1LTEA

Structure of a legume lectin with an ordered n-linked carbohydrate in complex with lactose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNQSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKLLHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORAL TREE LECTIN
molecule tags Lectin
source organism Erythrina corallodendron
publication title Structure of a legume lectin with an ordered N-linked carbohydrate in complex with lactose.
pubmed rcsb
total genus 56
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1991-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lteA00
3FLRA 1UN1A 4XJ8A 1G9CA 1B09A 1ULDA 4YM1A 3B69A 2NYYA 1BQPA 2ZGMA 5GLTA 1MZ5A 3R4UA 1DBNA 4YW4A 1Q8PA 5IK8A 4BMBA 4Q8KA 1O4ZA 1GZWB 1WW6A 5JLVA 4YGEA 1G7YA 4XJAA 1JW6A 1JHNA 1LOAA 2A6WA 3POYA 1VALA 4SLIA 5SV8A 3SITA 4XJ9A 4BOWA 1SBFA 3ZPYA 1QF3A 4GALA 3WCRA 1AVBA 4ATFA 4C1WA 2OVUA 4BMEA 1IKPA 1BXHA 1GKBA 1N1TA 2DV9A 4FOYA 1LGNA 2YZ4A 3WUDA 2DYCA 1IKQA 1BJQA 1W6OA 4PQ9A 2UWAA 4FPHA 4Y22B 1MS0A 4Q2FA 4LBKA 5T54A 3ZXKA 1AX2A 1AZDA 4AVVA 4AGVA 3NV3A 4AGGA 2DVBA 2DUQA 1WBLA 2ZGOA 1VAMA 2XG3A 1URXA 2D3RA 4FOWA 3HMYA 5GLUA 1ENSA 1G86A 1LHUA 2A6ZA 4XJUA 1LGBA 2EXHA 1SBDA 2W39A 3WCSA 1FV3A 2E7QA 1QDCA 3BTAA 3B00A 2WQZC 3ZSMA 5IT6A 3AYDA 2ZKNA 3WV6A 1LU2A 2DTWA 4YGBA 1FNYA 5AVAA 3U4XA 5E8AA 2JDZA 4TYSA 3WDUA 3RS6A 3OBRA 1HQWA 2A3WA 2CL2A 2DWRA 2ZBJA 1S1AA 1DIWA 2ZHKA 3FBYA 3WG4A 4TZDA 1W0PA 2UWBA 2R16A 5DZFA 3ZXLA 5DG2A 2DVDA 2RHPA 3WNXA 4FPYA 2A3YA 4M3CA 1YIFA 2V5YA 1AJKA 2ZAAA 4YFWA 3C2UA 2A3XA 2D44A 3R4SA 1W6QA 3UJQA 1LU1A 4HANA 2JE7A 4XILA 1SACA 2E6VA 2XB6C 4FQZA 3ZSKA 4PF5A 3O0WA 4YW2A 4M3CB 3RMXA 3MW3A 1EPWA 1NLSA 2P37A 3BOPA 3ZSLA 3ZYRA 4Y24A 2AH2A 4YGDA 5EYYA 1AF9A 3TB0A 4K1ZA 4Z8BA 3M3QA 3IN9A 4FP2A 4LBQB 3AP7A 1JN2P 1IS6A 2DUOA 4YZ4A 5F5QA 5L73A 3USUA 4DFSA 3WUCA 4YW5A 4XZPA 4LBLA 2ZGPA 2D6OX 2DVAA 4Q1RA 1DLLA 4CRQA 2R49A 4M00A 4DQAA 4HL0A 1O4YA 4XXPA 1CIWA 3AK0A 3ZYPA 3AZWA 4I30A 4M01A 1A3KA 1UZZA 1I3HA 1DQ4A 1V6LA 4XOGA 2P2KA 4LBOA 3WDWA 4AVTA 1FYUA 1HDKA 3AP6A 1S0CA 3B01A 4YM2A 1KJRA 1FAYA 2WLQA 5GZCA 2B7YA 4XJZA 1C1FA 1TEIA 2NMNA 3B9CA 1SLIA 4XYXA 4ZXKA 4YM3A 1G9DA 4YG6A 2SBAA 1LULA 4GKYA 1QDOA 1SCRA 3M3OA 1N47A 5T5LA 1DYPA 1LCLA 1F5FA 3IPVA 1G9AA 3ZXJA 5GM0A 4FQ4A 1V6IA 5KXDA 2JECA 2P3JA 3LSEA 2GNBA 1AX1A 2VH9A 2ZGKA 3RRDA 2DURA 3UL2A 3SH3A 2G4IA 2YXSA 3FLPA 1DQ6A 3WDXA 2KM2A 2YROA 3NWKA 2YY1A 3QLQA 4JCKA 1WLCA 4Y1UA 5BYNA 2A7AA 3UJOA 4L8QA 4Q8LA 1JUIA 1N3QA 3FUQA 2GNTA 1YI7A 5JDBA 3UK9A 5KXBA 1S0EA 1GNZA 3OJBA 4NOTA 5IK4A 4WVWA 3FFZA 3SNMA 1ENQA 1FX5A 2VW0A 1N1SA 1WW5A 1DQ1A 4BM8A 3N7JA 1VLNA 2UURA 1V00A 5E88A 3WG2A 1SLAA 3VKFC 2GN3A 3AJYA 1V6MA 1MS3A 2ZA9A 1W6QB 2EIGA 3VV1A 1QOOA 4ISRA 4Y1YA 3NV1A 3JU9A 5GJ6A 4YM0A 5JVVA 1Q8QA 1SLCA 4AVSA 1LECA 3DUIA 4AYUA 2NZ9A 3M2MA 3V0BB 2BQPA 2AENA 1H30A 1WD3A 5IK5A 1LOBA 4Y26A 2ERFA 1WCSA 3I8TA 3MW4A 4P9WA 3WG3A 3RMYA 1SFYA 1V6OA 2A75A 3N3HA 2JE9A 3LSDA 4XTPA 1ZA4A 3SISA 1LJ7A 3O0XA 1JBCA 3POSA 4BQ1A 3ILRA 1CPMA 1MS5A 3PJQA 3N35A 1C4RA 1CESA 3PVEA 5KXCA 1AX0A 1CJPA 4BLJA 3H0OA 1CN1A 2ZGUA 3ATGA 2W68A 1OQ1A 3ILNA 4YGCA 1PZ8A 5T5PA 1LHNA 4DRVA 3A0KA 4GKXA 2WKKA 1GICA 3CNAA 2D6PA 2GN7A 1DGLA 4BPZA 5JMCA 1IOAA 3KQRA 1WBFA 3V64A 5HCFA 5GZDA 1APNA 4Q26A 4K1YA 2D6NA 2TEPA 1C57A 2ZGLA 4M3CF 1S0GA 2LTNA 1LENA 4XIKA 3A4UA 2DTYA 1F31A 2A70A 2WJSA 4FPKA 3NV4A 1R1ZA 4XMIA 3VKNA 1WW4A 2CY6A 1RITA 2WSVA 1LEMA 3AXEA 5JOYA 3WDYA 4CZSA 2A6YA 1BKZA 4LBNA 3HN1A 4Y1VA 3VKMA 2ENRA 1Z0HA 3MPPG 1VAVA 3VUOA 2EF6A 4XBLA 5CBLA 4XBNA 2PHWA 4YG0A 1DYKA 3AFKA 1GSLA 3WG1A 1GZ9A 5LK5A 1U0AA 1A8DA 3PVOA 2I2SA 1JXNA 4FPCA 4YZ1A 1IS3A 2W08A 1D0HA 3V0AA 2UU8A 2UWCA 4XTMA 3GALA 1AJOA 4XXAA 4UW3A 1N3OA 1D2SA 5H9SA 1LTEA 4XIOA 3T2TA 5DUUA 3M3EA 3AP5A 2DU1A 1A78A 1LOGA 2D7FA 1ULEA 1WW7A 1YRZA 3WDVA 4JRAA 2FHRA 2ZGNA 5GZFA 1GBGA 2ZHNA 3OYWA 1Q56A 3SLIA 1W0OA 1Y7BA 3FLTA 3QCWA 4PBPA 1W6NA 2GNMA 3OPZA 2ZGRA 1YYNA 1DQ2A 2Q5TA 2GMMA 4U36A 1DFQA 1GV9A 1JYCA 5H9RA 2AYHA 1H9WA 1WD4A 1Q8SA 1ZM1A 4UW5A 2NN8A 4YLZA 2CTVA 3TAYA 3OYWB 3AYEA 2AR6A 1LGCA 1N1YA 5EXOA 2E7TA 4LBQA 3W59A 3AX4A 2A71A 2PHUA 3A0NA 4AGRA 2VY0A 2ARBA 3M3CA 4Y1XA 2OUHA 3D4KA 4FP3A 3WOGA 4YFZA 1SCSA 4ISQA 3AZYA 2EXJA 2CWMA 1WUVA 2R0HA 3D5OA 4D69A 5FREA 1LOEA 1G8WA 1UL9A 3O12A 5DZEA 1HLCA 3O5SA 4DRRA 1DHKB 1SLLA 2JJ6A 3AZXA 3AZZA 1GNHA 4XHXA 5DZGA 4UW6A 1GZWA 1C1LA 3AZVA 5GLZA 2ZGSA 3PVNA 5T5OA 3AXDA 2ZACA 1QKQA 2R1BA 2VW2A 4DS0A 5CAZA 3OGGA 5IUQA 4R9AA 4ASMB 1N1VA 2PHTA 5T52A 1HKDA 4FOVA 1CPNA 4K21A 3FUOA 4U2AA 2EXIA 2WT0A 4YW1A 3RQ0A 2DUPA 1BZWA 1LODA 2VUAA 2ZABA 1ENRA 2P34A 1PZ9A 4CTEA 3IPVB 1ULCA 1W6OB 4Y22A 1MVEA 4GXLA 4FVVA 1LHVA 2YMZA 2PHFA 2JKBA 3POWA 4FPGA 2EXKA 2LALA 4XE9A 1DQ0A 4GWNA 1Z78A 3AYCA 1AXYA 5GALA 1MVQA 3ILFA 5H9PA 1KJLA 4XMAA 1RINA 2DVFA 1V6KA 2NMOA 2SLIA 4W65A 1S0JA 3V65A 5GZEA 1V6JA 2ZGTA 2AREA 5T50A 1MZ6A 5GLVA 2OW4A 1MR5A 4M3CE 1MS8A 1MS9A 3HR9A 1FATA 2WT1A 4XJWA 3IKWA 5T55A 1SLBA 4DPNA 4NO4A 5JOWA 1ULFA 2NP0A 1ULGA 1N3PA 2ZGQA 4P14A 5H9QA 5F9TA 2GMPA 3R05A 3W58A 1PZ7A 3AP9A 2A5ZA 2GNDA 5EYXA 4YW3A 3NV2A 1IS5A 2GDFA 4ZKTB 1BYHA 1DZQA 2ZMLA 4LBJA 2VU9A 3SH5A 4R9DA 5T5JA 2EALA 2VW1A 5HCBA 1UZYA 1MACA 3OY8A 1LOFC 4BLIA 1CR7A 1W6NB 2E53A 3OBTA 4GA9A 2D6LX 4WV8A 2WSUA 1S0IA 4KBBA 2P3IA 1KITA 2ZHLA 3N7LA 4UW4A 2V73A 3WDTA 5KXEA 2WNEA 1G9BA 3MEPA 2PHXA 3ZVXA 1HQLA 1RIRA 4FPEA 3JUUA 4MYEA 4RA0A 1LOCA 2W52A 3OY8B 2HYKA 3ASIA 4R9CA 1LHWA 1UKGA 4GWMA 3V0BA 1UAIA 3ZXFA 1V6NA 3ZXEA 2OUJA 2PELA 1H9PA 2JD4A 4FPOB 3T1LA 5DG1A 1UMZA 3GNEA 2D43A 3O0VA 4OZXA 5DUXA 3AJZA 3WLUA 1AXZA 1IS4A 5CNAA 4WZFA 1LHOA 2H0BA 1LEDA 4LBQD 3INAA 5CA6A 2R1DA 1GANA 3VKOA 1CONA 2EAKA 4YG3A 1I1EA 2CNAA 3ENRA 3PMEA 2ES3A 5JOZA 4R9BA 2D3SA 2WT2A 1QGLA 2E51A 2DU0A 2YV8A 1W6PA 2Z42A 3RG0A 3APBA 4JC1A 1Q8OA 1QNWA 4RL7A 1QNYA 2AUYA 4FOQA 4F83A 1OKQA 2R0FA 4YZ3A 3BODA 3WVJA 3WZ1A 3IM0A 1Q8VA 3LCPA 1FNZA 2FMDA 5DUVA 5GLWA 4PBOA 3N7MA 2VXRA 3AP4A 1W6PB 3M1HA 4FPFA 2A6XA 5JOXA 4AWDA 1WLDA 3DGTA 1CVNA 1ONAA 1VIWB 1UPSA 1XQNA 2CYFA 1KQRA 1YO8A 5E89A 2C5DA 1G9FA 1KRIA 2P3KA 1LOFA 4Q27A 2D6KA 1F9KA 2D6MA 4H55A 3D6EA 3T1MA 1DQ5A 2C9AA 3Q9OA 2GMEA 3RSJA 1QOTA 2D3PA 1YXWA 5HCAA 2DVGA 2ZMNA 3AYAA 1S0BA 3B3QE 4FPJA 4P9YA 3MW2A 1FV2A 1KDKA 5CB7A 3BIWE 4K20A 1S0FA 1MS4A 2ZHMA 1KDMA 4YZ5A 3WHUA 4Y20B 1QU0A 1JOJA 1CQ9A 1MS1A 5EWSA 1SLTA 4YZ2A 2ZMKA 3V0AB 5IK7A 1W6MA 1X50A 3KM5A 4ITCA 2A6VA 1OFSA 4IQPA 2ARXA 1S0DA 4XBQA 4XHBA 1SBEA 3I4IA 4Y20A 3WHTA 1GZCA 1QOSA 5GZGA 2NM1A 2ZZJA 4WVVA 1LESA 1NXD1 4P9XA 4XDQA 3VKLA 4C1XA 1JYIA 1QMJA 1W6MB 1UX6A 4Y1ZA 1J1TA 2AGSA 2GALA 4ATEA 4PCRA 3ZSJA 3USUB 4FPLA 3N7KA 3N36A 5FRAA 1AXKA 1WLWA 5DUWA 4LBMA 2CWSA 3SH4A 3L2YA 1GYKA 3IMNA 4Q1PA 1GLHA 2PHRA 5DXDA
chains in the Genus database with same CATH superfamily
2PHLA 1NQJA 3MZHA 3KQ4B 1PO13 4EZHA 1OUXA 1ULDA 2W94A 3AKTA 3UV9A 2NYYA 3WNKA 1YJLA 3AMMA 1QXJA 3GDBA 5IHRA 1MZ5A 1L7QA 1DBNA 4I09A 5D8AA 1Q8PA 5FPZA 4BU2A 5IK8A 2VOXA 1EV11 2VQAA 3MICA 3EO6A 3KS7A 4YGEA 1G7YA 1XE8A 3HWJA 4XJAA 1WMDA 3POYA 1VALA 4ASKA 4UXAA 2B5HA 1SBFA 1CAUB 1W8HA 1CX4A 1W06A 4RFT0 4KU8A 1D4M2 1OF4A 3ZYHA 1OH3A 4B4RA 3O1PA 2YDEA 4GALA 3WCRA 1HB2A 2JENA 2WZPP 2DV9A 1HV1A 4XFFA 1VRH3 2BW8A 3Q8EA 2WO7A 5AFBA 2FDIA 4SBVA 3MFCA 4Y22B 3MBWA 1L7LA 5J3UA 4Q2FA 1J3RA 5T54A 4AVVA 1R091 3HD8B 5EIYB 1OQEA 1VBE1 3HMYA 5GLUA 3GZTB 4N43C 1RHI3 1K12A 3NAPB 5CFCA 2EXHA 4TLFA 3AKQA 1KGYA 2E7QA 3BVCA 4KQ7A 1QDCA 5ERLA 4JKMA 2VZOA 1Q3EA 2J1EA 2ZKNA 3RWKX 3GXUA 5FO8B 1FNYA 1JYVA 2HWF2 5T3NA 3U4XA 5CFCB 1OXCA 3WT3A 2RMU3 3M8LA 3POEA 3BCWA 3OBRA 1ULOA 3M70A 5FFOC 5C8CC 4DUXA 5A3WA 5L7OC 2ZHKA 4QX1A 3JB4C 1NCQB 3KCXA 1EV12 2BOJA 2JIJA 1PGW1 4NWWA 1W0PA 2J1UA 4A45A 3ZMNA 4BE3A 1QY4A 3I59A 2BTVC 3WNXA 2BOIA 3RPQA 2VQTA 2MEV3 5CIRA 5K8SA 2BFUL 4IEWA 1J1LA 2JD9A 3PL0A 2A3XA 3SCFA 4EROA 2D44A 1R083 4XFAA 1AL21 3UJQA 4XFIA 1LU1A 5FMOL 4HANA 1W9SA 2K2SA 4HT1T 4MGYE 1SACA 2E6VA 4IV1B 3QH7A 5J7MA 4PF5A 3O0WA 1PVXA 1U5ZA 1YHFA 3RMXA 4BISA 2YGLA 1TVGA 3UYJA 3ZSLA 3HT1A 3W9AA 4NVPA 5FZ1A 3UGGA 3GYDA 1AF9A 5KWRA 1FPN2 4K1ZA 1W2AX 4PF1A 2JDPA 2IC1A 4DFSA 3ZR6A 2FDHA 5DQ0A 5A6YA 4LA2A 4Z2AA 1F15A 2ZGPA 4Q1RA 1AR61 1DLLA 4Y5Z0 2RM21 3U11A 4HL0A 1O4YA 4XXPA 4QXCA 2Y38A 1HB3A 5FZBA 4QMAA 3CJIA 4KMQA 4PDWA 3J7NA 5ACA1 3MIDA 4MGSA 4O65A 2GP5A 2VXJA 5LBBA 4XOGA 3FHQA 2Y6JA 4YW7A 3KD4A 3LDBA 1HRV3 4IE5A 3AP6A 3B01A 2XJSA 3SQOA 2VCCA 2WLQA 4LHNA 3DXUA 4WVZA 1MQTC 4NPRA 4BQ4A 4E4ZA 1TEIA 5C3SA 2NMNA 4XYXA 4YM3A 1G9DA 5EPAA 3THDA 4E8DA 4GKYA 4QQLA 3Q8BA 5DAPA 1XRUA 4AR2A 5FPVA 4RHV3 5FOJB 1VBE3 2WZR1 3MIHA 4RYDA 2XQRA 1BBT3 1F5FA 3IPVA 1B35A 1I5PA 1G9AA 4K6BA 2XDVA 1Z7S1 4FQ4A 5JR2A 4CCLA 1OA2A 1OPOA 2QQLA 1J58A 1CAXA 2P3JA 3BYWA 3KB5A 2PA7A 3MV11 1AX1A 2VH9A 3LB9A 5D21A 4COVA 3KT7A 1F35A 4BDVB 3MFAA 4B3NA 3I3EA 3ACFA 3BN6A 3NWKA 3OUJA 4XDPA 3HBZA 1OUSA 4EQVA 4QDSA 4HKWA 2FBEA 3NAPA 3OOXA 4CDWB 4A7ZA 5BYNA 2ZX4A 4TLGA 4MGQA 4UYBA 4Y5TA 5FLIA 4BQ3A 3VD3A 4CP2A 4CDUB 4JDMA 3E6CC 3Q8AA 4LO7A 1JUIA 1NAEA 3SMHA 4B7EA 3BTYA 2GNTA 4PIYA 1YI7A 5JDBA 4MGTA 1UYZA 5FUIA 4WVWA 5C4WA 2CGOA 4J1WA 1ENQA 2W1SA 3VBOB 1NCQC 4CDUA 5DAXA 2PQSA 4BM8A 3ZR5A 3LEIA 4OCTA 5IVEA 1PK6A 1IPKA 5E88A 3VKFC 4CDWC 1HX6A 3AJYA 4Q4V1 4CCJA 1W6QB 1GOHA 2EIGA 1UYYA 1VJ2A 2WWUA 3HOBA 4LE3A 4R8HA 3VV1A 5FP9A 2XH6A 2XVGA 3JU9A 5JVVA 1GP5A 1F4AA 2VL4A 2HWD2 4JGZA 4MADA 2WNUC 4O9GA 4QX0A 4GB33 1VBB3 3HIFA 4JQRA 2FCUA 1JZ2A 2BQPA 1OF3A 4GH4B 4QQHA 1H30A 1ND3B 4Y26A 3AC0A 4P9WA 2ZJCA 3PJYA 3LSDA 1JYTA 1ZA4A 1LJ7A 1JBCA 3POSA 4BQ1A 2EVXA 1CPMA 2CAVA 2RR11 3PJQA 3WXPA 3O1RA 3PVEA 1CESA 3Q8FA 4NE9A 4ZS2A 5DDJ2 4Q4Y3 1COV3 1CN1A 2ZGUA 3ATGA 4PDWB 5D2AA 5C9AA 3ILNA 2CDOA 1LHNA 1BBT1 3UGHA 4E2QA 4Q0PA 2VOTA 4FFHA 1GICA 1NLRA 1Z7S3 2GN7A 2IVJA 1AHSA 1PHMA 1BCXA 2ZX2A 3HVDA 4RR3B 4BPZA 2VBDA 1WA6X 3KQRA 3UGFA 1WBFA 1MEC1 1NZIA 4WM7B 1APNA 4Q26A 1O3RA 4YARA 5J09A 1C57A 5ANQA 1PO11 5FZ9A 4AF9A 2VTXJ 4KL1A 4XIKA 3ZMOA 4E4DX 2DFBA 2DTYA 4F3JA 2A70A 2Z69A 3NV4A 4N53B 1R1ZA 1RTVA 1RUI2 1X8EA 2R6QA 2WO3A 5LASA 3VDBA 2CY6A 1RITA 2GC3A 2WSVA 1AYM3 3NVCA 4W8JA 2VZUA 4D6SA 4GAZA 3WDYA 3ZN5A 4AI3A 2XBO3 1VBB2 4LBNA 3VKMA 1Z0HA 3E5QA 1VAVA 4RSUA 1T6BX 4XBLA 5CBLA 2PHWA 5B4XA 1NUKA 1QQP3 1WLTA 1WKYA 4L92A 5CFCC 1PNFA 1GZ9A 1JXNA 2QDRA 4P5YA 2UU8A 2VECA 3GZUC 1QJY2 3GALA 3KSCA 1N3OA 1F2NA 4HONA 4EWAA 2RV9A 2WNVA 2ZEWA 1OD5A 1LTEA 1RUJ2 1AR91 4XF0A 1QJX1 3OG2A 5DUUA 2ZEXA 1I6XA 5C8CA 2D7FA 1ULEA 2VULA 4I0BA 3WDVA 4JRAA 2ZGNA 5CFDC 4HVOA 1H4GA 3SXWA 3QCWA 2IXKA 1W6NA 3KF3A 2ZGRA 1QWRA 1YYNA 2Q5TA 2GMMA 4IERA 5FUNA 4U36A 1X9PA 2VOKA 2VZTA 5H9RA 1VRH1 4Q0VA 1WD4A 1V9U1 1ZM1A 1W2TA 1VPHA 2Y6GA 4LITA 3AYEA 1BVVA 1UU5A 4DEVA 2AR6A 1RUC1 3A22A 1N1YA 2QFEA 3E6DA 2VMCA 2CGNA 5FIXA 2E7TA 4LO8A 4KH9A 3A0NA 1W2NA 2QQVA 3M3CA 3KT1A 2OUHA 2QJVA 1JOPA 1SCSA 3CHXA 4QX5A 3KV4A 3O1UA 5A80A 3I49A 1JZ5A 2E26A 3AZYA 1UOBA 2CWMA 3T0BA 4E8CA 4ZZ5A 1LOEA 2CHHA 3M7AA 4L2NA 3LEKA 4XF9A 1HLCA 5LA0A 1ASJ3 1SHWB 1SLLA 2JJ6A 2O0OA 1GNHA 4Q4X2 3NJYA 5DZGA 4RN5A 1QJY1 1GZWA 5GLZA 2ZGSA 3AB0A 1NG0A 1RJ8A 3AXDA 2ZACA 2R1BA 2XJVA 3KVBA 3TEXA 5CAZA 1RYYA 2NPIA 2VUJA 2DCKA 1PMJX 3KCCA 1HKDA 1G9CA 1CPNA 4K21A 5A7PA 2UY9A 2DUPA 1RVF1 1LODA 2XJTA 1OA3A 2VUAA 3K2OA 5FXZA 5CEHA 1ENRA 5IFTA 3IPVB 3ZLIA 1IZ3A 1W6OB 1OMIA 1MVEA 1YFXA 1DGRA 2VOVA 3UNPA 3O1OA 4FPGA 3WW4A 2EXKA 4V1PA 4UI9L 4XE9A 2QQJA 5K0UB 4LNVA 1DQ0A 1QJU3 2D40A 3AYCA 4AI1A 4KGQA 4AQSA 1JYNA 4G9SB 1O91A 1MVQA 1ST8A 3QACA 4AZZA 1DP0A 2UYAA 4Q4W3 1GUIA 1PM7A 1V6KA 2NMOA 4IE4A 3L9JT 5IVJA 4W65A 1HN1A 2R062 1S0JA 4WVMA 3E97A 1RUI3 1XXNA 3ACHA 3ZFFC 4OQ9A 5GZEA 5CZKA 4DNYA 2ZGTA 1UD1A 3WNPA 4X6RB 1MZ6A 4ZONA 2OW4A 1MR5A 3I59B 2WFF3 2WR9A 1MS9A 2PN5A 3HR9A 5FZAA 3N9QA 4DY5A 5ACA3 2RS11 2X8KA 1BK0A 4WVMB 4Y4RA 4DPNA 2NP0A 4XCAA 5FDBA 2PQQA 3R05A 1UKRA 3WNLA 1PZ7A 4ZY9A 3MUY1 3AP9A 1X36A 3U10A 5AC92 3NV2A 2GDFA 3TNPB 4B4PA 1DZTA 1BYHA 2QCSB 3JD71 2CGPA 3SH5A 3J8F2 1UMIA 2W91A 3KVAA 4IEYA 2VW1A 4JGYA 2ZAHA 4V2WA 3ZDVA 5JMOA 3H8OA 5JZGB 1LOFC 1CR7A 3O1SA 3CBNA 4GA9A 1F8VA 2VNGA 2WBKA 2D6LX 2P4EA 2ZHLA 3N7LA 3WDTA 3ZXGA 5DAQA 4QPGC 3VDAA 2HWB2 2IXLA 2OPWA 1EAH2 3VBHA 2F17A 1W8FA 3THPA 1E57A 2QUOA 4R9CA 2VNOA 3V0BA 5FQ0B 1P8JA 1V6NA 3ZXFA 4YVWA 3KMHA 1R093 3H1WA 4FPOB 5DG1A 1UMZA 2EIDA 2D43A 2VM9A 3AMNA 4A6OA 1J3PA 3NO8A 1IS4A 1S55A 2XXZA 3ACGA 2BZDA 1V0AA 2R1DA 4LO6B 4LTAA 2BVVA 4N43A 3ENRA 4PLMA 5C3RA 1I1EA 2Y6KA 4R9BA 3I2OA 2V5DA 2QZ3A 1JS9A 2Z42A 2DU0A 4ARYA 1QEXA 5M0TA 2BNOA 5J98B 1UY4A 3APBA 1Q8OA 3HN3A 4QPIA 2IUWA 1QNYA 3J9SA 5AC91 4F83A 4JDOA 1OKQA 4YZ3A 1AR93 3WVJA 3RZLA 4ARXA 2JXAA 3RZHA 3DEMA 2VMGA 3EMRA 1K5MB 3GHNA 3I97A 2FMYA 3D82A 2EICA 4TXWA 5E16A 2VXRA 5A6XA 1AL0G 1W6PB 4AFAA 5JOXA 4AWDA 1WLDA 1YQ2A 4XVHA 4CEWC 3K4ZA 5FOBB 1ONAA 5FPUA 5JPMB 1XQNA 2JG9C 4CCOA 4IEPA 4YVSB 4K40A 4QKNA 3CO2A 1RUG2 2YG0A 1LR5A 5JUVA 2D6KA 4AHYA 4WM8C 1UWWA 2D6MA 3T0DA 4H55A 5FYIA 1UIKA 1XNDA 3QH6A 3S7IA 1AYM2 1UY0A 5HCAA 1ENXA 2ZMNA 2V09A 1UQXA 3WW2A 1PGL2 4BQXA 1W39A 1RHI2 1FV2A 1KDKA 5CB7A 3V56A 5B4NA 3BIWE 4YZ5A 1S0FA 4HFSA 4IE7A 3W21A 3BI3A 4Y20B 3ZXDA 1PVC3 1MS1A 4W6YA 2JG9B 2Q1MA 1SLTA 1VBE2 3OB8A 4LOSA 1XSQA 1JU3A 1UU4A 1PK6B 4MV2A 5F2SA 1D4VB 5FYHA 3V0AB 4CU9A 1DYOA 4ITCA 4GWJA 5FYMA 3ZPOA 4WM8B 1LB2A 2Y33A 5EV7A 2Z2SB 4XBQA 3I4IA 4LKSA 3PUHA 1E5SA 4Y20A 4WVVA 1STMA 4CDXB 4XCBA 1WZXA 5FTTC 5LBFA 3ZFGB 4C1XA 1QIQA 1JYIA 3L2HA 4UFMA 3CJIC 4D6RA 1QMJA 3DV8A 4LIVA 4XEZA 4LLOA 1LAJA 2ET7A 5FZDA 1J1TA 4PCRA 3PURA 1XJAA 3POGA 5CADA 2DCYA 4FPLA 3N7KA 4AEJA 2DFCA 5FRAA 1WLWA 4NIGA 2ARCA 2G9FA 4P08A 4LIUA 1RUH2 1EV13 2CWSA 2LW8A 3L2YA 3U37A 4YYOA 1VBC1 2JDMA 4Q1PA 1TE1B 1AR72 3BOWA 2PHRA 2VG9A 2HJIA 2LROA 1ZNPA 1KFXL 3FLRA 1ULPA 2QQNA 2Y6FA 3I7DA 2D5HA 4HXCA 2X10A 5J48A 1UF2C 4AFDA 5GLTA 4YW4A 4YWAA 2QQWA 4QPGB 1WW6A 2MNGA 1QH7A 4BIOA 2XQXA 1NXMA 4QHZA 5FZ0A 4S2GA 4XJ9A 4BOWA 4AG4A 4CU8A 1SG3A 2CSGA 3POJA 2VZ3A 1RUC3 3WF1A 3KLSA 1WMXA 5KC5A 3B7MA 1GKBA 1QJEA 5FZCA 4C90A 1AR62 1LGNA 2FDFA 1D4M3 2VE1A 2YZ4A 4Q0SA 3WUDA 1CZTA 2DYCA 2PMWB 1IKQA 3PUAA 1W6OA 4ONUA 4FPHA 4LJHA 5FZHA 4AFCA 4AEKA 4O7XA 4LBKA 4C0BA 4FTSA 3RJRA 2C6SA 3P3PA 4AGGA 2DUQA 3A21A 2ZGOA 3KHBA 1URXA 2D3RA 2LS6A 3EB7A 3OGRA 4IV3B 5J36A 5F6LB 4XJUA 1PO23 4HK8A 1JH5A 2OZJA 2XKPA 2ZS6B 3EQEA 4I0WB 2ADEA 1AR71 5ISLA 3HNYM 5I0SA 4I3PA 1LU2A 4IV3A 2WDBA 4YGBA 5EJ1B 2WZR2 4AHWA 4GMP0 1XBFA 1XYOA 4TYSA 4AQ6A 5JI9A 2OX0A 4CUBA 4ZPIA 3WD5A 3RS6A 1Z7S2 2DWRA 5AFEA 2ZTNA 4TZDA 2HBUA 4AQTA 4Q4V3 3ZXLA 4AFMA 5C8CB 1X8MA 2QVSB 4AHZA 5A3TA 1W8TA 4ZHNA 2A3YA 2BNNA 2V5YA 1AJKA 1JUHA 3P5BA 1EPZA 4PJYA 1VBA1 3RNSA 3TN93 3R4SA 4BB3A 4XILA 2ADDA 3WEZA 4AI9A 4E4SA 1ZRFA 3ZSKA 4JGYB 4C91A 1JMUB 4OUSA 4B29A 2ZKLA 3OEBA 2XBO2 3AMHA 1ZBA1 3MW3A 4CPBD 2KA3A 1NLSA 4QKBA 2BNMA 3ZYRA 4Y24A 5LCWL 4FI9A 2AH2A 5EYYA 3M3QA 4CUCA 3LA2A 4FP2A 2V4VA 4IEVA 5L19A 3J7LA 1JN2P 1IS6A 1PX4A 2DUOA 2AZ5A 2BGOA 4UF0A 5F5QA 5L73A 4AEDB 1OH4A 2GSYA 2W46A 4IEZA 1PMHX 4YW5A 4B7KA 2H6BA 4EN7B 4Q4Y1 2BBAA 2D6OX 3I2DA 3UKTA 3I2IA 1K45A 2HWB3 1OOPB 3PMSA 2BGCA 1XNTA 2N7GA 5A1LA 1CIWA 5A6QA 1HQNA 3KHCA 4OULA 4C8DA 2XVKA 2WZR3 3PDQA 4QM9A 4AVAA 1MQTB 4X6QB 1V6LA 4MHUA 2DCTA 4LBOA 5FLJA 3OF1A 3WDWA 5A6ZA 4BQ5A 5K7PA 1ZZCA 2WO2A 5C9AC 1CZVA 3HJRA 4YM2A 1TMF2 5KHHA 4X8NA 5I93A 1AR81 4DB5A 1SLIA 3LWCA 4JGYC 4LK6A 1RUE3 1XC6A 5F3EA 4ZXKA 4D7SA 1HRI1 1M06G 1QDOA 2PAMA 3I2JA 5FXVA 4ORFA 1H1IA 1SCRA 3M3OA 1GWMA 4GIQA 4XUOA 4B1LA 1COV2 3DKWA 4MGZE 1LCLA 4G3YC 2OQ7A 4QU2A 3SEEA 3NNMA 4BZ4A 3VBSA 1V6IA 2RR12 3ECQA 4K8RB 3IT8A 5KXDA 3VBHC 4MXVA 1X33A 2WS93 3VHOA 4QDRA 4YVWC 4Z82A 1UY2A 2HBTA 2G4IA 1AR63 2B45X 2YROA 4DXSA 2HWC2 3MLLA 2RS51 3QLQA 4CCKA 3LPGA 2G9ZA 5KC6A 3C3VA 5A3OA 3ORJA 3CZJA 4RS5B 2MEV2 4CCNA 3UJOA 2BYVE 4Q8LA 1N3QA 5FR3A 2PLV3 3UK9A 3OJBA 5FYSA 4NOTA 1R081 4N53C 4MGKE 4QX8A 4Z1VA 5FPLA 4OLLA 5FYBA 4JKLA 2VW0A 1N1SA 2FZ1A 2BRTA 2RMU1 3GZAA 3N7JA 1AUYA 2IFRA 1ZZ6A 2UURA 3VL9A 1QH6A 4DXZA 5EQUA 3KV9A 5EZWA 2GN3A 4FFFA 4FO9A 3EXUA 1MS3A 2ZA9A 4OZOA 4RFRB 1ODNA 1OD3A 1WMEA 2VBPA 4LOTA 4JX0A 4HSJA 3SKJE 1QOOA 3ZYIB 1ZRCA 2CAUA 3DYPA 4ISRA 3F95A 5BY5A 4YM0A 3LF7A 4AAPA 4XPVA 1LECA 1Y43B 4FFGA 4UFJA 5FYTA 2WA4A 3TEWA 2CV6A 2ZX3A 1H2LA 5IK5A 3ES4A 1W8UA 2E63A 4LUKA 2R7EB 5JSPA 3I8TA 1UY1A 3WG3A 1SFYA 1V6OA 1SDWA 2A75A 4LPLA 3WF3A 4XTPA 5DDJ3 4BHPA 1FXZA 2ZZQA 3VHPA 5A7OA 4HZFA 1OPMA 1UIJA 2MPFA 3S6PA 2GU9A 1C4RA 5FY7A 1CJPA 3AKPA 2VTXA 1DU3D 1IPSA 3ZX7A 4BLJA 1YUDA 1OQ1A 4TN7A 4YGCA 1NA1B 4QHBA 4BQ2A 4UFLA 2VZQA 1ZBA3 3BU7A 1DGLA 4N8MA 1KEXA 1IOAA 4MX3A 4AI8A 4JZRA 1NCRB 5HCFA 4QDQA 1POV0 3S7EA 3VN4A 1EP0A 1JZ7A 3I2FA 2L9LA 2AEZA 2ET1A 4XZUG 5L9VA 4K1YA 4EYUA 1I9RA 2C4XA 2ID4A 2TEPA 2Y64A 3OBAA 4AK3A 4BQWA 2BEOA 1C5HA 1PK6C 1VBA3 3I2KA 2LTNA 1LENA 4M3CF 1UMHA 4UFKA 2Q8EA 3VKNA 5EJ3A 3GJBA 1NCRA 1WW4A 2FDJA 5JOYA 4GULA 2W0XA 3HT2A 5FYUA 1TNFA 4E9KA 4KNCA 5IFPA 5JXIA 1NYWA 2C24A 2OPKA 3MPPG 1HB4A 1SEFA 4BK4A 3RZMA 4OI0A 5HXVA 4BJ0A 4EWDA 1DYKA 3AFKA 4KWJA 5BXXA 4QU1A 2OA2A 1IHMA 3PVOA 5LK5A 2I2SA 2LUWA 4RS5A 1IS3A 2W08A 2QBXA 5JR7B 3UKVA 4XXAA 4CUAA 4UW3A 4EJRA 1D2SA 5H9SA 3THCA 3VHNA 5K0UC 5BNOC 2W3JA 5LBEA 4GWIA 2IZWA 1QHDA 3ES1A 3BTZA 3AP5A 2DU1A 1A78A 1YFYA 3I2HA 5LBCA 1OKOA 2E31A 2QTWB 2FHRA 4LKFA 3KV5A 1LKNA 2WFF2 5GZFA 1Q56A 2ORXA 2R061 3ZFEC 1Y7BA 3VZLA 4ES8A 1PVC1 3VLBB 4CCCA 1DQ2A 1W3XA 2HLEA 4DY3A 1GV9A 2JG8B 2VPVA 2XUEA 1H9WA 1Q8SA 1CGPA 4DEQA 5LRRA 1C28A 4HKLA 3T30A 2AACA 3KV6A 2VVDA 4RHV2 1LGCA 2RS12 5A32A 4LBQA 5I8SA 1QJFA 2A71A 2JIGA 2R042 2VY0A 2ARBA 5BNPB 4Y1XA 1FMD2 3WOGA 4YFZA 4NIAA 5C3PA 3PIGA 3GCXA 4ISQA 3RDIA 4D3WA 3D5OA 2QQPA 5FREA 1BEV3 1G8WA 4S2DA 5DZEA 1QJZA 2DCJA 4LO5B 4GD4A 4DRRA 3AZXA 3AZZA 5CKMA 1R1A1 1VBC3 4XHXA 5FXXA 4D7TA 1CIYA 3T09A 2X5IA 3ZFGC 3C8XA 4CP9B 1RUD1 3VZJA 3OGGA 1T2XA 3PUQA 3WW3A 2VMIA 1ND2A 4LEJA 1HB1A 1O4TA 1N1VA 1WCQA 3JB8A 1OHFA 4IE0A 3FUOA 4YW1A 1RUF3 2VUDA 1NZCA 1QXPA 5C7GA 4XQDA 2A73B 3JQWA 3NJVA 3WP5A 2ZEZA 5JI7A 4P5HA 1HV0A 1PZ9A 4WZCA 4GJZA 3H8XA 4Y22A 1E5RA 2VZRA 3BB6A 1OT5A 3VBSB 4LORA 1UOFA 3POWA 5C71A 4X8PA 3O1TA 1H2NA 2LALA 4AEMA 4GWNA 1BK1A 1Z78A 4XUNA 3LFIA 2WN2A 1CAXB 3WNMA 2RDQA 1W8ZA 2RR13 3VBFC 4A2UA 4Z92B 4XMAA 2R072 2DVFA 1FMD1 1REEA 1HXS2 5CYYA 5FY8A 2SLIA 1TME2 3UESA 1MZFA 2JDHA 3IDEA 3JCIA 2BUKA 5A3PA 4Y33A 1KXGA 3V65A 2Q8DA 5A1AA 4CP1A 1V6JA 2AREA 5L7OB 2BWCA 4OHZA 5KHGA 1MS8A 4FTBA 4PLOA 3FMGA 4Z07A 1RUNA 2WO1A 5JOWA 4J25A 1N3PA 4P14A 3VDDC 1RUG1 3R6SA 5IYYA 3DXTA 4COYA 4NRPA 4YW3A 2A5ZA 1IS5A 3DECA 3I3BA 1AYM1 4A44A 5KHIA 2VNRA 2YBPA 4HVQA 5T5JA 3JXSA 1O8SA 5HCBA 3LOBA 3ITQA 1RHI1 1LRHA 3OBTA 3LA3A 2DBIA 3BUCA 5F3IA 1W9YA 4HETA 2IFWA 1Q5OA 1OLME 1ZBE2 4UW4A 1F5JA 1H8TA 3H50A 3RGBA 1BHGA 2PHXA 3VD4A 4IGQA 2RS33 4LHLA 5F3GA 1RIRA 1EUTA 4MYEA 4RA0A 5DABA 3OY8B 5FZ7A 5IWFA 5JCTA 2HYKA 2EA7A 1RL3A 1UKGA 4GWMA 2BU9A 1GOGA 2XGXA 4D7YA 4FBFA 1HXS1 1TME1 5LA1A 3PTYA 3T1LA 2RM22 2R073 1HW5A 1H8TB 3GNEA 4QPYA 1O8PA 5D8AB 3AJZA 4BYYA 3USSA 1JYXA 1AXZA 3CJIB 3IDAA 3OD0A 2Z4FA 1LEDA 3ZYBA 2XLGA 4OMDA 4CEYA 2EAKA 4OUMA 2XUMA 2YPJA 4YG3A 3RYRA 3JBG1 3ZYGA 5K4LA 2WT2A 2Y26A 5FY0A 3RG0A 3UETA 2E33A 2VOWA 3LGRA 3ZN4A 2G19A 2AUYA 2I74A 3CMGA 1EY2A 2XWJB 3NRUA 4PQQA 2BP6A 4BH9A 3FHIB 4P00B 3VBRB 2RS32 3HEIA 5JIAA 4ZXEA 3M1HA 4AL9A 5HV4A 1H8VA 2FQPA 2HWF3 1UZVA 1YO8A 4L9BA 1UYPA 1KRIA 2XHNA 4A3ZA 1LOFA 4Q27A 5BPXA 3RI9A 4BIFA 3T1MA 4A6SA 3PUIA 3K77A 4MSVA 2Y6HA 2GMEA 3RSJA 4HLTA 4K9SA 3B93A 4OQ8A 4FPJA 1B35C 3MW2A 5FYZA 3H1MA 1YQCA 1PO22 3K3NA 3PNAA 4LULA 4Q4W1 1KDMA 3R0RA 3WHUA 1QU0A 1JOJA 1XOYA 5C4WB 1ZYBA 1O5LA 2ZMKA 2GH8A 2O8OA 2QQUA 1PGSA 5DPNA 3KM5A 2WNVB 1OFSA 4EN9B 2ARXA 3GJAA 4KI5M 1J59A 1TNRA 1GZCA 4LR4A 2RJLA 2NM1A 2QNKA 4XDQA 1LESA 3NW4A 5F32A 5F6KA 2XJPA 1JU4A 4IEXA 4QPIC 2HWE1 2AGSA 2F4LA 4ET7A 3WR0A 1XE7A 5F7UA 3USUB 3VDDB 2HWD1 3T2PA 4F8AA 1H0BA 1WCUA 3POFA 5DUWA 4DINB 3VDCA 1WA4A 1W8NA 2WN3A 3FHAA 4GH4C 3SH4A 1GYKA 5EP9A 1AYN3 1GLHA 5DMYA 3LAGA 1HRV2 4M0NA 4XUTA 5DXDA 5FZ3A 4RS5C 4XFBA 4XJ8A 5HXMA 3WNNA 4R4XA 3PVBB 4YM1A 5A33A 3B69A 1AR73 2JDKA 1FMD3 4FAGA 3NQHA 1BQPA 2ZGMA 3MPBA 3CF6E 5FXWA 4Q4W2 5EFUA 3C7EA 1NQDA 4Q8KA 1O4ZA 3VBUA 2X5IB 1JW6A 3N9LA 4QXKA 3NNFA 4CP9A 2W1UA 3SITA 4S2HA 2VZPA 3ZPYA 4NIDA 1RMU2 1NE4A 4QQ2A 2O1QA 1BLZA 1O7FA 2WFPA 4AXOA 4KG0A 4MHRA 5FZMA 1AVBA 3GBWA 4BMEA 1N1TA 2C26A 4FOYA 1NY72 2YB7A 5A7QA 4PQ9A 1TMF3 2UWAA 3DPRC 2J1RA 4OHXA 1RVF3 2VCBA 5A7NA 1AZDA 4OI2A 3FX3A 3VBRA 4UFHA 2DVBA 4AGVA 4N53A 1WBLA 1VAMA 4FOWA 3WQ1A 2ZX1A 2BBVA 4AFBA 5ABJA 1H2KA 4B4QA 1G86A 1DCSA 1LGBA 1F4HA 3CL1A 1XE0A 4LUMA 1SBDA 2W39A 1QQP2 3WCSA 4DMIA 1FV3A 4B8EA 1YQ8A 3B00A 2WQZC 4UOJA 5IT6A 3WV6A 1HJFA 2DTWA 2QE3A 2WAAA 3O1MA 5FY1A 2VVEA 5IVBA 5E8AA 2JDZA 2V72A 1HIXA 1PO12 3EYPA 5BUVA 2CL2A 1W28A 1S1AA 2A1XA 3LPFA 3NJXA 4NROA 4CP0A 1OLRA 2HEYF 3FBYA 3WG4A 3MV01 5F1RA 1NLQA 2AEYA 2UWBA 3TN92 4J6GA 3ZN6B 1IQDC 2ZXQA 1GZTA 2DVDA 3ZSEA 3W5NA 2XLAA 4FPYA 1RMU1 5JXHA 2ZAAA 5TSWA 3GF6A 4E27A 3NNJA 4GJYA 1W04A 1W6QA 3ZIWA 2JE7A 5JSOA 1NY71 1PIV3 1PMIA 5IVFA 2VD7A 5KHKA 3FJSA 3HQUA 4YW2A 2QQOA 5APAA 1GQPA 1PIV1 1VRH2 1QJU1 3WNOA 3BOPA 3HPNA 2VGDA 2ZX0A 1JODA 4XFGA 4LMFA 5FPAA 1IQAA 4AHXA 5BNPA 3TB0A 4CDQC 1RUC2 1GFF2 1RUJ1 1US3A 2QQKA 2WNVC 1XYNA 2Y6LA 3IN9A 5LK7B 4YZ4A 3USUA 5CG9A 2DCZA 4MXWA 3WUCA 2WS91 4XZPA 2O8QA 3E5XA 4LBLA 3K48A 2VZ1A 2DVAA 5CFDA 4CRQA 4M00A 1TG7A 2XMLA 4OI1A 3VB9A 4CU6A 4L11A 2D93A 2RDNA 3AK0A 4C0HA 1NX9A 5FQ0A 4I30A 4M01A 4NRQA 3LEGA 5I8TA 1GMMA 3LA7A 2ORZA 4L99A 1DQ4A 1H1MA 1KS5A 4Q4X1 2P2KA 4QGNA 5BNNA 4IV3C 2E7AA 4AVTA 1FYUA 4XACA 1S0CA 5FK7A 1KJRA 4YNIA 2B7YA 1G6NA 1C1FA 2OZ6A 3B9CA 3RI8A 4YG6A 1LULA 2VVFA 5FP7A 4A7KA 1ZX5A 1N47A 1W8OA 2JB4A 5T5LA 1DYPA 4P9GA 3MI8A 4O61A 3ZXJA 4COUA 5GM0A 3W5MA 3ZYFA 4NHKA 1OA4A 1VMHA 4JKKA 4DO0A 2XR4A 2BWAA 3LQCA 5K0UA 2GNBA 3FC0A 4YW6A 2ZGKA 3RRDA 1Y9MA 5BNPC 4MG2A 2YXSA 3GBFA 1DQ6A 3PU8A 4CDQA 2KM2A 5ABJB 4EV0A 1WLCA 1YC61 2WS92 4P9JA 4Y1UA 3GM8A 5FWJA 4QGLA 4M4PA 3KGZA 3TEYA 4XQWA 4XURA 4CEWB 3P3NA 1RUH3 1VE0A 4H3WA 4BXFA 5FP8A 4QX2A 3FUQA 1HJGA 3HNBM 5FMBA 4CDWA 2VNVA 1GNZA 2Y0IA 3MIEA 1ALYA 3ZKUA 1DF0A 5BNOA 3KF5A 3WINE 2QZ2A 2WUHA 4LLFA 1WW5A 1DQ1A 3AM2A 1UZWA 5K9YA 2W2IA 3WF0A 1WCDJ 2HKXA 2XJRA 1V00A 1ZA7A 3DL3A 3PHMA 3WG2A 5JAXA 1QXRA 1SLAA 2DDUA 2IWGB 2IXHA 4GZ9A 4QKDA 5FBZA 1ZREA 1V6MA 5JIUA 5LRSA 5IW0A 2Y8KA 1VRBA 2KR2A 3OGJA 4L97A 4HPKB 4Y1YA 1A8MA 5FUPA 1Q8QA 5A1FA 1S2EA 4AVSA 5JSRA 2QKDA 4EN0A 1OOPC 4H14A 5BNQA 2NZ9A 3M2MA 1ND2C 5C5UA 3RVHA 4CXXA 2AENA 4NMIA 3VBSC 4HPKA 1PM4A 1LOBA 2V4AA 2ERFA 3GBGA 1GWKA 3MW4A 3P1IA 3VZKA 3RMYA 1UNBA 1US2A 2JE9A 4S2FA 4NUBA 4JQTA 4QAWA 5FMOS 3BALA 2W47A 4IDZA 3VD7A 2J1SA 2C9KA 3QD6A 3S5AA 4JDNA 3ILRA 1MS5A 4XF3A 3WY6A 3MF6A 4FCAA 3FE5A 5KXCA 4RQPB 1VBD1 1AX0A 2XVLA 3H0OA 2E32A 2HWB1 2W68A 2W92A 1PZ8A 1S2KA 2HEVF 2YHJA 4QPGA 1BVP1 4DRVA 5BNNB 3A0KA 1ZZ9A 3CKHA 4IE6A 2WKKA 3CNAA 3E5UA 3C7OA 5F39A 2BDRA 4G4FA 3RYKA 3TYJA 2E9QA 4OI4A 1ZBE3 5GZDA 3LD8A 2K9ZA 3C7FA 3H3LA 3HQXA 2WWSA 2D6NA 1AL23 1RUE1 1AR83 1S0GA 5I0TA 5LB6A 3A4UA 2WJSA 1HRI3 3D0SA 3IBMA 1UXXX 3WF2A 5JLVA 1NKGA 3AL5A 3MUZ1 1LEMA 1RUD2 3AXEA 4I0AA 5FZGA 5A70A 5CU1A 4N90A 2W1QA 2IVIB 2J1AA 2A6YA 2WQ8A 3HN1A 1XNKA 2ENRA 4EN8B 4UFIA 5FWEA 5HPOA 3VUOA 2NLRA 4LXLA 4OFGA 3URFA 2HWF1 2AC1A 4LHKA 3WG1A 5HV0A 5FP4A 4YZ1A 4A42A 1IPJA 4FPCA 3AKSA 1EUUA 4XAEA 5JWPA 3AMQA 4XTMA 3W20A 1PGW2 1K3IA 1VBD2 3ALQA 3H7YA 1H8TC 3TNQA 2JG9A 1TME3 4QB2A 3TEZA 1Y4WA 5CKNA 3M3EA 3OD4A 3M3IA 1ASJ2 5KR7A 1LOGA 1ODMA 1KS4A 2PAKA 1WW7A 1UYXA 3SLIA 1GBGA 2ZHNA 2VAUA 5FAXA 3FLTA 4PBPA 5IJRA 2YU1A 1EAH3 4TTGA 1H4HA 2GNMA 3OPZA 3RZJA 3OGVA 1DFQA 5F5IA 5G05L 4HSLA 5FYYA 2JDAA 1RJ7A 1Y9GA 2Q1ZB 4UW5A 2NN8A 4XABA 2CTVA 4LK7A 1Y9QA 5FO9B 3U78A 2VQ0A 1FPN1 5SV5A 5EXOA 1W9TA 2EIBA 4BWOA 3W59A 3AX4A 2Z79A 2PHUA 4MXWB 4AGRA 1M4WA 1V70A 4FP3A 2C1FA 5FPXA 4PT6A 2B42B 4LA3A 3HNMA 3JZVA 1NCRC 2YC2A 3LEMA 3G7DA 5CFDB 2EXJA 2R0HA 1WUVA 1YWKA 2WWJA 4W50A 2FD8A 3O12A 3WX5A 1SFPA 3AKRA 3WSOA 3O5SA 4KG8A 5ACA2 2OIIA 4NJ4A 1C8M2 3POIA 3VZOA 4MZUA 1UW8A 1CAUA 1C1LA 5T5OA 2VCAA 3PVNA 3WQBA 3O1VA 1ZBE1 4RGGA 3G6JB 4DS0A 3X29B 3OTFA 1RUH1 1QJY3 5IUQA 4BA6A 1VBC2 4R9AA 3ZO0B 3T2QA 4COZA 4ASMB 4LKEA 2PHTA 3T0AA 4BCUA 4FOVA 1K5MA 2Q8CA 2XOMA 2EXIA 2WT0A 5BNNC 1J3QA 1BZWA 3TOJA 3FWEA 5F37A 4XF1A 4KGGA 5DAWA 1CX1A 4ZS3A 1LNSA 1SPPA 4FVVA 1LHVA 2YMZA 1POV1 5D1IA 1W3VA 4WM7A 2JKBA 4UBGA 1CAVA 1OLQA 2VZSA 2WRAA 1AXYA 5GALA 3THTA 4AEDC 1UO9A 5I0RA 1SPPB 3WF4A 5H9PA 2W1WA 1E5IA 1UPIA 3U1XA 1IG3A 3VHRA 1RINA 2WQ4A 4FXKB 3U14A 4Z2WA 4N7IA 1YIPA 2UY8A 3OBZA 3ZIXA 2J42A 5J1XA 1O3SA 1YFUA 4CA9A 4D0QA 4Q4V2 4Y4YA 2JDUA 4MLOA 3S30A 5GLVA 4OVEA 5FY9A 1C8M1 2WNUA 3MIFA 5J37A 2Y60A 4XJWA 2BFUS 5CKQA 5T55A 1ULFA 4NHLA 1ULGA 4N9IA 4NRMA 5H9QA 4E4HA 5F9TA 2BPA2 3H8RA 1WGPA 2GMPA 5JZGA 3W58A 5A3NA 2HWE3 4CDXA 1XYPA 4AOCA 3ZFGA 1DGWX 5FLHA 4IV1A 2WNUB 4LKDA 1VAKA 4ZKTB 4A7YA 4QPWA 4CU7A 2ZMLA 1R64A 2VU9A 5JXJA 1FOD1 1UZYA 3NSTA 1RUJ3 4H2AA 4M0HA 3MIBA 5C3OA 2XBO1 4BLIA 1ZBA2 1PO21 1W6NB 2WINB 1MEC3 2RDRA 4FT8A 4CXYA 4JGZB 4YVWB 4WV8A 2WSUA 1BEV2 1S0IA 4KBBA 2P3IA 1KITA 4XUQA 5FZ8A 2D97A 5KXEA 2WNEA 3MEPA 2G1MA 3ZVXA 1HQLA 4FPEA 4GH4A 3JUUA 1ND3A 1VBA2 3NKTA 3ASIA 1C8NA 3SCHA 5IATA 1VMFA 4NIIA 1PNGA 1VP6A 2OUJA 4YVSC 5FP3A 3ZXEA 4NIHA 2JD4A 3D8CA 5CISA 3CQOA 4F7ZA 3VD5A 1VB4A 2DBNA 1GP4A 3ZOIA 4Q5OA 1ZVFA 3F2ZA 2GC0A 1LHOA 2HWE2 1NT0A 1GR3A 1YFWA 2O14A 2Q30A 4NWVA 5DDJ1 2F4PA 3FN9A 4IL7A 3OPTA 4DUVA 2ES3A 3UT0A 4DXRA 1HXS3 2XKOA 2E51A 4XUPA 4PLNA 1W6PA 3EJKA 4P9LA 4EZ4A 3ETPA 1ZRDA 3O7OA 1VBB1 4Q4Y2 2LRPA 4RL7A 5C70A 4MOAA 1R1A3 2R0FA 2X05A 1AYN2 3U0ZA 3IM0A 4NR1A 2VBBA 1Q8VA 1UX7A 3LCPA 2FMDA 3T08A 3WP6A 5DUVA 5AC93 3BIEA 5GLWA 3AP4A 3POBA 1IG0A 3LZZA 2A6XA 1K42A 2ILMA 3MF9A 1CVNA 3SCGA 1VIWB 2R30A 4CDQB 3RZKA 2J22A 3T4HB 3MYXA 4PHZA 1BEV1 2WNOA 2ATFA 1JHJA 2C5DA 3DYOA 1TMF1 4NPLA 4OHWA 5E89A 2ZPXA 4D94A 4E2SA 2P3YA 1CAVB 1W2UA 3LDKA 3S5QA 2HWC1 1F9KA 2XJUA 3AVRA 4DXTA 2VJXA 3WQ0A 4CEWA 3J4UH 4ZZ8A 2C9AA 1QOTA 4NPMA 2RS13 1YXWA 1XU1A 4YRDA 2RJKA 4NAOA 2R043 4WM8A 2YPDA 3VD9A 2ZHMA 2WABA 1V9U2 3VBOA 5I0DA 3I3QA 3TRSB 1A6CA 4CSWA 4YZ2A 4FTEA 3RZGA 1QJX2 4NHYA 5IK7A 4FXGB 2WYSA 1W6MA 5FBJA 1X50A 2GC2A 3OPWA 4CVUA 4L0PA 4MVTA 1JZ6A 2XHKA 4CEYC 2RMU2 1S0DA 3RJ2X 4XHBA 1J84A 1W2OA 5FMDA 3WHTA 4FAHA 2D98A 1QOSA 4M4RA 5FJKA 5GZGA 5J96B 5C6CA 1AYN1 1SZBA 2MEV1 2I45A 2ZZJA 4P9XA 4WBBA 5IAVA 5C33A 1RUG3 1W6MB 2YBSA 4Y1ZA 2RS53 2GALA 4ATEA 3ZSJA 3MGUA 1KD7A 4W4ZA 3N36A 2P1BA 3HAGA 4XQ4A 5LA2A 5C5TA 4RGAA 3ZKYA 1Q43A 4LBMA 1U5YA 1YNAA 2CDPA 4QQOA 4R4ZA 2YU2A 4CE8A 2ETEA 1W03A 5DN2A 3A23A 1L3JA 4URAA 4N7UA 2EIEA 2GAUA 1UN1A 2XONA 3IIAA 4PIXA 3E6BA 4QXHA 2B8MA 1B09A 4RQPA 1VR3A 1GP6A 5LATA 2VMDA 1PIV2 2HEWF 3R4UA 1WWYA 5C9AB 3MO4A 4BMBA 1CJDA 1CAWB 1GZWB 2Z5WA 4IETA 2QQMA 2HYXA 4P02B 1LOAA 1JHNA 2A6WA 2K46A 4SLIA 5SV8A 4EN6B 1CD3G 4RR3A 4BK5A 1W9WA 4ZU4A 5FMCA 1QF3A 1RB8G 3KGLA 1FPN3 1UZ0A 2X29A 4ATFA 4C1WA 2OVUA 2TNFA 1RVF2 1IKPA 1BXHA 4OYUA 5F5CA 5L9BA 3U4SA 3I3MA 1ZRIA 3PUSA 4I2OA 2IXJA 2JG8C 2QQIA 3D0JA 1Y3TA 4V2VA 2VMHA 5FO7B 1O59A 5FYCA 1BJQA 1MS0A 5ANNA 3LDRA 3PLQA 2MHFA 3ZXKA 3U07A 2RJ2A 2JE8A 1AX2A 1K5MC 4NN0A 3NV3A 3OUIA 4W6XA 5L9RA 1JTZX 4QB1A 2KXLA 2XG3A 5IVVA 1ENSA 4MH0E 1K5JA 1LHUA 2A6ZA 1JYWA 2BERA 1HN0A 2LM3A 2G9GA 4KWLA 4PDWC 4UT5A 3BTAA 3NJZA 3DF0A 3ZSMA 3AYDA 2D5FA 5FZOA 4AQ2A 3O14A 5AVAA 3JD72 5F5AA 3J8F1 3WDUA 1GOFA 4META 4TSVA 1HQWA 2A3WA 1GQHA 2ZBJA 1DIWA 3MDPA 1OSGA 5IVCA 5FZKA 2OXBA 2P6HA 1OI6A 2R16A 5DZFA 1O3TA 1OVPA 2W95A 5I8YA 2FDKA 5DG2A 4IESA 2RHPA 4A3XA 2PAEA 1GWLA 4RR3C 4M3CA 1EAH1 1C3HA 1YIFA 4JHZA 4YFWA 3C2UA 4YSFA 5F8PA 3AMPA 1O5UA 3TWIA 2PLV1 3VBUC 4URTA 4UWDA 3GZEA 3VZNA 2XB6C 2KD7A 1DGRN 4FQZA 5FY5A 5DAVA 1OC1A 4IEQA 2RDSA 3CZUA 2HH9A 3C7HA 4M3CB 5EHDA 4AEDA 5JZGC 3IZOA 2R32A 4CDXC 5FZIA 1EPWA 2P37A 4PI0A 5LZ6A 4IV1C 4Y5SA 4MUVA 3JQXA 4YGDA 4HBNA 1OOPA 1OBNA 3IIIA 3T2OA 2DF7A 4Z8BA 2B4KA 2FCTA 2GZWA 2TUNA 3AP7A 3DPRA 4LBQB 4AAXA 1D4M1 5I0UA 2R041 5EJZB 1H1AA 2WL1A 3VBRC 3N4MA 1VBD3 2C0ZA 4DQAA 2R49A 1DLCA 3SEPA 3ZYPA 3AZWA 3DKQA 3DPRB 3WP3A 1A3KA 1UZZA 2HWC3 2I07B 1I3HA 3IWZA 3ME2A 4QHOA 1NA1A 2FCVA 2YBKA 5FKBA 4CCDA 2VMFA 3BPZA 3D3AA 4QKFA 5HBAA 4HN0A 3KT4A 1GQGA 1HDKA 4QX7A 2PHDA 1JI6A 4HG6B 1FAYA 2JDNA 3VZMA 5GZCA 4XJZA 5L36A 1ND2B 3FBMA 2XWBB 4GB32 4QQPA 1JZ3A 2B9VA 1XNBA 2SBAA 4QPIB 5HCHA 4MGIE 2PLV2 4OHYA 1REDA 2BJSA 1CWPA 1OFNA 1S2BA 5FYVA 1MZEA 1PGL1 1D0GA 1R1A2 4KBZA 2JECA 3LSEA 3UL2A 1XNCA 4YVSA 2DURA 3SH3A 3H42B 3QOPA 1OURA 2VCMA 3FLPA 4LE4A 3WDXA 5LEKA 2YY1A 3J26N 4QM8A 4JCKA 2WZEA 2R071 1AL22 5IAXA 1H2MA 2PXJA 4AI2A 4PIZA 3I3DA 4B1MA 4KWUA 2A7AA 2VR4A 1YCIA 3OEAA 4R52A 4ZU7A 1XSRA 2F6BA 2ZOEB 4L8QA 4JVAA 3NNLA 1RUD3 4DUWA 5FZOB 1RUE2 3RZZA 4OUEA 5FZEA 5C8WA 3FFQA 4GMP1 1U5IA 3EBRA 4I01A 5A7SA 5KXBA 1NE6A 1S0EA 5IK4A 2FZ2A 3TBDA 3SNMA 3FFZA 4XAAA 2ZEYA 1FX5A 2BVBA 4JAAA 4LQRA 3JD73 3IAPA 4CXWA 1UU6A 2WC2A 3H7JA 4GB31 1DZRA 2XL9A 3PIJA 2JWPA 1VLNA 3VBOC 4D6QA 1DDLA 2Q1FA 1POQA 3RFRA 1RC6A 5CG8A 3AVSA 1OLMA 2JKXA 1EYBA 1W90A 3GGLA 4K8FA 3T4VA 4K7JA 2YC0A 5A32B 4XDOA 3NV1A 5GJ6A 2B46X 1SLCA 5FV3A 3ZFFB 3BU0A 3DUIA 2IXCA 4HMZA 3B5LB 4NHMA 3VBHB 4AYUA 1BMV2 3WQ7A 4CYDA 1KFUL 3V0BB 1J83A 2X53S 3VDDA 5LY2A 4D8MA 1WD3A 4IEOA 5A7WB 5HI0A 2P17A 1ASJ1 3U75A 4KU7A 1H6XA 1ZZBA 1WCSA 1XPWA 5GKAC 2CU5A 3N3HA 3ELNA 5BV6A 3SISA 2OQ6A 2WZ8A 1U12A 4QXBA 5CVRA 2VZVA 3HBKA 3VL8A 3O0XA 3N9MA 3ZYJB 5A3LA 4N43B 2W9XA 3N35A 4O9EA 4XF4A 3ZXAC 4A41A 3IB3A 3SKVA 3IAQA 1MQTA 5T5PA 2J1VA 1POV3 2WIIB 4GKXA 1YI9A 1FI2A 1SDDB 2D6PA 4EWEA 4BQYA 5JMCA 5LWBA 1YJKA 3V64A 3PTRB 2XPJA 1YQ6A 3Q8CA 1NOVA 2RS31 1X7NA 2X09A 2JX9A 4NAMA 3LFMA 2ZGLA 2VTFA 2PTMA 1F31A 1D2QA 4FPKA 4XMIA 3LIHA 2B9UA 3JBG2 4RD7A 3KWVA 1BMV1 4CCMA 5F3CA 3MIGA 4AE2A 4BXSV 4CZSA 2P5BA 1BKZA 4Y1VA 5IVYA 4OHVA 4N9HA 2BGPA 5KBFA 4MO3M 4JTOA 2GP3A 2XJQA 1ZRRA 5E1RA 3ZFEB 2EF6A 3ABZA 3I2GA 4XBNA 4YG0A 4HN1A 2VQUA 2QDNA 1GSLA 2HWD3 5LEJA 3SC7X 4QT6A 1U0AA 1A8DA 2YGMA 3S57A 1D0HA 1VB2A 3V0AA 2UWCA 1SMVA 3CEWA 1AJOA 3UKNA 3LOIA 4XC9A 4XETA 3ZFEA 3NNGA 1T6GC 1NCQA 4XIOA 3T2TA 4XFHA 3AL6A 1ND3C 2TBVA 2JG8A 1RUOA 3P6BA 1YRZA 2JEMA 4FFIA 4TWTA 3WP4A 3OYWA 3DCQA 1W0OA 3JBG3 1OVSA 4IW3A 2K0GA 3H3UA 4Q29A 2W87A 5FKCA 3NKGA 1E5HA 3DYMA 1JYCA 4QX3A 3ETQA 2AYHA 2P6CA 4YLZA 3TAYA 3OYWB 4IEUA 3J7HA 2OYZA 1BBT2 4UF0B 4CDUC 3HQRA 1ZZ7A 2WLPA 3D4KA 5D8AC 5LW9A 3CIHA 3IMMA 1ACCA 1MEC2 3ACLA 4D69A 4AW7A 1UL9A 1FOD2 1CAWA 4CEYB 1O3QA 4I02A 4QWNA 1DHKB 1L7RA 3A7QA 3B02A 5FY4A 4UW6A 3KZ4C 1RUI1 3AZVA 4JGZC 4CUGA 5FPBA 3QBQA 1QKQA 2VW2A 3OSDA 3BKZA 5AVPA 2YFZA 1AR82 1X82A 4Q4X3 3M4FA 1WCKA 2RS52 1HRI2 1S4CA 5T52A 1HRV1 4U2AA 5KHJA 1FT9A 1NA1C 3WW1A 3RQ0A 3BTXA 2B39A 1W8WA 2ZABA 1COV1 2WAOA 3N9PA 4AVCA 2P34A 4CTEA 3ON7A 1ULCA 2XL7A 4GXLA 3OUHA 2Y34A 3B9IA 2PHFA 1DG6A 4GQ7A 3ZDSA 4HKOA 4IGOA 1GU3A 1RGSA 5FZ6A 4PI2A 2Y0OA 2YFUA 3GHMA 3LKJA 2RG4A 2Q8OA 3N9NA 1XB9A 1AR92 3DN7A 2R063 3MLKA 3ILFA 3AFGA 2ZCWA 3CLPA 1KJLA 5L7OA 3FL7A 5JPNB 2OT7A 1U5XA 2PFWA 1UXZA 3I54A 1C5IA 3VGIA 3R4DB 4RGKA 3LE0A 4QD2A 1ZZ8A 3J7MA 4UAPA 3MHZA 5T50A 3VBFA 4COWA 5I91A 4M3CE 1O6UA 1FOD3 4IXLA 5FZLA 1RUF2 4E2GA 1FATA 3ZN6A 1R082 2WT1A 4IGPA 3IKWA 5FK8A 1REFA 1SLBA 4NO4A 3TN91 5ABJC 1OQDA 2ZGQA 3SHRA 3BPSA 1UOGA 4INDA 1QQP1 3J8F3 3K46A 3VBFB 4HVRA 4H7LA 1UOJA 2RE9A 4UBHA 5E6HA 2GNDA 2IXIA 1XU2A 5EYXA 5BNOB 4YPJA 2VO5A 1V9U3 3IDCB 4QB6A 3H1YA 1C8M3 1DZQA 4J1XA 4LBJA 4RQPC 4R9DA 2EALA 1MACA 3OY8A 4A4AA 2E53A 4KWKA 3N9OA 2YUEA 2GH2A 3K4DA 3ROUA 4CPBA 3H3ZA 1UY3A 2UYBA 2V73A 1G9BA 4GMP3 4HK9A 1TZOA 5F2WA 2JDYA 1LOCA 2W52A 3BGAA 4WM7C 5A7WA 3RYPA 1LHWA 4H7MA 2W5FA 4HOOA 4OMCA 1UAIA 2PELA 3OCPA 1H9PA 3K75B 1SFNA 3O0VA 5DUXA 4OZXA 1CZSA 3WLUA 3S0MA 2Q0AA 4Y3OA 3VBUB 2VUCA 5CNAA 1X9TA 3OGSA 4WZFA 2H0BA 3KCYA 1QJU2 4LBQD 3INAA 5CA6A 4DOUA 1W9FA 1GANA 5LA9A 3VKOA 1RUF1 1CONA 4JHTA 4XW3A 2CNAA 5A3UA 3PMEA 2J7MA 1YEWA 5JOZA 3C7GA 2VMEA 3K51A 1XNAA 2D3SA 3LIGA 4K3UA 1QGLA 2YV8A 5LY1A 4LO4B 4Q0UA 2NQYA 1PX3A 1MPXA 1RXFA 2WA3A 1QNWA 4JC1A 3E1F1 1JZ4A 4Q0QA 5C4WC 4FOQA 4IUGA 3BODA 2PYTA 3WZ1A 1SQ4A 4DIQA 2EAAA 4XFCA 2WYFA 1FNZA 1JZ8A 1H6YA 1B35B 3N7MA 4PBOA 4I3GA 4FPFA 2J1TA 1D7PM 3CU7A 3DGTA 3NAPC 5FJHA 3B94A 4ASLA 1IGOA 2JICA 1UPSA 2ARAA 2CYFA 4ES9A 3FZ3A 1KQRA 2RM23 4FSJA 1G9FA 3IDBB 1A34A 1DGWA 2P3KA 4EE2A 2XLFA 3D6EA 4LHSA 3RWNA 1DQ5A 5G04L 3Q9OA 2WFF1 2D3PA 1PVC2 4P9IA 2DVGA 1YQ5A 1S0BA 3AYAA 4AVBA 3B3QE 3MLJA 3T3YA 1GNYA 3H9AA 2H0VA 4P9YA 2OS2A 4AI0A 3PU3A 1W99A 2BV4A 3NL1A 4K20A 1MS4A 2GC1A 1W05A 4JV4A 2RVAA 3K4AA 4QGMA 1CQ9A 4W6WA 5EWSA 5B2GB 5C3QA 2H6CA 4JRLA 4LT5A 4ZU5A 1I5ZA 1UCXA 4JTNA 3H8UA 2A6VA 4IQPA 1W0NA 3ACIA 1SBEA 2VC9A 3GCWA 2YYOA 1QJX3 4DZGA 3VKLA 1NXD1 3NMBA 2OKXA 3K3OA 3CDZB 1RMU3 1VMJA 3ZFFA 3CJXA 1UX6A 1RXGA 1JOBA 4NHXA 1TQ5A 1R092 2JB8A 2X5IC 1WMFA 5FZFA 4RHV1 3ZM8A 5A3MA 1AXKA 2Q4SA 4CCEA 5FCCA 5A33B 5FZ4A 5JXGA 2FDGA 3IMNA 3ST7A 1YLLA 3EHKA 2YC4A
chains in the Genus database with same CATH topology
2PHLA 1NQJA 3MZHA 1PO13 1ULDA 3UV9A 3AKTA 2NYYA 1YJLA 3AMMA 1QXJA 1MZ5A 1DBNA 4I09A 5D8AA 1Q8PA 5FPZA 5IK8A 2VOXA 1EV11 2VQAA 3MICA 3EO6A 3KS7A 4YGEA 1G7YA 1XE8A 3HWJA 4XJAA 1WMDA 3POYA 1VALA 4UXAA 2B5HA 1SBFA 1CAUB 1CX4A 4RFT0 4KU8A 1D4M2 4B4RA 2YDEA 4GALA 3WCRA 2JENA 2WZPP 2DV9A 1HV1A 4XFFA 1VRH3 2BW8A 5AFBA 4SBVA 3MFCA 4Y22B 5J3UA 4Q2FA 1J3RA 5T54A 4AVVA 1R091 3HD8B 1OQEA 1VBE1 3HMYA 5GLUA 3GZTB 4N43C 1RHI3 3NAPB 5CFCA 2EXHA 4TLFA 3AKQA 2E7QA 4KQ7A 1QDCA 1Q3EA 2ZKNA 5FO8B 1FNYA 2HWF2 5T3NA 3U4XA 5CFCB 3WT3A 2RMU3 3M8LA 5FFOC 3BCWA 3OBRA 5L7OC 3M70A 5C8CC 2ZHKA 3JB4C 1NCQB 3KCXA 1EV12 4NWWA 4BE3A 1PGW1 1W0PA 3ZMNA 1QY4A 3I59A 2BTVC 3WNXA 3RPQA 5CIRA 2MEV3 5K8SA 2BFUL 4IEWA 1J1LA 3SCFA 5HBAA 2A3XA 4EROA 2D44A 1R083 4XFAA 1AL21 3UJQA 4XFIA 1LU1A 5FMOL 4HANA 2K2SA 4HT1T 4MGYE 1SACA 2E6VA 4IV1B 3QH7A 5J7MA 4PF5A 3O0WA 1PVXA 1U5ZA 1YHFA 3RMXA 2YGLA 3ZSLA 3HT1A 3W9AA 4NVPA 5KWRA 3GYDA 1AF9A 1FPN2 4K1ZA 2IC1A 4DFSA 4LA2A 2ZGPA 4Q1RA 1AR61 1DLLA 4Y5Z0 2RM21 3U11A 4HL0A 1O4YA 4XXPA 2Y38A 4QMAA 3CJIA 4PDWA 5ACA1 3MIDA 4XOGA 3KD4A 1HRV3 3AP6A 3B01A 2XJSA 2WLQA 4LHNA 4E4ZA 4WVZA 1MQTC 4NPRA 1TEIA 2NMNA 4XYXA 4YM3A 1G9DA 4GKYA 4QQLA 1XRUA 4RHV3 5FOJB 1VBE3 2WZR1 3MIHA 1BBT3 1F5FA 3IPVA 1B35A 1G9AA 4K6BA 1Z7S1 4FQ4A 1OA2A 1OPOA 3KB5A 1J58A 1CAXA 2P3JA 2PA7A 1AX1A 2VH9A 3LB9A 4COVA 3KT7A 3MFAA 4B3NA 3NWKA 3HBZA 4HKWA 2FBEA 3NAPA 4CDWB 4A7ZA 5BYNA 2ZX4A 5FLIA 4CP2A 4CDUB 4JDMA 3E6CC 4LO7A 1JUIA 3SMHA 4B7EA 2GNTA 4PIYA 1YI7A 5JDBA 4WVWA 5C4WA 2CGOA 4J1WA 1ENQA 3VBOB 1NCQC 4CDUA 4BM8A 1PK6A 1IPKA 5E88A 3VKFC 4CDWC 1HX6A 3AJYA 4Q4V1 1W6QB 2EIGA 3VV1A 1VJ2A 4LE3A 4R8HA 2XH6A 2XVGA 3JU9A 5JVVA 2HWD2 4JGZA 4O9GA 2WNUC 4GB33 1VBB3 3HIFA 4JQRA 2BQPA 4GH4B 4QQHA 1H30A 1ND3B 4Y26A 4P9WA 2ZJCA 3PJYA 3LSDA 1ZA4A 1LJ7A 1JBCA 3POSA 4BQ1A 2EVXA 1CPMA 2CAVA 2RR11 3PJQA 3WXPA 3PVEA 1CESA 5DDJ2 4Q4Y3 1COV3 1CN1A 2ZGUA 3ATGA 4PDWB 5C9AA 3ILNA 1LHNA 1BBT1 4E2QA 4Q0PA 1GICA 2ZX2A 1NLRA 1Z7S3 2GN7A 1AHSA 1PHMA 1BCXA 4RR3B 4BPZA 3KQRA 1WBFA 1MEC1 4WM7B 1APNA 4Q26A 1O3RA 4YARA 5J09A 1C57A 1PO11 4AF9A 4KL1A 4XIKA 3ZMOA 4E4DX 2DFBA 2DTYA 4F3JA 2A70A 2Z69A 3NV4A 4N53B 1R1ZA 1RTVA 1RUI2 1X8EA 2R6QA 2CY6A 1RITA 2GC3A 2WSVA 1AYM3 3NVCA 3WDYA 3ZN5A 4AI3A 2XBO3 1VBB2 4LBNA 3VKMA 1Z0HA 3E5QA 1VAVA 4RSUA 4XBLA 5CBLA 2PHWA 1QQP3 1WLTA 4L92A 5CFCC 1PNFA 1GZ9A 1JXNA 2QDRA 2UU8A 2VECA 3GZUC 1QJY2 3GALA 3KSCA 1N3OA 1F2NA 4EWAA 2WNVA 1OD5A 1LTEA 1RUJ2 1AR91 4XF0A 1QJX1 5DUUA 1I6XA 5C8CA 2D7FA 1ULEA 2VULA 4I0BA 3WDVA 4JRAA 2ZGNA 5CFDC 4HVOA 1H4GA 3SXWA 3QCWA 2IXKA 1W6NA 2ZGRA 1QWRA 1YYNA 2Q5TA 2GMMA 4IERA 4U36A 2VOKA 5H9RA 1VRH1 4Q0VA 1WD4A 1V9U1 1ZM1A 3AYEA 1BVVA 1UU5A 2AR6A 1RUC1 3E6DA 1N1YA 2QFEA 2CGNA 2E7TA 4LO8A 4KH9A 3A0NA 3M3CA 3KT1A 2OUHA 2QJVA 1SCSA 4QX5A 3AZYA 2CWMA 1LOEA 3M7AA 4L2NA 4XF9A 1HLCA 1ASJ3 2O0OA 1SLLA 2JJ6A 1GNHA 4Q4X2 5DZGA 1QJY1 1GZWA 5GLZA 2ZGSA 3AXDA 3AB0A 1NG0A 1RJ8A 2ZACA 2R1BA 2XJVA 5CAZA 2NPIA 2VUJA 2DCKA 3KCCA 1HKDA 1G9CA 1CPNA 4K21A 2UY9A 2DUPA 1RVF1 1LODA 2XJTA 1OA3A 2VUAA 1ENRA 3IPVB 1IZ3A 1W6OB 1OMIA 1MVEA 1YFXA 1DGRA 2VOVA 4FPGA 3WW4A 2EXKA 4V1PA 4XE9A 5K0UB 4LNVA 1DQ0A 1QJU3 2D40A 3AYCA 4AI1A 4KGQA 4AQSA 4G9SB 1O91A 1MVQA 3QACA 2UYAA 4Q4W3 1PM7A 1V6KA 2NMOA 3L9JT 4W65A 2R062 1S0JA 4WVMA 3E97A 1RUI3 1XXNA 3ZFFC 5GZEA 4DNYA 2ZGTA 1UD1A 4X6RB 1MZ6A 2OW4A 1MR5A 3I59B 2WFF3 1MS9A 2PN5A 3HR9A 4DY5A 5ACA3 2RS11 2X8KA 4WVMB 4DPNA 2NP0A 5FDBA 2PQQA 3R05A 1UKRA 1PZ7A 3AP9A 1X36A 3U10A 5AC92 3NV2A 2GDFA 3TNPB 4B4PA 1DZTA 1BYHA 2QCSB 3JD71 2CGPA 3SH5A 3J8F2 4IEYA 4JGYA 2VW1A 2ZAHA 5JZGB 1LOFC 1CR7A 4GA9A 1F8VA 2VNGA 2D6LX 2ZHLA 3N7LA 3WDTA 3ZXGA 4QPGC 2HWB2 2IXLA 1EAH2 3VBHA 3THPA 1E57A 2QUOA 4R9CA 2VNOA 3V0BA 5FQ0B 3ZXFA 1V6NA 4YVWA 3KMHA 1R093 3H1WA 4FPOB 5DG1A 1UMZA 2D43A 3AMNA 1J3PA 3NO8A 1IS4A 1S55A 2R1DA 4LO6B 4LTAA 2BVVA 4N43A 3ENRA 4PLMA 1I1EA 4R9BA 2QZ3A 2Z42A 2DU0A 2BNOA 5J98B 3APBA 1Q8OA 4QPIA 1QNYA 3J9SA 5AC91 4F83A 4JDOA 1OKQA 4YZ3A 1AR93 3WVJA 2JXAA 2VMGA 3GHNA 1K5MB 2FMYA 3D82A 5E16A 2VXRA 1AL0G 1W6PB 4AFAA 5JOXA 4AWDA 1WLDA 4CEWC 5JPMB 5FOBB 1ONAA 1XQNA 2JG9C 4IEPA 4YVSB 4K40A 3CO2A 1RUG2 1LR5A 2D6KA 4AHYA 4WM8C 2D6MA 4H55A 1UIKA 1XNDA 3QH6A 3S7IA 1AYM2 5HCAA 1ENXA 2ZMNA 2V09A 3WW2A 1PGL2 1W39A 1RHI2 1FV2A 1KDKA 5CB7A 3V56A 3BIWE 4YZ5A 1S0FA 4HFSA 4Y20B 3ZXDA 1PVC3 1MS1A 4W6YA 2JG9B 2Q1MA 1SLTA 1VBE2 1UU4A 4MV2A 1PK6B 3V0AB 1D4VB 4ITCA 4WM8B 1LB2A 5EV7A 2Z2SB 4XBQA 3I4IA 4Y20A 4WVVA 4CDXB 5FTTC 3ZFGB 4C1XA 1JYIA 3L2HA 3CJIC 1QMJA 3DV8A 4XEZA 4LLOA 2ET7A 1J1TA 4PCRA 5CADA 2DCYA 4FPLA 3N7KA 4AEJA 2DFCA 5FRAA 1WLWA 2G9FA 1RUH2 1EV13 2CWSA 3L2YA 4YYOA 1VBC1 4Q1PA 1TE1B 1AR72 3BOWA 2PHRA 2VG9A 2HJIA 1ZNPA 1KFXL 3FLRA 3I7DA 2D5HA 5J48A 1UF2C 4AFDA 5GLTA 4YW4A 4QPGB 1WW6A 2MNGA 1QH7A 4BIOA 1NXMA 4S2GA 4XJ9A 4BOWA 4AG4A 1RUC3 3KLSA 5KC5A 3B7MA 1GKBA 4C90A 1AR62 1LGNA 1D4M3 2YZ4A 4Q0SA 3WUDA 2DYCA 4ONUA 4B8EA 1IKQA 4AFCA 1W6OA 4FPHA 4AEKA 4LBKA 4C0BA 4FTSA 3RJRA 4AGGA 3P3PA 2DUQA 2ZGOA 1URXA 2D3RA 4IV3B 5J36A 5F6LB 4XJUA 1PO23 4HK8A 1JH5A 2OZJA 2XKPA 2ZS6B 3EQEA 4I0WB 1AR71 5I0SA 4I3PA 1LU2A 4IV3A 4YGBA 2WZR2 4AHWA 4GMP0 1XYOA 4TYSA 4AQ6A 5JI9A 3WD5A 3RS6A 1Z7S2 2DWRA 5AFEA 2ZTNA 4TZDA 4AQTA 4Q4V3 3ZXLA 4AFMA 5C8CB 1X8MA 2QVSB 4AHZA 2A3YA 2BNNA 2V5YA 1AJKA 1JUHA 1EPZA 4PJYA 1VBA1 3RNSA 3TN93 3R4SA 4XILA 1ZRFA 4E4SA 3ZSKA 4JGYB 4C91A 4OUSA 4B29A 2ZKLA 3AMHA 2XBO2 1ZBA1 3MW3A 2KA3A 1NLSA 2BNMA 3ZYRA 4Y24A 2AH2A 5EYYA 3M3QA 3LA2A 4FP2A 4IEVA 5L19A 1JN2P 1IS6A 2DUOA 5F5QA 2AZ5A 5L73A 4AEDB 2GSYA 4IEZA 4EN7B 4YW5A 4B7KA 2H6BA 4Q4Y1 2D6OX 3I2DA 3UKTA 2HWB3 1OOPB 3PMSA 2BGCA 2N7GA 1CIWA 1HQNA 4OULA 2XVKA 2WZR3 4QM9A 4AVAA 1MQTB 4X6QB 1V6LA 5FLJA 2DCTA 4LBOA 3OF1A 3WDWA 5K7PA 1ZZCA 5C9AC 4YM2A 1TMF2 5KHHA 4X8NA 5I93A 1AR81 4DB5A 1SLIA 3LWCA 4JGYC 4ZXKA 1RUE3 4D7SA 1HRI1 1M06G 1QDOA 2PAMA 4ORFA 1H1IA 1SCRA 3M3OA 4GIQA 1COV2 3DKWA 4MGZE 1LCLA 4G3YC 4QU2A 4BZ4A 3VBSA 1V6IA 2RR12 3ECQA 5KXDA 3IT8A 3VBHC 4MXVA 1X33A 2WS93 3VHOA 4YVWC 4Z82A 2G4IA 1AR63 2B45X 2YROA 2HWC2 3MLLA 2RS51 3QLQA 5KC6A 3C3VA 4RS5B 2MEV2 3UJOA 2BYVE 4Q8LA 1N3QA 2PLV3 3UK9A 3OJBA 4NOTA 1R081 4N53C 4MGKE 4Z1VA 4OLLA 2VW0A 1N1SA 2FZ1A 2RMU1 3GZAA 3N7JA 1AUYA 2IFRA 1ZZ6A 2UURA 3VL9A 1QH6A 4DXZA 5EZWA 2GN3A 4FO9A 3EXUA 1MS3A 2ZA9A 1WMEA 1ZRCA 4HSJA 1QOOA 3ZYIB 2CAUA 4ISRA 5BY5A 4YM0A 4XPVA 1LECA 1Y43B 2WA4A 2CV6A 2ZX3A 1H2LA 5IK5A 3ES4A 2E63A 4LUKA 5JSPA 3I8TA 3WG3A 1SFYA 1V6OA 1SDWA 2A75A 4XTPA 5DDJ3 4BHPA 1FXZA 2ZZQA 3VHPA 4HZFA 1OPMA 1UIJA 2MPFA 3S6PA 2GU9A 1C4RA 1CJPA 3AKPA 4BLJA 1DU3D 3ZX7A 1YUDA 1OQ1A 4YGCA 1NA1B 4QHBA 1ZBA3 3BU7A 1DGLA 1IOAA 4MX3A 4AI8A 1NCRB 5HCFA 3S7EA 1POV0 3VN4A 1EP0A 2ET1A 4K1YA 1I9RA 2TEPA 4AK3A 2BEOA 1C5HA 1PK6C 1VBA3 4M3CF 2LTNA 1LENA 3VKNA 5EJ3A 1NCRA 1WW4A 5JOYA 4GULA 2W0XA 3HT2A 4E9KA 1TNFA 4KNCA 1NYWA 2OPKA 3MPPG 1SEFA 4OI0A 5HXVA 4EWDA 1DYKA 3AFKA 4KWJA 5BXXA 2OA2A 1IHMA 3PVOA 5LK5A 2I2SA 2LUWA 4RS5A 1IS3A 2W08A 5JR7B 3UKVA 4XXAA 4UW3A 4EJRA 1D2SA 5H9SA 3VHNA 5K0UC 5BNOC 2IZWA 1QHDA 3ES1A 3AP5A 2DU1A 1A78A 1YFYA 2FHRA 5GZFA 1LKNA 2WFF2 3S0MA 1Q56A 2R061 3ZFEC 1Y7BA 3VZLA 4ES8A 1PVC1 3VLBB 1DQ2A 4DY3A 1GV9A 2JG8B 2VPVA 1H9WA 1Q8SA 1CGPA 5LRRA 1C28A 4HKLA 2VVDA 4RHV2 1LGCA 2RS12 5A32A 4LBQA 5I8SA 2A71A 2R042 5BNPB 2VY0A 2ARBA 4Y1XA 1FMD2 3WOGA 4YFZA 4ISQA 3RDIA 4D3WA 3D5OA 2QQPA 5FREA 1BEV3 1G8WA 4S2DA 5DZEA 1QJZA 2DCJA 4LO5B 4DRRA 3AZXA 3AZZA 1R1A1 1VBC3 4XHXA 4D7TA 3ZFGC 2X5IA 1RUD1 3VZJA 3OGGA 3WW3A 2VMIA 1ND2A 4LEJA 1O4TA 1N1VA 3JB8A 1OHFA 3FUOA 4YW1A 1RUF3 1NZCA 1QXPA 4XQDA 2A73B 3JQWA 3WP5A 5JI7A 4P5HA 1HV0A 1PZ9A 4WZCA 4Y22A 3BB6A 3VBSB 3POWA 4X8PA 1H2NA 2LALA 4AEMA 4GWNA 1BK1A 1Z78A 1CAXB 2RR13 3VBFC 4A2UA 4Z92B 4XMAA 2R072 2DVFA 1FMD1 1REEA