF D;  1PTO C;  1LO5 D;  2IPK D;  2RDH A;  3BVZ A;  2O2L D;  2ICI A;  1B1Z A;  1EU4 A; 
#chains in the Genus database with same CATH topology
 1A3U A;  5M3F H;  4A3B G;  4K0K L;  2QEJ C;  3HOY B;  2YTY A;  2XSC A;  5K36 H;  3H0G H;  4K14 A;  4DV3 Q;  1JC7 A;  2L4N A;  2LXJ A;  1AN8 A;  2FMC A;  2SNS A;  1S5E D;  5JVH 3;  3VYS A;  3K57 A;  1HNX L;  2B2U C;  4IUQ A;  1QIL A;  1FL0 A;  3F8T A;  5FOB B;  3QR8 A;  4TKO B;  5E1F A;  1N34 Q;  1EWH A;  3KF6 B;  1HCZ A;  1SYF A;  1RTO A;  2OWO A;  1Q1B A;  1GUS A;  2Z4H A;  4DV0 L;  3I4N B;  2A19 A;  2WFW A;  4JI8 L;  2UUC L;  1AZP A;  1QUQ A;  2DN8 A;  1S5F D;  2BA1 A;  3LWE A;  3HOX H;  1EQV A;  1F2Z A;  1STN A;  4YCU A;  3NTI A;  4NPS A;  4LF9 L;  1CQV A;  3DLL A;  5LL6 X;  1DOM A;  1E24 A;  3A0J A;  2XWB B;  1KRT A;  4UPA A;  2PNR C;  5IGE A;  1Y8P B;  4DV6 L;  4IUP A;  2X69 A;  2F0M A;  5FLX E;  3G4S A;  2HHH Q;  5JOB A;  2D5D A;  1CQF A;  4JC0 A;  3AEV A;  3RZO B;  2A6E C;  3ER0 A;  1SNO A;  2EYO A;  5D3I B;  3S1Q H;  5J22 A;  3S2H H;  1X3G A;  3GTG B;  5GAG C;  1S5B D;  1SN8 A;  2ZTD A;  5FLX L;  3E3X A;  1N33 L;  5C44 B;  2IX3 A;  4HJ5 A;  3T1H L;  1TS3 A;  2OQK A;  4B3M L;  2M9V A;  3CXC A;  2QW7 A;  3F2B A;  4DV1 L;  4X62 L;  4Q0F A;  1GUG A;  2NVX H;  1EQR A;  2DY8 A;  3LGJ A;  1VQL A;  1WCM B;  5CV6 A;  2DJG C;  1H9J A;  1IKL A;  1IZ6 A;  1SND A;  4DXG A;  5IOD A;  1F2Y A;  3OMG A;  3DUZ A;  2CHB D;  1VQA A;  3UI2 A;  4RGT A;  4LW1 A;  4IUU A;  1UWV A;  4BXX G;  2JA6 B;  2B39 A;  2F0D A;  2KEN A;  4BBR B;  4KK7 A;  1HRJ A;  2JEB I;  1YNJ D;  4OHJ A;  2A69 C;  1PRT F;  3N6R A;  3BVZ A;  3P20 A;  4OWX B;  2ZTE A;  5HY6 A;  2K14 A;  1DYQ A;  2OQ0 A;  3NQI A;  4KHZ A;  3CMA A;  1TWG B;  4QJF A;  4C2M H;  2F3I A;  5C0X G;  4ZYS A;  3IRB A;  1HR0 W;  2R92 G;  1A62 A;  4JI3 Q;  1V1P B;  1YZ6 A;  3ULJ A;  4KY5 A;  2A74 C;  4EQP A;  4HIK A;  3NQT A;  1OXT A;  1SNP A;  2HDM A;  4DK0 A;  5C0X J;  4A93 B;  3OHX C;  4KTA A;  2F0O A;  4OX9 L;  1GD7 A;  4IFD H;  2JA5 H;  2KCM A;  4R4O A;  4IOC A;  3PO3 B;  2QIL A;  2UUB L;  3OMC A;  5KRU A;  2HIV A;  3FP9 A;  1F9Q A;  4LUV A;  4UDU C;  5M3M H;  3GTK B;  4IUR A;  1LAC A;  1E1O A;  3A7A B;  2NYZ D;  2FMM A;  3CCM A;  1RJT A;  3UDI A;  2RF4 A;  3S14 H;  1KXL A;  2WIN B;  3H91 A;  3IFT A;  4N8X 1;  4H0L C;  1TS5 A;  4BBS B;  3ERQ A;  3HG9 A;  1S40 A;  1GUO A;  2F0N A;  5FO7 B;  5EKI A;  1EQQ A;  1STY A;  3W2D A;  4BY1 B;  2UXD Q;  1QVC A;  1BBX C;  1V43 A;  2GN5 A;  1Z6H A;  3PUZ A;  3WOF A;  1GO3 E;  1CI3 M;  4X66 Q;  3CAM A;  4XDX A;  4DV5 L;  2K5Q A;  1ZYR D;  4CJ2 C;  1Q12 A;  5DNF A;  2WAQ G;  1PYB A;  3R2I A;  1KRS A;  3ERS X;  5JPN C;  1IW7 C;  4IAL A;  3M7G A;  3NEN A;  2F52 A;  4DV7 Q;  1S5C D;  4HR7 B;  4DV2 L;  2R6G A;  1WD1 A;  1X3E A;  2HCC A;  2Z6K C;  1OXV A;  1SNC A;  2VY3 A;  2EPB A;  5FLM H;  1TR5 A;  1CKM A;  1DD2 A;  1IHZ A;  3H15 A;  3RN2 A;  2K52 A;  2ENB A;  5COY A;  3L7Z C;  1NY4 A;  2VQF L;  1B7Y B;  1NR2 A;  2KHS A;  2XIW A;  3T51 B;  1DGS A;  1VQ4 A;  4K5X A;  1LTA D;  3MWY W;  5LHY 1;  2IX0 A;  4K5W A;  3HOV H;  1L2F A;  5IWA L;  2UUA Q;  3I3C A;  1KLU D;  5JJI A;  2PPB C;  4J6H A;  1NNX A;  4A3C G;  2WP8 J;  3ND9 A;  1P16 A;  3GV3 A;  1ESF A;  3S1N H;  1B4O A;  3T16 A;  5JAV A;  4JI5 Q;  2B8G A;  5FKA C;  4LAA A;  4A3B H;  1LYL A;  1VQD A;  1K83 H;  3U4V A;  1J9O A;  3J81 i;  4LF5 L;  2VS1 A;  4YCV A;  1PYS B;  1S5D D;  3A8I E;  4GS3 A;  4XTC S;  3D0F A;  3GTL B;  3RN5 A;  2EXD A;  1UE7 A;  3R8B A;  5ELN A;  2HDL A;  1L0W A;  1PZI D;  1KC8 C;  5KNC A;  2CVR A;  2F4V Q;  1XJV A;  2N55 A;  1O7I A;  4KKU A;  4A3E G;  5C4X B;  1AEX A;  4X64 Q;  1NE3 A;  3S2D B;  2ZJQ A;  2A6H C;  1EU3 A;  3BDL A;  5E7N A;  4HN7 A;  1U4L A;  5HGQ A;  2E76 C;  2BH8 A;  3OIP A;  2K1B A;  4DUZ L;  2NVY H;  2VXW A;  1HFG A;  4KMU C;  4UHV A;  3GTQ H;  4K2L A;  2Y0S B;  1W2B A;  1UNS A;  3BZK A;  3UE0 A;  1SSO A;  4MNO A;  1SR3 A;  1HNW Q;  5T1I A;  3HOY G;  1MSH A;  1ILQ A;  3CP0 A;  3OOC A;  2V4D A;  1EOV A;  1GUW A;  1QNU A;  1RF2 D;  5GAE C;  4DV3 L;  4J8Q A;  1R9T H;  2H4O A;  2K32 A;  2K28 A;  1PMR A;  3FKI B;  3J81 c;  1YIT A;  1EIF A;  3SK5 A;  3NUC A;  4V19 0;  4I65 A;  3I56 A;  4C1N I;  3VDY A;  4N9P A;  3AB9 A;  1X6O A;  1N34 L;  2EY5 A;  4XYO A;  3CPW A;  3VR5 A;  1A3V A;  1RCV D;  2DGY A;  3I4N G;  1X3P A;  4RKB A;  3CC2 A;  1QUQ B;  1QVG A;  1EY0 A;  1HNZ Q;  2K5V A;  2KVM A;  4H02 A;  1IYJ B;  2WII B;  2WKD A;  1CSP A;  2ICI A;  1K73 C;  1PFM A;  1MSG A;  2NWG A;  1F9R A;  3MFY A;  5EKL A;  4BXX H;  2UXB Q;  1R4P B;  1HTP A;  3A74 A;  2HQE A;  4B3S Q;  4F87 A;  1XMO L;  1X3Q A;  3SE0 A;  3HOU B;  3PSI A;  3GD7 A;  2NZ1 D;  5IP9 G;  1SRU A;  4ZUJ A;  2PO4 A;  1PVO A;  3CKI B;  1ILP A;  4JBJ A;  2EIF A;  1BO0 A;  2F0J A;  3MC0 B;  1HTL D;  5C5L A;  4YIJ A;  2C5C A;  1WOC A;  5C0X H;  2R92 H;  1GUT A;  3O13 A;  2YU9 H;  4X3U A;  1FNU A;  2Y0S E;  3K58 A;  2DJF C;  2GA4 B;  2I5L X;  1BCP C;  2M2L A;  2JYO A;  3SK8 A;  3BDO A;  3URY A;  3S16 H;  3A5U A;  2A68 C;  2E2J H;  3MA2 B;  2K5N A;  2JA7 H;  1VCI A;  2K50 A;  1EY4 A;  4M1U B;  5C44 G;  2PMZ B;  2I5H A;  2B2T A;  1B70 B;  1YJ9 A;  3NE5 B;  2IHE A;  5DAU A;  4HCE A;  4IJH A;  1SFO H;  1WCM G;  1PDQ A;  4A3L G;  3CCR A;  2NVQ B;  3T4A C;  4PV1 C;  2F0K A;  3J7A 5;  3OIQ A;  4G57 A;  5IYB H;  1B8A A;  1LT5 D;  1JIC A;  4FF1 A;  1PH2 A;  4PNY A;  3D4W A;  2JA6 G;  3J81 E;  4GLX A;  2AUK A;  5F2D A;  4BBR G;  2Q2T A;  1I50 B;  4FVM A;  2OT2 A;  1J6Q A;  1STB A;  3V2T A;  2UU9 Q;  3MEH A;  3J7A F;  1PZJ D;  1CUK A;  1D8L A;  2F0U A;  2JN4 A;  2OEO A;  1NSN S;  2CW0 C;  2VW9 A;  1E2W A;  2CH4 W;  4DN4 M;  4IPD A;  2WAC A;  1FNV A;  3J81 L;  2B2U A;  1GKH A;  3KLW A;  4LF7 Q;  1E3P A;  1A6X A;  4JI3 L;  1KAA A;  2L15 A;  2AQ1 B;  2B8F A;  4YWM A;  4Q5V A;  4A93 G;  3S1R H;  4Z9C B;  1STH A;  4CDD C;  4NDX A;  3UDG A;  1PH8 A;  1C8C A;  1HZA A;  1F9P A;  5FO8 B;  4DAP A;  2JP1 A;  3PO3 G;  3M3Y B;  4GNX A;  4OWW B;  1PTO C;  4GKJ Q;  2PMZ E;  4A3F B;  1HZC A;  2Z6B A;  2D9U A;  1N8R C;  3VA5 A;  1VQ5 A;  1BVS A;  2V1C C;  4XT1 B;  1ZXT A;  3TZU A;  1BCP B;  2Q2H A;  3A7L A;  4C3I H;  4XXE A;  4KHV A;  3GTM B;  4QCL A;  5BR8 Q;  3VA7 A;  1EYG A;  4BBS G;  4OEM B;  4YHH L;  2YV5 A;  3FPP A;  5M5X B;  3MXG A;  4BY1 G;  4A3C H;  2R93 H;  1SNM A;  1HA5 A;  1BOS A;  1VQH A;  2UXD L;  4C3J B;  4IPG A;  2RCF A;  4ABN A;  1NR4 A;  2IY5 B;  4GN5 A;  2G9H D;  1EIH A;  3GTO H;  4L5R C;  4X66 L;  1V9P A;  3X3N A;  1QCB D;  3KUP A;  1PRT D;  1NMG A;  4A76 A;  2PCF B;  2RHQ B;  1C9O A;  1ZKO A;  2L55 A;  2H5X A;  4B9W A;  2N88 A;  3TZD A;  1SE8 A;  5I6W A;  1Q82 C;  4ME3 A;  4BY7 H;  3CQZ H;  1SBB B;  2D2C C;  3M7N A;  2MHV A;  1I4X A;  1ENC A;  2ATW A;  1DXM A;  1AE2 A;  4F8M A;  4DV7 L;  2GVA A;  2KCC A;  3E9I A;  4RH6 A;  1QWY A;  1K8M A;  3DMU A;  4JCV E;  1JOO A;  1WYD A;  4A3E H;  4J15 A;  3J7A V;  3CCS A;  1KLG D;  3I73 A;  1SMY D;  2AQ3 B;  2K33 A;  1XPO A;  3G6J B;  2EJM A;  1I5F A;  1JWU D;  2JK8 A;  1YNJ C;  5TSS A;  2B63 B;  1KDA A;  4HMJ A;  1L1O B;  3D6C A;  4AYB B;  3CCE A;  4A75 A;  3H94 A;  5CV4 A;  2EYL A;  4DNR B;  3FRP B;  1MHW C;  1HJP A;  5JPM C;  1NMF A;  3NSW A;  2B2Y C;  1MGS A;  3KDF A;  1BR9 A;  4KY7 A;  1LAB A;  2I0Q A;  1PFB A;  1JWS D;  3C2P A;  3K81 C;  4WFN 3;  5C3E B;  1FD7 D;  4V0B A;  1O80 A;  1I6H H;  1RKN A;  3H3V C;  3BVM A;  1LTL A;  2NN6 I;  4G7H C;  1Y1V B;  1ONL A;  2ZTC A;  3H09 A;  3JAM i;  1EWI A;  1XPR A;  1TXY A;  5DM7 3;  4HSV A;  1WTR A;  4AH6 A;  1FVI A;  1Q90 A;  2F4V L;  5C4X G;  3DWA A;  1KD1 C;  1VDZ A;  3CCL A;  4X64 L;  2FFK B;  3RNU A;  5C4J B;  1O7L A;  3LNN A;  1SXT A;  2F4I A;  1FNW A;  1H9R A;  4HJ8 A;  3I2Z A;  4DXF A;  4PMC A;  3H3V H;  4HID A;  2Y0S G;  4DR7 Q;  5C4H A;  1N9W A;  5D3D A;  3RZO H;  3ICE A;  3R93 A;  4JG2 A;  4ZRZ A;  3RLO A;  2I07 B;  1PH9 A;  1SYD A;  1A2U A;  2LFN A;  5A35 A;  4RA8 A;  3K5N A;  3HGB A;  3DHQ A;  4HED A;  4HIO A;  2K7V A;  1HNW L;  4DNT B;  3GTG H;  4X65 Q;  4FXG C;  3FKI G;  1Z7T A;  1E7Z A;  1QG7 A;  4A3D H;  1KNE A;  4LUO A;  3F2U A;  3IFD A;  4BWG B;  4DFA A;  1LM0 A;  4A3L H;  1ASZ A;  3P75 A;  4L5S A;  3JAM c;  3VYT A;  3M4P A;  3AFQ A;  4LF4 Q;  1HNZ L;  1PV4 A;  1C0A A;  4UY8 C;  3OSO A;  2JA6 H;  4MZ9 A;  4BBR H;  2F0F A;  2UXB L;  3HOU G;  4WJ4 A;  2EOT A;  1CHP D;  2B29 A;  2XWJ B;  3S15 H;  3IL8 A;  4ODG A;  1SE4 A;  4B3T Q;  3C46 A;  2JA8 B;  1G6P A;  1GHK A;  2MPM A;  1OXX K;  1HR0 Q;  1VQ8 A;  4KN7 C;  2IJ0 A;  4JVZ A;  2ZM6 L;  2MO0 A;  3TP7 A;  2BE5 C;  1SJH D;  1TWG H;  4WOR A;  2Z4I A;  4N8F A;  3S1M B;  2DNC A;  1DCZ A;  2KED A;  1JJ2 A;  1ICF B;  1K8G A;  2ZT9 C;  1U9R A;  3D6W A;  1H9M A;  2N49 A;  4A93 H;  1U4M A;  1HZB A;  2EYH A;  5CV7 A;  2JA9 A;  3H0G B;  2F0Q A;  3DXJ C;  4QL5 A;  2X6G A;  2VZA A;  1W6K A;  4WJ3 M;  3F2C A;  2A1A A;  2EY6 A;  3PO3 H;  1A3T A;  3MXN A;  3FDT A;  3STB C;  2R7Z G;  3TP8 A;  3K7A H;  2GVB A;  4P72 A;  3GTK H;  3V96 A;  2IW3 A;  4EX5 A;  3CCJ A;  2IL8 A;  4R1J A;  4PQX A;  2L9H A;  1W6J A;  3CD6 A;  5C3X A;  4BBS H;  1YVC A;  3RZD H;  3HOX B;  2D0O A;  1RHP A;  2RDF A;  3Q6S A;  3OYY A;  4PZ7 A;  4CDC C;  1Q46 A;  4HCS A;  1A0I A;  3HZX A;  5EQ0 A;  2UU9 L;  1S3O A;  5I2X A;  4C56 C;  2R7F A;  2F03 A;  3DEO A;  3C1E A;  5EKK A;  1KL9 A;  3JAM E;  2XNA C;  4K5V A;  3HOW B;  1AFP A;  1U0L A;  3X3M A;  4LF7 L;  1Q8K A;  1UE1 A;  2RQX A;  1I4H A;  3S2H B;  1EZ8 A;  1PHJ A;  3NXW A;  4QGU A;  1NTG A;  3JAM L;  4X6A H;  2KHI A;  1XNR Q;  5I4D A;  1EYA A;  1K9M C;  5NUC A;  4XQJ A;  4GNX B;  4JI2 L;  1WVL A;  1T9H A;  2XVS A;  4A3F G;  3E0J A;  3AYH B;  4GKJ L;  1TS2 A;  2Z9H A;  2EY2 A;  2QDB A;  4L5T A;  4R8N A;  1QE6 A;  1G2S A;  1W3S A;  2FIN B;  2NZH A;  1EY7 A;  1H9S A;  3RUZ A;  2KQ3 A;  5K5P A;  1L0Y B;  4OXP A;  2BDO A;  3KF8 A;  3CF5 A;  3WWV A;  2F0S A;  1Q81 C;  3I70 A;  3QOL A;  1BF4 A;  3H6M A;  4C3H B;  5BR8 L;  2F0L A;  3AMU A;  1QZH A;  1SJE D;  4IZ8 A;  1I3Q H;  3WDN A;  4DAM A;  4JBK A;  5CV5 A;  5D65 A;  4C3J G;  2NTT A;  4R9W A;  2XGT A;  3HKZ B;  3G71 A;  1HA6 A;  4U67 3;  5JJZ A;  3P7J A;  4DF7 A;  4ID6 A;  5LMU L;  1MI2 A;  2WV6 D;  4POG A;  2HT1 A;  5KGU A;  4A3K B;  2R3Z A;  4R8I A;  1LT3 D;  3CME A;  1CM9 A;  4JV5 Q;  3OW2 A;  1QVF A;  3GTL H;  1IYU A;  1EWC A;  5EBD A;  1OO9 B;  2KUM A;  2E8G A;  3CCQ A;  3DM1 A;  1PZK D;  3N52 A;  3MTS A;  3S2D H;  2PW5 A;  2EYP A;  1QJO A;  4ZAI A;  2Q2I A;  4X3S A;  2KCT A;  1NAP A;  2I46 A;  2QDL A;  2B63 G;  4XYQ A;  4AYB G;  3TBI B;  4KHP Q;  5IT9 L;  5ELC A;  1XTD A;  1I4P A;  5C4Z A;  2B2V C;  1TWC B;  2OTL A;  1XMQ Q;  2AMC B;  1GJX A;  3EQL C;  3HRZ C;  4FF4 A;  2CCZ A;  3IKJ A;  3K5O A;  2SDF A;  3HFZ B;  1STA A;  2HQL A;  3EN2 A;  3HKZ E;  2A6E D;  4QIW B;  5C3E G;  4LF8 Q;  3E9H A;  1EYD A;  4BA2 I;  3FKI H;  1XXG A;  4RHS A;  2ES2 A;  2JE6 I;  2NTS A;  1PTO F;  3J81 j;  1Y1V G;  4HMI A;  4DNI A;  3T53 B;  3I4L A;  4LJZ C;  4GN3 B;  4OIJ A;  2PI2 A;  4DA2 A;  2ZJP A;  3TP6 A;  1AW7 A;  1JMC A;  2MP1 A;  3QWN A;  1D1I A;  1VMP A;  3GDE A;  1E0B A;  3EFX D;  3GO5 A;  1LTS D;  5GAD C;  2UXC Q;  1PH5 A;  1G29 1;  3PQI A;  3TRE A;  3UDF A;  4DAY A;  5KEE A;  2MQH A;  2VL6 A;  4IPC A;  2LXK A;  3GTJ B;  4DV4 Q;  1UEB A;  2BH2 A;  4PG3 A;  3OTO Q;  2L12 A;  4CKC A;  1Y8O B;  4RCO A;  3VR4 A;  3W5O A;  1X55 A;  4Y7N B;  1PH6 A;  5A2Q E;  1IBM Q;  2L1B A;  3PIO 3;  5BN4 A;  3SXH A;  5I2Y A;  4DR7 L;  2A69 D;  1SYB A;  1XTC D;  2E5L Q;  3UE1 A;  1X32 A;  2X6L A;  5M5Y H;  3PF4 A;  1EY6 A;  1OXU A;  1PRT C;  1UE6 A;  2WKC A;  3PUY A;  3T1Y Q;  4J1M A;  4G7Z C;  5A2Q L;  2OTJ A;  2NZO A;  3CRK C;  4KY6 A;  2F0P A;  1JOK A;  4HIM A;  5KIX A;  4X65 L;  3VYR A;  2PZT A;  2K75 A;  4GOP A;  4QIW E;  1SAP A;  1KNA A;  1TY0 A;  1KQS A;  2A8V A;  2N78 A;  2FJ2 A;  3S17 H;  1VQI A;  2Q8R E;  4RWS C;  5LMN Q;  2NVQ H;  4XIG S;  3SR1 A;  2VNU D;  4KD3 A;  4GN4 B;  4PZ8 A;  3TDQ A;  2F3W A;  4LF4 L;  1WTO A;  3V05 A;  4M8A A;  3HOZ B;  4Y52 H;  5ELF A;  1I50 H;  2JA8 G;  2NVT H;  1JOQ A;  2PZU A;  1K8A C;  1RD9 D;  4DU9 A;  2K6A A;  2HHH L;  3GP7 A;  4KJO A;  2F0T A;  2F0G A;  1E2Z A;  3K7U C;  1YHQ A;  4IFD I;  1LV9 A;  2NVY B;  5BN5 A;  1BDO A;  4IUN A;  3G6E A;  4JI4 Q;  2B2W A;  1WI5 A;  4RHR A;  4RGN A;  4K8J A;  1DJR D;  1OTC A;  1Y1W B;  5J3B A;  4A3J B;  3I8Z A;  1VQ6 A;  1K28 A;  3EJI A;  4CDF C;  4DPG A;  5G3L F;  2R7Z B;  3H0G G;  4X3K A;  3HS0 C;  5L37 A;  5E4X A;  4EQN A;  2QCP X;  4K8I A;  4NMZ A;  1N32 Q;  2AWO A;  4RFB A;  3M3Y H;  2EJG C;  3MXN B;  4LFA Q;  1B3Q A;  4DR6 Q;  1BXT A;  1IW7 D;  4HJA A;  4LF6 Q;  1HQM C;  3SK4 A;  3GTP B;  1E1T A;  5FK9 C;  3M85 A;  3AU7 A;  3KFU A;  1VQP A;  4OO1 G;  1PRT B;  3U50 C;  4A3G B;  1TT2 A;  5IYD G;  1WTQ A;  1IKM A;  3GTM H;  1HQR D;  3BYT B;  3D3R A;  3HOX G;  3E0E A;  2KJX A;  2JXM B;  3J7Y W;  2AKW B;  3A5Z B;  5CYU A;  5M5W B;  2Q8T A;  3QOJ A;  2OCE A;  1AH9 A;  4TSS A;  4C3J H;  3BS1 A;  2PW7 A;  5DEH A;  1C7Y A;  1KIX A;  1IL2 A;  1EFI D;  1VMC A;  1D5Z C;  4GKK Q;  1B9M A;  4DUY Q;  1KTK A;  1PXU A;  3HOW G;  4L8J A;  1L1O C;  2CQO A;  4R4T A;  2YU9 B;  1I4G A;  2DY7 A;  2EYF A;  3C1F A;  4L6T B;  1JT8 A;  3L3O C;  2R61 A;  5KYI A;  2EDG A;  1YJN A;  1TQO A;  1B9N A;  5FJ8 G;  1QZG A;  5IGB A;  2JA7 B;  1CKO A;  1XNR L;  4ZK9 B;  4F7X A;  3AQQ A;  4CKB A;  4NP5 A;  1O7Z A;  2C9O A;  4DK3 C;  1F2L A;  5M9O A;  1HUM A;  4C1N K;  3I7F A;  2N3S A;  5DLQ E;  1I4Q A;  4R4I A;  4EVO A;  1H9S B;  5EJW A;  1Z47 A;  2KBN A;  3KF8 B;  3KOJ A;  3QIA A;  3ULP A;  3TME A;  3PO2 B;  2Z1C A;  3PGZ A;  2E2H H;  4C3H G;  1EFW A;  2A6H D;  2VB2 X;  2XTI A;  1G51 A;  2E2I B;  4IN3 A;  2HIX A;  1LLR D;  1ET6 A;  1H9K A;  5H1S E;  1YNN D;  1WTW A;  1CHQ D;  4LUZ A;  1PTO H;  2YYZ A;  2YTV A;  4DR1 Q;  1ICW A;  1SLJ A;  1X3F A;  3I72 A;  3MXP A;  3QJY A;  2RVL A;  1E2V A;  4FO2 A;  4ZCK A;  4CHT B;  1JB7 A;  2NBF A;  3HKZ G;  2F0W A;  2EYM A;  5IYC G;  4ZLT F;  3BDC A;  2SEB D;  1BKB A;  5C3E H;  4ZQ3 A;  4A3K G;  3M9B A;  4OEL B;  3DEP A;  1K0S A;  2LSS A;  1WJJ A;  3PUX A;  1ASY A;  1DZ1 A;  4JV5 L;  1WTH A;  4HSP A;  1BUV T;  2IWH A;  1ESR A;  5IIF A;  4A3I B;  4FXD A;  4DV2 Q;  1FGB D;  4DK1 A;  1VQN A;  2OXP A;  3ULL A;  4ALP A;  4R4C A;  2VUM B;  1K0R A;  1B2T A;  1S72 A;  3FPU B;  4AQY Q;  3A8J E;  2IX1 A;  1JCK B;  3NTH A;  1CA5 A;  4CBV A;  1EEF D;  2RDH A;  1TWF H;  1Y8N B;  2L0C A;  2NUC A;  5C4J H;  1KHI A;  4MIU A;  2J7Z A;  4IUV A;  2UUA L;  2AQ2 B;  1CKN A;  4A3M B;  2KEC A;  3NTK A;  4C3I B;  1CZW A;  4NB3 A;  4CJ1 B;  4K2K A;  3VR6 A;  5IWA Q;  5JJK A;  4DAV A;  4JI5 L;  3HOY H;  5CBA E;  4NW2 A;  1LT6 D;  1XNQ Q;  4MTN A;  1XMQ L;  4JBW A;  1Q7Y C;  5EGT A;  1M4V A;  2FHT A;  2K5W A;  3I4M B;  1B3A A;  2D62 A;  1T5E A;  3PIO A;  4LF5 Q;  3NBH A;  3CRL C;  1U5K A;  1YJW A;  3KBG A;  3A54 A;  3BZD B;  4RGM A;  4LF8 L;  3I4N H;  1PLF A;  4QUF A;  2VQE Q;  5JJL A;  2A68 D;  2ZXP A;  4UP8 A;  2EZV A;  4UAI A;  4JI7 Q;  2WB1 B;  1BBW A;  3TQY A;  4BY7 B;  1EIY B;  3W3A A;  4O2D A;  1KAB A;  3SHL A;  2EYJ A;  1SRO A;  2CQA A;  3L9A X;  4IJL A;  1B50 A;  4CJ0 B;  5C0X I;  5IP9 H;  2EVB A;  2Z0S A;  2UXC L;  1LTG D;  3K5L A;  4DR5 Q;  3ND8 A;  4QY7 A;  2TSS A;  2CWP A;  1AP0 A;  2JA8 H;  4AYB E;  3I4O A;  4DV4 L;  1SDF A;  4RAU C;  5D14 A;  1G91 A;  3OTO L;  3MVV A;  4DUZ Q;  1ZYR C;  3PMF A;  4H13 C;  2D0P A;  1KDC A;  1TII D;  1IBM L;  1LTR D;  3DM3 A;  3Q22 A;  1Q3L A;  5EPL A;  5I9P A;  3F2D A;  3CC4 A;  2Z6K A;  2E5L L;  3U58 A;  3IAY A;  2CW0 D;  4DR3 Q;  5C44 H;  1WTV A;  2MGS A;  2TMP A;  1V1Q A;  3T1Y L;  4GZY C;  4JI1 Q;  2KCN A;  5IY0 A;  1F9S A;  1WCM H;  4E6I A;  4KKS A;  4GOP B;  1SE3 A;  1C48 A;  1H95 A;  2NB0 A;  1EL0 A;  1I6H B;  3M4O B;  5EAY A;  1GHJ A;  1TWA B;  5CGK A;  1KAW A;  3RLN A;  2EE1 A;  5E3F A;  2Z8L A;  3P1H A;  2PI2 E;  3JC6 6;  3NEL A;  2WB1 E;  3NWT A;  1XPU A;  4OO1 H;  4HTH A;  5LMN L;  2O2L D;  1PTO D;  3M4Q A;  5IYD H;  4B3S L;  4MN3 A;  1XYI A;  3NHH A;  2F0I A;  3HOZ G;  2KOL A;  2LMC B;  2B2V A;  3PIP 3;  1VQJ A;  3OWF A;  1P8L A;  1GM5 A;  1IBK Q;  4JK1 C;  2J0T D;  3S9W A;  4GNX C;  2CFM A;  1XMO Q;  3KJO A;  2KEE A;  2KHJ A;  1BQQ T;  1LTI D;  4JOI C;  5FO9 B;  1G8Z D;  1B53 A;  1YEZ A;  3WOE A;  3F1Z A;  1TWH B;  1S4Z A;  5CBE E;  1PA6 A;  3MFG A;  4CDE C;  5M3F B;  5GRO A;  1YI2 A;  1K8O A;  3C3L A;  1V8Q A;  2PQA A;  4P71 A;  3HOW H;  2HD3 A;  4JI4 L;  4ME5 A;  5BN3 A;  3TP5 A;  4PMB A;  1Y1W G;  4DR4 Q;  4A3J G;  2F0H A;  1IYV A;  4JI6 Q;  4XQQ A;  5KND A;  4KD4 A;  3Q23 A;  2EJF C;  5FJ8 H;  3U4Z A;  1VQF A;  1I4R A;  1UEA B;  1SMX A;  4APV A;  1N32 L;  4B3R Q;  4LFA L;  4DR6 L;  1FR3 A;  5ELO A;  3ZJY C;  3QO2 A;  4A3D B;  4LF6 L;  1T5X D;  2J4X A;  3BG3 A;  2AHO B;  1IBL Q;  4WRD A;  1EY5 A;  3KJP A;  1M1K C;  1STG A;  1LT4 D;  4OIK A;  5AJ3 Q;  4A3G G;  4TQU S;  4JI0 Q;  3TEH B;  1CTM A;  4BY1 H;  1JB3 A;  2NN6 G;  4NXM Q;  2FXQ A;  3TSS A;  4C3H H;  4JPB W;  2QA4 A;  1A2T A;  2LKV A;  2R7D A;  1VS0 A;  2K5D A;  2ZXO A;  2JEA I;  4K6D A;  3KLS X;  2Q2U A;  4MHE A;  2PZW A;  2MO1 A;  2K04 A;  3S15 B;  5IT9 c;  3KYH C;  1PYW D;  4PZ6 A;  2E74 C;  2RBM A;  5ELB A;  4CKE A;  3HKS A;  4FF2 A;  3S1Q B;  1GUN A;  4QUC A;  5ISR A;  4P2C B;  4GKK L;  5IYC H;  4DUY L;  2ZXR A;  4EQO A;  4A3K H;  4LWC A;  4KI0 A;  1EEI D;  2DUD A;  3L0O A;  4G4K A;  1JWM D;  4HAE A;  5EPJ A;  4YCW A;  1CZG A;  4DGZ A;  5I9O A;  3NBI A;  3VYU A;  1WD0 A;  3PF5 A;  2VB3 X;  1C4Q A;  2JA7 G;  2QKI C;  2RHS B;  3K5M A;  4TRD A;  2NVX B;  1EOT A;  4L5Q A;  1EY8 A;  1IXR A;  3CW2 C;  3GQB A;  2ZJR A;  1X54 A;  3J7Z C;  5J39 A;  3I91 A;  5G3L D;  2RSN A;  3SEB A;  3K7A B;  1PH4 A;  3PO2 G;  1VQE A;  3CCU A;  1WTX A;  5IYB G;  4DR2 Q;  1RL2 A;  2A5H A;  3NWS A;  1BCP F;  2IT1 A;  4YHH Q;  3RZD B;  3K59 A;  3PCO B;  1GXD C;  1PH3 A;  1TWC H;  1NJI C;  2E2D C;  1UE5 A;  4RCN A;  4RGO S;  3RLF A;  1XWE A;  2XN9 C;  4JYA Q;  4C2M B;  2E75 C;  4DR1 L;  2QEX A;  3GV6 A;  2Q8I B;  1CT1 D;  2ALY B;  2RCN A;  4HJ9 A;  1D5M C;  4GLA C;  3EVQ A;  1EQT A;  4EQ5 A;  1TS4 A;  1A15 A;  1PFS A;  4XQN A;  4IPH A;  2AUJ D;  1J5E Q;  3E6Z X;  1AZQ A;  4NXN Q;  1PH1 A;  2F0E A;  3VR2 A;  4P73 A;  3M4Y A;  1QNK A;  3Q8D A;  2JA5 B;  4IO9 A;  4A3I G;  5IT9 E;  2LY7 A;  1TY2 A;  5C4X H;  2B3G A;  3K80 C;  4OWT B;  3TS2 A;  4KJN A;  3H3V I;  3PUV A;  2MNA A;  1II3 A;  3K0Y A;  4YY3 Q;  3UDX A;  3MEF A;  5M3M B;  2VUM G;  4RKL A;  4ZKC B;  2IHF A;  1RTN A;  3DWP A;  1X9N A;  4WJW A;  1N36 Q;  4FNF A;  2PNH A;  4AQY L;  3SDZ A;  1DOK A;  2F0V A;  5KNB A;  1AE3 A;  3S14 B;  1FJG Q;  2CKZ B;  1VQG A;  2EXZ A;  1STE A;  4XT3 B;  3GTJ H;  1MJE A;  3PUW A;  1CKN B;  4A3M G;  3AFP A;  4C3I G;  1VQO A;  4Y7N H;  1L1O A;  4KV6 A;  2EY1 A;  1I6V C;  3KDF B;  4H7B A;  4LFC Q;  1CK1 A;  1I3Q B;  1U4R A;  1YBY A;  2R93 G;  2K4K A;  4QB4 A;  1XNQ L;  3A8K E;  2O4X A;  3R2T A;  2BE5 D;  3RD4 A;  3I4M G;  3NBH B;  1VF5 C;  1ZEQ X;  5IOC A;  1MKH A;  4KLK A;  1HXY D;  4OO1 I;  2CH4 A;  2F3V A;  1IL8 A;  2IPK D;  5EBC A;  4KKT A;  3U9S A;  1B1Z A;  2VQE L;  4NKL A;  3W1B A;  3I55 A;  1VQK A;  2WB1 G;  4BY7 G;  5CMD A;  4JI7 L;  2CWA A;  1I94 Q;  5JEA G;  2OF1 A;  2MFI A;  3DWQ A;  1DON A;  4EGV A;  4AIM A;  3STB D;  1MJC A;  3HOU H;  4ULL A;  4FYD A;  2RA4 A;  2JSO A;  4POF A;  4FXK C;  5JEA J;  3HOZ H;  1M90 C;  1CA6 A;  4DR5 L;  5E4W C;  5CC4 A;  1PH7 A;  3S24 A;  2AWN A;  3HOV B;  1YNN C;  3EA6 A;  5IGD A;  4LFB Q;  2RKS A;  1LUZ A;  1WTP A;  3CC7 A;  3PIP A;  4K0K Q;  3S1N B;  3CPF A;  4A3B B;  5IP7 G;  1K83 B;  4F88 A;  2RSO A;  3K0X A;  2MUY A;  2K01 A;  4R4Q A;  1Y1W H;  3B6Y A;  2SNM A;  4A3J H;  4U68 A;  1HNX Q;  4L63 B;  3D4D A;  4DR3 L;  4FP5 D;  5JVG 3;  2R7Z H;  1A8V A;  4JI1 L;  3KF6 A;  1SYG A;  4DV0 Q;  1QB5 D;  3SVM A;  4JI8 Q;  2UUC Q;  3MZ5 A;  4H44 C;  3TRZ A;  1A63 A;  3NEM A;  4JW0 A;  4JBM A;  1SMY C;  4ZKB B;  4MTK A;  1R4Q B;  4I7A A;  3GTP H;  1V1O A;  3K6O A;  1JOR A;  1OXS C;  4IOA A;  1Y69 U;  1JQY D;  1HUN A;  1Z9F A;  5HGT A;  2ICE C;  1DOL A;  4A3G H;  1BBU A;  4UP7 A;  5IE8 A;  1EZ6 A;  2B2Y A;  4LF9 Q;  1J8I A;  4OGQ C;  4QF4 A;  2NN6 H;  1ML0 D;  4B3T L;  1MBY A;  1U4P A;  5C5M A;  4DV6 Q;  1HR0 L;  1IBK L;  1PFN A;  1Y14 B;  5C3W A;  5I6Y A;  5M5W H;  1G2T A;  3G7L A;  3W1G A;  3A55 A;  3GTQ B;  3A56 A;  4X3T A;  3NP8 A;  3ZYY X;  4O42 A;  1FYC A;  3D4R A;  2ZM6 Q;  1BNZ A;  2XRQ D;  1CSQ A;  5J1Z A;  2HUG A;  5M3F G;  3OW7 A;  2PQA B;  2PYK A;  5K36 G;  4S3S A;  3TS0 A;  3FMC A;  4TVA B;  1N33 Q;  2MJ8 A;  1ROD A;  5M5Y B;  1YHB A;  1LO5 D;  3KLR A;  4DR4 L;  1D7Q A;  5COR A;  1R9T B;  1EIG A;  3J80 i;  3T1H Q;  3KBX A;  3U9O A;  4JI6 L;  4B3M Q;  2P5Z X;  3HP3 A;  4DV1 Q;  4A3F H;  4X62 Q;  3Q0A A;  1YIJ A;  3CU7 A;  3CHB D;  3G48 A;  1JJC B;  3NK9 A;  3OWE B;  1VQ9 A;  1G6Z A;  2N8N A;  4A3D G;  4B3R L;  2H1E A;  4K6L A;  5CV8 A;  5AFW A;  3D8G A;  3ONA B;  4UP9 A;  1IBL L;  3S17 B;  5IGC A;  3R3O A;  1L0X B;  5EPK A;  2XRS D;  1M8A A;  2KA7 A;  5AJ3 L;  2HCI A;  3PO2 H;  4BS9 A;  5M5X H;  1D2B A;  4JI0 L;  1D6E C;  3BYY B;  2BDN A;  4BA1 I;  4NXM L;  5LMN W;  2E2I H;  3BZC A;  2A73 B;  5ELD A;  4ILW A;  2JQO A;  1YHA A;  4B9X A;  2NVT B;  4LMQ D;  1ET9 A;  3QB3 A;  2QF7 A;  3PV0 A;  2R92 B;  4IQZ A;  5GAH C;  1V1P A;  2L11 A;  3EIV A;  1SNQ A;  3LX0 A;  1K3R A;  3S16 B;  4OX9 Q;  1VQM A;  2E2J B;  2JJQ A;  4IUT A;  5IGF A;  2UUB Q;  1UAP A;  2K5H A;  3FVQ A;  1UUP A;  4A3I H;  3OPO A;  4LNQ A;  4P74 A;  3J80 c;  1F2M A;  1SFO B;  1F77 A;  4JI2 Q;  5ELE A;  1VQ7 A;  2VUM H;  3I90 A;  1ENF A;  1RIP A;  2RDG A;  2B63 H;  2K05 A;  2O5J C;  4JOI A;  1ENA A;  4QQB X;  3FHW A;  3LWU A;  2BA0 A;  3KLS A;  1XX8 A;  5C6A A;  2BOS A;  4A3M H;  4DR2 L;  1TVX A;  2I5M X;  4FF3 A;  2M00 A;  3D31 A;  5HUR A;  1TU2 B;  2SOB A;  5GQO A;  3ERO A;  1RDP D;  1VQB A;  3MAQ A;  3ITP A;  4DV5 Q;  4YWL A;  1WFQ A;  4QMG A;  2G5D A;  1SYE A;  4ZUI A;  1E22 A;  4JYA L;  3RR5 A;  4B08 A;  2WAQ B;  3I4M H;  1EYC A;  1HHV A;  5LMU Q;  3BJU A;  4O0A A;  1Y1V H;  4KN4 C;  1D1K A;  2K03 A;  3S1R B;  3T13 A;  5IGG A;  3L2P A;  4LK1 C;  3EBE A;  1CFM A;  4RG1 A;  4NXN L;  1LTB D;  1J5E L;  4OL7 A;  1HFN A;  1SEB D;  4IFD G;  3SGI A;  2JA5 G;  3QG1 A;  5LL6 S;  1NCV A;  2L5T A;  2LS0 1;  1HPC A;  1JR0 D;  5JEA H;  4IFD J;  1NBW A;  1Q1E A;  4CGY B;  5M3M G;  1VF7 A;  5DM6 3;  1TKW B;  4YY3 L;  2VQF Q;  1LTT D;  1N36 L;  3E5S A;  3SK6 A;  4YWK A;  4O1N A;  4GOP C;  1Q8I A;  2PQE A;  1MIU A;  1HH2 P;  4GLV B;  1FJG L;  4KHP L;  3HEJ A;  2ID0 A;  4DK6 C;  3MXU A;  3TN2 A;  1JE4 A;  1K3B C;  1HZ9 A;  4P75 A;  1YNX A;  2R93 B;  1FGU A;  3J80 E;  2E2H B;  2G9D A;  1DM0 B;  1Q86 C;  1D5X C;  4HJ7 A;  4LFC L;  5IP7 H;  5CR3 A;  1KDB A;  1X65 A;  3VR3 A;  3BU2 A;  2YTX A;  1PTO B;  3GTO B;  2BCO A;  5CV9 A;  3MHB A;  4OON A;  1QOH A;  4N9T A;  1BCP D;  3FEW X;  1VQC A;  3J80 L;  3K8A A;  2ASB A;  5T1G A;  2EQS A;  4I7Z C;  2WAQ E;  3CQZ B;  2O5I C;  4PMW A;  2C35 B;  4G7O C;  2B2W C;  3M4O H;  4FDB A;  1TWA H;  1EUJ A;  1JJG A;  5KYL A;  5FLX c;  3Q24 A;  1MD2 D;  4DAY B;  3KK7 A;  5FLM G;  4A3E B;  3RMH A;  2B2T C;  4RMF A;  1JE5 A;  1I94 L;  1X56 A;  2QGQ A;  3BVG A;  3CCV A;  1GOZ A;  1O78 A;  1O7Y A;  1SE2 A;  1B44 D;  3HOV G;  3S1M H;  4DKA C;  1EY9 A;  1TWF B;  1NUC A;  1GVP A;  1TWH H;  1SYC A;  2DNE A;  4LFB L;  3T56 B;  2F1M A;  1EU4 A;  3NPP A;  4A4I A; 
#chains in the Genus database with same CATH homology
 1A3U A;  2QEJ C;  3HOY B;  2XSC A;  5K36 H;  4K14 A;  1JC7 A;  2L4N A;  1AN8 A;  2FMC A;  2SNS A;  1S5E D;  5JVH 3;  3VYS A;  3K57 A;  2B2U C;  4IUQ A;  1QIL A;  5FOB B;  4TKO B;  5E1F A;  1EWH A;  1HCZ A;  1SYF A;  1RTO A;  1Q1B A;  1GUS A;  2Z4H A;  3I4N B;  1AZP A;  2DN8 A;  1S5F D;  2BA1 A;  3LWE A;  1EQV A;  1F2Z A;  1STN A;  3NTI A;  1CQV A;  5LL6 X;  1DOM A;  2XWB B;  2PNR C;  5IGE A;  1Y8P B;  4IUP A;  2X69 A;  2F0M A;  5FLX E;  5JOB A;  2D5D A;  1CQF A;  3RZO B;  2A6E C;  1SNO A;  2EYO A;  5D3I B;  5J22 A;  3GTG B;  1S5B D;  5FLX L;  5C44 B;  2IX3 A;  1TS3 A;  2M9V A;  4Q0F A;  1GUG A;  2DY8 A;  1WCM B;  5CV6 A;  1H9J A;  1IKL A;  4DXG A;  1SND A;  5IOD A;  1F2Y A;  3OMG A;  3DUZ A;  2CHB D;  3UI2 A;  4RGT A;  4IUU A;  2JA6 B;  2B39 A;  2F0D A;  4BBR B;  4KK7 A;  1HRJ A;  2JEB I;  1YNJ D;  4OHJ A;  2A69 C;  1PRT F;  3N6R A;  3BVZ A;  3P20 A;  1DYQ A;  3NQI A;  4KHZ A;  1TWG B;  5C0X G;  4ZYS A;  1V1P B;  4KY5 A;  2A74 C;  4EQP A;  3NQT A;  1OXT A;  1SNP A;  2HDM A;  4DK0 A;  5C0X J;  4A93 B;  3OHX C;  4KTA A;  2F0O A;  4IFD H;  3PO3 B;  2QIL A;  3OMC A;  5KRU A;  1F9Q A;  4UDU C;  3GTK B;  4IUR A;  1LAC A;  3A7A B;  2NYZ D;  2FMM A;  1RJT A;  2WIN B;  3H91 A;  3IFT A;  4H0L C;  1TS5 A;  4BBS B;  3ERQ A;  3HG9 A;  1GUO A;  2F0N A;  5FO7 B;  5EKI A;  1STY A;  3W2D A;  4BY1 B;  1BBX C;  1V43 A;  1Z6H A;  3WOF A;  3PUZ A;  1CI3 M;  4XDX A;  2K5Q A;  1ZYR D;  4CJ2 C;  1Q12 A;  5DNF A;  3R2I A;  5JPN C;  1IW7 C;  4IAL A;  3M7G A;  1S5C D;  4HR7 B;  2R6G A;  1WD1 A;  2HCC A;  1OXV A;  1SNC A;  2EPB A;  1TR5 A;  1DD2 A;  1IHZ A;  2ENB A;  5COY A;  3L7Z C;  1NR2 A;  2KHS A;  2XIW A;  3T51 B;  4K5X A;  1LTA D;  3MWY W;  5LHY 1;  2IX0 A;  4K5W A;  3I3C A;  1KLU D;  2PPB C;  4J6H A;  2WP8 J;  3ND9 A;  3GV3 A;  1ESF A;  1B4O A;  3T16 A;  5JAV A;  2B8G A;  5FKA C;  4LAA A;  1J9O A;  1S5D D;  3A8I E;  4XTC S;  3GTL B;  3R8B A;  2HDL A;  1PZI D;  5KNC A;  2CVR A;  2N55 A;  4KKU A;  5C4X B;  1AEX A;  3S2D B;  2A6H C;  1EU3 A;  3BDL A;  4HN7 A;  1U4L A;  2E76 C;  3OIP A;  2K1B A;  2VXW A;  1HFG A;  4KMU C;  4K2L A;  2Y0S B;  1UNS A;  1SSO A;  5T1I A;  1MSH A;  1ILQ A;  3OOC A;  2V4D A;  1GUW A;  1QNU A;  1RF2 D;  4J8Q A;  2H4O A;  2K32 A;  2K28 A;  1PMR A;  3FKI B;  3SK5 A;  3NUC A;  4V19 0;  4I65 A;  4C1N I;  4N9P A;  3AB9 A;  2EY5 A;  4XYO A;  3VR5 A;  1A3V A;  1RCV D;  1X3P A;  4RKB A;  1EY0 A;  2KVM A;  2WII B;  2WKD A;  2ICI A;  1PFM A;  1MSG A;  2NWG A;  1F9R A;  3MFY A;  5EKL A;  1R4P B;  1HTP A;  2HQE A;  4F87 A;  1X3Q A;  3SE0 A;  3HOU B;  3GD7 A;  2NZ1 D;  4ZUJ A;  2PO4 A;  3CKI B;  1ILP A;  1BO0 A;  2F0J A;  3MC0 B;  1HTL D;  5C5L A;  4YIJ A;  2C5C A;  5C0X H;  1GUT A;  3O13 A;  4X3U A;  1FNU A;  3K58 A;  2GA4 B;  1BCP C;  2M2L A;  2JYO A;  3SK8 A;  3BDO A;  3URY A;  2A68 C;  3MA2 B;  1VCI A;  1EY4 A;  4M1U B;  2PMZ B;  2B2T A;  3NE5 B;  5DAU A;  4HCE A;  1PDQ A;  2NVQ B;  3T4A C;  4PV1 C;  2F0K A;  3OIQ A;  4G57 A;  1LT5 D;  1JIC A;  4FF1 A;  4PNY A;  3D4W A;  3J81 E;  2AUK A;  5F2D A;  1I50 B;  4FVM A;  2OT2 A;  1STB A;  3V2T A;  3MEH A;  3J7A F;  1PZJ D;  2F0U A;  2OEO A;  1NSN S;  2CW0 C;  1E2W A;  4DN4 M;  2WAC A;  1FNV A;  3J81 L;  2B2U A;  1A6X A;  1KAA A;  2AQ1 B;  2B8F A;  4Q5V A;  4Z9C B;  1STH A;  4NDX A;  1C8C A;  1F9P A;  5FO8 B;  4DAP A;  2JP1 A;  3M3Y B;  1PTO C;  4A3F B;  2D9U A;  3VA5 A;  4XT1 B;  1ZXT A;  3TZU A;  1BCP B;  3A7L A;  4XXE A;  4KHV A;  3GTM B;  4QCL A;  3VA7 A;  3FPP A;  5M5X B;  3MXG A;  1SNM A;  1HA5 A;  1BOS A;  4C3J B;  4ABN A;  1NR4 A;  2G9H D;  1EIH A;  3X3N A;  1QCB D;  3KUP A;  1PRT D;  2PCF B;  1ZKO A;  2L55 A;  4B9W A;  2N88 A;  3TZD A;  5I6W A;  1SBB B;  2D2C C;  3M7N A;  2MHV A;  1I4X A;  1ENC A;  1DXM A;  4F8M A;  2KCC A;  4RH6 A;  1QWY A;  1K8M A;  3DMU A;  1JOO A;  3J7A V;  1KLG D;  3I73 A;  1SMY D;  2AQ3 B;  2K33 A;  3G6J B;  2EJM A;  1JWU D;  1YNJ C;  5TSS A;  2B63 B;  1KDA A;  4HMJ A;  3D6C A;  4AYB B;  3H94 A;  5CV4 A;  2EYL A;  4DNR B;  3FRP B;  5JPM C;  3NSW A;  2B2Y C;  1MGS A;  1BR9 A;  4KY7 A;  1LAB A;  1PFB A;  1JWS D;  3C2P A;  4WFN 3;  5C3E B;  1FD7 D;  4V0B A;  1O80 A;  1RKN A;  3H3V C;  3BVM A;  2NN6 I;  4G7H C;  1Y1V B;  1ONL A;  3H09 A;  5DM7 3;  4HSV A;  1WTR A;  1Q90 A;  3DWA A;  1VDZ A;  2FFK B;  5C4J B;  1O7L A;  3LNN A;  1SXT A;  2F4I A;  1FNW A;  1H9R A;  4DXF A;  4PMC A;  5C4H A;  5D3D A;  3R93 A;  4ZRZ A;  2I07 B;  1SYD A;  1A2U A;  2LFN A;  5A35 A;  4RA8 A;  3K5N A;  3HGB A;  3DHQ A;  4HED A;  2K7V A;  4DNT B;  4FXG C;  1Z7T A;  1QG7 A;  1KNE A;  3F2U A;  3IFD A;  4BWG B;  4DFA A;  3P75 A;  3VYT A;  3OSO A;  2F0F A;  2EOT A;  1CHP D;  2XWJ B;  3IL8 A;  4ODG A;  1SE4 A;  3C46 A;  2JA8 B;  1GHK A;  2MPM A;  1OXX K;  4KN7 C;  2IJ0 A;  3TP7 A;  2BE5 C;  1SJH D;  4WOR A;  2Z4I A;  3S1M B;  2DNC A;  1DCZ A;  2KED A;  2ZT9 C;  1U9R A;  3D6W A;  1H9M A;  1U4M A;  2EYH A;  5CV7 A;  3H0G B;  2F0Q A;  3DXJ C;  2X6G A;  1W6K A;  2EY6 A;  1A3T A;  3MXN A;  3FDT A;  3TP8 A;  3V96 A;  2IW3 A;  2IL8 A;  4PQX A;  2L9H A;  1W6J A;  5C3X A;  3HOX B;  1RHP A;  2RDF A;  3Q6S A;  4HCS A;  3HZX A;  5EQ0 A;  5I2X A;  4C56 C;  2F03 A;  3DEO A;  3C1E A;  5EKK A;  3JAM E;  2XNA C;  4K5V A;  3HOW B;  1AFP A;  3X3M A;  2RQX A;  1I4H A;  3S2H B;  1EZ8 A;  3NXW A;  3JAM L;  5I4D A;  1EYA A;  5NUC A;  4XQJ A;  1WVL A;  2XVS A;  3E0J A;  1TS2 A;  2EY2 A;  2QDB A;  4R8N A;  1QE6 A;  1G2S A;  2FIN B;  1EY7 A;  1H9S A;  3RUZ A;  2KQ3 A;  5K5P A;  1L0Y B;  2BDO A;  3KF8 A;  2F0S A;  3I70 A;  3QOL A;  1BF4 A;  3H6M A;  4C3H B;  2F0L A;  3AMU A;  1SJE D;  4IZ8 A;  3WDN A;  5CV5 A;  5D65 A;  4C3J G;  2NTT A;  4R9W A;  3HKZ B;  1HA6 A;  4U67 3;  5JJZ A;  3P7J A;  4DF7 A;  4ID6 A;  1MI2 A;  2WV6 D;  5KGU A;  4A3K B;  2R3Z A;  4R8I A;  1LT3 D;  1CM9 A;  1IYU A;  1EWC A;  5EBD A;  1OO9 B;  2KUM A;  3DM1 A;  1PZK D;  3N52 A;  3MTS A;  2PW5 A;  2EYP A;  1QJO A;  4ZAI A;  4X3S A;  1NAP A;  2I46 A;  4XYQ A;  3TBI B;  5IT9 L;  5ELC A;  1I4P A;  5C4Z A;  2B2V C;  1TWC B;  1GJX A;  3EQL C;  3HRZ C;  4FF4 A;  3IKJ A;  3K5O A;  2SDF A;  1STA A;  2A6E D;  4QIW B;  1EYD A;  4BA2 I;  1XXG A;  4RHS A;  2JE6 I;  2NTS A;  1PTO F;  4HMI A;  3T53 B;  3I4L A;  4LJZ C;  4OIJ A;  4DA2 A;  3TP6 A;  1AW7 A;  2MP1 A;  3QWN A;  1D1I A;  1VMP A;  1E0B A;  3EFX D;  3GO5 A;  1LTS D;  1G29 1;  4DAY A;  5KEE A;  3GTJ B;  2L12 A;  4CKC A;  1Y8O B;  4RCO A;  3VR4 A;  4Y7N B;  5A2Q E;  2L1B A;  3PIO 3;  5BN4 A;  3SXH A;  5I2Y A;  2A69 D;  1SYB A;  1XTC D;  1X32 A;  2X6L A;  1EY6 A;  1OXU A;  1PRT C;  2WKC A;  3PUY A;  4J1M A;  4G7Z C;  5A2Q L;  3CRK C;  4KY6 A;  2F0P A;  1JOK A;  5KIX A;  3VYR A;  2PZT A;  1SAP A;  1KNA A;  1TY0 A;  2FJ2 A;  2Q8R E;  4RWS C;  4XIG S;  3SR1 A;  2VNU D;  4KD3 A;  3TDQ A;  2F3W A;  1WTO A;  3V05 A;  4M8A A;  3HOZ B;  5ELF A;  1JOQ A;  2PZU A;  1RD9 D;  4DU9 A;  2K6A A;  3GP7 A;  2F0T A;  2F0G A;  1E2Z A;  4IFD I;  1LV9 A;  2NVY B;  5BN5 A;  1BDO A;  4IUN A;  2B2W A;  4RHR A;  4RGN A;  4K8J A;  1DJR D;  1Y1W B;  4A3J B;  3I8Z A;  3EJI A;  5G3L F;  2R7Z B;  4X3K A;  3HS0 C;  5E4X A;  4EQN A;  2QCP X;  4K8I A;  4NMZ A;  2AWO A;  4RFB A;  2EJG C;  1BXT A;  1IW7 D;  1HQM C;  3SK4 A;  3GTP B;  5FK9 C;  3M85 A;  3AU7 A;  4OO1 G;  1PRT B;  4A3G B;  1TT2 A;  1WTQ A;  1IKM A;  1HQR D;  3BYT B;  3D3R A;  2KJX A;  2JXM B;  3J7Y W;  5CYU A;  5M5W B;  2Q8T A;  3QOJ A;  4TSS A;  3BS1 A;  2PW7 A;  5DEH A;  1EFI D;  1VMC A;  1D5Z C;  1B9M A;  1KTK A;  1PXU A;  4L8J A;  2YU9 B;  1I4G A;  2DY7 A;  2EYF A;  3C1F A;  4L6T B;  3L3O C;  2R61 A;  5KYI A;  2EDG A;  1TQO A;  1B9N A;  5IGB A;  2JA7 B;  4ZK9 B;  4F7X A;  4CKB A;  4NP5 A;  1O7Z A;  2C9O A;  1F2L A;  5M9O A;  1HUM A;  4C1N K;  1I4Q A;  4EVO A;  1H9S B;  5EJW A;  1Z47 A;  3QIA A;  3TME A;  3PO2 B;  2Z1C A;  4C3H G;  2A6H D;  2VB2 X;  2E2I B;  4IN3 A;  1LLR D;  1ET6 A;  1H9K A;  1YNN D;  1WTW A;  1CHQ D;  1PTO H;  2YYZ A;  1ICW A;  3MXP A;  3I72 A;  3QJY A;  2RVL A;  1E2V A;  4FO2 A;  4CHT B;  2NBF A;  2F0W A;  2EYM A;  4ZLT F;  3BDC A;  2SEB D;  4ZQ3 A;  3DEP A;  3PUX A;  1DZ1 A;  4HSP A;  1BUV T;  2IWH A;  1ESR A;  5IIF A;  4A3I B;  4FXD A;  1FGB D;  4DK1 A;  2OXP A;  2VUM B;  1B2T A;  3FPU B;  3A8J E;  2IX1 A;  1JCK B;  3NTH A;  1CA5 A;  4CBV A;  1EEF D;  2RDH A;  1Y8N B;  2L0C A;  2NUC A;  4MIU A;  2J7Z A;  4IUV A;  2AQ2 B;  4A3M B;  2KEC A;  3NTK A;  4C3I B;  1CZW A;  4CJ1 B;  4K2K A;  3VR6 A;  4DAV A;  5CBA E;  4NW2 A;  1LT6 D;  4JBW A;  5EGT A;  1M4V A;  2FHT A;  2K5W A;  3I4M B;  1B3A A;  2D62 A;  1T5E A;  3NBH A;  3CRL C;  3KBG A;  3A54 A;  3BZD B;  4RGM A;  1PLF A;  4QUF A;  2A68 D;  2ZXP A;  2EZV A;  4UAI A;  2WB1 B;  4BY7 B;  3W3A A;  1KAB A;  3SHL A;  2EYJ A;  2CQA A;  3L9A X;  1B50 A;  4CJ0 B;  5C0X I;  2EVB A;  1LTG D;  3K5L A;  3ND8 A;  2TSS A;  1AP0 A;  1SDF A;  4RAU C;  5D14 A;  1G91 A;  3MVV A;  1ZYR C;  3PMF A;  4H13 C;  1KDC A;  1TII D;  1LTR D;  3Q22 A;  1Q3L A;  5EPL A;  5I9P A;  3IAY A;  2CW0 D;  1WTV A;  2MGS A;  2TMP A;  4GZY C;  2KCN A;  1F9S A;  4E6I A;  4KKS A;  1SE3 A;  1C48 A;  2NB0 A;  1EL0 A;  1I6H B;  3M4O B;  1GHJ A;  1TWA B;  5CGK A;  2EE1 A;  5E3F A;  2Z8L A;  3P1H A;  3NWT A;  4OO1 H;  4HTH A;  2O2L D;  1PTO D;  4MN3 A;  1XYI A;  3NHH A;  2F0I A;  2KOL A;  2LMC B;  2B2V A;  3PIP 3;  3OWF A;  4JK1 C;  2J0T D;  3S9W A;  2KEE A;  1BQQ T;  1LTI D;  5FO9 B;  1G8Z D;  1B53 A;  3WOE A;  1TWH B;  1S4Z A;  5CBE E;  3MFG A;  5M3F B;  1K8O A;  3C3L A;  1V8Q A;  4ME5 A;  5BN3 A;  3TP5 A;  4PMB A;  2F0H A;  1IYV A;  4XQQ A;  5KND A;  4KD4 A;  3Q23 A;  2EJF C;  1I4R A;  1UEA B;  1FR3 A;  3QO2 A;  4A3D B;  1T5X D;  2J4X A;  3BG3 A;  4WRD A;  1EY5 A;  1STG A;  4OIK A;  1LT4 D;  4TQU S;  1CTM A;  1JB3 A;  2NN6 G;  3TSS A;  1A2T A;  2LKV A;  2ZXO A;  2K5D A;  2JEA I;  4K6D A;  3KLS X;  4MHE A;  2PZW A;  2K04 A;  3S15 B;  1PYW D;  2E74 C;  2RBM A;  5ELB A;  4CKE A;  4FF2 A;  3S1Q B;  1GUN A;  4QUC A;  5ISR A;  4P2C B;  2ZXR A;  4EQO A;  4KI0 A;  1EEI D;  4G4K A;  1JWM D;  4HAE A;  5EPJ A;  1CZG A;  4DGZ A;  5I9O A;  3NBI A;  3VYU A;  1WD0 A;  2VB3 X;  1C4Q A;  2QKI C;  3K5M A;  4TRD A;  2NVX B;  1EOT A;  1EY8 A;  3GQB A;  5J39 A;  3I91 A;  5G3L D;  2RSN A;  3SEB A;  3K7A B;  1WTX A;  2A5H A;  3NWS A;  1BCP F;  2IT1 A;  3RZD B;  3K59 A;  1GXD C;  2E2D C;  4RCN A;  4RGO S;  3RLF A;  1XWE A;  2XN9 C;  4C2M B;  2E75 C;  3GV6 A;  2Q8I B;  1CT1 D;  1D5M C;  3EVQ A;  1EQT A;  1TS4 A;  1A15 A;  4XQN A;  2AUJ D;  3E6Z X;  1AZQ A;  2F0E A;  3VR2 A;  3M4Y A;  1QNK A;  2JA5 B;  5IT9 E;  2LY7 A;  1TY2 A;  4KJN A;  3PUV A;  1II3 A;  3K0Y A;  5M3M B;  4RKL A;  4ZKC B;  1RTN A;  3DWP A;  4WJW A;  4FNF A;  3SDZ A;  1DOK A;  2F0V A;  5KNB A;  3S14 B;  2EXZ A;  1STE A;  4XT3 B;  3PUW A;  4C3I G;  4KV6 A;  2EY1 A;  1I6V C;  4H7B A;  1CK1 A;  1I3Q B;  1U4R A;  4QB4 A;  3A8K E;  2O4X A;  3R2T A;  2BE5 D;  3RD4 A;  1VF5 C;  1ZEQ X;  5IOC A;  1HXY D;  4OO1 I;  2F3V A;  1IL8 A;  2IPK D;  5EBC A;  4KKT A;  3U9S A;  1B1Z A;  4NKL A;  5CMD A;  5JEA G;  2OF1 A;  3DWQ A;  1DON A;  4EGV A;  4FYD A;  4ULL A;  2RA4 A;  2JSO A;  4FXK C;  5JEA J;  1CA6 A;  5E4W C;  5CC4 A;  2AWN A;  3HOV B;  1YNN C;  3EA6 A;  5IGD A;  2RKS A;  1WTP A;  3S1N B;  4A3B B;  1K83 B;  4F88 A;  2RSO A;  2MUY A;  2K01 A;  2SNM A;  4U68 A;  4L63 B;  3D4D A;  4FP5 D;  5JVG 3;  3NPP A;  1SYG A;  1QB5 D;  3SVM A;  3MZ5 A;  4H44 C;  1SMY C;  4ZKB B;  1R4Q B;  1V1O A;  3K6O A;  1JOR A;  1OXS C;  1Y69 U;  1JQY D;  1HUN A;  5HGT A;  2ICE C;  1DOL A;  1EZ6 A;  2B2Y A;  1J8I A;  4OGQ C;  4QF4 A;  2NN6 H;  1ML0 D;  1MBY A;  1U4P A;  5C5M A;  1PFN A;  5C3W A;  5I6Y A;  1G2T A;  3G7L A;  3A55 A;  3GTQ B;  3A56 A;  4X3T A;  3NP8 A;  3ZYY X;  4O42 A;  1FYC A;  3D4R A;  1BNZ A;  2XRQ D;  5J1Z A;  2HUG A;  3OW7 A;  2PYK A;  5K36 G;  4S3S A;  3FMC A;  2MJ8 A;  1ROD A;  5M5Y B;  1LO5 D;  3KLR A;  5COR A;  1R9T B;  1EIG A;  3KBX A;  3U9O A;  3HP3 A;  3Q0A A;  3CU7 A;  3CHB D;  3NK9 A;  3OWE B;  1G6Z A;  2H1E A;  4K6L A;  5CV8 A;  5AFW A;  3D8G A;  3ONA B;  3S17 B;  5IGC A;  3R3O A;  1L0X B;  5EPK A;  2XRS D;  1M8A A;  2KA7 A;  2HCI A;  4BS9 A;  1D2B A;  1D6E C;  3BYY B;  2BDN A;  4BA1 I;  2A73 B;  5ELD A;  4ILW A;  4B9X A;  2NVT B;  4LMQ D;  1ET9 A;  3QB3 A;  2QF7 A;  3PV0 A;  2R92 B;  4IQZ A;  1V1P A;  2L11 A;  1SNQ A;  3LX0 A;  3S16 B;  2E2J B;  4IUT A;  5IGF A;  1UAP A;  3FVQ A;  1UUP A;  3OPO A;  1F2M A;  1SFO B;  1F77 A;  5ELE A;  3I90 A;  1ENF A;  2RDG A;  2K05 A;  2O5J C;  1ENA A;  3LWU A;  2BA0 A;  3KLS A;  1XX8 A;  5C6A A;  2BOS A;  1TVX A;  4FF3 A;  2M00 A;  3D31 A;  5HUR A;  1TU2 B;  2SOB A;  3ERO A;  1RDP D;  3MAQ A;  3ITP A;  4QMG A;  1SYE A;  4ZUI A;  4B08 A;  2WAQ B;  1HHV A;  1EYC A;  4KN4 C;  1D1K A;  2K03 A;  3S1R B;  3T13 A;  5IGG A;  4LK1 C;  1CFM A;  1LTB D;  4OL7 A;  1HFN A;  1SEB D;  4IFD G;  3QG1 A;  5LL6 S;  1NCV A;  2L5T A;  2LS0 1;  1HPC A;  1JR0 D;  5JEA H;  4IFD J;  4CGY B;  1Q1E A;  1VF7 A;  5DM6 3;  1TKW B;  1LTT D;  3E5S A;  3SK6 A;  4O1N A;  1Q8I A;  2PQE A;  3HEJ A;  2ID0 A;  3MXU A;  3TN2 A;  1JE4 A;  2R93 B;  3J80 E;  2E2H B;  2G9D A;  1DM0 B;  1D5X C;  5CR3 A;  1KDB A;  3VR3 A;  1PTO B;  3GTO B;  2BCO A;  5CV9 A;  3MHB A;  1QOH A;  4N9T A;  1BCP D;  3FEW X;  3J80 L;  5T1G A;  4I7Z C;  3CQZ B;  2O5I C;  4PMW A;  4G7O C;  2B2W C;  5KYL A;  3Q24 A;  1MD2 D;  3KK7 A;  4A3E B;  3RMH A;  2B2T C;  3BVG A;  1GOZ A;  1O78 A;  1O7Y A;  1SE2 A;  1B44 D;  1EY9 A;  1TWF B;  1NUC A;  1SYC A;  2DNE A;  3T56 B;  2F1M A;  1EU4 A;  4KJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...