1LTEA

Structure of a legume lectin with an ordered n-linked carbohydrate in complex with lactose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNQSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKLLHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORAL TREE LECTIN
publication title Structure of a legume lectin with an ordered N-linked carbohydrate in complex with lactose.
pubmed rcsb
source organism Erythrina corallodendron
molecule tags Lectin
total genus 56
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1991-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lteA00
4Y1ZA 3OY8A 3W58A 2D44A 1W6QA 2KM2A 1CESA 1CPMA 1BJQA 1JHNA 5FRAA 4XE9A 3I4IA 4ITCA 1V00A 1LOCA 3AJYA 3HR9A 4RL7A 1ZA4A 3WVJA 1KJLA 1WLCA 3IPVA 3WG1A 1DFQA 1MR5A 1AVBA 2CYFA 4LBMA 1FAYA 1DZQA 1KJRA 2P3IA 3PVOA 2E7TA 1C1FA 4U36A 4M00A 1FNYA 1WW7A 3FUOA 3INAA 2UURA 1AX1A 1BXHA 1LOEA 1S0FA 1YYNA 4FOWA 1OFSA 1UN1A 4BQ1A 1S0DA 1H9WA 4Y20A 1ENQA 1GBGA 1YXWA 1IS3A 4Y22B 2DU0A 2AR6A 4YLZA 3M3QA 3OBTA 1S0CA 4YGEA 3WNXA 2ZGKA 1I3HA 5H9QA 1N3PA 2ZHNA 1SBFA 4P9WA 1KRIA 5CNAA 3ZXKA 2CY6A 3R4UA 3POYA 2OUJA 2C5DA 3LSDA 4YG3A 1SLBA 2DUPA 1S0JA 1S0BA 2SLIA 4XXPA 3AJZA 1LTEA 2GN3A 3B01A 1HDKA 4XTPA 2DVDA 1GSLA 3TAYA 4GA9A 3ZVXA 2OVUA 4AGVA 1QU0A 1URXA 1GV9A 1MZ6A 2PHWA 4JC1A 5H9RA 3WUCA 1YI7A 4AGRA 1DQ6A 1LGCA 1VLNA 2XB6C 2V5YA 4Y26A 2ZGRA 3AP7A 2VW1A 4UW4A 1N1YA 5F5QA 2A71A 3WV6A 1FV2A 1Q8VA 1F5FA 3UL2A 2GNDA 2JE9A 3AZYA 2NP0A 1N1SA 2DUOA 1FX5A 4AWDA 2VXRA 5JOWA 1F31A 1UPSA 2EXHA 2P2KA 1MACA 1V6JA 3H0OA 5GLVA 3UJOA 2UU8A 1UZZA 1PZ8A 1GKBA 1CVNA 1ULEA 3APBA 3BTAA 1MS3A 1CR7A 2EF6A 2ZMKA 2E51A 5EXOA 1LOFC 1DGLA 2D6MA 4Z8BA 3R05A 3WDTA 5CBLA 3AP9A 1GYKA 3W59A 1QMJA 1LESA 3GNEA 5JOYA 1OKQA 1C1LA 1BYHA 3D4KA 4Q1PA 2ZGOA 1TEIA 1LU2A 4DQAA 1O4ZA 2GMEA 1DQ2A 4GXLA 4XXAA 4Y1UA 1ULDA 4LBNA 3ILFA 4YZ4A 5JVVA 2YZ4A 1MS0A 1GZCA 2ZKNA 3DUIA 3WDUA 1WLDA 3VKNA 5JOZA 2JD4A 4M3CB 1CQ9A 1SACA 2D43A 1W6PA 3N7MA 4YM2A 5IT6A 1I1EA 5E8AA 2AH2A 2DURA 3AZXA 4LBKA 4K1ZA 2GN7A 4LBJA 3B00A 3FFZA 4YM0A 4FPLA 4Q8LA 3OYWB 3AZVA 1JXNA 5JLVA 1H30A 4YGDA 5JOXA 1QGLA 4XTMA 5DZGA 1UZYA 1SLCA 3ILRA 1JYCA 4P14A 4ASMB 3IN9A 3PVEA 1Y7BA 1D2SA 1W6OA 4YG6A 1BKZA 3U4XA 1AXKA 2WQZC 3A4UA 3AYEA 3M3CA 4M3CF 3LCPA 2YMZA 2ZHKA 1NLSA 2H0BA 2BQPA 4LBOA 4TYSA 1Q8QA 1AXZA 3POWA 4D69A 3O5SA 4XZPA 3CNAA 2A3YA 2WSVA 1N1TA 1IS5A 3V0BA 1QOSA 1GNZA 3NV4A 4YZ1A 3OJBA 3AYDA 4XBLA 1JW6A 1W6QB 3AZWA 2NZ9A 1LHOA 1V6LA 4FPGA 5DUWA 3FLPA 1MS4A 1HQWA 5DUXA 4XMIA 5DXDA 4GKYA 3ZSMA 5IK4A 2R0FA 4BLIA 2ZBJA 5GLWA 4YG0A 5JDBA 4AYUA 1SBEA 3WG3A 5GLUA 1V6KA 3BOPA 2E7QA 3V0AB 5GM0A 1V6NA 1CIWA 5DUVA 2D6KA 4FPJA 3PVNA 1WD4A 1GLHA 1MVQA 1G9AA 4Y20B 2DWRA 4Q26A 3NWKA 1ENSA 2PHXA 4R9CA 5CB7A 1N1VA 4PQ9A 4YZ3A 2WT1A 3T1LA 4AGGA 4FQ4A 1LHUA 1LODA 1LEMA 2A6ZA 5EWSA 2ZGUA 3POSA 2FHRA 1V6IA 3NV2A 5HCAA 4YZ2A 2ERFA 4Y1XA 3WZ1A 3AYCA 3WUDA 1DQ1A 2A6YA 2DTYA 3SH4A 2GDFA 4LBQA 3SISA 2UWBA 3FBYA 4L8QA 1JUIA 1WW6A 3WOGA 1UKGA 1VALA 1GANA 2AENA 2CTVA 3RSJA 2A7AA 1EPWA 1HKDA 1SLAA 2EAKA 4FOVA 1LOGA 3IM0A 4HL0A 1A8DA 1IKQA 3B3QE 5F9TA 1QOTA 5SV8A 3SH5A 1O4YA 1LEDA 1UL9A 1G9BA 1OQ1A 4ATEA 2ZZJA 1FNZA 3RS6A 4KBBA 2JE7A 3WCSA 1FYUA 1W0OA 2W68A 1SLLA 1G7YA 3WCRA 1QDOA 2JECA 2UWAA 2GMPA 4PBPA 1WD3A 1W6MB 1DQ0A 2ZGQA 2GNBA 4YM1A 4FPKA 2B7YA 3AXEA 2R0HA 3FLTA 1N3QA 2ES3A 2DV9A 5L73A 3HMYA 1Q8PA 2A75A 2YROA 4FP3A 1QNWA 3N7KA 1QNYA 4Y22A 3HN1A 1LECA 2EALA 1G9DA 1DYPA 1DHKB 1LOBA 1CN1A 1Q56A 2NN8A 2ZAAA 3BIWE 5DZEA 3JU9A 5IK8A 4FPHA 1IKPA 2FMDA 5EYXA 2DTWA 1DQ5A 4WZFA 3ZXFA 3M3EA 5GALA 4UW3A 2A6XA 2DYCA 1AZDA 2GMMA 3C2UA 2XG3A 1LENA 4ATFA 4XJUA 3SITA 1NXD1 4FPFA 5E89A 2ZMNA 2A6WA 2VU9A 1LOFA 4I30A 3ZXEA 3AP5A 2JDZA 2PHFA 4U2AA 3USUA 1VIWB 4NOTA 4XDQA 2D3PA 2OW4A 3FUQA 3M3OA 4DRVA 3KM5A 4CTEA 5GJ6A 2G4IA 5HCFA 1WBFA 4BMEA 4AVTA 4UW5A 5CAZA 1A3KA 2DU1A 4XHBA 2YXSA 1CJPA 5FREA 2A3WA 2DVFA 2Q5TA 2W08A 4R9DA 5GLZA 2CL2A 1DYKA 4ZXKA 3N7LA 2UWCA 4P9XA 4BLJA 1LGNA 4FPYA 1W6OB 1Z78A 1WBLA 2LTNA 2EXIA 2EXKA 1Q8OA 1SBDA 1F9KA 1ULFA 2ZGTA 2ZGNA 3MW2A 5GZEA 4XHXA 4YW2A 3A0KA 3WDWA 1WW5A 2WLQA 3N7JA 2ZA9A 5IK7A 5BYNA 3VUOA 3AYAA 1A78A 1Q8SA 4Y24A 1CPNA 1DBNA 2PHRA 2ZABA 3SNMA 4DS0A 3AP4A 4BMBA 2WKKA 1ULGA 3V0BB 3NV1A 5DG2A 3D5OA 5T5JA 1ULCA 4P9YA 5IK5A 2A5ZA 4DRRA 4M3CE 2VH9A 1LGBA 4C1XA 1W6NA 2NYYA 3AK0A 3QLQA 4M3CA 3Q9OA 3TB0A 5GZFA 4XYXA 3OY8B 2ENRA 4WVVA 4GKXA 3OGGA 1KQRA 1C57A 1AF9A 1UX6A 2D6NA 2R49A 5GZCA 3WLUA 3N36A 1S0IA 2D6OX 1UMZA 3OYWA 3IPVB 2P3KA 4ZKTB 4W65A 3M2MA 4FQZA 1DLLA 1KITA 1WLWA 1ONAA 1X50A 2P3JA 1MZ5A 3O0XA 2A70A 4Q2FA 4XBQA 4Q1RA 1LHVA 4YM3A 1S0EA 1GNHA 5EYYA 1V6OA 2PHTA 4OZXA 4YW5A 1G86A 3VV1A 1IS4A 4XJZA 3I8TA 2CWSA 1YIFA 2ZGMA 2GNMA 4AVVA 2VY0A 1GZWA 4WVWA 4Y1VA 3ZSKA 1JYIA 1CONA 5GZDA 1V6MA 4LBLA 4LBQB 5T50A 3MW3A 1G9CA 2I2SA 1S1AA 2WNEA 4XJ9A 5T55A 1YO8A 3KQRA 3MPPG 3MW4A 4XILA 1SCSA 1WCSA 4TZDA 2R1DA 2PHUA 2P37A 2VW2A 3ZXJA 3WDVA 1FATA 1H9PA 4GWMA 4XIKA 3R4SA 3WDYA 1DIWA 3MEPA 3PJQA 3GALA 3AP6A 3V65A 3WHTA 5KXEA 4XBNA 1LHWA 1JBCA 4Q27A 1LCLA 3V0AA 3AX4A 2AUYA 3RRDA 4UW6A 1LOAA 3WHUA 4SLIA 4XOGA 2R1BA 2WJSA 3VKFC 1W0PA 1HLCA 1MS1A 2PELA 1APNA 1GZ9A 1LJ7A 1ENRA 3PMEA 3T2TA 4YZ5A 1IS6A 1RITA 5DUUA 3V64A 3RG0A 2D3SA 4XJWA 4PBOA 1D0HA 2V73A 5JMCA 2RHPA 1AX2A 3T1MA 3ASIA 4K1YA 2WT0A 5T5PA 1ZM1A 4GWNA 3SLIA 1YRZA 2NM1A 5AVAA 1PZ7A 1J1TA 1R1ZA 5DZFA 2CNAA 4K20A 3ZSLA 4H55A 2OUHA 5CA6A 1MS8A 3ZPYA 2EXJA 4BOWA 1DQ4A 3ZXLA 4XIOA 4YFWA 3UJQA 2SBAA 3IKWA 3ZSJA 2W52A 1KDKA 2A6VA 4FPOB 4IQPA 1LULA 1SCRA 2AREA 5KXDA 1LHNA 2AGSA 2DVAA 5GZGA 2E6VA 1AJOA 3NV3A 3A0NA 2EIGA 4ISRA 4PF5A 4FPCA 4YGBA 3ZYPA 2DVBA 3O0VA 3USUB 2C9AA 2ZACA 5H9PA 1VAMA 5IUQA 2Z42A 4CZSA 3B9CA 5E88A 4YGCA 4YW1A 2NMOA 3AFKA 2CWMA 2R16A 1WUVA 1JN2P 5T54A 2GALA 1W6MA 4YFZA 4XJAA 1G9FA 2TEPA 3WDXA 3L2YA 4F83A 2E53A 3ZYRA 3DGTA 1W6PB 2WSUA 2NMNA 2YY1A 4FVVA 3AZZA 4RA0A 4M01A 4XJ8A 1N47A 4R9AA 4YW4A 3JUUA 4DPNA 1JOJA 1PZ9A 3N3HA 3D6EA 4FOQA 5KXCA 2JJ6A 3ILNA 5T5OA 1G8WA 2LALA 3BODA 4FP2A 4R9BA 1MVEA 4YW3A 2JKBA 4FOYA 2DVGA 1N3OA 3IMNA 3WG4A 1FV3A 2D6LX 3ENRA 2ZHLA 2ZMLA 4HANA 3RMXA 4BM8A 4PCRA 2HYKA 3O12A 2ZGLA 4Q8KA 1IOAA 3UK9A 4GALA 1WW4A 3O0WA 1W6NB 1U0AA 1QKQA 1C4RA 3ATGA 3VKLA 2P34A 2VW0A 4CRQA 1UAIA 2GNTA 2D7FA 4K21A 1B09A 2VUAA 2D6PA 2W39A 1XQNA 3OBRA 2WT2A 2A3XA 1BQPA 3B69A 4WV8A 4JCKA 4C1WA 1MS5A 5KXBA 1LU1A 4BPZA 5HCBA 1QDCA 1KDMA 2ZHMA 4FPEA 1HQLA 5T52A 4ISQA 2DUQA 4JRAA 4LBQD 2ARXA 1RINA 1AJKA 4AVSA 3LSEA 5H9SA 1MS9A 3WG2A 5T5LA 3OPZA 3RMYA 4NO4A 1GICA 1QF3A 1AXYA 3RQ0A 3M1HA 5LK5A 4Y1YA 1QOOA 4XMAA 1GZWB 2AYHA 3FLRA 1SLIA 1SLTA 3AXDA 3VKMA 4MYEA 1VAVA 1S0GA 5DG1A 3SH3A 3VKOA 2ZGPA 1AX0A 1BZWA 3QCWA 2ZGSA 1Z0HA 5GLTA 1RIRA 4DFSA 2ARBA 2YV8A 1SFYA 2D3RA 3N35A
chains in the Genus database with same CATH superfamily
1QHDA 4CUGA 2XLGA 4RGKA 2D44A 1W6QA 3EMRA 2V09A 1PNFA 1CX1A 4YRDA 1SFPA 2YC0A 2VZ3A 4MGYE 5J98B 3ZSEA 4DUXA 5EJ3A 1ZA4A 1WLCA 3BUCA 4OUEA 1VJ2A 4L2NA 3URFA 5ANNA 4B7EA 3VL9A 3RYKA 1SQ4A 1DZQA 1KJRA 2QJVA 2VNRA 4N7IA 4Q0SA 5BY5A 4LXLA 5I8TA 4SBVA 3USSA 2PQSA 1S0FA 3M7AA 1XNKA 4BQ1A 1HW5A 2HWF1 5FLIA 2V5DA 1I5ZA 2VCCA 3BU7A 4DXRA 4QX8A 1ENQA 1GBGA 2ZEXA 3I59A 2D97A 2IXLA 4LE3A 1ZRIA 3JBG2 3OGVA 4HOOA 1IS3A 2ADDA 4Y4RA 3OBTA 5JZGA 1I3HA 3U11A 4JX0A 4INDA 2VJXA 4LUKA 1CZVA 1J3PA 1R1A1 2RDQA 4DZGA 3CF6E 1SBFA 1DCSA 3ACLA 4RS5B 2WZEA 4OHYA 1XPWA 4CSWA 3H3LA 3JQXA 1NOVA 3POYA 4IE4A 5FZOB 1JZ6A 3NNLA 4H7LA 1KFUL 2Q1MA 1UOJA 2VZQA 2OUJA 5A3NA 1YQ2A 2C5DA 3ZX7A 5IATA 1SLBA 3IDBB 1S0JA 3R0RA 3AJZA 2GN3A 2HWE1 3IDCB 1GSLA 4JDNA 5IFPA 4N9IA 4UFLA 4DNYA 1QU0A 3AC0A 1FPN1 3RJRA 2BYVE 2RS12 3OOXA 3W5MA 1OLQA 5LZ6A 2JG9C 4Z92B 3CDZB 3CKHA 1YI7A 3ETQA 4BWOA 1KEXA 1DQ6A 3ZLIA 2JDPA 4QAWA 5IVJA 2VZOA 4A6SA 2ZGRA 1MZEA 1RJ7A 3NNJA 4LIVA 1FV2A 4MGTA 1H6YA 5FPAA 3UL2A 3WW3A 3MBWA 2C4XA 4GQ7A 3O1MA 4Q4W2 3UGHA 2BW8A 5LASA 1RUF1 2VXRA 2XLFA 1AHSA 2VNVA 5GLVA 2HEVF 1NCQC 2ILMA 1TVGA 4COZA 1K5MA 4FTBA 2WFPA 2RS31 1W03A 1W3VA 4Z8BA 3R05A 4ZU5A 1RUG1 1DU3D 3MHZA 4Q4Y3 2DFBA 3J8F3 1GYKA 2VE1A 3G6JB 3OSDA 4OQ8A 3GNEA 1REDA 2Q1FA 1OKQA 1CGPA 5FYVA 3D3AA 2W9XA 4ZHNA 4W6XA 3UETA 5A32A 1NCRA 1MS0A 5C8CB 3AMQA 3WX5A 4OI4A 3VKNA 1F15A 2P3YA 4ZONA 2YHJA 2EVXA 1O5LA 4UWDA 3M8LA 4KWJA 2WDBA 4YM2A 4CEWB 1I1EA 5AFBA 2HWF3 5A6ZA 5FYCA 4H2AA 4LBKA 3WF3A 5C4WC 4LBJA 3LD8A 4CDWB 1RUI1 5JUVA 1T2XA 4Q8LA 1WMDA 4CDXB 2BGOA 2FDHA 5CIRA 3OBZA 3ES4A 3S57A 5JWPA 1UZYA 1SLCA 3ACIA 2RS52 5LEJA 1R1A3 4CA9A 1MEC2 4PIZA 1W6OA 1YUDA 1NZCA 4TN7A 4V1PA 4CU6A 5BNOC 3A4UA 4QB6A 3AYEA 1XC6A 3WNPA 2VUDA 1GQGA 1NLSA 1GOFA 3E6BA 1Q8QA 4HZFA 1XYPA 2CGOA 4XZPA 2HWE3 2VNGA 3LZZA 1AR62 4D0QA 1DF0A 3V0BA 4Q0PA 1FPN3 4YZ1A 2WLPA 5FZ1A 2QNKA 1KS5A 5D1IA 5FXZA 4NRPA 4B4RA 3I3MA 3AZWA 3A22A 5F2WA 1PVXA 2VZSA 2BGPA 4MG2A 2XBO1 5DXDA 1JYNA 3SEPA 2YUEA 5I93A 2VZVA 1OPMA 3UGFA 2VGDA 4QPWA 4MGSA 2Q8EA 3ST7A 4EN6B 1XYNA 4NAOA 3I2FA 4G4FA 4PLMA 4YG0A 4UXAA 3A7QA 1H6XA 1VBB1 1RUF3 2OYZA 3WG3A 3V0AB 4JGYA 2GZWA 1V6NA 4FPJA 1G9AA 1WD4A 2CGNA 1F2NA 4K3UA 3RPQA 5FZHA 3VBUA 4TWTA 3VBHB 2RS33 5B4NA 5L7OA 1GNYA 4AGGA 2QKDA 5AC91 5EWSA 1JZ3A 1RUG3 4IEYA 1RB8G 1PM7A 4YZ2A 3WZ1A 5EJ1B 4B8EA 1POQA 2W1WA 1DQ1A 2A6YA 2JXAA 4YW7A 1M4WA 2GDFA 2YYOA 5JSRA 1V9U1 1H2KA 2UWBA 3KVAA 3SISA 3ZN4A 1WW6A 2WA4A 1BCXA 3WOGA 1UKGA 3WQBA 1QQP3 3QH7A 1O3TA 1J1LA 1GANA 3D8CA 4I0AA 1HKDA 4QKNA 4O65A 1WLTA 2JDYA 3OTFA 3BGAA 4ZZ5A 1IKQA 4OMDA 5F9TA 1QOTA 3MF6A 4ZPIA 5LB6A 1UL9A 1G9BA 5CKMA 2ZZJA 2IXKA 4WVMA 3RS6A 2O8QA 2JE7A 3WCSA 1FYUA 5DAWA 4EJRA 1HV1A 2XUMA 3WCRA 2H6CA 3S6PA 1T6GC 1CAWB 1EV12 1RUI3 2HBUA 3MICA 1GMMA 1NLRA 2GC3A 4PBPA 1DQ0A 3OD4A 2B7YA 3FLTA 1QJEA 1UYPA 2DV9A 2PA7A 3HMYA 1CAUB 1RXFA 1PO22 3NO8A 1VB4A 4Y22A 1UQXA 4RS5C 1DYPA 1DHKB 3OUHA 4NHLA 1Q56A 3BIWE 3ZN6A 3TN92 5IK8A 1W9TA 1QXPA 3T2OA 2Y33A 2WAOA 2DTWA 2GC2A 5GALA 2Z69A 5FBZA 5FKCA 2DYCA 3CZUA 2VUCA 3FL7A 3HVDA 5IVYA 4CCCA 2AC1A 4IERA 5F39A 3IWZA 4XJUA 1HN0A 5FZKA 1XXNA 3LPFA 1HB4A 2ZMNA 2XBO3 1RYYA 3BALA 1K42A 5LBFA 5J37A 4QMAA 3USUA 1GP4A 4KGGA 1VRH1 3BVCA 1H8VA 1OVPA 5E1RA 4GIQA 2E32A 2ZX0A 2A1XA 1JZ2A 4DXSA 5FZBA 1VBB3 4IE7A 3KM5A 2Q8CA 5DDJ2 2WNUA 3H9AA 3JD71 3MIEA 4LJHA 3VBOB 4Y5TA 5LA2A 1WWYA 2DU1A 4AHZA 2W94A 4HONA 4IEUA 1OF4A 5FREA 2A3WA 3CMGA 1PGW1 1WGPA 2Q5TA 2W08A 3CJIA 5FZ4A 4Y33A 1OF3A 1QJY1 3CQOA 5AC93 2UWCA 4P9XA 3CJXA 4FPYA 4QPYA 5KHKA 1WBLA 4FXKB 1HV0A 4AI8A 2EXIA 2BU9A 1Q8OA 1ULFA 1O8PA 1WZXA 1V9U3 4XHXA 2ZX4A 1B35B 1YFWA 3O1VA 1WW5A 2WLQA 2ZA9A 5F7UA 5LA9A 2X5IA 2PAKA 1S2KA 2B9VA 4KU8A 2N7GA 3VUOA 1CPNA 2PHRA 2O1QA 5ANQA 4BMBA 4DS0A 5I91A 5C8CC 3NV1A 2P6CA 4MXWA 3RVHA 3VZMA 4UT5A 1JZ4A 4P9YA 5FMDA 1GUIA 4ARYA 1C28A 1NE4A 2BOIA 3L2HA 3SKJE 4CEWC 5C3SA 3TB0A 2VMDA 1AR72 3AKSA 5GZFA 1ASJ2 1LRHA 2BJSA 3TRSB 1QIQA 2WIIB 2CU5A 2ENRA 4K8FA 4GKXA 4QQ2A 4WVVA 4X8PA 4CDWC 3H8XA 1C57A 2XLAA 4CDXC 2RJ2A 5FP7A 4PI0A 1S0IA 1ZREA 1UMZA 5LBEA 4COUA 5FPUA 4ZKTB 3M2MA 2VVFA 4IE0A 1KITA 3GJBA 5KXCA 5FYIA 1MZ5A 4YM3A 4QXCA 4N8MA 1V6OA 1GFF2 4Y3OA 4OZOA 3VV1A 5IFTA 4AF9A 1IS4A 3T4VA 3TEZA 4NUBA 2CWSA 2VNOA 5C9AB 3S5AA 2B5HA 3FHAA 3TWIA 1PK6A 2ZGMA 4Y1VA 3ZSKA 1JYIA 3VZKA 1UY4A 4HVRA 3A23A 2QFEA 2Z2SB 1RUD2 2W87A 2I2SA 3VZJA 5C3RA 3LEGA 3GBFA 5T55A 4Q4V1 1YO8A 5IJRA 1VRH3 2NLRA 4XILA 1WCSA 3VBRA 5LATA 3VD9A 1FATA 1H9PA 1W2OA 1AYM2 4J6GA 5F6KA 2JDNA 4M4PA 3JD73 3PJQA 1TNFA 3O14A 3V65A 5IVCA 3KQ4B 1OI6A 4IETA 4XBNA 3HQXA 1H2MA 4BE3A 3KHCA 4Q27A 2DDUA 4YPJA 1H4GA 4RSUA 4CP9A 3AX4A 1ZZCA 3RRDA 1JYTA 2EIDA 3LEKA 3VBHC 3DEMA 4E2SA 3THCA 4A3ZA 1CD3G 3LOBA 1HRI1 5FFOC 5CZKA 1Q5OA 5FMBA 3V64A 1L7RA 4PBOA 1BMV1 1X9TA 1EPZA 1XU2A 3FN9A 1XRUA 5JMCA 3VDAA 1W8HA 3ASIA 4K1YA 3D0JA 5JIAA 4NRMA 2BGCA 4NVPA 2VR4A 2VZRA 3SLIA 3ZFFB 1PZ7A 1J1TA 1R092 1R1ZA 5DZFA 5EZWA 3B02A 2QQJA 2O8OA 1U5IA 2OUHA 4H55A 4N7UA 4QHZA 4PQQA 3MDPA 2WNVA 1US2A 4BOWA 1NXMA 1PO11 2HWD2 3IDAA 3IKWA 1ZBE1 2W52A 1KDKA 4FPOB 4AK3A 4I3GA 2Y34A 4LK6A 1LHNA 4ISRA 2EIGA 4OHZA 1RHI1 3POJA 1MZFA 2O14A 3HBKA 5FZ8A 1C8NA 2Y26A 5H9PA 4S2HA 3JB4C 4CZSA 1QJU2 3ZFEB 4LHSA 4YW1A 4GAZA 1Z7S2 3AFKA 3RZKA 2R16A 2KA3A 2W46A 4GH4B 3OG2A 1D4M2 1JTZX 5BV6A 3OBAA 2GALA 1W6MA 5FOBB 1G9FA 1HJFA 3WDXA 3L2YA 3H3UA 3LF7A 2C24A 5ABJA 2OPKA 1W6PB 2WSUA 2JENA 2Z79A 3AZZA 1PNGA 3ZYIB 5FO7B 1OQEA 2FMYA 4MGIE 3U78A 2MEV2 2R041 5FY7A 1ZBA1 1ODNA 2FD8A 4I0BA 3N3HA 1PZ9A 4FOQA 4UFIA 2JJ6A 5FZ6A 5T5OA 2J1SA 4XQ4A 1OXCA 2EIBA 3GF6A 2JKBA 3BIEA 3THTA 5FXVA 1REFA 1CX4A 2D6LX 5FPBA 4UI9L 2VQTA 4JGZA 4HANA 4RD7A 4N53B 3JXSA 1RGSA 5FYSA 4B1MA 4BM8A 4EV0A 2HYKA 4R4XA 2ZGLA 2EIEA 3H1MA 1OT5A 5AFEA 4JQRA 4K7JA 3TOJA 3VL8A 3AMPA 1RJ8A 1TZOA 3HNBM 3VBOC 3U14A 4IESA 1WW4A 2B39A 3C7OA 4UF0A 3I2DA 1C4RA 3ATGA 4CCNA 3FJSA 3POFA 4CRQA 4QGLA 4UYBA 1DDLA 2WZR1 1UW8A 2J1AA 2VTXJ 4YVSA 4CCKA 4DINB 4XUPA 5C7GA 4LQRA 4JCKA 1HRI3 1AR81 1H4HA 4QDSA 4CU8A 1FOD2 1LU1A 5I8SA 5L73A 4BPZA 4CCJA 2BBVA 4UFMA 1KDMA 1W9FA 3LA2A 4FPEA 1UZ0A 3RGBA 4ISQA 4JRAA 4LBQD 2ARXA 4GMP0 1AJKA 5A3OA 3J7MA 4AG4A 4DXZA 1F4AA 4LTAA 1B35C 3I3DA 4I0WB 3Q8CA 4NO4A 1YQ8A 3M1HA 3T0BA 1ST8A 1PO13 3WQ0A 5C70A 3ZYFA 1K45A 3I2JA 1UY0A 3AKPA 1ZBE3 5FZEA 2QQPA 4DB5A 1UOGA 3U75A 2BTVC 3WW2A 4OYUA 1OA2A 1SLTA 3AXDA 4FFGA 4WM7A 3WINE 4MYEA 5CKQA 5A3PA 1S0GA 3EYPA 5DG1A 1RHI3 3SH3A 2ZGPA 1D0GA 2ZGSA 1Z0HA 1QXJA 2DFCA 4D6QA 2BUKA 3FBMA 2WQ4A 3N35A 4QX0A 4Y1ZA 3EHKA 4W4ZA 3THPA 3ZDSA 3OY8A 3I2HA 4PDWA 2W3JA 3NNGA 3C7FA 3O1OA 1CESA 3JBG1 1TE1B 4CXWA 5HXMA 1GQPA 4QQHA 1V00A 4XUNA 4KU7A 4RL7A 4GMP1 4IV1A 4C91A 3BU0A 2OZ6A 4G3YC 2Y64A 4LK7A 3ECQA 1Y9MA 2HLEA 1UU6A 2P3IA 2Y6LA 2E7TA 2R043 2XJSA 5K4LA 5C9AC 3NRUA 1UWWA 2R32A 1AX1A 1BXHA 3H7YA 5C8WA 1UN1A 2E9QA 4Z1VA 3ETPA 1NA1B 2BFUS 4IV3B 1A8MA 2W1UA 3BN6A 4L92A 5FMOS 1GOGA 1YXWA 2RS11 3H8OA 4UFKA 4OI0A 4OCTA 1VBA2 3M3QA 5A1FA 1KD7A 2ZGKA 4LULA 5FZGA 5FY0A 3ORJA 4URTA 1U5ZA 2VXJA 4P9WA 1MQTA 4LPLA 5A7WA 3K4DA 4JTNA 2XL7A 4Q4W1 2WO7A 3KB5A 1ENXA 1UD1A 2DUPA 1S0BA 2SLIA 4XXPA 3RZLA 1LTEA 2WZR3 1HDKA 2RM22 2DVDA 5K0UA 4GA9A 4XDPA 3ZVXA 4AGVA 1NAEA 1OHFA 4AEKA 1URXA 3WF0A 1AR83 1MZ6A 2PHWA 4JC1A 1YFUA 4QPGB 5IAVA 4BIFA 2XB6C 3ZXAC 2AACA 2JG9A 1GU3A 2VW1A 3MPBA 2A71A 3WV6A 5F3CA 4AXOA 3F95A 2Y6HA 5J7MA 4RFT0 3ZFFC 1N1SA 1BHGA 4LOTA 3MIGA 3DL3A 3WNKA 1F31A 1XBFA 3BCWA 3H0OA 1MACA 2DCTA 4PLOA 4QXHA 4WM8B 4N43B 2RJLA 1WA4A 2CAUA 4KL1A 4A7YA 1UZZA 1GR3A 1WCKA 1GOHA 2C26A 2PYTA 3APBA 4RHV2 4RN5A 3T30A 3IZOA 3K2OA 3HQUA 3ZR6A 1DGLA 4QDRA 3MIFA 4BQ2A 3NMBA 5CBLA 2VD7A 2X8KA 3I3QA 5A3MA 3T0DA 3EJKA 5EP9A 1YQ5A 3ZFEC 1QMJA 3LEMA 2WL1A 3JBG3 4GH4C 2PAEA 3RZZA 2VOWA 3KGLA 4Q1PA 4EZHA 1TEIA 2Y6FA 4DQAA 1O4ZA 2GMEA 4GXLA 1UY3A 4GMP3 4A41A 5KHGA 2RS51 5JVVA 3OGSA 2ZKNA 1MEC1 3W20A 2YU1A 4QX1A 4KWKA 5HV0A 4O9EA 2IXHA 1SPPB 1FI2A 2JD4A 2W0XA 3NKTA 4M3CB 1SACA 2D43A 3BKZA 1BLZA 5E8AA 2Z5WA 2J1EA 4AEMA 4D7TA 4Y5SA 4K1ZA 3OF1A 4MUVA 1AR61 5A3WA 1Q3EA 2QDNA 2RS13 5JOXA 3AZVA 4YGDA 4JTOA 3ILRA 3IDEA 4P14A 5I8YA 4LLOA 4ASMB 2ADEA 4ASLA 4N53C 3U4XA 1XSRA 2YBSA 3FC0A 5IYYA 3U1XA 5JXHA 3OEBA 1UZVA 2YMZA 3T09A 4LBOA 2BQPA 4TYSA 4Q4W3 3N9NA 2R30A 1UOFA 4HSLA 5ACA2 2X09A 3POWA 3VBSA 3OCPA 2A3YA 4KGQA 1N1TA 2HWC2 4W6YA 2BOJA 2V4AA 2Y6GA 1YEWA 2RDNA 4UBHA 3W5NA 1OA4A 4YM1A 4XBLA 1W6QB 4FBFA 1F8VA 4CDQB 1LHOA 4PF1A 3S7IA 3H42B 4COYA 5FLJA 1MS4A 1NUKA 4AEDA 4Y4YA 1JUHA 3ZSMA 3GHMA 2R0FA 1KGYA 2W1SA 3B7MA 3P5BA 4RQPA 4BLIA 1UYYA 3GHNA 5A7OA 5GLWA 4AAXA 1XNAA 2H0VA 1V6KA 2HJIA 2E7QA 4S2GA 4LNVA 2F17A 4TSVA 1GLHA 3GGLA 1JI6A 1QY4A 3I59B 4Q26A 4X6QB 4R9CA 5K9YA 5EQUA 1IPJA 5CB7A 5C3OA 3LEIA 2TNFA 4XCAA 2WT1A 4YZ3A 4EN7B 1LODA 1HXS2 4CXXA 1OD5A 2ZCWA 4LEJA 1QWRA 4AE2A 2WS91 4IDZA 3NV2A 4HFSA 3LE0A 3AYCA 5FZCA 1NQDA 1RUJ2 1RUE3 2ORZA 1EV11 4LBQA 4L8QA 4ET7A 5EJZB 1VALA 3Q8EA 5FZ3A 3H7JA 1OFNA 5FOJB 2EAKA 2RS53 3VLBB 1WMXA 4FOVA 1MEC3 2JDMA 1LOGA 3RZMA 1PO21 4HL0A 4Z07A 2ZPXA 1NY72 3M70A 4NPRA 5A6XA 2LRPA 1O4YA 3DPRA 1LEDA 3TN91 4EE2A 4JKMA 2QZ3A 3PHMA 2ORXA 2X29A 2ARCA 4QXKA 4QX7A 2XJPA 3J7HA 3E5UA 3PIGA 1RUH2 5FUIA 3UKNA 4BCUA 4LHNA 1SLLA 1AR63 1G7YA 1NA1C 4E2QA 5ABJB 2XWJB 4IV3C 1QDOA 2UWAA 2GMPA 1O4TA 3AL5A 5F2SA 2ZGQA 3D82A 2R7EB 1PHMA 3NQHA 2WO3A 1ZZ6A 2B45X 2GNBA 3ACHA 1YIPA 4X8NA 1BBT2 3OGRA 1RL3A 3VDCA 2F4PA 1Q8PA 2A75A 4FP3A 1W8FA 5DAQA 1HB1A 3AKQA 3HN1A 1LECA 2EALA 3ZKYA 1RTVA 3V56A 3HNYM 2ZAAA 2NN8A 4DMIA 3JU9A 2VOTA 1FXZA 3PURA 3ZR5A 2FMDA 5L9RA 5I0TA 5DDJ1 3O1SA 3DKQA 3E97A 3UESA 1ZYBA 4JHZA 4M4RA 5FY8A 4V2WA 1AZDA 3C2UA 1W9YA 2WNOA 1LENA 4XUTA 3KSCA 2QE3A 1MPXA 4NIAA 4NIIA 4AFBA 3H8UA 4QPGC 3T08A 1LOFA 2AEZA 2DCZA 1UY2A 3VD7A 2PHFA 2ETEA 5A32B 1VIWB 2E33A 1NCRB 4F8AA 1XE7A 3BTYA 4E27A 4XDQA 4IEVA 2D3PA 4URAA 4ZS2A 3OGJA 2X10A 3WP5A 5JPMB 4DRVA 2DCJA 4CTEA 4XFCA 5KHHA 3E6CC 4FFHA 2C9KA 1YC61 2BNOA 3ROUA 5K7PA 4WM8C 1A3KA 4N43C 4XHBA 3DV8A 1K3IA 2XHNA 2VQ0A 3NJXA 3I2IA 5FQ0B 4ZU4A 5GLZA 1NZIA 2CL2A 3O1TA 4ZXKA 4C0BA 1W06A 4P08A 2IUWA 3R6SA 2VVEA 2WS93 1DGWX 3KV4A 5EFUA 1OUSA 1W6OB 1Z78A 2LTNA 1AR71 1I6XA 3KF3A 4LHKA 3EB7A 1ASJ1 1SBDA 2GAUA 2XQXA 3WD5A 2YGLA 1CAVA 4MXVA 2Y6JA 2QUOA 3A21A 4IEPA 4L97A 5IVBA 1PVC2 5A6YA 1A78A 4YW6A 3WXPA 5G05L 3LOIA 1PO23 1ULGA 3V0BB 2PQQA 2ZJCA 1NG0A 2GP3A 1X8MA 2A73B 5T5JA 3TN93 4ZU7A 1HIXA 1OBNA 2LUWA 1D4VB 2A5ZA 1VBD2 3N9OA 3PUSA 4M3CE 5KBFA 2VH9A 3QBQA 4C1XA 5KR7A 3AK0A 1VBC2 2W1QA 2Y8KA 2XVKA 5CEHA 4CDUA 4RR3A 4E2GA 2BVVA 5IAXA 1AR92 3KF5A 1RVF2 1VMHA 5GZCA 5FPZA 3MZHA 4CDWA 3N36A 4YARA 1RUD1 2QQVA 5LEKA 4JGYB 2JDAA 2CDPA 3I2OA 2QQOA 2P3KA 3IPVB 3HWJA 3P6BA 4FQZA 1OLRA 4Q4X2 1WLWA 3KCXA 2P3JA 1E5SA 2A70A 3O0XA 4XBQA 4Q1RA 3VBUB 1AYM1 3ES1A 5DDJ3 4OI1A 4CEYB 3U0ZA 2XKOA 4B1LA 3ZFGB 2LM3A 2YB7A 2RE9A 3VBFB 5A7NA 1YIFA 5JPNB 4WVWA 1W8TA 3E6DA 5CYYA 1LB2A 4AHWA 1CONA 1O7FA 5GZDA 3RI9A 1UY1A 1YJLA 2PLV2 4MZUA 1EYBA 5D21A 4CDQC 3OPTA 5C6CA 3GM8A 1S1AA 2LS6A 2GU9A 3MW4A 3PL0A 3VHOA 1WCUA 4GD4A 4KNCA 2R1DA 2P37A 3VDBA 3PMSA 1DZTA 4IUGA 2CGPA 3BOWA 5CFCB 4PHZA 1X33A 3MEPA 2WFF2 4D6SA 4TLFA 5LA1A 2BRTA 1R091 1LHWA 4BQ4A 1ACCA 2O0OA 1LCLA 4KMQA 3V0AA 3PU8A 2AUYA 5F32A 2BEOA 4UW6A 2HWD1 3KS7A 4JDOA 1SHWB 4NR1A 4XOGA 4Q4Y2 2R1BA 2VTXA 3ZYJB 2VBPA 5L9BA 1NKGA 2XHKA 3KWVA 4HK9A 3IAQA 3ACFA 1APNA 3LWCA 4OVEA 4AVCA 1GZ9A 2HH9A 3PMEA 4NHMA 4YZ5A 1IS6A 3N9PA 3NJYA 4W6WA 1AR73 4XJWA 2I07B 1V70A 2R6QA 1ASJ3 1SG3A 2RHPA 1Y9QA 1AX2A 3T1MA 3JQWA 3P1IA 4QX5A 5T5PA 4ZY9A 5AVAA 1QJU1 3E5QA 1Z7S1 5JXIA 4K20A 4L99A 5FJKA 4GZ9A 3UYJA 2Y60A 4EN0A 1Y4WA 5CA6A 3W9AA 3ZIXA 2Q4SA 2VPVA 1ODMA 3H1YA 1VR3A 1ALYA 2A6VA 2ZKLA 4QU2A 5DQ0A 1LULA 2AREA 2RV9A 3ZYBA 1X7NA 2BDRA 2E6VA 3A0NA 5GZGA 4PF5A 4FPCA 3N9QA 1W04A 3O0VA 3USUB 1O8SA 2MEV1 2JG8B 1GQHA 4IEOA 1VAMA 4IXLA 2QQIA 2VOVA 3HOBA 5FWJA 3WP3A 5A7SA 4OI2A 1AL22 2CWMA 2WNUB 2V4VA 4FTEA 1RUD3 2K0GA 4DXTA 2WYFA 3DYPA 1BEV2 1QEXA 3KHBA 3KZ4C 5JR7B 4XJAA 1P8JA 5CISA 3JZVA 3ZYRA 3DGTA 2ZEYA 2FCUA 2OS2A 5DPNA 2IVJA 2VMEA 1AYM3 2YY1A 3MUY1 3O1RA 5A33B 4M01A 5FWEA 4Y5Z0 1COV2 5F5AA 4D8MA 3VHRA 4YW4A 4COWA 5A3TA 2IXCA 3JUUA 5DN2A 4AL9A 4ASKA 4HVOA 2WO1A 3VHPA 3SHRA 2P4EA 4HT1T 1JU4A 3NNFA 4MX3A 4R9BA 4CPBA 4CU9A 3VDDB 2DVGA 1N3OA 2PXJA 4LOSA 2P1BA 4FO9A 1FOD1 5JIUA 1VMJA 3ENRA 1NCRC 1OQDA 3KV5A 2ZOEB 4MXWB 5FBJA 1KS4A 2WABA 4TTGA 5LRRA 4HBNA 3VN4A 2C0ZA 1R093 3UK9A 4HMZA 4P9GA 2LW8A 2W47A 1U0AA 1QKQA 4XFAA 3S30A 3FFQA 3VKLA 5BPXA 5K8SA 3NSTA 1ZA7A 3VBOA 2HWD3 2VW0A 5C5TA 1UAIA 2GNTA 2D7FA 1UZWA 2VUAA 4K21A 2D6PA 3X29B 2W39A 1POV1 5LBCA 2JICA 4C1WA 1MS5A 4NE9A 2VMIA 4M0HA 1D2QA 3IAPA 4QWNA 3GYDA 5FIXA 1W2UA 3NNMA 1QQP2 1U12A 1YHFA 2R062 4XPVA 5F3GA 2Y38A 2DUQA 4BH9A 3WP6A 2WA3A 1QJU3 3LSEA 1Z7S3 2BWAA 2D5HA 2VTFA 4OHWA 3WG2A 5C3PA 1PGL2 1GICA 1QF3A 2ZTNA 5BNNB 4FI9A 5LK5A 4Y1YA 1PK6B 1QOOA 4CYDA 1WKYA 4C90A 1UYZA 4LITA 2JDUA 4I09A 1DLCA 1VAVA 3PUAA 3JCIA 4XCBA 1AX0A 4NIGA 2MEV3 3D0SA 3RYRA 3VBRB 4DFSA 4MHRA 2YV8A 4BYYA 1VAKA 5D8AB 3WY6A 2Z4FA 2QQLA 2UY8A 4BQXA 3W58A 4O7XA 2KM2A 3BYWA 4JGYC 4AR2A 3TEWA 4JVAA 4XDOA 3UV9A 3I4IA 2D5FA 2WUHA 3HR9A 4CP9B 3WVJA 2NQYA 5HI0A 3VBUC 2XMLA 4UOJA 1MR5A 2RMU2 2CYFA 4I02A 2HWB2 4CEYC 4FXGB 4LBMA 4QHBA 1W05A 3ZFGC 4IGPA 3FUOA 1Y9GA 3VBFC 2UURA 4F7ZA 2RG4A 1LOEA 1YYNA 1UNBA 1QJY3 5FJHA 1H9WA 5M0TA 4Y20A 5C9AA 2RM21 2VECA 4QPIB 1RMU2 1A34A 1H8TB 3OEAA 4YVWA 1R64A 2AR6A 1FOD3 2DU0A 3IIIA 1S0CA 3NAPB 3WNXA 3LFIA 3AVRA 5H9QA 3FHQA 5FXWA 2ZHNA 4KI5M 2VBBA 3BTZA 3ZXKA 1I9RA 5CFCC 5FY1A 3MIDA 3O7OA 4XUOA 4GB32 1I5PA 5A80A 2VULA 3H50A 4MGKE 5JSOA 1JS9A 1S4CA 3LSDA 1TG7A 4YG3A 3I49A 4S2FA 3ZYHA 2BZDA 3GZUC 3B01A 4H3WA 4XTPA 3TAYA 2OVUA 1POV3 4RHV1 1VBE2 3P3NA 4ZXEA 2ET7A 4AGRA 1O3SA 4IEZA 3WUCA 2D93A 1LGCA 2P6HA 5FK7A 2V5YA 2BVBA 3IMMA 4UAPA 4Z2AA 5FR3A 1UXXX 4QHOA 1N1YA 2QQUA 5F5QA 3LKJA 1Q8VA 2GSYA 1F5FA 2JE9A 1FMD2 3AZYA 4L11A 3T2QA 3K3NA 4A7ZA 2DUOA 1W2AX 1ZRFA 2VMHA 5DAXA 1V0AA 1FX5A 3ACGA 1AYN2 4MVTA 4EYUA 1ZRCA 5LRSA 3C8XA 5JOWA 1T6BX 1UPSA 2EXHA 3ZFFA 1QH6A 3N9MA 3I2GA 4XUQA 3UJOA 4KWUA 5JI9A 2UU8A 2OXBA 5C71A 1PZ8A 1GKBA 1CVNA 1ULEA 2VUJA 1PMIA 2VBDA 3CU7A 1MS3A 1CR7A 2GH8A 3PTYA 5FTTC 4A44A 2DBNA 2D6MA 2FCTA 3MV01 2R072 5IHRA 3WF1A 4MO3M 2DBIA 4JGZB 2JG8C 3NKGA 1YI9A 1ND2B 5E16A 3SXWA 1UXZA 1CZTA 4Q4V3 1HB3A 1LESA 4GWJA 2WNUC 1DGRA 1C1LA 4P9JA 3D4KA 1CAXB 5CVRA 3ZFEA 1PIV2 4NJ4A 1W28A 1JHJA 1DQ2A 4GH4A 1ULDA 4Y1UA 1IZ3A 2YZ4A 3DUIA 2VZTA 2XJQA 3MIHA 1WLDA 2YBKA 1XNCA 5FYYA 2VZPA 1XU1A 2XGXA 5FYMA 3SEEA 3SQOA 2EAAA 3ZOIA 2B46X 3ZO0B 1W6PA 4ONUA 3RDIA 1JODA 4CCOA 1ND3B 3ZDVA 3POGA 2QCSB 5ACA1 5FCCA 2AH2A 3AZXA 4XURA 5HCHA 2GN7A 4XF1A 2RM23 2HWC1 3ZM8A 5BNPB 1Y3TA 3H1WA 5FZDA 4RGAA 4YM0A 2I45A 4FPLA 1OOPB 3OYWB 5LBBA 3VDDC 4CCLA 2JE8A 5JLVA 1QGLA 5DZGA 3POBA 4NPLA 1Y7BA 2FDJA 4LHLA 2XONA 1D2SA 1JZ7A 1CJDA 4NWVA 1BKZA 2K2SA 1AXKA 3R4DB 2WQZC 4L0PA 5A7PA 4BA6A 5CFDA 4M3CF 4BISA 4WM7B 1O91A 2ZHKA 4ZZ8A 4J1WA 2H0BA 1TME2 1AXZA 4BIOA 1DGWA 2FDIA 4D69A 3O5SA 3CNAA 2WSVA 4LO4B 3G7DA 2JD9A 5SV5A 2JKXA 3TNQA 4RHV3 3GXUA 3AYDA 1H0BA 4PDWB 1YFYA 4XC9A 2NZ9A 1V6LA 1ZRRA 2JEMA 2IXIA 4CUBA 4FPGA 4XF9A 2OPWA 5DUXA 1HQWA 4XMIA 2GC0A 5A3UA 1HXS1 3PIJA 4IV1B 1XNTA 1W90A 4QKFA 2YDEA 2ZBJA 3U07A 5A7QA 2XJVA 1RUJ1 1SBEA 2JX9A 1UPIA 3B93A 4M0NA 2PTMA 3GJAA 4LE4A 5GLUA 1J84A 3C7HA 1XJAA 4CCDA 3AFGA 5BNNC 5IVEA 3MGUA 2ARAA 2ZX2A 1PK6C 1EP0A 1ZVFA 4KG8A 4P9LA 2CAVA 5DUVA 5GM0A 2FDKA 2HYXA 3NWKA 1ENSA 1NY71 2PHXA 3GDBA 1ZBA3 1N1VA 4PQ9A 4FQ4A 1LHUA 4AFDA 4EROA 2ZGUA 1OMIA 4L9BA 3VBRC 5HCAA 2ID4A 1O5UA 3B94A 1C8M2 1RUH1 4OQ9A 1H1IA 4Y1XA 5D8AC 3U4SA 3UT0A 4B4PA 1MQTB 5A7WB 3SH4A 4CP0A 2J7MA 3TBDA 3HIFA 3ZMOA 4P5HA 3TNPB 3FBYA 2VCAA 4LO5B 1JUIA 1W8NA 5CKNA 1BBT1 1EPWA 1SLAA 3RSJA 4CU7A 2E63A 3IM0A 5K0UB 4BHPA 3T2PA 2MHFA 4EZ4A 3C7GA 3EXUA 5SV8A 1NQJA 1L3JA 5FMCA 4ATEA 1O6UA 5FY9A 4KBBA 5ACA3 2OT7A 4CUCA 1EAH2 1W0OA 2WWSA 3KV6A 2HWC3 4NN0A 4XFHA 1UOBA 4E4SA 5HBAA 2VMGA 3CL1A 4QPIC 3AM2A 2XJRA 1NA1A 1H8TC 1S55A 1ULOA 2YBPA 3AXEA 3NAPC 4D7YA 4IV3A 3NL1A 3N4MA 4AZZA 1D7PM 2YROA 3PNAA 1QNYA 1CN1A 3ABZA 3LIGA 3POIA 5DZEA 1DYOA 1VB2A 2FQPA 3HN3A 3WNLA 3WF4A 5FKBA 4NHKA 1DQ5A 2QQMA 3ZXFA 3CBNA 2Q8OA 3RWKX 3Q8FA 2A6XA 1R082 3RZHA 2GMMA 2UY9A 1NCQA 2WC2A 5DAVA 2XG3A 4RGGA 4ATFA 3C3VA 1NXD1 2XDVA 4FPFA 1OPOA 5E89A 3ZKUA 1Y43B 2A6WA 3DXUA 3NW4A 3ON7A 2JWPA 3OUIA 1DGRN 1HXS3 1IG0A 4I30A 3AP5A 1XOYA 3ZXEA 2PN5A 2XPJA 2BBAA 4DY5A 3NJZA 1BVVA 3WNMA 4QPGA 1HQNA 4NOTA 2OIIA 4AAPA 1RUJ3 2NPIA 2OW4A 3FUQA 3KVBA 3M3OA 2VMFA 4MLOA 2BP6A 4UFHA 3RJ2X 1LKNA 5GJ6A 2G4IA 4QM9A 4BMEA 4AVTA 2B42B 2VCMA 1PVC1 4AOCA 4UW5A 4W50A 2CDOA 1TMF2 4MHUA 5CAZA 5FZMA 1UIJA 3SMHA 4XW3A 1CJPA 4WM8A 1UMIA 4CUAA 4N43A 3KCCA 1AUYA 4YWAA 3KT7A 1DYKA 3LA7A 1VBD1 3IB3A 2G9GA 2IFRA 4BLJA 5J1XA 4JGZC 4V2VA 1RUH3 1ND2C 3HJRA 1VBC1 5FO8B 1LAJA 5C4WA 2EXKA 2XJUA 3LPGA 3MW2A 2ZGTA 1AR91 2ZGNA 4LKFA 4ZS3A 1H2NA 3A0KA 2JIJA 2UYBA 3WDWA 1RVF1 2BV4A 5A1LA 5BYNA 4JQTA 5IWFA 2XOMA 1BBT3 1HRV2 3Q8BA 3SC7X 1Q8SA 1YJKA 2ZABA 1DBNA 2VMCA 4HETA 3SNMA 1QH7A 3VBSB 3AP4A 2WKKA 2VL4A 5DG2A 1W8ZA 1OLME 4Q4X1 2VC9A 3GZAA 1UU5A 3D5OA 5C5UA 2ZX3A 5BNOA 3WQ7A 4DRRA 4HK8A 1ND3C 4AEDB 1LGBA 4BZ4A 5JXGA 1SPPA 1W6NA 2NYYA 4M3CA 5E6HA 4XYXA 4Q5OA 4RQPB 5BNPC 2GP5A 1OOPC 1KQRA 1UX6A 1AF9A 4PI2A 2R49A 3OB8A 2PLV1 5F6LB 2XWBB 1SZBA 2BERA 4XAEA 1WCQA 4W65A 2WR9A 4Q2FA 1X50A 4HPKA 1LHVA 4WM7C 2OQ6A 5EYYA 2PHTA 3VZNA 3SKVA 4YW5A 1G86A 2WFF1 4IGQA 4Z82A 4D3WA 3O1UA 2OZJA 4XEZA 4I2OA 4AVVA 2W95A 1GZWA 5I0SA 1C5HA 1KXGA 4HN1A 3IBMA 1V6MA 4EN9B 4LBQB 1C3HA 4PDWC 5JZGB 4Q4Y1 3DYMA 1GP5A 1JZ8A 3MW3A 1G9CA 4CE8A 2J1RA 1W99A 1WCDJ 3KQRA 3K4AA 3MPPG 4JHTA 3N9LA 1SCSA 4CDQA 4TZDA 1K12A 4IV1C 2VW2A 4NWWA 3ZXJA 2WN2A 3GCWA 4GWMA 4XIKA 3R4SA 4AVAA 1XNBA 3DPRB 2ATFA 2B9UA 2DF7A 3AP6A 5FO9B 3SCHA 5KXEA 1PVC3 4XF4A 2G19A 5A3LA 3FMGA 4N90A 1RXGA 5HXVA 3WHUA 1QJX2 2W92A 1LOAA 4SLIA 1GWLA 1FT9A 2WJSA 3VKFC 5J09A 2RDSA 1MS1A 2PELA 4AI9A 4EN8B 1PGSA 1VBD3 4KG0A 2XKPA 2YC2A 3T2TA 5J96B 4A6OA 1RITA 2RR12 4CPBD 4EQVA 1VBC3 4Q0UA 2XUEA 3TYJA 5EIYB 1AR93 1D0HA 1MQTC 2V73A 4LA2A 4LORA 4JRLA 4J25A 5F1RA 4AI1A 1O59A 4O61A 1RVF3 2QBXA 5D2AA 3K46A 4FAHA 5CG8A 5ERLA 1AL21 2G1MA 3ZSLA 1MS8A 1YNAA 1BEV1 1X8EA 3LB9A 5K0UC 1DQ4A 2QTWB 1K5MB 4Q4X3 4XIOA 3UJQA 3WW1A 3ZXLA 2ZZQA 4PIXA 1IQDC 4RS5A 1SCRA 2AGSA 2DVAA 5FZOA 5LW9A 1AJOA 2V72A 1F5JA 1JYVA 1LR5A 4YGBA 3ZYPA 2E31A 1VP6A 1COV1 2C9AA 3UKVA 2J22A 1RUC2 5I0UA 2Z42A 3PLQA 4K9SA 2Y0IA 1X82A 1HB2A 3LFMA 3BI3A 2PLV3 2NMOA 2DCYA 2JIGA 5KC6A 1WUVA 1JN2P 5T54A 3S0MA 5FP3A 2HEWF 4YFZA 2XJTA 1LNSA 2E53A 4XETA 4CXYA 1UF2C 5FUNA 2NMNA 4FVVA 4Y26A 4KQ7A 2WFF3 2HKXA 2PFWA 4QGMA 2EA7A 5FUPA 4DPNA 1JOJA 4AW7A 4A4AA 3D6EA 4OLLA 1W3XA 3ILNA 4D94A 1QXRA 1G8WA 2LALA 1CAVB 5EV7A 4FP2A 3K77A 1MVEA 1EY2A 3WG4A 2AEYA 4C8DA 2ZEZA 2ZMLA 1EV13 3GBGA 1S2BA 2FCVA 2ZS6B 2CHHA 3RMXA 1QQP1 3NJVA 4AFCA 1W8UA 2R061 3O12A 3VD3A 4A42A 1U5XA 3LDKA 4Q8KA 3ZYGA 4OHXA 1IOAA 2FBEA 4A2UA 2JB4A 2QDRA 4GALA 4P9IA 4QB2A 1PGL1 4K6BA 3PUHA 4CDUB 4RR3B 2P34A 4ES8A 4LKDA 3T0AA 5C8CA 1BVP1 5LCWL 2A3XA 5FZ0A 1BQPA 2C6SA 3B69A 2RVAA 1RUE2 3E5XA 5KWRA 2YPJA 1US3A 4YNIA 1JZ5A 5FQ0A 4DEQA 3JB8A 3ZXGA 1QDCA 4P5YA 4CEWA 2BWCA 3DKWA 1HQLA 2IZWA 3FHIB 4K8RB 3VZLA 4HVQA 1RINA 3FWEA 2IXJA 1H1AA 3DYOA 3WR0A 1AL23 4CDXA 3RMYA 1M06G 3VBSC 1AXYA 1GP6A 1BEV3 1PX4A 3CHXA 1JOPA 3KLSA 4IW3A 4META 1OA3A 1VE0A 3RQ0A 2BNNA 1NYWA 4P02B 2BFUL 5L7OB 1UIKA 2TBVA 3CO2A 3WQ1A 4N9HA 4NHYA 4BDVB 5LA0A 4QKBA 5FMOL 2RMU1 4QT6A 3VKMA 4CCEA 2HWB1 2TUNA 1JU3A 2ZEWA 4AEDC 5FAXA 3KGZA 1COV3 4P00B 1F35A 1OKOA 5FP4A 3VKOA 1HJGA 3QCWA 4XFIA 5GLTA 3U37A 4AI2A 2ARBA 4RQPC 1W39A 1BK1A 1GWMA 1XSQA 4H7MA 1SEFA 1QJZA 2VG9A 1SFYA 5FZAA 4DUVA 4LA3A 2L9LA 2F4LA 1UX7A 3K51A 1YFXA 1RMU1 1CPMA 1BJQA 1JHNA 5FRAA 1ZZ9A 1ZZ7A 4XE9A 5FK8A 3UKTA 4A7KA 4ITCA 1LOCA 1RUOA 4DOUA 3AJYA 2Q30A 5CADA 3F2ZA 1XE8A 1KJLA 5FPLA 3IPVA 3WG1A 1DFQA 4WVMB 1AVBA 3HQRA 4FCAA 1FAYA 1OVSA 3PVOA 4GB31 1C1FA 5JI7A 4U36A 4M00A 1FNYA 1PM4A 1WW7A 3INAA 4CEYA 4FOWA 4JZRA 1OFSA 2RJKA 3J8F2 2QZ2A 1S0DA 4IEXA 4LO8A 3ZFGA 5C3QA 3VBFA 3ZN5A 1VMFA 3K75B 2K9ZA 5JZGC 2Y0OA 3MO4A 3VBHA 1ZRDA 1VBE1 3PTRB 1YQCA 2AZ5A 3HBZA 4Y22B 4YLZA 1IG3A 2X05A 4YGEA 1ZX5A 5LWBA 3ZN6B 2J1TA 5B2GB 4XVHA 1N3PA 4Z2WA 3THDA 2R063 3MLKA 4NMIA 5CNAA 5FYTA 1KRIA 2CY6A 3DPRC 3R4UA 4IEWA 1FMD1 2E7AA 1D4M1 3Q8AA 3GBWA 2WINB 3U10A 4DUWA 3KT4A 3CLPA 4R4ZA 5CFCA 1AYN1 2W5FA 2LROA 2HWF2 4HG6B 4MSVA 3RFRA 1GWKA 1TNRA 2WS92 3WF2A 1JYWA 4BK4A 5A70A 2WRAA 4XZUG 1GV9A 2VZUA 5H9RA 2HBTA 4QQPA 4D6RA 4MGQA 1VLNA 2JB8A 2R071 1R1A2 2MPFA 3FE5A 4I01A 2ZXQA 2CV6A 2QQKA 3AP7A 1J3RA 4MOAA 1W8OA 4UW4A 1CAWA 2GNDA 1CWPA 2NP0A 4EWAA 4AEJA 4PJYA 1UCXA 4JV4A 3MLJA 4AWDA 2P2KA 5KXBA 1PIV1 1CAUA 1V6JA 1WMFA 3ZPOA 5IVVA 1K5MC 2HWE2 2YC4A 3CJIB 4NRQA 4C0HA 4CP1A 3AMHA 5IK5A 3W21A 1FPN2 1POV0 3LDRA 4FFFA 3BTAA 5KHJA 4PIYA 2IFWA 3O1PA 2RMU3 2EF6A 2HWB3 1W9SA 2IWGB 2ZMKA 2E51A 5EXOA 1LOFC 4O9GA 2FDFA 3UGGA 3WDTA 1XNDA 5DAPA 1H2LA 3UNPA 1OD3A 1GZTA 3AP9A 5FZ9A 2G9ZA 3W59A 2X5IB 2JG8A 3IT8A 1RMU3 5JOYA 3KD4A 1BYHA 4LMFA 1ZNPA 1RUF2 2RDRA 4E9KA 5AVPA 2ZGOA 4JDMA 3T3YA 5I0RA 1LU2A 3I7DA 4XXAA 4LBNA 4LUMA 3ILFA 4XQDA 4PT6A 4J1XA 4YZ4A 1GZCA 5JR2A 3WDUA 4IL7A 1EUUA 3PDQA 1RC6A 3AB0A 5JOZA 2RS32 4GB33 1CQ9A 3N7MA 1TME1 4XFFA 4AQTA 4XFBA 2WN3A 1RUG2 4IE6A 5IT6A 5A33A 4B4QA 2DURA 4BQ3A 3B00A 4OFGA 3FFZA 1VBE3 1JXNA 1H30A 4XTMA 3RI8A 3WW4A 1JYCA 3FZ3A 3IN9A 2XXZA 3PVEA 5G04L 3K4ZA 3VDDA 3POEA 4YG6A 2WYSA 4NROA 1UYXA 1E57A 3OPWA 3M3CA 1FMD3 4A45A 1D4M3 3AMMA 3LCPA 4B3NA 2HEYF 1B35A 1JOBA 2YGMA 1SMVA 4BB3A 4BXSV 1AYN3 3AMNA 4DO0A 1SDDB 4CDUC 4RR3C 3J7LA 3KCYA 3K48A 1IS5A 1REEA 3LQCA 4KBZA 1QOSA 3S5QA 1GNZA 1RUI2 3NV4A 2WZPP 1STMA 3OJBA 3E1F1 1JW6A 3AKTA 1E5IA 5DUWA 3FLPA 2R073 4AQ6A 2JDHA 4GKYA 4WZCA 5IK4A 4QX3A 3HD8B 3WNNA 3VZOA 1C8M1 2H6BA 4AHXA 5JDBA 4AYUA 1VBA1 2CSGA 4FFIA 3T4HB 3BOPA 3PVBB 1PIV3 4AQ2A 2G9FA 2JDKA 5FY5A 5KHIA 1CIWA 1VPHA 2D6KA 2VVDA 3PVNA 4QX2A 1MVQA 3NVCA 3TEXA 5L7OC 5BNNA 2VZ1A 1IPKA 4Y20B 2XQRA 3BTXA 2DWRA 5FXXA 4F3JA 2YU2A 2XVLA 1U5YA 2WAAA 4HLTA 4HXCA 2K46A 2MNGA 4QKDA 4YVWB 3QOPA 2XBO2 5FYBA 2KXLA 1NE6A 3T1LA 2IVIB 1LEMA 2A6ZA 4Q29A 3POSA 2FHRA 1V6IA 1EAH1 4OHVA 2ERFA 4JAAA 5JSPA 5FZFA 3DN7A 3WUDA 2DTYA 4RYDA 5APAA 1J58A 3MFCA 4AHYA 4D7SA 1VBB2 3AVSA 5CG9A 2WNVB 5D8AA 4FTSA 2AENA 2CTVA 2ET1A 1H1MA 1OC1A 2A7AA 5DABA 1YWKA 3MF9A 4RFRB 2X53S 3SCGA 5EHDA 4XAAA 2FZ1A 4ES9A 3S7EA 1A8DA 5FV3A 1WA6X 3B3QE 2WO2A 4GULA 4NAMA 3SH5A 4EWEA 5JCTA 2KD7A 1OQ1A 1TME3 4JKLA 2VQAA 5AC92 1FNZA 3ZIWA 4E4HA 1A6CA 3DF0A 2W68A 1R081 2J42A 2JECA 1V9U2 3HT1A 4AFMA 2QQNA 1WD3A 1W6MB 1ZZ8A 2IC1A 3DXTA 3LDBA 5F3EA 2P17A 3ITQA 2Q1ZB 3CEWA 2R0HA 4FPKA 1IPSA 1N3QA 1XYOA 2ES3A 3DECA 4QD2A 4QPIA 5BXXA 1UMHA 1QNWA 1H8TA 3N7KA 4BQWA 2FZ2A 3NAPA 2VOXA 4LKSA 3BPSA 4K40A 1JYXA 1G9DA 3BPZA 1LOBA 5J36A 1J59A 1TQ5A 2OKXA 4IE5A 4FPHA 1IKPA 3HT2A 2W91A 5EYXA 2BPA2 1YCIA 4WZFA 2ZAHA 1X36A 3M3EA 4QQOA 3M4FA 3GZTB 4UW3A 4BQ5A 4S2DA 1TMF1 3P3PA 1HN1A 4FSJA 3EBRA 3KT1A 3SITA 2W2IA 4QM8A 4QQLA 2VU9A 4BU2A 4QXBA 4KH9A 2J1VA 2JDZA 4U2AA 1IGOA 5FYHA 4IEQA 5I0DA 1C8M3 5HV4A 1VBA3 4UF0B 4NIDA 3FX3A 3MI8A 1RUNA 4W8JA 1OSGA 5HCFA 1WBFA 3CIHA 4PLNA 3OUJA 3RZJA 2I74A 3HEIA 4WVZA 1HRV1 1ULPA 3HAGA 4EWDA 3CJIC 4YVSB 2XL9A 2YXSA 2VOKA 3QACA 1W8WA 4A3XA 2XH6A 2DVFA 3ZMNA 3BB6A 3PU3A 4R9DA 3WP4A 4QU1A 3VGIA 3N7LA 5A1AA 4HKLA 1LGNA 5TSWA 1VRH2 1EAH3 4BJ0A 1IHMA 5GZEA 1F9KA 2X5IC 5CFDB 5GKAC 3MV11 4YW2A 1ND2A 3JD72 1JH5A 3N7JA 1K5JA 5FP8A 5IK7A 2YFUA 4R8HA 3AYAA 4Y24A 3KV9A 1CAXA 3C7EA 4LLFA 4N53A 1DZRA 1PGW2 1NT0A 1W0NA 1QJY2 1ULCA 1XE0A 4LIUA 1OLMA 4UBGA 3KMHA 4AI3A 5IVFA 3VHNA 4XF0A 4E4ZA 4MGZE 3TEYA 3J26N 3QLQA 3Q9OA 1R083 4HKWA 3WEZA 1ND3A 3OY8B 4LKEA 2B4KA 4LO7A 2WWJA 1WMEA 3VD5A 5L36A 1PMHX 3OGGA 1O3QA 4YYOA 2D6NA 1Q43A 3WLUA 3MLLA 4JKKA 4DY3A 4TLGA 5BNPA 5T3NA 2D6OX 1F4HA 1OOPA 3M3IA 4MADA 3L9JT 3OYWA 1HX6A 5F5IA 3IIAA 1DLLA 1DP0A 3RNSA 1ONAA 2KR2A 5ISLA 4IGOA 1S0EA 1GNHA 3WNOA 1XB9A 3B5LB 5BNQA 4OZXA 5FY4A 1EUTA 3MFAA 4AVBA 4XJZA 3I8TA 4BK5A 1UU4A 1TMF3 2GNMA 3LIHA 5JMOA 2VY0A 1OURA 3ME2A 5FLHA 5FZLA 2YPDA 1QJX1 2VCBA 4MH0E 4LBLA 4LR4A 1O3RA 1G6NA 5T50A 4OUMA 4XJ9A 2OX0A 2WNEA 2YFZA 5F8PA 5IW0A 1KFXL 4XACA 4E4DX 2RR11 3ALQA 4OULA 2PHUA 3K3OA 3I97A 3WDVA 4NHXA 1E5RA 3GZEA 3WDYA 2Q0AA 1DIWA 3GALA 3WHTA 2F6BA 4CVUA 2PHDA 2P5BA 3I2KA 1HRV3 2PAMA 2VM9A 5C33A 3EQEA 1JBCA 3HPNA 4WBBA 4KWLA 4DIQA 5FZIA 2XR4A 5HPOA 3WSOA 2PMWB 4XFGA 1W0PA 1X9PA 4DEVA 1HLCA 2DCKA 3I3BA 4YVWC 3DCQA 2JG9B 3OD0A 4Q4V2 4R52A 2OQ7A 5BUVA 1LJ7A 1ENRA 4XF3A 5J3UA 2FDGA 2WBKA 5DUUA 3LA3A 5LY1A 3RG0A 2D3SA 4YSFA 1QJFA 5F5CA 1RUC1 3LAGA 1PX3A 4HSJA 1C5IA 2Q8DA 2WT0A 1ZM1A 4GWNA 1YRZA 1UKRA 2NM1A 2WNVC 4AI0A 4OMCA 2CNAA 5L9VA 5JAXA 2BNMA 1S2EA 3EO6A 2WWUA 3ZPYA 2PHLA 2EXJA 1OH4A 4AQSA 1NCQB 4YFWA 4LT5A 3VB9A 4GJZA 2SBAA 3ZSJA 3QH6A 4OUSA 4IQPA 2YG0A 5KXDA 5CU1A 4UFJA 1L7QA 1HRI2 3NV3A 3J4UH 4ORFA 2D40A 2DVBA 5FDBA 5KC5A 1BMV2 3I54A 1NLQA 2ZACA 4I3PA 4CCMA 5FPXA 5IUQA 2QQWA 3B9CA 5E88A 1YQ6A 3ELNA 4YGCA 3B9IA 3CZJA 1E5HA 2C1FA 5ABJC 2VQUA 4GWIA 3J9SA 4XABA 2EICA 3ZXDA 5LY2A 1PO12 2TEPA 1BK0A 1NX9A 4F83A 2GC1A 1J3QA 5LK7B 1IQAA 2B8MA 1ZBE2 3RWNA 5EPAA 4Q0QA 4ARXA 5B4XA 4RA0A 3H8RA 1OUXA 1RHI2 4FT8A 4XJ8A 1JMUB 1N47A 4H14A 4R9AA 1ZZBA 4LO6B 4AFAA 3J7NA 2XVGA 1OH3A 5FYZA 5C4WB 1QJX3 3WT3A 3MUZ1 5FZ7A 1J83A 3BODA 4YW3A 5A6QA 4FOYA 2VAUA 4TXWA 3IMNA 3RYPA 4NIHA 1RUE1 2J1UA 1FV3A 3VD4A 2RR13 5FPVA 2WQ8A 2ZHLA 1CZSA 3HNMA 4B7KA 4NPMA 3MIBA 1CIYA 4PCRA 3AKRA 5FYUA 4MV2A 5L19A 5BNOB 1W2TA 2Y6KA 1PMJX 1W2NA 4Q0VA 2R042 3O0WA 1W6NB 1ZBA2 4QGNA 4YVSC 4HN0A 5JXJA 4B29A 4X6RB 3LGRA 1B09A 2E26A 4FAGA 1SDWA 1XQNA 3OBRA 2WT2A 2OA2A 1W9WA 3H3ZA 4WV8A 3AL6A 4QB1A 4G9SB 3SCFA 4QDQA 4CP2A 5HCBA 4BQYA 4E8DA 1YLLA 2ZHMA 1RUC3 5T52A 4COVA 5CFDC 3RZGA 4AVSA 4HPKB 1VRBA 4GJYA 3QD6A 3PUIA 4BXFA 2WZ8A 1MS9A 5H9SA 5T5LA 3OPZA 3MYXA 5FP9A 3GCXA 4HKOA 4XMAA 1GZWB 2D98A 1UO9A 2WZR2 4E8CA 2AYHA 1SFNA 3FLRA 1SLIA 1AR82 3PJYA 1DG6A 5DMYA 5F37A 5F3IA 1AL0G 1BZWA 2QVSB 2ZX1A 3I3EA 2UYAA 1RIRA 1L7LA 3PUQA 4XQWA 2VO5A 5J48A 3J8F1 2GH2A 2D3RA
chains in the Genus database with same CATH topology
1QHDA 2XLGA 2D44A 1W6QA 2V09A 1PNFA 4YRDA 2YC0A 4MGYE 5J98B 3ZSEA 5EJ3A 1ZA4A 1WLCA 1VJ2A 4L2NA 3URFA 4B7EA 3VL9A 3RYKA 1SQ4A 1DZQA 1KJRA 2QJVA 2VNRA 4N7IA 4Q0SA 5BY5A 5I8TA 4SBVA 3USSA 1S0FA 3M7AA 1XNKA 4BQ1A 1HW5A 2HWF1 5FLIA 1I5ZA 3BU7A 1ENQA 1GBGA 3I59A 2D97A 2IXLA 4LE3A 3JBG2 1IS3A 3OBTA 5JZGA 1I3HA 3U11A 4INDA 4LUKA 4DZGA 1J3PA 1R1A1 3CF6E 1SBFA 3ACLA 4RS5B 4OHYA 3JQXA 1NOVA 3POYA 4H7LA 1KFUL 2Q1MA 2OUJA 2C5DA 3ZX7A 1SLBA 3IDBB 1S0JA 3R0RA 3AJZA 2GN3A 2HWE1 3IDCB 1GSLA 4JDNA 4N9IA 4DNYA 1QU0A 1FPN1 3RJRA 2BYVE 2RS12 1OLQA 2JG9C 4Z92B 3ETQA 1YI7A 4BWOA 1DQ6A 2ZGRA 1MZEA 1RJ7A 1FV2A 3UL2A 3WW3A 4GQ7A 4Q4W2 2BW8A 1RUF1 2VXRA 2XLFA 1AHSA 5GLVA 2HEVF 1NCQC 2ILMA 4COZA 1K5MA 4FTBA 2WFPA 2RS31 4Z8BA 3R05A 4ZU5A 1RUG1 1DU3D 4Q4Y3 2DFBA 3J8F3 1GYKA 3G6JB 1CGPA 3GNEA 1REDA 1OKQA 4W6XA 5A32A 1NCRA 1MS0A 5C8CB 3AMQA 3WX5A 4OI4A 3VKNA 2YHJA 2EVXA 1O5LA 3M8LA 4KWJA 4YM2A 4CEWB 1I1EA 5AFBA 2HWF3 4LBKA 5C4WC 4LBJA 4CDWB 1RUI1 4Q8LA 1WMDA 4CDXB 5CIRA 3ES4A 5JWPA 1UZYA 1SLCA 2RS52 5LEJA 1R1A3 1MEC2 4PIZA 1W6OA 1YUDA 1NZCA 4V1PA 5BNOC 3A4UA 3AYEA 1GQGA 1NLSA 3E6BA 1Q8QA 4HZFA 1XYPA 2CGOA 4XZPA 2HWE3 2VNGA 3LZZA 1AR62 1DF0A 3V0BA 4Q0PA 1FPN3 4YZ1A 2WLPA 4B4RA 2QNKA 1KS5A 5D1IA 3AZWA 1PVXA 2XBO1 5DXDA 2YUEA 5I93A 1OPMA 2VGDA 3ST7A 4EN6B 1XYNA 4PLMA 4YG0A 4G4FA 4UXAA 1VBB1 1RUF3 2OYZA 3WG3A 3V0AB 4JGYA 2GZWA 1V6NA 4FPJA 1G9AA 1WD4A 2CGNA 1F2NA 4K3UA 3RPQA 3VBUA 4TWTA 3VBHB 2RS33 5L7OA 4AGGA 2QKDA 5AC91 5EWSA 1RUG3 4IEYA 1RB8G 1PM7A 4YZ2A 3WZ1A 4B8EA 1DQ1A 2A6YA 2JXAA 5JSRA 1M4WA 2GDFA 2YYOA 1V9U1 1H2KA 2UWBA 3SISA 3ZN4A 1WW6A 2WA4A 1BCXA 3WOGA 1UKGA 1O3TA 1QQP3 3QH7A 1J1LA 1GANA 3D8CA 4I0AA 1HKDA 1WLTA 3OTFA 1IKQA 5F9TA 1QOTA 3MF6A 1UL9A 1G9BA 2ZZJA 2IXKA 4WVMA 3RS6A 2O8QA 2JE7A 3WCSA 1FYUA 4EJRA 1HV1A 2XUMA 3WCRA 2H6CA 3S6PA 1T6GC 1CAWB 1EV12 1RUI3 3MICA 1NLRA 2GC3A 4PBPA 1DQ0A 3OD4A 2B7YA 3FLTA 2DV9A 2PA7A 3HMYA 1CAUB 1PO22 3NO8A 1VB4A 4Y22A 4RS5C 1DYPA 1DHKB 4NHLA 3ZN6A 1Q56A 3BIWE 3TN92 5IK8A 1QXPA 2DTWA 2GC2A 5GALA 2Z69A 5FBZA 2DYCA 4IERA 3IWZA 4XJUA 1XXNA 2ZMNA 2XBO3 3BALA 5J37A 4QMAA 3USUA 4KGGA 1VRH1 1H8VA 5E1RA 4GIQA 2ZX0A 1VBB3 3KM5A 5DDJ2 2WNUA 3H9AA 3JD71 3MIEA 3VBOB 2DU1A 4AHZA 4IEUA 5FREA 2A3WA 1PGW1 1WGPA 2Q5TA 2W08A 3CJIA 1QJY1 5AC93 2UWCA 4P9XA 3CJXA 4FPYA 4QPYA 5KHKA 1WBLA 4FXKB 1HV0A 4AI8A 2EXIA 1Q8OA 1ULFA 1V9U3 4XHXA 2ZX4A 1B35B 1YFWA 1WW5A 2WLQA 2ZA9A 2X5IA 2PAKA 1S2KA 4KU8A 3VUOA 2N7GA 1CPNA 2PHRA 2O1QA 4DS0A 4BMBA 5I91A 5C8CC 3NV1A 4MXWA 3VZMA 4P9YA 1C28A 1NE4A 3L2HA 4CEWC 3TB0A 1AR72 3AKSA 5GZFA 1ASJ2 1LRHA 3TRSB 2WIIB 4K8FA 4X8PA 2ENRA 4WVVA 4GKXA 4QQ2A 4CDWC 1C57A 2XLAA 4CDXC 1S0IA 1ZREA 1UMZA 4COUA 4ZKTB 3M2MA 2VVFA 1KITA 5KXCA 1MZ5A 4YM3A 1V6OA 1GFF2 3VV1A 4AF9A 1IS4A 2CWSA 2VNOA 5C9AB 2B5HA 3TWIA 1PK6A 2ZGMA 4Y1VA 3ZSKA 1JYIA 3VZKA 4HVRA 2QFEA 2Z2SB 1RUD2 3VZJA 2I2SA 5T55A 3GBFA 4Q4V1 1YO8A 1VRH3 2NLRA 4XILA 1WCSA 3VBRA 1FATA 1H9PA 1AYM2 4J6GA 5F6KA 3JD73 3PJQA 1TNFA 3O14A 3V65A 1OI6A 4IETA 4XBNA 3HQXA 1H2MA 4BE3A 4Q27A 1H4GA 4RSUA 3AX4A 1ZZCA 3RRDA 3VBHC 4E2SA 1CD3G 3LOBA 1HRI1 5FFOC 1Q5OA 3V64A 4PBOA 1BMV1 1XU2A 1EPZA 1XRUA 5JMCA 3ASIA 4K1YA 3D0JA 5JIAA 2BGCA 4NVPA 3SLIA 3ZFFB 1PZ7A 1J1TA 1R092 1R1ZA 5DZFA 5EZWA 3B02A 4H55A 2O8OA 1U5IA 2OUHA 4N7UA 3MDPA 2WNVA 4BOWA 1NXMA 1PO11 2HWD2 3IKWA 1ZBE1 2W52A 1KDKA 4FPOB 4AK3A 4I3GA 1LHNA 4ISRA 2EIGA 4OHZA 1RHI1 1MZFA 1C8NA 2Y26A 5H9PA 4S2HA 3JB4C 4CZSA 1QJU2 3ZFEB 4YW1A 1Z7S2 3AFKA 2R16A 2KA3A 4GH4B 1D4M2 1JTZX 5BV6A 2GALA 1W6MA 5FOBB 1G9FA 3WDXA 3L2YA 3H3UA 5ABJA 2OPKA 1W6PB 2WSUA 2JENA 2Z79A 3AZZA 1PNGA 3ZYIB 5FO7B 1OQEA 2FMYA 4MGIE 2MEV2 2R041 1ZBA1 4I0BA 3N3HA 1PZ9A 4FOQA 2JJ6A 5T5OA 4XQ4A 3GF6A 2JKBA 3THTA 1REFA 1CX4A 2D6LX 4JGZA 4HANA 4RD7A 4N53B 4EV0A 1RGSA 4BM8A 2HYKA 4R4XA 2ZGLA 3H1MA 5AFEA 4JQRA 4K7JA 3TOJA 3VL8A 3AMPA 1RJ8A 3VBOC 4IESA 1WW4A 2B39A 3I2DA 1C4RA 3ATGA 3FJSA 4CRQA 4QGLA 1DDLA 2WZR1 1UW8A 4YVSA 4DINB 5KXBA 4JCKA 1HRI3 1AR81 1H4HA 5BNQA 1FOD2 1LU1A 5I8SA 4BPZA 2BBVA 1KDMA 3LA2A 4FPEA 4ISQA 4JRAA 4LBQD 2ARXA 4GMP0 1AJKA 4AG4A 4DXZA 4LTAA 1B35C 4I0WB 4NO4A 3M1HA 1PO13 3WQ0A 3AKPA 1ZBE3 2QQPA 4DB5A 2BTVC 3WW2A 1OA2A 1SLTA 3AXDA 4WM7A 3WINE 4MYEA 1S0GA 5DG1A 1RHI3 3SH3A 2ZGPA 1D0GA 2ZGSA 1Z0HA 1QXJA 2DFCA 2BUKA 3FBMA 2WQ4A 3N35A 4Y1ZA 3ZDSA 3EHKA 3THPA 3OY8A 4PDWA 1CESA 3JBG1 1TE1B 4QQHA 1V00A 4KU7A 4RL7A 4GMP1 4IV1A 4C91A 2OZ6A 4G3YC 3ECQA 1UU6A 2P3IA 2E7TA 2R043 2XJSA 5C9AC 2R32A 1AX1A 1BXHA 3H7YA 5C8WA 1UN1A 2E9QA 4Z1VA 1NA1B 2BFUS 4IV3B 1A8MA 4L92A 5FMOS 1YXWA 2RS11 1VBA2 3M3QA 1KD7A 2ZGKA 4LULA 4URTA 1U5ZA 4P9WA 1MQTA 4JTNA 2XL7A 4Q4W1 3KB5A 1ENXA 1UD1A 2DUPA 1S0BA 2SLIA 4XXPA 1LTEA 2WZR3 1HDKA 2RM22 2DVDA 5K0UA 4GA9A 3ZVXA 4AGVA 4AEKA 1OHFA 1URXA 1AR83 1MZ6A 2PHWA 4JC1A 1YFUA 4QPGB 4BIFA 2XB6C 3ZXAC 2JG9A 2VW1A 3MPBA 2A71A 3WV6A 4AXOA 5J7MA 4RFT0 3ZFFC 1N1SA 3MIGA 3DL3A 1F31A 3H0OA 3BCWA 4WM8B 1MACA 2DCTA 4PLOA 4N43B 2RJLA 1WA4A 2CAUA 4KL1A 4A7YA 1UZZA 1GR3A 1WCKA 2PYTA 3APBA 4RHV2 1DGLA 3MIFA 5CBLA 2X8KA 5A3MA 3EJKA 3ZFEC 1QMJA 2WL1A 3JBG3 4GH4C 2PAEA 3RZZA 2VOWA 3KGLA 4Q1PA 1TEIA 5KHGA 4DQAA 1O4ZA 2GMEA 4GXLA 4GMP3 2RS51 5JVVA 2ZKNA 1MEC1 4KWKA 4O9EA 2IXHA 2W0XA 1FI2A 2JD4A 4M3CB 3NKTA 1SACA 2D43A 5E8AA 2Z5WA 4AEMA 4D7TA 4K1ZA 3OF1A 4MUVA 1AR61 1Q3EA 2QDNA 2RS13 5JOXA 3AZVA 4YGDA 4JTOA 3ILRA 3IDEA 4P14A 5I8YA 4LLOA 4ASMB 4ASLA 4N53C 3U4XA 3FC0A 2YMZA 4LBOA 2BQPA 4TYSA 4Q4W3 2R30A 4HSLA 5ACA2 3POWA 3VBSA 3OCPA 2A3YA 4KGQA 1N1TA 2HWC2 4W6YA 4UBHA 1OA4A 4YM1A 4XBLA 1W6QB 4FBFA 1F8VA 4CDQB 1LHOA 3S7IA 4COYA 5FLJA 1MS4A 4AEDA 4Y4YA 1JUHA 3ZSMA 3GHMA 2R0FA 3B7MA 4BLIA 4RQPA 3GHNA 5GLWA 2H0VA 1V6KA 2HJIA 2E7QA 4S2GA 4LNVA 4TSVA 1GLHA 1QY4A 3I59B 4Q26A 4X6QB 4R9CA 5K9YA 1IPJA 5CB7A 2TNFA 4YZ3A 2WT1A 4EN7B 1LODA 1HXS2 1OD5A 2ZCWA 4LEJA 1QWRA 4AE2A 2WS91 3NV2A 4HFSA 3AYCA 1NQDA 1RUJ2 1RUE3 1EV11 4LBQA 4L8QA 1VALA 3H7JA 1OFNA 5FOJB 2EAKA 2RS53 3VLBB 4FOVA 1MEC3 1LOGA 1PO21 4HL0A 4Z07A 2ZPXA 1NY72 3M70A 4NPRA 1O4YA 3DPRA 1LEDA 3TN91 2QZ3A 3PHMA 2X29A 4QXKA 2XJPA 3E5UA 4BCUA 1RUH2 3UKNA 4LHNA 1SLLA 1AR63 1G7YA 1NA1C 4E2QA 2XWJB 4IV3C 1QDOA 2UWAA 2GMPA 1O4TA 2ZGQA 3D82A 1PHMA 1ZZ6A 2B45X 2GNBA 1YIPA 4X8NA 1BBT2 1RL3A 2F4PA 1Q8PA 2A75A 4FP3A 3AKQA 3HN1A 1LECA 2EALA 1RTVA 3V56A 2ZAAA 2NN8A 4DMIA 3JU9A 1FXZA 2FMDA 5I0TA 5DDJ1 3E97A 1ZYBA 1AZDA 3C2UA 1LENA 3KSCA 2QE3A 4AFBA 3H8UA 4QPGC 1LOFA 2DCZA 2PHFA 2ETEA 5A32B 1VIWB 4F8AA 1NCRB 1XE7A 4E27A 4XDQA 4IEVA 2D3PA 3OGJA 3WP5A 5JPMB 4DRVA 2DCJA 4CTEA 4XFCA 5KHHA 3E6CC 2BNOA 3ROUA 5K7PA 4WM8C 1A3KA 4N43C 4XHBA 3DV8A 2VQ0A 5FQ0B 4ZU4A 5GLZA 2CL2A 4ZXKA 4C0BA 3R6SA 2VVEA 2WS93 1DGWX 5EFUA 1W6OB 1Z78A 2LTNA 1AR71 1I6XA 4LHKA 1ASJ1 1SBDA 2GAUA 3WD5A 2YGLA 1CAVA 4MXVA 2QUOA 4IEPA 4L97A 1PVC2 1A78A 3WXPA 3LOIA 1PO23 1ULGA 3V0BB 2PQQA 2ZJCA 1NG0A 1X8MA 2A73B 5T5JA 3TN93 4ZU7A 5IK5A 1HIXA 2LUWA 1D4VB 2A5ZA 1VBD2 4M3CE 5KBFA 2VH9A 3QBQA 4C1XA 3AK0A 1VBC2 2XVKA 4CDUA 4RR3A 4E2GA 2BVVA 1AR92 1RVF2 5GZCA 5FPZA 3MZHA 4CDWA 3N36A 1RUD1 5LEKA 4JGYB 3IPVB 2P3KA 3HWJA 4FQZA 4Q4X2 1OLRA 1WLWA 3KCXA 2P3JA 3O0XA 2A70A 4XBQA 3VBUB 4Q1RA 1AYM1 3ES1A 5DDJ3 4OI1A 4CEYB 3U0ZA 2XKOA 3ZFGB 2LM3A 5JPNB 2RE9A 3VBFB 1YIFA 4WVWA 1LB2A 3E6DA 4AHWA 1CONA 1O7FA 5GZDA 3RI9A 1YJLA 2PLV2 4MZUA 1EYBA 4CDQC 5C6CA 1S1AA 2GU9A 3MW4A 3VHOA 4KNCA 2R1DA 2P37A 3PMSA 1DZTA 2CGPA 3BOWA 5CFCB 1X33A 3MEPA 2WFF2 4TLFA 1R091 1LHWA 2O0OA 1LCLA 3V0AA 2AUYA 2BEOA 4UW6A 2HWD1 3KS7A 4JDOA 4NR1A 4XOGA 4Q4Y2 2R1BA 3ZYJB 2XHKA 4HK9A 3LWCA 1APNA 4AVCA 4OVEA 1GZ9A 4YZ5A 3PMEA 4NHMA 1IS6A 4W6WA 1AR73 4XJWA 2I07B 1V70A 2R6QA 1ASJ3 2RHPA 1Y9QA 1AX2A 3T1MA 3JQWA 4QX5A 5T5PA 5AVAA 1QJU1 3E5QA 1Z7S1 4K20A 4L99A 5CA6A 4EN0A 3W9AA 3ZIXA 2Q4SA 2VPVA 3H1YA 1VR3A 1ALYA 2A6VA