1LTEA

Structure of a legume lectin with an ordered n-linked carbohydrate in complex with lactose
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGASLITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNQSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKLLHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORAL TREE LECTIN
publication title Structure of a legume lectin with an ordered N-linked carbohydrate in complex with lactose.
pubmed rcsb
source organism Erythrina corallodendron
molecule tags Lectin
total genus 56
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1991-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lteA00
1OFSA 1WD4A 2UWAA 4D69A 2C5DA 3C2UA 1WBLA 3WLUA 2ES3A 5AVAA 1BZWA 4BLIA 2P34A 3O5SA 3OY8B 1AXZA 5GLVA 4FPOB 4LBJA 1N1YA 5CBLA 3O12A 1GV9A 3B3QE 5CNAA 1ULCA 3UJQA 1N3QA 1SACA 3SH5A 1S0EA 3RG0A 4I30A 4P14A 3AYAA 3NWKA 1QNWA 1LOBA 1VAVA 4L8QA 2A6XA 4XYXA 4Y26A 2SBAA 2A3WA 1IS3A 3ZPYA 4ASMB 1LU2A 2UWCA 4Y22B 1N1VA 2W68A 3JU9A 1WUVA 4YG3A 1V6IA 2JE7A 4C1XA 5SV8A 5T5OA 3ZVXA 5H9PA 1X50A 3B00A 1IKQA 1PZ7A 4YM1A 4AGRA 2WLQA 3SITA 2EXKA 1LCLA 2D6NA 2DU1A 3USUA 1SLIA 3ASIA 1S0DA 3OBRA 2LALA 2V73A 3ZXEA 5H9SA 5JOZA 4AVSA 3FUQA 2EALA 1KITA 1LODA 2CTVA 2LTNA 1UZYA 2OW4A 2ZMKA 4GA9A 2R1BA 4DRVA 4GKYA 5T5PA 4Y24A 5JMCA 2AENA 3AYCA 2A6VA 2A71A 4FOYA 4XMIA 1HQLA 2D6PA 4Q1PA 1W6QB 4YW3A 1QDCA 4YW5A 2WKKA 3UL2A 1LOGA 1UX6A 3I4IA 3POSA 2FHRA 2ZKNA 1WD3A 4FPKA 5DUUA 1APNA 1W6MB 1G9BA 3B9CA 2ZGKA 1OQ1A 3WDUA 2ZGRA 1FV2A 2YMZA 3B01A 4AGGA 3IPVB 1EPWA 1OKQA 1DIWA 1JOJA 5EYXA 1C4RA 2E53A 3DUIA 4XJ8A 4XHBA 1QGLA 1WLWA 1Z78A 1ZM1A 1AJOA 3M3CA 4Q8LA 4M01A 4R9DA 3PVOA 3N7KA 4FPCA 2ZGMA 1F5FA 1LOFA 1HKDA 1MS5A 2GMPA 2SLIA 1GNHA 3BOPA 2ZGPA 4XOGA 3VKNA 4AGVA 3V0BA 3WZ1A 4P9YA 1Y7BA 2CWMA 3VKLA 1Q56A 1S0CA 1YYNA 4XXPA 4YFWA 1KDKA 3WG4A 4HL0A 2D7FA 1XQNA 4LBNA 1W0PA 4YFZA 5IK5A 4FOQA 2D3RA 2KM2A 3FFZA 5BYNA 2PHXA 2NN8A 3UJOA 4IQPA 2DUQA 2WNEA 3AJZA 4FPJA 2CL2A 1GYKA 1F31A 2A6WA 3FLPA 3AFKA 4AYUA 3ZSMA 2W52A 4F83A 4ATFA 5GALA 1R1ZA 1N3OA 4Y1ZA 3SNMA 5IK8A 5DUVA 3AYDA 2ZGSA 4DRRA 2GNDA 1JYCA 3B69A 3HR9A 3W58A 1LULA 1C1FA 2DURA 3MPPG 4XDQA 4ZXKA 4Y20A 1MR5A 1MVEA 2ZA9A 3PJQA 3INAA 1QOSA 4K1ZA 4KBBA 4PBOA 3ZXLA 2GNTA 4XJUA 4XBQA 5DUXA 5T5LA 5IK4A 1LEMA 1V6KA 4LBQA 2NZ9A 3WDTA 1B09A 1GNZA 2R0FA 3BIWE 4XZPA 4BMEA 2VW0A 1LHVA 1RITA 3N35A 3RS6A 4M3CB 4PBPA 3RMXA 4YZ1A 4HANA 4XILA 3WDWA 5JDBA 4LBKA 4Y1XA 4XBNA 3AZYA 2G4IA 2CY6A 3RQ0A 3AZVA 1GANA 1GZCA 2GALA 1G9FA 4U2AA 3ILFA 2PHUA 2DV9A 3AX4A 5FRAA 1AJKA 2D3SA 3A4UA 2WT2A 2TEPA 4WZFA 4Q8KA 4K21A 4YZ5A 1W6OA 3D5OA 2A6YA 1LGBA 5GZGA 1JYIA 1UN1A 1ULDA 5GZEA 4Q27A 3MW4A 1LU1A 3N7MA 5GLUA 5E88A 1FATA 2GDFA 1NXD1 4YGBA 3WUCA 3RSJA 2Q5TA 4YW1A 2DUPA 4PF5A 3WCRA 1WW5A 1ZA4A 1WLDA 4XJAA 2ZZJA 5JOWA 1SLTA 1MZ5A 2E7TA 1TEIA 2VU9A 1YXWA 2UURA 3V0AB 1MVQA 1JN2P 1G9AA 4BM8A 3PMEA 1QMJA 1IKPA 4LBQD 2W39A 4FPGA 5JOYA 1C57A 3AZXA 2DVBA 4YZ4A 5KXEA 4Y1UA 1CPNA 2GN7A 3LSDA 4XJZA 4Y1YA 4R9BA 4GWMA 1MACA 3M1HA 4FQ4A 2VW2A 4JRAA 3AP5A 4H55A 1UKGA 2P37A 2VH9A 1IS4A 2WQZC 4Y22A 1S0GA 1GBGA 2I2SA 2A70A 3POWA 1CONA 4YM3A 2ZGOA 5DZEA 2E7QA 1JBCA 1MS1A 3MW3A 4MYEA 3WHUA 1LJ7A 2HYKA 2JD4A 4Q26A 3LSEA 1YO8A 2GMMA 3V65A 1N47A 2YY1A 2DVFA 4YM2A 1H9PA 4WV8A 5F5QA 1UMZA 1BKZA 2JJ6A 3AYEA 1DYPA 2CNAA 1IS5A 2PELA 2ZHNA 3KQRA 1S0BA 3ATGA 4U36A 3SLIA 3W59A 4AVVA 1LTEA 1Q8QA 5HCBA 1IS6A 4YGEA 4NO4A 3WG1A 2ZGQA 1W6QA 4LBMA 4YZ2A 1BXHA 4YW4A 2VY0A 5H9QA 3N3HA 4FP3A 1VLNA 4GWNA 2A5ZA 1SBEA 3AZZA 1N1SA 1KQRA 1W6MA 1I3HA 3GALA 3PVNA 1DGLA 1SLCA 1URXA 1QKQA 4ITCA 4XXAA 3ZYPA 4FVVA 2ZMLA 1GZWB 4XBLA 1G9DA 2OUHA 4SLIA 4R9CA 2OVUA 5IUQA 4PQ9A 5L73A 1G8WA 1LGCA 1FYUA 4GKXA 4W65A 4XMAA 3Q9OA 4K1YA 3RRDA 1IOAA 1GLHA 2P3IA 3T1MA 2A3YA 4TYSA 1LEDA 1W6NA 1WLCA 5HCFA 3L2YA 1YI7A 3OPZA 4YG6A 1W6PB 2NM1A 3ILNA 3IKWA 4P9XA 5LK5A 1ULFA 4DS0A 1D0HA 2D43A 1V6JA 3MW2A 1Z0HA 1WW6A 1LOAA 2WT0A 3WVJA 1V6LA 1QDOA 4UW3A 2ZGUA 5GLZA 1SBDA 3FBYA 2P2KA 1J1TA 5GZFA 5KXBA 2ZGNA 3WNXA 2NMNA 4C1WA 5EXOA 2ENRA 1DQ6A 1SCRA 2ZHMA 3AK0A 5T54A 2OUJA 3SH4A 4JC1A 3HMYA 3M3OA 1UPSA 1VALA 3H0OA 2WSUA 1CIWA 4WVVA 1A8DA 4XE9A 1VIWB 1HDKA 2E6VA 4FPFA 3VKMA 4JCKA 4BOWA 1DQ5A 1QU0A 4BPZA 5F9TA 4CZSA 3NV2A 3M2MA 1SBFA 1KRIA 1F9KA 2PHTA 3OYWA 4DPNA 2CYFA 2PHRA 5CA6A 1G9CA 1SCSA 2ZMNA 4FPYA 1HQWA 3UK9A 3U4XA 3I8TA 1ENRA 2ZHKA 4ISRA 3FLRA 2DTYA 1WCSA 3FLTA 2JE9A 1N1TA 1G86A 3M3QA 3OBTA 4Y1VA 2DWRA 1S0IA 4CRQA 2A75A 2R16A 4DFSA 2PHWA 2DUOA 1H30A 1S0JA 3AZWA 1MS0A 5DUWA 4YW2A 5HCAA 3N7JA 2ZHLA 3ZYRA 1CQ9A 2B7YA 5DZGA 2EXJA 1DYKA 4RL7A 2AUYA 3WG3A 5GJ6A 2JECA 3R4UA 3N7LA 1CVNA 4M3CA 1KJLA 1Q8SA 1U0AA 2D6LX 4YM0A 1LHOA 5GM0A 4M3CF 3IM0A 1DLLA 4ATEA 4FOWA 2EXIA 1DFQA 3NV4A 4Z8BA 2A6ZA 1Q8OA 3AXEA 4M00A 3O0XA 3HN1A 1FNZA 4UW5A 3T1LA 5IT6A 3R05A 3PVEA 3OY8A 4OZXA 4YLZA 1CJPA 3RMYA 1UZZA 1ULGA 3JUUA 1JUIA 1S0FA 1AXKA 4FQZA 1SLBA 4YG0A 1LGNA 3APBA 3BODA 5T55A 1UAIA 3POYA 4P9WA 3USUB 3VV1A 2NMOA 3NV1A 3VUOA 1Q8PA 2WJSA 3OGGA 3SISA 3V0AA 2D6MA 1A78A 2EF6A 1LOCA 2YROA 3WV6A 1O4YA 4XJWA 1LHUA 5E8AA 3VKOA 5DZFA 1S1AA 3AXDA 3AP6A 3O0VA 4BMBA 5KXCA 1QNYA 2RHPA 1DQ1A 1DZQA 2A7AA 1AX2A 2DTWA 2XG3A 2ARXA 2YXSA 3LCPA 4XTMA 4TZDA 5EWSA 4Q1RA 4FPHA 2NP0A 1CR7A 2UWBA 2EXHA 1WBFA 1DQ2A 2D6KA 4FOVA 1LHNA 2YV8A 1VAMA 2R1DA 3N36A 4FPEA 1LOEA 3ZSJA 3IN9A 2D6OX 2VUAA 5DXDA 4FP2A 4ZKTB 2R0HA 4CTEA 1I1EA 2WSVA 1AXYA 1LECA 1PZ8A 5E89A 4AVTA 1O4ZA 4M3CE 1FV3A 2EIGA 5T5JA 1RINA 2D3PA 4R9AA 2PHFA 1CESA 3ZXFA 1AX1A 1DBNA 1LESA 3AP7A 5T50A 5GZCA 2EAKA 1AX0A 1WW7A 4XTPA 3A0KA 4NOTA 1BQPA 2DVDA 3SH3A 3ZSKA 3WHTA 1C1LA 4LBLA 1BJQA 1QF3A 1ENQA 1MS9A 1N3PA 2AYHA 3A0NA 3V0BB 1MS3A 1A3KA 4YZ3A 2C9AA 2AGSA 1V00A 4UW6A 3WCSA 2AH2A 3IPVA 2A3XA 2VW1A 3QCWA 4BQ1A 4ISQA 1V6NA 2ZABA 4XIOA 1UL9A 2ARBA 3AP9A 5JVVA 5CAZA 1MS8A 3GNEA 1AZDA 1GICA 1ULEA 1W6NB 2GNMA 3VKFC 1D2SA 1GKBA 1LHWA 1W0OA 1LOFC 2VXRA 3WDVA 3ZXKA 2DVAA 3DGTA 3ZXJA 1BYHA 1DQ0A 3AJYA 1GZWA 2YZ4A 3CNAA 3WDXA 4RA0A 4BLJA 3WG2A 3FUOA 2W08A 1GSLA 1GZ9A 3R4SA 4WVWA 3TB0A 1DQ4A 2GNBA 1SLLA 1V6OA 4GXLA 2JKBA 1G7YA 4UW4A 5GLTA 1FX5A 3TAYA 4XIKA 2JDZA 1AVBA 1JHNA 5KXDA 4Y20B 1SLAA 2P3JA 1DHKB 2ZGLA 3QLQA 2CWSA 3ILRA 1W6PA 1YIFA 2XB6C 2FMDA 2DYCA 2V5YA 2DVGA 1QOOA 2ZBJA 2D44A 4FPLA 4LBQB 4K20A 1CPMA 2BQPA 2ZACA 1V6MA 4XHXA 5JLVA 5FREA 5JOXA 1WW4A 2ZGTA 5DG2A 1KDMA 1JW6A 1YRZA 3ZSLA 5T52A 1Q8VA 2WT1A 2H0BA 3OYWB 4PCRA 5CB7A 2AR6A 2ERFA 2GN3A 1AF9A 1SFYA 4AWDA 1CN1A 1MS4A 1JXNA 1NLSA 2Z42A 3KM5A 3BTAA 4DQAA 1KJRA 3IMNA 3AP4A 4LBOA 3O0WA 1QOTA 1ENSA 3OJBA 2R49A 1ONAA 2NYYA 1RIRA 4GALA 4XJ9A 5GZDA 2GMEA 1PZ9A 1W6OB 5DG1A 5GLWA 5IK7A 3WDYA 3D6EA 4Q2FA 4YGDA 3MEPA 1FNYA 2E51A 2UU8A 3D4KA 1MZ6A 3WOGA 2P3KA 3V64A 1HLCA 3ENRA 3M3EA 3T2TA 1FAYA 3NV3A 1LENA 2DU0A 1H9WA 3WUDA 5EYYA 2ZAAA 4YGCA 5H9RA 2AREA
chains in the Genus database with same CATH superfamily
3L2HA 4G9SB 1WD4A 2UWAA 4S2GA 3P3PA 3C2UA 4XVHA 3PUHA 3ON7A 4CP9B 2W9XA 4FPOB 4IDZA 2BFUL 2WR9A 5CBLA 3KQ4B 2V4VA 1W3XA 3C7EA 3D3AA 4QXHA 4A4AA 5I8YA 3K4ZA 5FO7B 2DCTA 3MZHA 5AC93 3GBWA 1N3QA 4I30A 3OGRA 4P14A 5A7WA 4K8FA 3NWKA 5A6ZA 1VAVA 3NNFA 4HG6B 2EVXA 2JIGA 4XUOA 5CU1A 1RUJ1 1UPIA 2ZX0A 3NKGA 2FZ1A 3J8F1 4M4RA 2WQ8A 1WUVA 3MI8A 1V9U3 4WM8C 1YEWA 1D4M1 1XYNA 3TEZA 4AHZA 1JMUB 2KR2A 2Y6HA 2HEVF 3GZAA 5H9PA 4HXCA 2C1FA 1IKQA 3KZ4C 1YC61 4AI8A 5FZ8A 3W20A 5A3NA 5AC92 3AMPA 1OKOA 1NA1C 2PMWB 1MQTC 2XJPA 1S0DA 3JQXA 2LALA 2VL4A 4IEYA 4JGZB 4CCJA 1ENXA 3FUQA 2JENA 4GULA 2LTNA 1KITA 4MGQA 1UZYA 3UYJA 2ZMKA 1PK6C 3MICA 2IFRA 4GA9A 3VD4A 2WNVC 3ES4A 2OYZA 3BTZA 3K2OA 1PM7A 2WNVA 5JMCA 1V9U2 4TSVA 1DCSA 1MEC3 2A71A 4FOYA 4XFFA 5I0DA 1MZFA 2D6PA 3RGBA 1E5HA 4Q1PA 4BQXA 1J84A 1OH3A 2QQKA 4N43B 4DOUA 1W8FA 4COVA 2VVEA 4YW5A 1CZTA 3ZYFA 1RUE1 4AEDB 4RR3C 4FPKA 1APNA 4KWKA 4LQRA 4COYA 1QJU1 2W1WA 1OQ1A 2G9FA 2JE8A 4K9SA 1W39A 3E97A 4GD4A 1OQDA 5D21A 4RQPC 3RYKA 4CA9A 2E53A 5FPAA 4DO0A 1JODA 4XJ8A 1PX4A 1WLWA 1Z78A 3B9IA 3VZJA 4QQ2A 4M01A 4R9DA 3PVOA 1CAUB 4AAXA 1F5FA 1LOFA 4XEZA 2GZWA 1NT0A 4RD7A 1PNFA 3BOPA 3WNKA 2ZGPA 1YIPA 2R32A 1NKGA 3FHAA 1W2AX 4P9YA 2W0XA 2O8OA 3H8OA 2BGPA 4XXPA 1YYNA 3WQBA 4YFWA 4ZY9A 1K5JA 3EHKA 3C7HA 3H7JA 2YGLA 4HL0A 1ND2B 1RUJ3 5CZKA 3J8F3 3D82A 5IK5A 2KM2A 4MVTA 3LOIA 3SKVA 4N9IA 3T2PA 1D4M3 2PHXA 1OF4A 4IQPA 1H1IA 2DUQA 3UKNA 5L7OA 3EJKA 1F31A 1OA2A 3MIGA 2QQJA 1PMJX 3EYPA 1GFF2 3RFRA 3W9AA 4AI9A 2MEV1 5ABJC 4XDPA 5GALA 5D8AA 3TEWA 1R1ZA 1N3OA 3SNMA 3ZOIA 2WNUA 2XR4A 2BBVA 2XONA 4DRRA 3O1TA 2VNOA 3GGLA 5CKQA 4CCMA 4LJHA 3J8F2 4YVSA 3UNPA 4NRQA 3W58A 3ZR5A 1W2UA 1OLMA 4XDQA 4ZXKA 4Y20A 3PJQA 1QOSA 1UXZA 3ZXLA 2GNTA 4XJUA 5T5LA 1POV1 1HX6A 1LEMA 1KXGA 4AF9A 1RUE3 2VJXA 1GNZA 4Q4V1 2F4LA 3HQUA 4QU1A 1TZOA 2HWE1 1QJU3 2JDMA 3Q8FA 5CISA 1RITA 4S2FA 1H2NA 2VR4A 4M3CB 4EQVA 2YBPA 4MOAA 2HLEA 4P5YA 4LA2A 4XILA 1SDDB 3GBFA 4HK8A 4XFIA 4I09A 4Y1XA 5FMOL 5FOBB 2V4AA 2VUDA 1EAH2 2VE1A 4Z92B 1RUOA 1GANA 5IAVA 2OKXA 3ILFA 4PI0A 2XHNA 3AX4A 2X5IB 2D3SA 3UT0A 4CUGA 4EYUA 1UD1A 1E5IA 1XB9A 4LITA 1RUE2 3LE0A 4PDWA 3WNNA 4WZFA 3M4FA 4IV1B 5A7NA 4O9GA 4YZ5A 1PNGA 1J59A 4JGYB 3D5OA 3B5LB 5F6LB 5JCTA 1LGBA 5GZEA 2W2IA 2WFPA 3DPRA 4RYDA 4YGBA 5A7WB 2HWC1 1WW5A 1VBC2 4XJAA 5DAWA 1YQ8A 2E26A 1M06G 2UURA 1WCUA 1SEFA 1JN2P 4LO6B 1O8SA 4MXWA 4QPYA 2QE3A 1IKPA 4QU2A 5J36A 2MEV3 4FPGA 1OLME 4CDQC 4E2GA 4W6XA 1C57A 2YPDA 2YC4A 4QPIC 2DVBA 4XAEA 2VZPA 5KXEA 4Y1UA 2XPJA 4XJZA 4R9BA 1FT9A 3W21A 4N53C 3M1HA 3OGJA 4JRAA 5JI9A 5C8CA 2VH9A 4IE5A 1I9RA 2A73B 4DY5A 5LY2A 1S0GA 5FPVA 2YPJA 1GBGA 3EMRA 2J1RA 2A70A 3POWA 4Z2AA 1POV3 2Y6FA 2ZGOA 2VMEA 5A3UA 4QPGA 1S2EA 4LULA 3MW3A 4Q4V3 2BGCA 5DAVA 5LBFA 1UU6A 3KLSA 4W6YA 4AQ6A 2HWE3 1LJ7A 4HSLA 1NQJA 5FZ7A 3CJIB 1AYN2 1OHFA 1RUI1 3VL8A 2Y0IA 1UNBA 3VZMA 3H7YA 4CDUB 1IQDC 1N47A 2WO1A 2LUWA 1NCRA 4IV3C 1R091 1UMZA 4FFIA 2WIIB 1BKZA 3T2OA 2Q4SA 2CNAA 1P8JA 1RUG1 3KQRA 3LAGA 5C9AC 1ND3C 1LTEA 5HCBA 4QM9A 3WF4A 4NO4A 5FXWA 4K40A 3POEA 4LBMA 1BXHA 3NKTA 2HWE2 4OI2A 3AKRA 3TOJA 3LFMA 4LKDA 1N1SA 3NL1A 4HK9A 2Y34A 1W6MA 1I3HA 3GALA 4EE2A 5C5TA 4OHXA 4ITCA 1RUD1 2BOIA 3RVHA 4XBLA 5FP9A 4MLOA 2P4EA 2VUJA 2HWC3 2OVUA 2G9ZA 2Z5WA 4GKXA 4C8DA 1SPPA 2WINB 4GH4A 4MUVA 4CXWA 1U5ZA 1L7LA 2Q1ZB 4XMAA 3Q9OA 4K1YA 3RRDA 2Q8OA 4CDXA 1UYXA 2A3YA 2RS52 4ZPIA 4YW6A 5FDBA 1WLCA 2QDRA 5FBZA 5HCFA 4CU6A 5FOJB 4KG0A 4A45A 5JXJA 1YI7A 3E5QA 4YG6A 3RZHA 4P9GA 3SEEA 3IKWA 4FBFA 1ULFA 3H9AA 4DS0A 4DXRA 5CFCA 4KBZA 1Z0HA 3J7MA 2HWC2 2WT0A 5FYMA 4E4ZA 5I8SA 2BNNA 2VXJA 3POGA 4CEWB 2ZGUA 4CEYC 2QQVA 4IGPA 4C1WA 5FAXA 1DQ6A 1SCRA 2ZHMA 4JC1A 1OVSA 3MBWA 3CIHA 2PAEA 1XXNA 1UPSA 2XUMA 1CX4A 3J4UH 2FMYA 3OB8A 2FCVA 1HDKA 2E6VA 2BPA2 1RUI3 3O1PA 3AMQA 3OUIA 4MH0E 2WZ8A 1SBFA 1KRIA 2PHTA 3OYWA 4QD2A 4DXTA 1R093 2VZTA 2PHRA 3WNOA 2VCMA 1BBT1 4DPNA 5CA6A 1RUG3 1HQWA 3U4XA 4AHWA 3NAPC 1ENRA 2ZHKA 2ZX3A 4ISRA 3I2GA 1CAWA 1WCSA 2GC2A 2VNVA 3J9SA 3SQOA 2DFBA 1W9TA 2JE9A 4LLOA 4XABA 1Y43B 3GZEA 1G86A 3M3QA 3OBTA 3OGVA 4AEJA 4DFSA 3E6DA 1C3HA 3WW2A 3H3UA 2PHWA 1RUI2 1H30A 2X8KA 3D0SA 2FDHA 2BUKA 2ZHLA 2RMU3 2WL1A 1CQ9A 1D2QA 3CKHA 3J7HA 5FZLA 2GC1A 4WVMB 3ZYRA 3VBFC 1RUD3 2AEYA 2AUYA 2VTXA 5FYUA 4QB1A 1RUG2 1ZZ9A 1Q8SA 4MX3A 2VCBA 3ALQA 3SCHA 5FIXA 1RL3A 5A3PA 1HB1A 5FZDA 3DPRB 5FWEA 3K48A 3NV4A 2A6ZA 3KT7A 4IW3A 3C7FA 3MIEA 3O0XA 4M00A 3VBSA 1VMFA 3AMNA 4UFLA 5F8PA 4AVCA 1L7QA 2D5HA 3PVEA 4UWDA 3MIDA 4OZXA 3GDBA 5A7SA 2VAUA 2RMU2 3JUUA 5FQ0A 1JUIA 1S0FA 4FQZA 2QZ2A 2FCUA 5FXZA 3H3LA 1RUD2 3MDPA 4Y33A 5FZIA 5L9VA 4BE3A 4C0BA 4YYOA 3RDIA 4H7MA 3OCPA 3OUHA 3ITQA 1UAIA 1HN0A 1PX3A 4Y5SA 5CFDC 4Z07A 2GH8A 1DZTA 2Q30A 1QQP1 2WBKA 3KVBA 2WJSA 2B42B 4H7LA 1JOBA 2ZX2A 4AHXA 4AL9A 2IC1A 3SISA 5EIYB 3BTXA 3C7GA 4XJWA 1OOPA 1LHUA 3ABZA 3I2KA 5E8AA 1UZ0A 4ARYA 4QPGB 3SEPA 1O5LA 4NPLA 3LCPA 2DTWA 3GCWA 3AKPA 4KGQA 5EWSA 5TSWA 3DCQA 1ZBE1 3I7DA 1WBFA 1VRH1 1BBT3 2YV8A 1VAMA 1LOEA 1U5YA 4CCKA 5KHKA 5DXDA 4FP2A 4LMFA 5FUIA 4FAGA 2ET1A 4LO5B 4BQYA 1NCRB 4CTEA 1LECA 1PZ8A 3BCWA 2I07B 3RZJA 1HIXA 1HV0A 1O4ZA 1UU5A 3GHNA 4RS5C 5F3CA 5FLHA 4NHXA 1QJEA 2QFEA 4A2UA 2D3PA 4R9AA 4Q5OA 2PHFA 1AX1A 1DBNA 3LF7A 5K0UB 1C5IA 5ERLA 1BBT2 1ZVFA 3H8UA 3Q8EA 2XJQA 3SH3A 3ZSKA 1BMV2 1BJQA 1J3QA 2OPKA 1ENQA 2WA4A 3A0NA 3V0BB 4LT5A 1MS3A 3LIGA 1A3KA 4FFHA 5FZ6A 3U37A 4PI2A 2QNKA 4UW6A 2XL7A 4HKOA 1EY2A 1HW5A 2NPIA 3L9JT 4G3YC 1UOGA 2WAOA 4CDWB 1ASJ2 1UMIA 2ZABA 4XIOA 2ARBA 3ZYJB 4BU2A 1GICA 1CAXB 1UYZA 2E9QA 1GKBA 1LHWA 1W0OA 2E31A 2JDUA 2ZAHA 4OMDA 4AK3A 3DGTA 4Q4Y1 1RB8G 1QQP3 2A1XA 2BV4A 2YZ4A 3O7OA 3WX5A 4B4PA 2WLPA 4FXGB 4Q0SA 1UWWA 1NOVA 5JI7A 2PAMA 1SLLA 2VNRA 1O4TA 1PVXA 5GLTA 2BTVC 3WF2A 1NXMA 4A7YA 1GU3A 3FC0A 4DB5A 2O0OA 1ZZ8A 2BVBA 2JDZA 5C3SA 1UY4A 1QXJA 3H50A 5FY4A 5BNPA 2ZGLA 4GB31 5CVRA 3NNMA 1W6PA 3HEIA 1AR82 2W46A 5CG8A 2ID4A 3LFIA 3OG2A 2FMDA 5LASA 4NIGA 2V5YA 1ODNA 1KFUL 4FPLA 1ZBE3 2D44A 1W04A 1QQP2 2FBEA 4HT1T 1VRH3 4XHXA 1WW4A 5DPNA 1JW6A 4JDMA 1B35A 1BHGA 2WT1A 2W47A 2GP3A 2H0BA 2XQRA 2XWBB 3OYWB 3VBRA 4PLNA 4YSFA 3B02A 3KV6A 1S2BA 1JYWA 1RXFA 1MS4A 2JDKA 3KM5A 4J25A 1CAWB 5L9BA 4DQAA 4BIOA 4QGLA 1KJRA 2ET7A 2XVGA 4SBVA 4CYDA 4QB2A 1ZBE2 3OJBA 5EP9A 5LEKA 1VRH2 3QOPA 2AACA 2GMEA 1W6OB 3ZFGA 2E32A 5DG1A 1RMU1 2EIBA 1ZRRA 3MF6A 3WDYA 3D6EA 4Q2FA 4OHVA 4NRPA 3MEPA 5JSOA 1UY2A 1DG6A 3T2TA 1BCXA 1IPKA 1W28A 1FAYA 2D97A 3G7DA 4C0HA 5H9RA 1OPOA 2P3JA 1J1LA 4K7JA 1DZRA 4COUA 4YVWA 4AFAA 4D69A 2FDKA 2XUEA 2RM21 4L97A 1K45A 2IXHA 3VBOA 3IDBB 3LD8A 3WLUA 4Z2WA 3MV11 3O5SA 4EWEA 3Q8CA 4J6GA 5JXIA 3I2DA 4Q4Y3 5F39A 1D7PM 4LBJA 1N1YA 3ST7A 3H1MA 5FYHA 3WT3A 1GV9A 2BGOA 5LK7B 3ZFFC 4FFFA 4MV2A 3O1SA 1US3A 1S0EA 3VDDA 2WZR2 3LEKA 2XLFA 4A7KA 4KNCA 4BA6A 4ZU4A 5C7GA 2K0GA 2DCZA 3ZPYA 4JHTA 2CU5A 2W5FA 4MHRA 4FTBA 4GB33 5LA1A 1VPHA 1OOPB 1CJDA 2JE7A 1VE0A 2XLAA 2JG8B 1OF3A 2ZEYA 1AL21 5SV8A 3S5QA 4PT6A 4COWA 4MZUA 4Q4Y2 3B00A 4NHYA 4AQTA 5J1XA 1AR62 2WLQA 5C71A 3SITA 5FZEA 1LCLA 3JD72 3WP4A 1SLIA 4OVEA 4OCTA 5EQUA 2V73A 5JOZA 5H9SA 2XH6A 2DCKA 2EALA 5IHRA 4LOSA 3K3OA 5J96B 2XJRA 5T5PA 5FO9B 4J1WA 1ZZBA 4GB32 4DY3A 3ZIXA 3NW4A 4FO9A 4LR4A 4DUVA 3AYCA 2XLGA 2A6VA 4XMIA 5A6XA 1HQLA 1Y9QA 3EBRA 4CXXA 4DUXA 3I3BA 1F35A 2ZTNA 1W6QB 4YW3A 1UX7A 1CGPA 2WKKA 1LOGA 1RMU3 4JGZC 3I4IA 1AUYA 1PVC1 5CYYA 5FYBA 4QPWA 5DUUA 1DGRA 4AI3A 3ZSEA 4BQ2A 2W87A 4L11A 3TN91 1CIYA 3VZKA 3MIHA 4F3JA 3B01A 1FV2A 3IDAA 3TRSB 4AGGA 2FD8A 1OUSA 4KQ7A 1EPWA 1L3JA 4P9LA 5JXHA 1GMMA 1DIWA 1JOJA 1UW8A 2RM23 1WCDJ 2JICA 2VTFA 4N43C 1AJOA 1VRBA 3F2ZA 1JOPA 2WWUA 1RMU2 3KB5A 3PLQA 4FPCA 4HBNA 4AEDC 3GF6A 1ACCA 1MS5A 4HSJA 5BNQA 4AFCA 4XOGA 4LA3A 4AGVA 1D0GA 3JQWA 3FL7A 4QKBA 3WZ1A 4K6BA 5JSRA 2RG4A 2IXIA 1RC6A 4CSWA 1Q56A 1PM4A 4Q0VA 4NE9A 2WNOA 4NWWA 4NVPA 4O61A 3WG4A 4JQRA 3VBHA 1XPWA 4YFZA 4XPVA 3KVAA 3I3QA 2RS11 1AL23 5BPXA 2MPFA 4HKLA 3MLJA 2LM3A 3UJOA 2BYVE 2ZPXA 3AJZA 4CU9A 4ZHNA 2HEWF 4TN7A 1GYKA 1POV0 1UU4A 1H1MA 3NMBA 2XJSA 1F15A 1K5MA 1RYYA 2W52A 2XMLA 4UOJA 4F83A 4ATFA 4AW7A 4OI4A 4NROA 2RJLA 1UCXA 2PHLA 2I74A 1JYCA 4OLLA 4EZHA 2X10A 4X6QB 1OQEA 1LULA 5FKBA 1Y9GA 2DURA 3MPPG 3RJRA 1AL22 3KMHA 4RSUA 1JU4A 1MVEA 3ZFEA 5I93A 5C3QA 3MGUA 5IK4A 3T3YA 4XQWA 1V6KA 2IFWA 4LBQA 2UYAA 1PVC3 2N7GA 5IVYA 2R0FA 4QQOA 4CP1A 2ETEA 1W8TA 1ZYBA 3RZKA 5J48A 4BMEA 5DAPA 3TN93 2CGNA 4LEJA 3VBUB 1C8NA 3P1IA 3RMXA 4YZ1A 4HANA 4I2OA 5K4LA 3P3NA 4JV4A 2JKXA 2W1UA 3AZVA 2FCTA 1G9FA 4U2AA 2DV9A 4YVWB 2Y8KA 1SG3A 1R1A2 1X82A 3A4UA 4JZRA 3ZO0B 4AR2A 2IXCA 1PVC2 1US2A 2TEPA 3T09A 3VBOB 3LA3A 3VDCA 4M4PA 3LDKA 5APAA 1RTVA 4B7KA 3A23A 3TN92 3ZDSA 5C5UA 4AVAA 1QWRA 2R6QA 5JMOA 4CP0A 3O14A 4WVZA 5GLUA 3LDBA 5E88A 1FATA 3T4VA 2GDFA 2Q5TA 4YW1A 2DUPA 1ZA4A 2RS13 1WLDA 2X5IC 1MZ5A 1YXWA 2CAVA 3RZLA 1MVQA 4IE0A 2QQPA 3DV8A 3PMEA 2VBPA 4WM8A 5FUNA 3RYRA 4JGYC 5LBBA 5JOYA 3FJSA 4NHLA 4V2WA 4AFMA 4YZ4A 5FZ0A 2GN7A 3LSDA 1NA1A 2WDBA 1MQTA 1W0NA 5FZCA 1MACA 2VW2A 3NVCA 3AP5A 3VHPA 2RS12 4H55A 4E27A 3POIA 1PK6A 4RFRB 4PQQA 5A33B 4Y22A 1KS4A 2BERA 4LKFA 1ZRDA 4GIQA 1KS5A 2BP6A 4B3NA 2IXLA 5IFTA 1OI6A 1F5JA 1YUDA 2JD9A 2V09A 1EAH1 2JIJA 1REFA 1NZIA 1A6CA 2YB7A 5F2WA 5A1FA 3M7AA 2YFUA 5JR7B 3GJAA 2IVJA 5IVEA 2HYKA 3VGIA 2VQUA 4RR3A 4A6OA 1YO8A 1QH6A 3AL5A 3V65A 5LZ6A 2R30A 2WC2A 3C7OA 1H9PA 4WV8A 5F5QA 4C91A 1DYPA 4EN7B 1IS5A 4NHMA 1H2KA 1CAVB 1PGW1 3SLIA 1Q8QA 1PIV2 4RQPA 4DNYA 1NG0A 4IEVA 5JIAA 3PJYA 2ZOEB 4ZU7A 3S6PA 1VBC1 1IG0A 3HIFA 4YW4A 5IVVA 1YQ6A 3CJIC 1QEXA 1VLNA 3LB9A 4WZCA 1SBEA 5C4WB 2VZQA 1KQRA 5BNOB 1O3RA 3PU3A 4CDUC 4QM8A 1DGLA 1SLCA 1URXA 3ZYPA 5BV6A 4X6RB 4FVVA 5J3UA 2X09A 2ZMLA 4NIHA 4BYYA 1G9DA 3BU0A 1UKRA 2OUHA 4SLIA 5C33A 3NJZA 4MGIE 3Q8AA 1JZ8A 4J1XA 1UY1A 4FTEA 3AKQA 5JR2A 4W65A 4BZ4A 2BW8A 1GLHA 1W6NA 2VOKA 3I59A 3L2YA 5E6HA 3VD7A 1QXPA 2JG9C 5ABJA 1K5MB 3LPFA 2P3YA 4QQLA 2D43A 3OUJA 4DEQA 2OS2A 1LOAA 2FDJA 1XU1A 3RYPA 4UW3A 1AYN1 5FY0A 1J1TA 3IWZA 2E7AA 1AYM2 2C26A 5EXOA 3KWVA 2OUJA 1EAH3 3HNYM 5F3GA 1VBD1 3HNBM 4A44A 1REEA 1VALA 2VM9A 3H0OA 4I0BA 3DECA 3ZFEB 5HI0A 4H3WA 2FDIA 3S5AA 5BNNC 5JZGC 3DKWA 4JCKA 5BNNA 1DQ5A 2IVIB 5JZGA 5F9TA 5I0SA 4CZSA 5EHDA 4IXLA 3M2MA 4CEWC 2QUOA 5L36A 3LA2A 1GQGA 2WWSA 4XF4A 4Y5Z0 2ZMNA 4FPYA 4IEOA 4NPMA 3I8TA 2ATFA 2VZSA 4IEPA 3X29B 3FLRA 2WO3A 1NCQC 4IEWA 1NCQA 1VBC3 1W90A 2NLRA 4UI9L 2DWRA 5FY1A 1EP0A 4LPLA 5JIUA 2DUOA 5F5AA 1MS0A 2RS51 1BEV2 4WM7C 2B7YA 5DZGA 3OGSA 3KHBA 3AKTA 4RL7A 5A3LA 3HT2A 4YWAA 2OZJA 1CVNA 4D6SA 1JZ4A 1U0AA 1PGW2 2HEYF 1ZNPA 2JB4A 4IE6A 4XACA 4UAPA 5IVCA 3CL1A 2QBXA 2XJTA 4IERA 4M3CF 1BK0A 5J98B 2OIIA 1DLLA 3IM0A 4FOWA 2EXIA 4I0WB 3USSA 1XNCA 3ZN4A 4Z8BA 4RGKA 3HN1A 2J1TA 3HN3A 3T1LA 5IT6A 3DYMA 2VZRA 2BBAA 3R05A 2OPWA 4L0PA 2NQYA 4NIDA 1CJPA 1CX1A 5HBAA 3I3DA 1AXKA 2VECA 5FPXA 4UFMA 4RGAA 3H42B 2CDPA 4M0HA 4CDQA 3BODA 4ZZ8A 1WMEA 4R4XA 1Z7S1 3KV9A 1W3VA 4QPIA 3BYWA 3POYA 4P9WA 3USUB 1AYN3 1GP5A 1O3SA 1BLZA 1NA1B 3GM8A 4M0NA 4GAZA 3WF3A 2BZDA 3FZ3A 4N53A 4AEMA 1Q8PA 2QQIA 1W2TA 4MXVA 4KG8A 1KFXL 1EV11 3A7QA 3V0AA 1A78A 1PK6B 1LOCA 1VBD3 2G9GA 2YROA 4XDOA 2WNVB 3VDAA 4W6WA 5CIRA 1S1AA 5KXCA 3AP6A 1WZXA 4KGGA 1QNYA 4GWJA 1DQ1A 2VZ1A 2A7AA 1AX2A 3KV4A 3P5BA 2ARXA 2BOJA 4W8JA 5A1AA 5FP7A 1HRV2 2BWAA 4FPHA 2EXHA 4FOVA 1DQ2A 4QKFA 2VC9A 1UIKA 2B5HA 2XGXA 1JS9A 3KT4A 4IGOA 1PGSA 2VOXA 4K3UA 4RR3B 3TNPB 2D6OX 3ZSJA 4BK4A 2VUAA 2OXBA 3NSTA 2YDEA 3RNSA 4IV3A 4LK7A 1VBD2 1UQXA 1AXYA 3GXUA 5C9AA 1ND3A 4PJYA 1HRI1 2JDYA 1TG7A 4O7XA 1DF0A 4EZ4A 2EIGA 2VOWA 2RS53 1K42A 1DGWA 5LA2A 4LHKA 2EAKA 3DXUA 1WW7A 2YU2A 3A0KA 4NOTA 2RMU1 2DVDA 4MGYE 1CZVA 3POJA 5A3WA 4LBLA 1QF3A 4YPJA 1N3PA 4JTNA 1UOFA 3U11A 2C9AA 4UFIA 1V00A 1E5RA 3WCSA 1JZ3A 4CUAA 5LEJA 3N9MA 3PUIA 4Q0UA 2YC0A 4ES9A 2D98A 2VMDA 2HJIA 4XC9A 3I2HA 4PHZA 3AP9A 5CAZA 5FBJA 5B4NA 2JX9A 4CCNA 3GNEA 2DBIA 1AZDA 2Y60A 1W6NB 2MNGA 5F7UA 2ZXQA 1D2SA 1DGWX 5K0UC 5HXMA 5L7OB 1ZREA 3SXWA 1Z7S3 4QHZA 1ZRCA 4DMIA 3CZJA 5A32A 3AJYA 1Q3EA 4QWNA 1GZWA 5D8AB 3U75A 2WNUB 2W08A 1GSLA 1GZ9A 3R4SA 4KWUA 3AVSA 3RWNA 4CDWC 5LWBA 5FV3A 1EV13 3JB8A 1V6OA 1VR3A 4HVRA 3AVRA 2JKBA 3IZOA 4YVSB 4CEYA 3CQOA 1YNAA 4XIKA 3U1XA 3IIAA 4NAMA 1AVBA 3Q8BA 4TWTA 4Y20B 1E57A 3WW3A 4I0AA 2WO2A 3RI9A 3QLQA 2YBKA 3ILRA 2LS6A 1OD3A 1V70A 1YIFA 1Z7S2 2H6CA 2XB6C 1PHMA 1CZSA 2Y38A 4MADA 5FO8B 1CPMA 2PHDA 2ZACA 1V6MA 4BH9A 4BQ3A 5FZ4A 5ANQA 3MLLA 5F6KA 4LHLA 4NHKA 5DG2A 5FREA 5JOXA 1JTZX 3DYPA 5T52A 5LA9A 5KWRA 3M8LA 5L9RA 1EV12 1J58A 1VP6A 5ANNA 1H4HA 1AF9A 3ZN6A 1BMV1 4AWDA 1UYYA 2YG0A 3E5XA 3NO8A 1CN1A 3NAPA 2J1SA 3CF6E 1HRI3 1OA4A 2DCJA 2VVFA 3BTAA 1O5UA 5F2SA 3ZKUA 2WO7A 4BXFA 5FXVA 2BJSA 3AP4A 3IMNA 2ZCWA 4LBOA 4OULA 4A6SA 3BI3A 4LOTA 4BQ5A 1ASJ1 1ENSA 5D2AA 3NNLA 1XE0A 2E33A 4PDWB 1RIRA 1GQPA 4XJ9A 5IYYA 2EIEA 5GZDA 1MZEA 2L9LA 5A6QA 2LW8A 3GBGA 2ZX1A 5I0RA 3A21A 5GLWA 5IK7A 3ACGA 3VBFA 2Y64A 1OLRA 1XC6A 2Q8EA 1JYXA 5FMDA 3I2JA 2UU8A 3U4SA 2GC0A 2JDAA 2WWJA 4YW7A 3V64A 3WOGA 1L7RA 2XL9A 3M3EA 1HRI2 2DU0A 2RDNA 3HOBA 5EYYA 2VBBA 4AFBA 3NNJA 3AFGA 4BHPA 2R071 5FZOA 4V1PA 2HWB1 1H6XA 5K7PA 1S4CA 4ONUA 2C5DA 4MGSA 3MIFA 1K3IA 5EV7A 5A3TA 1BZWA 1YFYA 1AHSA 4MXWB 4BLIA 5CEHA 1AXZA 5GLVA 4N90A 1EYBA 1XBFA 3TEXA 4LNVA 1PGL1 4CDQB 3O12A 1AR81 2OZ6A 2VCAA 3WP6A 4QT6A 1QY4A 4QPIB 4QAWA 4UF0A 5CFDA 4AVBA 3PHMA 3SH5A 3HQRA 3AYAA 1YQ2A 2VMFA 4N53B 1H8TC 4EJRA 1BVVA 1LOBA 4L8QA 3WNMA 4E8CA 4XYXA 2CHHA 4Y26A 5FK8A 5A1LA 2A3WA 3ZXAC 5C8CB 1ALYA 5J7MA 1JYTA 3PU8A 5SV5A 1N1VA 4E4DX 3RZMA 2DF7A 1E5SA 4D6RA 5ACA1 5LB6A 1J83A 3I3EA 4Q0PA 5T5OA 4LUKA 1X50A 5I8TA 1PZ7A 3KSCA 4AGRA 3OEBA 4QKDA 1F4AA 5CG9A 2HBTA 3ASIA 3ZXEA 2WQ4A 4O9EA 5KR7A 2G1MA 3CZUA 4AVSA 2QQOA 3DL3A 1FMD2 2CTVA 3O1MA 1W2OA 1NLRA 5BXXA 4B29A 1QH7A 2R1BA 1RUF2 3I2FA 5K8SA 4Y24A 2KA3A 4D3WA 1JYVA 2AENA 3FFQA 1YI9A 1ASJ3 1ND3B 4RS5A 5K9YA 2EAAA 5JAXA 3VZLA 3N9QA 3UL2A 1TQ5A 1UX6A 4GMP1 4NRMA 5FLIA 2Q0AA 3POSA 2FHRA 1W8HA 2ZKNA 4CCDA 1WD3A 1G9BA 1W6MB 2RVAA 1RUNA 3G6JB 4V2VA 3CO2A 1CD3G 1NY71 2ZGRA 2XVKA 3ETQA 2R073 1KEXA 3PIGA 2HWB3 1QXRA 5F3IA 3C8XA 1SPPB 4N7UA 2WZR1 4GH4B 4QX5A 4XETA 1C4RA 5C8WA 1RUH2 3DUIA 1X36A 5LY1A 4XHBA 2W3JA 1ZM1A 4JKKA 4CDXB 3MHZA 3ZMOA 2Y6JA 4OUSA 1SFPA 2YC2A 1AR83 1HKDA 4L92A 5G04L 1H4GA 4Q0QA 1F2NA 1UIJA 2SLIA 1YJKA 3VKNA 3BPZA 5A32B 5CFCB 1AR61 3HPNA 2PLV2 2GC3A 3JD71 2R072 2V72A 2HWB2 4GQ7A 3U14A 4Z82A 3OEAA 5BYNA 3I54A 5ACA3 3CHXA 2QQUA 1QJX1 2VZVA 3S7IA 4HKWA 2WNEA 3OBZA 2VZ3A 2VCCA 2CL2A 2WFF2 2O8QA 1PGL2 4OHZA 2A6WA 2ZKLA 4LO7A 1OD5A 4AYUA 4B8EA 4BQWA 5KHIA 4Y1ZA 5IK8A 1TMF1 2VQAA 3AYDA 2Z79A 5I0TA 1KD7A 1MPXA 2GNDA 3ZMNA 2QQLA 4OYUA 3SC7X 2FZ2A 5ACA2 1R64A 2RR11 2CGOA 1ULPA 4P9JA 5FZBA 1MR5A 4X8PA 2ZA9A 4K1ZA 4XF1A 4KBBA 4PBOA 1WA4A 5DUXA 1D4VB 2QVSB 3T2QA 4B4RA 5IVBA 3LWCA 2NZ9A 4GMP3 1B09A 1OSGA 2GP5A 3WDTA 3BIWE 4BK5A 1QJY1 4L9BA 4MSVA 1FOD2 1TE1B 1FI2A 2KXLA 3IB3A 3GCXA 2VW0A 3VBFB 3N35A 3T0AA 3IBMA 1KGYA 3FWEA 3LPGA 1GR3A 5JDBA 3N9LA 3PUSA 4LBKA 4XBNA 2WZR3 3AZYA 2G4IA 4P5HA 2CY6A 1JZ2A 3VD5A 1RUC1 5FWJA 1VMHA 3AL6A 4XAAA 4ASLA 2GALA 1DLCA 5FRAA 2RDSA 1UY3A 3HT1A 3WSOA 2J22A 1VB2A 3VBSB 3JBG1 2WT2A 4LORA 1ZZ6A 5FQ0B 4Q8KA 4K21A 5FUPA 4MGKE 3ZYHA 1XNBA 5FFOC 2A6YA 1AR63 2PXJA 3M70A 3VBUC 5C70A 1NY72 1UN1A 1ULDA 1XU2A 3K3NA 3I2OA 1JYIA 3JD73 5CADA 4W4ZA 4BWOA 3ZYGA 2WN3A 3ZFFA 3MW4A 1LU1A 1UO9A 2EIDA 3N7MA 4QXCA 4JAAA 5FPBA 4D7SA 1NXD1 2BEOA 3PMSA 2PA7A 3WCRA 3AC0A 5LW9A 1QJX3 2ZZJA 3WINE 3E5UA 4XFBA 4XFAA 1TEIA 2VU9A 4GWIA 2JDPA 2YFZA 1DDLA 1G9AA 3HQXA 4BM8A 1GWKA 5M0TA 2W39A 2YGMA 4XUQA 4AG4A 1VBB2 3FMGA 4AHYA 3QH7A 4LE4A 3AZXA 1TMF3 2Y6KA 2Q1FA 3KV5A 4QX3A 4O65A 4IE7A 4Y1YA 4DXZA 3RWKX 4FTSA 1W9WA 4N9HA 2VOVA 3LIHA 1HB3A 2XXZA 2RR13 1QJX2 3AKSA 4BISA 1XNTA 1XE7A 3KGLA 1IS4A 1ZZCA 2WQZC 3NQHA 3T4HB 3ZPOA 3WF0A 2I2SA 2VOTA 3PTYA 4IEQA 4YM3A 3BALA 1JBCA 1HXS2 3BUCA 1S55A 4MYEA 1QJY3 3WHUA 1TMF2 1R1A1 2VMGA 4XF0A 4QGNA 3HBKA 4JGZA 3CDZB 4TLGA 4UXAA 4QQHA 4Q26A 1W06A 5ISLA 2C0ZA 3MUY1 4YM2A 2RR12 2BU9A 1IG3A 4LUMA 3QBQA 4AXOA 1Q5OA 1RUC3 3VN4A 2ZHNA 3WR0A 4BDVB 4DINB 5FR3A 5IAXA 3ATGA 3W59A 3WY6A 1IS6A 1RVF3 2VMCA 1GZTA 3JBG3 4IEXA 4PIZA 4UFKA 4CUBA 5KC6A 2ZGQA 4YZ2A 3R6SA 4N43A 3RJ2X 1QJY2 5JUVA 4XUTA 3BU7A 3N3HA 1WMXA 4AEDA 3ZXGA 3AZZA 4LE3A 4D6QA 4XXAA 1QKQA 4AOCA 1TNRA 2R7EB 4AZZA 3THPA 4QDSA 1T6BX 1RUC2 5FP3A 2P6CA 1SQ4A 4R9CA 2VVDA 2Z69A 4PQ9A 5IUQA 1G8WA 1LGCA 1FYUA 5L73A 3S30A 2HWD2 1RVF2 4I01A 4DUWA 1XJAA 1WMDA 3BOWA 3JBG2 2RJ2A 4NAOA 1IOAA 2P3IA 1OMIA 4I3GA 1O8PA 1NAEA 1LEDA 2OQ6A 2P1BA 4OHWA 5BNPB 2B46X 1CAUA 4AEKA 3UESA 4KWJA 5BNOC 1SDWA 1W6PB 2DBNA 5C4WC 3ECQA 4P9XA 4HVQA 5LK5A 2UY8A 5LA0A 4OZOA 1D0HA 4D94A 5A7OA 3MW2A 4AQ2A 1GWMA 1OC1A 1WWYA 1WW6A 1XSQA 3NNGA 3H8RA 2YYOA 2VGDA 1B35B 4R8HA 3VBRB 1ZRIA 2GH2A 1ND2C 4JX0A 5GLZA 5KC5A 1SBDA 3FBYA 3C3VA 4ARXA 3WNXA 4CCLA 5G05L 5J37A 5T54A 1UYPA 3AK0A 3HMYA 5I91A 3O1VA 4NIIA 5FLJA 2C4XA 4UT5A 5FPLA 3I3MA 2WSUA 1PIV1 4WVVA 1R1A3 1SZBA 2XJUA 4XW3A 1VIWB 1X8EA 1Y4WA 4LIUA 4BOWA 5FZGA 4BCUA 1OXCA 3NV2A 3ZFGB 3AMMA 2OT7A 5C3PA 2QQNA 2CYFA 2W94A 1LAJA 3OD4A 1QHDA 3S57A 3ETPA 3FLTA 2WS91 1SHWB 1IPJA 4Y1VA 4CRQA 2A75A 4UFHA 3AZWA 5DUWA 4YW2A 2XBO2 3N7JA 1H0BA 5FMBA 1S2KA 3WNPA 5DABA 1XE8A 3SKJE 4KI5M 5C6CA 1TNFA 1NE4A 4M3CA 1COV1 4NN0A 3JB4C 3J26N 3VZNA 5FY8A 5FP8A 4R4ZA 3PUAA 3VDDB 1LHOA 4P02B 2HH9A 5HXVA 4QHBA 1OLQA 1ZX5A 5EFUA 4HMZA 4ATEA 1WCQA 1DFQA 1NE6A 1NZCA 3CLPA 2XKOA 3AXEA 5EJZB 5FYCA 2X5IA 1FNZA 5AFEA 4RN5A 4IV1C 1AYM1 3H1YA 1RJ7A 3OY8A 4IV1A 4YLZA 5EZWA 2HYXA 3RMYA 5AFBA 4JGYA 4INDA 2D5FA 3FX3A 5FZAA 3U07A 4HFSA 1LGNA 3APBA 1VJ2A 2GU9A 5LBEA 1Y9MA 4NUBA 2WYFA 1JZ7A 3VUOA 5KXBA 3OGGA 3VHNA 1NYWA 2QTWB 2VUCA 2EF6A 3DF0A 3WV6A 1O4YA 1OFNA 1PIV3 4QX0A 5E16A 5DZFA 2ZEXA 1NLQA 4AE2A 2VULA 1GNYA 3UKTA 3IAQA 2RHPA 1IZ3A 2Y6GA 3I97A 2QCSB 4XTMA 3SMHA 4CUCA 4Q1RA 2PQQA 5IVFA 1UOJA 2NP0A 2UWBA 3K77A 2QQMA 4JQTA 1BEV1 1HB2A 2ZX4A 3N36A 3LDRA 2R0HA 3GYDA 2WS93 2WSVA 5CKMA 5E89A 5L19A 4CPBA 4P9IA 1FXZA 1NX9A 4M3CE 4DZGA 1UF2C 3ZIWA 2XOMA 5FXXA 2HKXA 2F4PA 1JH5A 3PTRB 1C8M1 1DGRN 1OURA 5T5JA 5LRSA 3DXTA 5T50A 1XYPA 1AX0A 2XJVA 3CJIA 4XTPA 3D0JA 2V5DA 2HWF1 1BQPA 3WF1A 5IVJA 1COV3 3WHTA 2WN2A 4CDUA 3ACLA 4YRDA 2YHJA 1WCKA 3T0BA 1JUHA 3RZGA 2XVLA 1ODMA 3FN9A 2AH2A 2WS92 3CEWA 2WAAA 3IPVA 3QCWA 4BQ1A 2B9VA 4ISQA 1MEC2 1V6NA 5JPMB 3VBHB 2FQPA 2W1SA 4QX8A 1X33A 4RGGA 2Q8DA 3N9NA 5JVVA 1AYM3 3A22A 1H8VA 1MS8A 2UY9A 2QKDA 3ORJA 2KD7A 2JDHA 1NUKA 2YUEA 1O91A 1LOFC 2VXRA 3ZXKA 3HJRA 3WP5A 4UFJA 1COV2 4E9KA 2JG9A 3IAPA 3TEYA 5FK7A 1F8VA 5JPNB 1DYOA 4WBBA 2OA2A 4BLJA 3FE5A 1U12A 1HRV1 4CCEA 4MGZE 4EN6B 3TB0A 3K4AA 1DQ4A 5EPAA 1BK1A 3QD6A 5EJ3A 3VD3A 3O1UA 2QJVA 4UW4A 3EB7A 4XFGA 3PUQA 5L7OC 5KXDA 1SLAA 3TYJA 4QXBA 4N7IA 2CWSA 2TUNA 5E1RA 5C3RA 2DYCA 3AMHA 3FHQA 3I2IA 1QOOA 2ZBJA 4LBQB 5FMCA 2WRAA 1O6UA 3J7NA 5D8AC 5JLVA 1BEV3 2PTMA 3WEZA 1GOFA 3B94A 2ZGTA 2WNUC 1KDMA 2AC1A 2YU1A 4CEWA 1Q8VA 1RHI1 4XQ4A 4QXKA 5CB7A 4PCRA 2F6BA 2AR6A 4GZ9A 4NIAA 4CP2A 4C90A 3AM2A 2GN3A 3NJYA 1RUJ2 5DQ0A 4XCAA 4YVSC 1JXNA 1NLSA 1D4M2 1H1AA 1XNDA 2TNFA 2Y26A 1C8M3 4ET7A 2RJKA 4W50A 1AL0G 1ONAA 5F3EA 4F7ZA 2HWF3 3H3ZA 3K4DA 2RE9A 1G6NA 4WM7A 5KHGA 3VDBA 5IJRA 4LHNA 1W8ZA 3PIJA 4HETA 1V0AA 2E51A 4AI2A 1T2XA 1O7FA 3ENRA 3P6BA 2ORZA 2XHKA 3PNAA 3NV3A 1H9WA 3BN6A 1C28A 3MYXA 2J1UA 1C8M2 2BRTA 1R081 1OFSA 4PLMA 1W8WA 2UYBA 1QIQA 5A6YA 3N4MA 1WBLA 4DEVA 1YQCA 4PDWC 4ZS3A 2Y0OA 2ES3A 2HWF2 1UY0A 2Y33A 4WM8B 2DFCA 2P34A 3OY8B 5AVAA 4KU8A 1M4WA 4E8DA 4WVMA 3ACIA 5FZHA 1QJU2 1J3RA 2O1QA 3B3QE 1HRV3 3IDCB 4LKEA 1ULCA 4UBGA 5CNAA 3UJQA 5JSPA 2JWPA 2C24A 1MQTB 1SACA 4IE4A 4HOOA 3J7LA 5FYIA 3DPRC 3RG0A 4I3PA 4IETA 1QNWA 4B1LA 4BQ4A 2A6XA 3MUZ1 5DN2A 2SBAA 1IS3A 3NRUA 1EUUA 4UYBA 4KH9A 4ASMB 1LU2A 3H8XA 2UWCA 1Q43A 4Y22B 3ZDVA 4YG3A 2W68A 3JU9A 4OQ9A 2FDGA 2ORXA 1V6IA 4NJ4A 3UETA 3OSDA 3HWJA 4C1XA 2B39A 3ZVXA 3B93A 3LGRA 1GQHA 4HONA 4KWLA 1LB2A 4YM1A 4MO3M 3JZVA 2EXKA 2D6NA 2DU1A 5A3OA 4GMP0 1QJZA 1RHI3 3LQCA 4XFHA 3OBRA 3WNLA 1YQ5A 5FYYA 1PO21 1REDA 4XZUG 1LODA 3KS7A 1YJLA 2OW4A 3THDA 5C8CC 3TWIA 1UZWA 2CAUA 1XNKA 4FXKB 3GJBA 4DRVA 3SHRA 4GKYA 4I02A 2W1QA 3TNQA 2RDQA 5D1IA 4RQPB 2X29A 4QPGC 4CU7A 4EV0A 4CU8A 2MEV2 3OF1A 2J7MA 2C6SA 4ZONA 1QDCA 1TVGA 4PLOA 2Q8CA 1RHI2 2WA3A 3URFA 4QGMA 3HVDA 1OA3A 2XWJB 3ME2A 3B9CA 3DEMA 1AR71 5DDJ1 2ZGKA 1A8MA 1NCRC 3WDUA 3ZXDA 4B4QA 2YMZA 3VLBB 5F1RA 4BB3A 2ADEA 1R083 2P5BA 1HB4A 2H0VA 1OKQA 3IPVB 4P08A 5EYXA 5KHJA 4ZXEA 4B7EA 4QX1A 1QGLA 4Q4W1 4Q4V2 3WP3A 2CGPA 3M3CA 2EICA 4Q8LA 2YBSA 4LK6A 4JKMA 1UMHA 3DKQA 4Y4YA 3I59B 3N7KA 5K0UA 2JDNA 2ZGMA 4BJ0A 5A3MA 4NR1A 3O1RA 2GMPA 3W5MA 1GNHA 3OBAA 5ABJB 2JG9B 3V0BA 2QDNA 2GAUA 4HLTA 3WQ7A 1Y7BA 1O3TA 2F17A 2CWMA 3VKLA 1S0CA 1R082 1DU3D 4CDWA 4IL7A 1KDKA 4CE8A 3CMGA 4GH4C 3DYOA 3MFCA 1FMD1 1HQNA 5JXGA 2D7FA 1W9FA 1XQNA 2IUWA 1W0PA 1X8MA 2J1VA 4FOQA 2D3RA 3FHIB 3FFZA 4LBNA 5FCCA 4CDXC 3U0ZA 1YLLA 2NN8A 1RUF1 4CXYA 1CAXA 1GUIA 1XYOA 2D40A 4OI1A 4FPJA 3DN7A 1IPSA 4XQDA 3FLPA 2RV9A 3PDQA 3AFKA 3ZSMA 1UOBA 1OPMA 1VBA1 4META 5BNNB 5CFCC 5JZGB 1PO23 1JU3A 3EQEA 5HV4A 5DUVA 2X53S 1F4HA 2XDVA 1TME1 4XF9A 2ZGSA 4ZU5A 4ASKA 3BKZA 3B69A 3HR9A 1W8NA 3AB0A 3PURA 2ZS6B 3KCXA 2BNOA 1C1FA 3POBA 1PMHX 1JHJA 4FCAA 3UV9A 1X9TA 3INAA 1NCQB 1W9YA 1J3PA 4HZFA 3BGAA 4XBQA 1YFUA 1DP0A 1RUH1 1YFWA 4QHOA 3T30A 1XSRA 1VB4A 1PO22 1VAKA 4XZPA 1AR73 4WM7B 4JDNA 5DDJ3 1W8UA 1LHVA 3RS6A 4A42A 4IUGA 5F32A 4PBPA 3M3IA 3MFAA 3KCCA 3QACA 3WDWA 2VNGA 2ZJCA 4UBHA 1OH4A 2PLV1 3RQ0A 2JB8A 1IHMA 1I5ZA 4Q4W3 1GZCA 2PHUA 1AJKA 1EPZA 4XFCA 3ZLIA 5HCHA 3OD0A 3OPWA 4S2HA 4ZZ5A 2K2SA 4EN0A 3MO4A 1W6OA 5HV0A 1AR72 1XRUA 3MPBA 5DDJ2 2WFF1 1WKYA 2QQWA 3LZZA 2PQSA 5FYSA 1R092 3D8CA 4JDOA 4Q27A 1XNAA 2O14A 3BVCA 5FZFA 2OQ7A 3LEIA 1FMD3 3ELNA 2B45X 3V56A 3RSJA 3WUCA 1H8TA 4PF5A 4Q4W2 4PIYA 3ZN5A 2K46A 4D7YA 1SLTA 4Y3OA 1RUF3 2E7TA 3VBSC 5JOWA 3V0AB 3SCFA 3UKVA 4E4HA 3WD5A 3VZOA 3LKJA 2ZEZA 1GOHA 1QMJA 4QB6A 4LBQD 3VHRA 4NMIA 2XQXA 3ZR6A 1VBA3 4D7TA 3KT1A 1OBNA 3N9PA 4Q4X1 1CPNA 1TME3 2VBDA 4QKNA 2CSGA 3ZYIB 4GWMA 1VBE1 2B9UA 4FQ4A 4QX2A 1FOD1 2AEZA 1H2LA 2E63A 3ZX7A 1HN1A 1UKGA 2P37A 2XKPA 4IV3B 4GJYA 1XOYA 2R061 5BY5A 1OOPC 2JG8C 5C9AB 4LLFA 4JRLA 5LBCA 4OI0A 1CONA 2JG8A 4LKSA 1GWLA 1RUH3 5DZEA 2E7QA 1VBA2 1VMJA 1MS1A 4X8NA 4TLFA 5F5IA 2EA7A 2IZWA 1STMA 4QQPA 1ZZ7A 2QZ3A 2JEMA 1TME2 2BNMA 3N9OA 5A80A 2JD4A 1W03A 2R041 1W05A 3LSEA 3I49A 2GMMA 2VMHA 3EO6A 1PO11 2YY1A 2DVFA 4CVUA 3OPTA 4A7ZA 2VPVA 3T0DA 2Y6LA 2PLV3 3MF9A 3K75B 2JJ6A 3ZKYA 3AYEA 2PELA 4U36A 4TTGA 1S0BA 3VL9A 5B2GB 1CWPA 3RPQA 4AVVA 1A34A 1OVPA 4YGEA 4H2AA 2ADDA 2RS31 2BWCA 5A70A 2H6BA 1JZ6A 3WG1A 1W6QA 2VY0A 2OX0A 4E4SA 4FI9A 2WFF3 3QH6A 4LIVA 4FP3A 5H9QA 4GWNA 2A5ZA 4L2NA 3PVNA 4GJZA 4NPRA 1ZRFA 2W95A 4IGQA 1VBB1 3JXSA 1GZWB 4N8MA 1Y3TA 1EUTA 3W5NA 4HVOA 4Z1VA 1LKNA 4CEYB 1YWKA 3T1MA 4TYSA 1W99A 2VZUA 3MV01 3CU7A 3MIBA 4ZS2A 1W8OA 1UZVA 1GOGA 3OPZA 1FPN1 2NM1A 4XUPA 3ILNA 2WUHA 4URTA 4Q4X3 3VD9A 1HXS1 1WMFA 1HV1A 3O1OA 4K8RB 1V6JA 1VBE3 5FTTC 2ZZQA 1FOD3 3TBDA 1ZBA1 1V6LA 3OTFA 4MHUA 3WVJA 4CCOA 1QDOA 4EWDA 2P6HA 4MG2A 1I6XA 2LROA 1U5IA 2BVVA 2P2KA 2R063 5GZFA 2CDOA 3ZN6B 3ZM8A 2ZGNA 4CPBD 2NMNA 4HN1A 5FJKA 1RGSA 2C9KA 2ENRA 3KCYA 3NAPB 5GKAC 5KBFA 2WZPP 3SH4A 2J42A 3M3OA 5BNPC 1H2MA 3ACFA 4EROA 1CIWA 4FT8A 1A8DA 2PAKA 2G19A 1C5HA 3HD8B 3R0RA 4FPFA 4LXLA 4Q4X2 4XE9A 3VKMA 2R043 5DMYA 1QU0A 1VBE2 5CKNA 4BPZA 1GP4A 2VG9A 1PO13 4DIQA 4OFGA 4OHYA 1B35C 3VBRC 2VTXJ 4AQSA 3LOBA 1F9KA 5IWFA 5FY9A 1G9CA 1X7NA 1OT5A 2R062 2VO5A 1IQAA 1SCSA 2VMIA 3PVBB 3R4DB 5FJHA 1K12A 3UK9A 4AI0A 2LRPA 3VB9A 3IIIA 2DTYA 2RS33 2B4KA 5FZOB 1N1TA 2W91A 3KHCA 2HWD1 1YHFA 1OUXA 1RVF1 1S0IA 1SMVA 1YFXA 2R16A 3EXUA 4E2QA 5JWPA 2R042 1S0JA 3LA7A 3GHMA 4IEZA 5HCAA 3ES1A 3IT8A 1PO12 4HPKA 3ZFGC 2EXJA 1DYKA 2BFUS 3WG3A 1VBB3 5GJ6A 4RHV1 3VBUA 2JECA 2VQ0A 3N7LA 3R4UA 4FAHA 4LO8A 4YARA 5GZGA 1ULOA 1KJLA 3BIEA 1AR91 2WYSA 2D6LX 4UF0B 4YM0A 2I45A 3WW4A 5CFDB 4XUNA 3BTYA 3BB6A 1W2NA 2RS32 3PL0A 4XF3A 5GM0A 4OUEA 3WW1A 1H8TB 4YVWC 2K9ZA 1Q8OA 4UW5A 4R52A 2Q1MA 4E2SA 1WLTA 1I5PA 3VBOC 3KD4A 5IFPA 4CP9A 1FPN3 2AZ5A 1UZZA 1ULGA 2P17A 3IMMA 1HXS3 4EN8B 1SLBA 4YG0A 3THCA 4PIXA 3KF3A 5F5CA 1ZBA3 4NWVA 5T55A 1NQDA 1O59A 2IXJA 4LTAA 3VV1A 3VDDC 2NMOA 3KF5A 3NV1A 3VHOA 1YCIA 1W9SA 5FYZA 4H14A 2CV6A 2D6MA 1JYNA 4URAA 1FPN2 3VKOA 4KMQA 2D93A 3GZUC 1X9PA 4RS5B 5FP4A 5FZ3A 4BXSV 3AXDA 4BMBA 2VD7A 2PFWA 3O0VA 4TXWA 5FZKA 3RI8A 1DZQA 4TZDA 2XG3A 2YXSA 1ZBA2 3LEMA 4OMCA 3F95A 4FSJA 1BVP1 2HBUA 1CR7A 2XBO1 4A3XA 2D6KA 4YNIA 1LHNA 4EWAA 5F37A 2R1DA 4IESA 4FPEA 5LCWL 1O3QA 2VQTA 2PYTA 3GZTB 3IN9A 4HN0A 2X05A 4ZKTB 2WZEA 4XCBA 4CCCA 4COZA 1RXGA 1I1EA 5A33A 3T08A 4JKLA 4AVTA 5DAQA 1U5XA 2HWD3 3USUA 5LATA 2B8MA 1FV3A 1ZA7A 4JHZA 1PMIA 1GP6A 4JTOA 3POFA 4L99A 5FPZA 2GSYA 1RINA 5FY5A 4QX7A 3ZXFA 1CESA 2Z2SB 1LESA 3IDEA 3UGHA 3AP7A 5GZCA 4IEUA 3OOXA 4D0QA 4A41A 5HPOA 3UGFA 4RHV3 3HBZA 5C3OA 4JVAA 2WABA 1C1LA 1AR93 1MS9A 4FFGA 2AYHA 2ARCA 4DXSA 4YZ3A 2J1AA 2AGSA 3CJXA 4QDQA 2W92A 3ACHA 2A3XA 2BDRA 2VW1A 4AAPA 1CAVA 4P00B 2DDUA 3NJVA 4F8AA 1UL9A 3U10A 4D8MA 2J1EA 2RDRA 1JI6A 2VZOA 5FYVA 3S7EA 4A3ZA 2GNMA 1ULEA 3VKFC 4AFDA 4RHV2 3NJXA 3WDVA 5C4WA 2DVAA 5BNOA 5J09A 5EJ1B 1AR92 3ZXJA 1BYHA 3E6CC 4QDRA 1DQ0A 4EN9B 1WGPA 1UXXX 3CNAA 4Y4RA 1POQA 4RA0A 4ORFA 5AVPA 5FYTA 2IXKA 4KL1A 3WG2A 3FUOA 3WDXA 5FKCA 5AC91 4WVWA 3E1F1 1T6GC 2GNBA 1ND2A 3K46A 3VBHC 3ZYBA 4GXLA 3KGZA 2RM22 1G7YA 1SFNA 2MHFA 2Z4FA 2IWGB 5A7QA 1FX5A 2ARAA 3TAYA 1IGOA 4ES8A 1JHNA 1LRHA 4AI1A 4RFT0 1DHKB 2TBVA 3WXPA 2ZEWA 1V9U1 4LO4B 4S2DA 1JZ5A 5IW0A 3HNMA 1K5MC 3LEGA 2PN5A 2DVGA 4XURA 3BPSA 3E6BA 5I0UA 4K20A 2XBO3 2BQPA 4MGTA 1LNSA 4KU7A 1YRZA 3ZSLA 4B1MA 5T3NA 5FZMA 2DCYA 2ERFA 5FY7A 3B7MA 5LRRA 1SFYA 5FZ1A 4OQ8A 2ILMA 5FMOS 3ROUA 1ST8A 2Z42A 3CBNA 2FDFA 3SCGA 4QMAA 3HAGA 5DAXA 3ZFEC 5KHHA 1WA6X 1QOTA 3O0WA 1MEC1 4Y5TA 3JCIA 2JXAA 1QJFA 2R49A 2NYYA 3H1WA 4GALA 3UGGA 5BUVA 5A7PA 1HJFA 1LR5A 3THTA 1PZ9A 4HPKB 1RJ8A 3U78A 5FPUA 4LHSA 4YGDA 1H6YA 3MLKA 4BIFA 1FNYA 3D4KA 4G4FA 5B4XA 1MZ6A 3WQ0A 1HJGA 2P3KA 1HLCA 4OUMA 5FZ9A 3RZZA 3K51A 3ZFFB 3FBMA 1LENA 3WUDA 4PF1A 3WQ1A 5IATA 2ZAAA 4YGCA 4Q29A 3S0MA 2AREA
chains in the Genus database with same CATH topology
3L2HA 4G9SB 1WD4A 2UWAA 4S2GA 3P3PA 3C2UA 4FPOB 2BFUL 5CBLA 5I8YA 3MZHA 5FO7B 2DCTA 5AC93 3GBWA 1N3QA 4I30A 4P14A 4K8FA 3NWKA 1VAVA 2EVXA 5CU1A 1RUJ1 1UPIA 2ZX0A 3NKGA 2FZ1A 3J8F1 1WUVA 3MI8A 1V9U3 4WM8C 1D4M1 1XYNA 4AHZA 2HEVF 3GZAA 5H9PA 2C1FA 1IKQA 3KZ4C 4AI8A 5AC92 3AMPA 1NA1C 2XJPA 1MQTC 3JQXA 1S0DA 4IEYA 2LALA 4JGZB 3USUA 1ENXA 3FUQA 2JENA 4GULA 2LTNA 1KITA 1UZYA 2ZMKA 1PK6C 3MICA 2IFRA 4GA9A 2WNVC 3ES4A 2OYZA 1PM7A 2WNVA 5JMCA 1V9U2 4TSVA 4XFFA 1MEC3 2A71A 4FOYA 1MZFA 2D6PA 4Q1PA 4DOUA 4N43B 4COVA 2VVEA 4YW5A 4AEDB 1RUE1 4RR3C 4FPKA 1APNA 4KWKA 4COYA 1QJU1 1OQ1A 2G9FA 4K9SA 1W39A 3E97A 1OQDA 4RQPC 3RYKA 2E53A 4XJ8A 1WLWA 1Z78A 3B9IA 3VZJA 4QQ2A 4M01A 4R9DA 3PVOA 1CAUB 1LOFA 1F5FA 4XEZA 2GZWA 4RD7A 1PNFA 3BOPA 2ZGPA 1YIPA 2R32A 4P9YA 2W0XA 2O8OA 4XXPA 1YYNA 4YFWA 3EHKA 3H7JA 4HL0A 2YGLA 1ND2B 1RUJ3 3J8F3 3D82A 5IK5A 2KM2A 4MVTA 3LOIA 4N9IA 1D4M3 2PHXA 4IQPA 1H1IA 2DUQA 3UKNA 5L7OA 3EJKA 1F31A 1OA2A 3MIGA 3W9AA 1GFF2 5ABJC 2MEV1 5GALA 5D8AA 1R1ZA 1N3OA 3SNMA 2WNUA 2BBVA 4DRRA 2VNOA 3J8F2 4YVSA 3W58A 1W2UA 4XDQA 4ZXKA 4Y20A 3PJQA 1QOSA 3ZXLA 2GNTA 4XJUA 5T5LA 1POV1 1HX6A 1LEMA 1KXGA 4AF9A 1RUE3 4Q4V1 1GNZA 2HWE1 1QJU3 1RITA 4S2FA 1H2NA 4M3CB 4XILA 5FMOL 4LA2A 3GBFA 4HK8A 4XFIA 4I09A 4Y1XA 5FOBB 1EAH2 4Z92B 1RUOA 1GANA 3ILFA 3AX4A 2X5IB 2D3SA 1UD1A 4PDWA 1RUE2 4WZFA 3M4FA 4IV1B 4O9GA 4YZ5A 1PNGA 1J59A 4JGYB 3D5OA 3B5LB 5F6LB 5JCTA 1LGBA 5GZEA 2WFPA 3DPRA 4YGBA 2HWC1 1WW5A 1VBC2 4XJAA 1M06G 2UURA 1SEFA 1JN2P 4LO6B 4MXWA 4QPYA 2QE3A 1IKPA 4QU2A 5J36A 2MEV3 4FPGA 4CDQC 4E2GA 4W6XA 1C57A 4QPIC 2DVBA 5KXEA 2XPJA 4Y1UA 4XJZA 4R9BA 1FT9A 4N53C 3M1HA 3OGJA 4JRAA 5JI9A 5C8CA 2VH9A 1I9RA 2A73B 4DY5A 1S0GA 2YPJA 1GBGA 2A70A 3POWA 1POV3 2ZGOA 4QPGA 4LULA 3MW3A 4Q4V3 2BGCA 4AQ6A 1UU6A 3KLSA 4W6YA 2HWE3 1LJ7A 4HSLA 1NQJA 3CJIB 1AYN2 1OHFA 1RUI1 3VL8A 2Y0IA 3VZMA 3H7YA 4CDUB 1N47A 2LUWA 1NCRA 4IV3C 1R091 1UMZA 2WIIB 1BKZA 2Q4SA 2CNAA 1RUG1 3LAGA 3KQRA 5C9AC 1ND3C 1LTEA 5HCBA 4QM9A 4NO4A 4K40A 4LBMA 1BXHA 3NKTA 2HWE2 4OI2A 3AKRA 3TOJA 1N1SA 3NL1A 4HK9A 1W6MA 1I3HA 3GALA 4OHXA 4ITCA 1RUD1 4XBLA 4MLOA 2VUJA 2HWC3 2OVUA 2Z5WA 4GKXA 2WINB 4GH4A 4MUVA 1U5ZA 2Q1ZB 4XMAA 3Q9OA 4K1YA 3RRDA 2Q8OA 4CDXA 2A3YA 2RS52 5FDBA 1WLCA 2QDRA 5FBZA 5HCFA 5FOJB 4KG0A 1YI7A 3E5QA 4YG6A 4P9GA 3IKWA 4FBFA 1ULFA 3H9AA 4DS0A 5CFCA 1Z0HA 2HWC2 2WT0A 4E4ZA 5I8SA 2BNNA 4CEWB 2ZGUA 4CEYC 4C1WA 5FAXA 1DQ6A 1SCRA 2ZHMA 4JC1A 2PAEA 1XXNA 1UPSA 2XUMA 1CX4A 3J4UH 2FMYA 1HDKA 2E6VA 2BPA2 1RUI3 3AMQA 4MH0E 1SBFA 1KRIA 2PHTA 3OYWA 4QD2A 1R093 4DPNA 2PHRA 5CA6A 1BBT1 1RUG3 1HQWA 3U4XA 4AHWA 3NAPC 1ENRA 2ZHKA 2ZX3A 4ISRA 1CAWA 1WCSA 2GC2A 3J9SA 2DFBA 2JE9A 4LLOA 1Y43B 1G86A 3M3QA 3OBTA 4AEJA 4DFSA 3E6DA 1C3HA 3WW2A 3H3UA 2PHWA 1RUI2 1H30A 2X8KA 3D0SA 2BUKA 2ZHLA 2RMU3 2WL1A 1CQ9A 1D2QA 3ZYRA 2GC1A 4WVMB 3VBFC 1RUD3 2AUYA 1RUG2 1ZZ9A 1Q8SA 4MX3A 3ALQA 3SCHA 1RL3A 3DPRB 3K48A 3NV4A 2A6ZA 3KT7A 4M00A 3MIEA 3O0XA 3VBSA 3AMNA 4AVCA 3PVEA 2D5HA 1DDLA 3MIDA 4OZXA 5FQ0A 2RMU2 3JUUA 1JUIA 1S0FA 4FQZA 2QZ2A 1RUD2 3MDPA 4BE3A 4C0BA 4YYOA 3RDIA 4H7MA 3OCPA 1UAIA 5CFDC 4Z07A 2GH8A 1DZTA 2Q30A 1QQP1 2WJSA 2B42B 4H7LA 4AHXA 2ZX2A 2IC1A 3SISA 4XJWA 1OOPA 1LHUA 5E8AA 4QPGB 1O5LA 3LCPA 2DTWA 3AKPA 4KGQA 5EWSA 5TSWA 1ZBE1 3I7DA 1WBFA 1VRH1 1BBT3 2YV8A 1VAMA 1LOEA 1U5YA 5KHKA 5DXDA 4FP2A 4FAGA 2ET1A 4LO5B 4CTEA 1NCRB 1LECA 1PZ8A 3BCWA 2I07B 1HIXA 1HV0A 1O4ZA 1UU5A 3GHNA 4RS5C 5FLHA 2QFEA 4A2UA 2D3PA 4R9AA 2PHFA 1AX1A 1DBNA 5K0UB 1C5IA 1BBT2 1ZVFA 3H8UA 2XJQA 3SH3A 3ZSKA 1BMV2 1BJQA 1J3QA 2OPKA 1ENQA 2WA4A 3A0NA 3V0BB 4LT5A 1MS3A 1A3KA 2QNKA 4UW6A 2XL7A 4HKOA 1EY2A 1HW5A 2NPIA 3L9JT 4G3YC 4CDWB 1ASJ2 2ZABA 4XIOA 2ARBA 1GICA 1CAXB 2E9QA 1GKBA 1LHWA 1W0OA 2ZAHA 4AK3A 3DGTA 4Q4Y1 1RB8G 1QQP3 2YZ4A 3WX5A 3O7OA 4B4PA 2WLPA 4FXGB 4Q0SA 1NOVA 5JI7A 2PAMA 1SLLA 2VNRA 1O4TA 1PVXA 5GLTA 2BTVC 1NXMA 4A7YA 3FC0A 4DB5A 2O0OA 1ZZ8A 2BVBA 2JDZA 1QXJA 3H50A 5BNPA 2ZGLA 4GB31 5CVRA 1W6PA 1AR82 5CG8A 2FMDA 2V5YA 3RJ2X 1KFUL 4FPLA 1ZBE3 2D44A 1QQP2 2FBEA 4HT1T 1VRH3 4XHXA 1WW4A 1JW6A 4JDMA 1B35A 3VBRA 2WT1A 2XWBB 2H0BA 3OYWB 4YSFA 4PLNA 3B02A 1S2BA 1MS4A 3KM5A 1CAWB 4DQAA 4BIOA 4QGLA 1KJRA 2ET7A 2XVGA 4SBVA 4CYDA 1ZBE2 3OJBA 5LEKA 1VRH2 3QOPA 2GMEA 1W6OB 3ZFGA 5DG1A 1RMU1 1ZRRA 3MF6A 3WDYA 3D6EA 4Q2FA 4OHVA 3MEPA 5JSOA 1DG6A 3T2TA 1BCXA 1IPKA 1FAYA 2D97A 3G7DA 4C0HA 5H9RA 1OPOA 2P3JA 1J1LA 4K7JA 1DZRA 4COUA 4YVWA 4AFAA 4D69A 2RM21 4L97A 3VBOA 2IXHA 3WLUA 3IDBB 4Z2WA 3O5SA 4EWEA 4J6GA 3I2DA 4Q4Y3 4LBJA 1N1YA 3ST7A 3H1MA 3WT3A 1GV9A 5LK7B 3ZFFC 4MV2A 1S0EA 3VDDA 2WZR2 2XLFA 4A7KA 4KNCA 4BA6A 4ZU4A 2K0GA 2DCZA 3ZPYA 4FTBA 4GB33 1OOPB 1CJDA 2JE7A 2XLAA 2JG8B 1AL21 5SV8A 4COWA 4MZUA 4Q4Y2 3B00A 4AQTA 1AR62 2WLQA 3SITA 1LCLA 3JD72 3WP4A 1SLIA 4OVEA 5JOZA 2V73A 5H9SA 2XH6A 2DCKA 2EALA 5J96B 2XJRA 5T5PA 5FO9B 4J1WA 1ZZBA 4GB32 4DY3A 3ZIXA 3NW4A 4FO9A 4LR4A 3AYCA 2XLGA 2A6VA 4XMIA 1HQLA 1Y9QA 3EBRA 2ZTNA 1W6QB 4YW3A 1CGPA 2WKKA 1LOGA 1RMU3 4JGZC 3I4IA 1AUYA 1PVC1 5DUUA 1DGRA 4AI3A 3ZSEA 4L11A 3TN91 3VZKA 3MIHA 4F3JA 3B01A 1FV2A 3TRSB 4AGGA 4KQ7A 1EPWA 1L3JA 4P9LA 1DIWA 1JOJA 1UW8A 2RM23 1WCDJ 2JICA 4N43C 1AJOA 1RMU2 3KB5A 3PLQA 4FPCA 4HBNA 4AEDC 3GF6A 4HSJA 1MS5A 5BNQA 4AFCA 4XOGA 4LA3A 4AGVA 1D0GA 3JQWA 3WZ1A 4K6BA 5JSRA 2IXIA 1RC6A 1Q56A 4Q0VA 4NVPA 4NWWA 3WG4A 4JQRA 3VBHA 4YFZA 4XPVA 2RS11 1AL23 5BPXA 2MPFA 4HKLA 3MLJA 2LM3A 3UJOA 2BYVE 2ZPXA 3AJZA 2HEWF 1GYKA 1POV0 1UU4A 1H1MA 2XJSA 1K5MA 2W52A 4F83A 4ATFA 4AW7A 4OI4A 2RJLA 1UCXA 2PHLA 2I74A 1JYCA 4OLLA 4X6QB 1OQEA 1LULA 2DURA 3MPPG 3RJRA 1AL22 3KMHA 4RSUA 1MVEA 3ZFEA 5I93A 3MGUA 5IK4A 4XQWA 1V6KA 2IFWA 4LBQA 2UYAA 1PVC3 2N7GA 2R0FA 4QQOA 4CP1A 2ETEA 1ZYBA 5J48A 4BMEA 3TN93 2CGNA 4LEJA 3VBUB 1C8NA 3RMXA 4YZ1A 4HANA 4I2OA 3P3NA 4JV4A 3AZVA 1G9FA 4U2AA 2DV9A 4YVWB 1X82A 1R1A2 3A4UA 3ZO0B 2IXCA 1PVC2 2TEPA 3VBOB 3LA3A 1RTVA 4B7KA 3TN92 3ZDSA 4AVAA 1QWRA 2R6QA 4CP0A 3O14A 4WVZA 5GLUA 5E88A 1FATA 2GDFA 2Q5TA 4YW1A 2DUPA 1ZA4A 2RS13 1WLDA 2X5IC 1MZ5A 1YXWA 2CAVA 1MVQA 2QQPA 3DV8A 3PMEA 4WM8A 3RYRA 4JGYC 5JOYA 3FJSA 4NHLA 4AFMA 4YZ4A 2GN7A 3LSDA 1NA1A 1MQTA 1MACA 2VW2A 3NVCA 3AP5A 3VHPA 2RS12 4H55A 4E27A 1PK6A 5A33B 4Y22A 1KS4A 1ZRDA 4GIQA 1KS5A 4B3NA 2IXLA 1OI6A 1F5JA 1YUDA 2V09A 1EAH1 1REFA 1A6CA 3M7AA 5JR7B 2HYKA 3VGIA 4RR3A 1YO8A 1QH6A 3V65A 2R30A 2WC2A 1H9PA 4WV8A 5F5QA 4C91A 1DYPA 4EN7B 1IS5A 4NHMA 1H2KA 1CAVB 1PGW1 3SLIA 1Q8QA 1PIV2 4RQPA 4DNYA 1NG0A 4IEVA 5JIAA 3PJYA 2ZOEB 4ZU7A 3S6PA 1VBC1 3HIFA 4YW4A 3CJIC 1VLNA 3LB9A 4WZCA 1SBEA 5C4WB 5BNOB 1KQRA 1O3RA 4CDUC 4QM8A 1DGLA 1SLCA 1URXA 3ZYPA 5BV6A 4X6RB 4FVVA 5J3UA 2ZMLA 4BYYA 1G9DA 1UKRA 2OUHA 4SLIA 5C33A 3NJZA 4MGIE 4J1XA 4FTEA 3AKQA 4W65A 4BZ4A 2BW8A 1GLHA 1W6NA 2VOKA 3I59A 3L2YA 1QXPA 2JG9C 5ABJA 1K5MB 4QQLA 2D43A 1LOAA 1XU1A 3RYPA 4UW3A 1AYN1 1J1TA 3IWZA 2E7AA 1AYM2 5EXOA 2OUJA 1EAH3 1VBD1 1REEA 1VALA 3H0OA 4I0BA 3ZFEB 5HI0A 4H3WA 5BNNC 5JZGC 3DKWA 4JCKA 5BNNA 1DQ5A 5JZGA 5F9TA 5I0SA 4CZSA 4IXLA 3M2MA 4CEWC 2QUOA 5L36A 3LA2A 1GQGA 2WWSA 4XF4A 4Y5Z0 2ZMNA 4FPYA 4IEOA 3I8TA 2ATFA 4IEPA 3X29B 3FLRA 1NCQC 4IEWA 1NCQA 1VBC3 2NLRA 2DWRA 1EP0A 5JIUA 2DUOA 1MS0A 2RS51 1BEV2 4WM7C 2B7YA 5DZGA 3AKTA 4RL7A 5A3LA 3HT2A 2OZJA 1CVNA 1U0AA 1PGW2 2HEYF 1ZNPA 3CL1A 2XJTA 4IERA 4M3CF 5J98B 2OIIA 1DLLA 3IM0A 4FOWA 2EXIA 4I0WB 3USSA 1XNCA 3ZN4A 4Z8BA 3HN1A 3T1LA 5IT6A 3R05A 2NQYA 1CJPA 5HBAA 1AXKA 2VECA 5FPXA 4RGAA 4CDQA 4M0HA 3BODA 1WMEA 4R4XA 1Z7S1 4QPIA 3POYA 4P9WA 3USUB 1AYN3 1O3SA 1NA1B 4M0NA 4N53A 3FZ3A 4AEMA 1Q8PA 4MXVA 4KG8A 1KFXL 1EV11 3V0AA 1A78A 1PK6B 1LOCA 1VBD3 2G9GA 2YROA 2WNVB 4W6WA 5CIRA 1S1AA 5KXCA 3AP6A 4KGGA 1QNYA 1DQ1A 2A7AA 1AX2A 2ARXA 1HRV2 2BWAA 4FPHA 2EXHA 4FOVA 1DQ2A 2XGXA 1UIKA 2B5HA 4K3UA 3KT4A 4RR3B