1LTIC

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
41
structure length
41
Chain Sequence
b'GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
source organism Escherichia coli
molecule tags Enterotoxin
total genus 13
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1996-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltiC00
1LTBC 1XTCC 1HTLC 1LTAC 1LTSC 1LTIC 1LTGC 1LTTC
chains in the Genus database with same CATH superfamily
4ZMDA 1S4XA 4EDFA 1Q81Q 1FE6A 1K9MQ 4A7PA 5APQA 2JWAA 1VL2A 2W27A 2YMKA 1KILB 4ZNCA 3MTUE 1ZR2A 2CPBA 1U7MA 2UWJE 1ZMEC 4W7ZA 3A3YB 3CWBE 2I1JA 2WSEH 1H89A 2OQQA 3H1JD 3IAOA 1G2CB 1U57A 1CW5A 3VP8A 1SQBK 3CX5E 1LTSC 3BCCE 3I5CA 1IFNA 3B5NA 1OVRA 1KD1Q 5APVA 3OJAB 5AW9B 1WMKA 3A2AA 2ZJSE 1QEXA 1H88A 1KMIZ 4UB6E 2VRSA 3F89A 1LWUB 1EC5A 3ZDMA 4BXLA 1LTJC 1IK9A 3B4SA 1SQVD 4U3FE 3GF7A 4WY4C 3A0BH 2WTYA 3TGUG 3NXSA 3VYIA 5CCHA 3H1KG 5GTIE 1FZCC 1FOSE 3CCQP 4M3LA 1VF5B 1BCCE 1OXZA 1SQXD 1LP1B 2O01H 3A0HE 1KILA 4MN4C 2A06D 4DT0A 1USEA 1G1IA 2FFDC 3SWYA 3OA7A 2YO3A 2QE7H 1KYOI 3O6QB 1D7MA 3IF4A 2WWWA 4HH2A 3L70E 1G2CA 1GU4A 2MJZA 1OVVA 1R5LA 3M91A 3P8MC 4XFJA 3TGUJ 1PPJE 1ZN5A 1JNMA 3BRTB 5AW0B 4JF7A 5KLVJ 2E74B 5CCHD 4IFDK 1CSBA 2LXBA 2R32A 3EWKA 1LJ2A 3CCMP 1JUNA 4PV1B 3RBZA 3TNUB 2RKLA 1LWUA 5GTHH 2FXOA 3H1HG 2KK7A 3RK2D 4H44B 4HKZH 5CJ0A 1HF9A 2FYNB 2ITAA 2P1JA 2WSFH 3CXHE 2WSCJ 1M1JC 5APXA 2M5AB 1MFTA 1L0LK 2N1TC 1N8RQ 1SQPK 1Y9BA 4H13D 2WQYC 2CPSA 4EOTA 1JOCA 1KQGB 3MP7B 4OGQB 2YKOA 4W7YA 4OH8B 3AE7C 1FOSF 3RK3D 1LGHB 2Z4EA 3KXDA 1LP1A 1GW3A 1H0TB 1SQBG 2ZT9C 1M90Q 3H1HJ 3L75G 1NTME 4N78E 3O6QA 4WWIA 1IK7A 1LTJB 3TGUD 5AW3B 5B5EH 3GHGB 2K3RA 3AE3C 5KLVD 1GL2D 3VMZA 3AE4C 3IFMA 1PGJA 4XA4A 2WITA 1NTZG 2HYNA 1J2JB 1FZCB 2QG4A 4NPDA 2V4HA 3TNUA 5AVXB 3M0DA 3C8VA 4K35A 3VOPA 3H1LE 5M1BA 3L75J 2QJKB 2Q9IA 4PD4I 1FBMA 2HR3A 1SQVK 1KB9E 4WVZA 1KB9I 3TDKA 1YBKA 1P84E 1PIXA 2M5AA 1P84I 3Q5SA 3SWFA 1VQ9P 1ZP0C 1NTZJ 2FXMA 2AXTE 2HG5D 3H1HD 1SQXK 2H89C 4HB1A 5CHXA 3AECC 1NJIQ 1URQC 1H0TA 4GT1A 1KFMA 1DIPA 2YKPA 1L0NG 1LTJA 1VQNP 3CCLP 1NKZB 1QX8A 1Q90D 2P58A 3C1LA 1SQQE 1AQ5A 3GHGA 2FXPA 3D71A 2B89A 5KJ7A 3P8CE 1PGOA 4ASVA 2N1TB 1CZQA 3L74E 1FZCA 1N7SB 1OMIA 2YKQA 2W6JH 2O01N 1S1CX 2AXCA 3L75D 5TISE 5CCGA 1EDJA 3JCUH 1L4AB 2R44A 1DD3A 3USSA 2IBZE 2POHA 3PRJA 4I7ZC 2IBZI 4GDOA 4BRYB 3ITKA 1NAFA 2OYIC 2WT7B 1L0NJ 3FWLA 1VQMP 1YI2P 2FYUJ 3MGNA 1NO4A 4H0LB 2E75D 1J1DB 1T3UA 4IOIH 1AV1A 2LXCB 4K3AA 1OVUA 1NTZD 5B66H 1N73B 3H32B 1W2BO 2GM4A 4C7NB 3PLNA 5KJ7D 3RK2C 1NHLA 2QM7A 1NTKE 2L91A 2YIUB 3JSVC 1FZFA 3H1JG 2H7HA 1NU1E 2Q3IA 1KYOD 1PP9G 3CI9A 2GUVA 1RQUA 1M8OB 2Q3EA 1IFIA 3OAKA 5APTA 3L70D 2L5GB 1YIJP 2DW3A 5KAIH 5KLVK 2W6BA 4LLHA 1H8AA 1SFCB 1M56D 4LC1A 2N1TA 5K5GB 1LTAC 1JMBA 3L71E 3L4FA 1EXJA 1K05A 4WBAA 1FZBA 1N7SA 2D2CC 1BGYJ 4Y99C 5APWA 1T6AA 1L4AA 1Q2NA 5EFWB 1L0ND 3L72E 1GL2C 2FYUD 4UB8H 5BVZA 2K37A 2QJYC 5C39A 4BRYA 1S5LH 1OFCX 3H1KE 1T3JA 2W90A 3H1IE 2WT7A 1PP9J 3FWNA 1UIXA 2GUSA 4W80A 3A0BE 3MIWA 3CPWO 1N73A 1SQXG 2IYOA 2NZ2A 3H32A 3WU2H 4C7NA 2A06G 3GF3A 3BVHA 1HTLC 2K1AA 3II6A 3NFQA 1N7LA 4GOEA 2CK3H 3F5HA 1HVVA 1EQ7A 1OX3A 1GDTA 1DD4A 2ZYAA 3E1IA 1VQ7P 1DX7A 1A02J 2QSIA 4TT3H 2H8PD 2YXQB 4JBZA 1FJKA 5KAFH 1L4AD 1LTGC 4DZOA 3EFGA 2ZXEB 1SQXJ 4H0LD 3W68A 1Z56A 3L37A 2QRXA 1SFCA 5KLIB 3HD7B 1BGYD 5AVSB 2KP8A 3M9HA 1YQ3C 1LTIC 1EZVG 2KB7P 4WB4A 1NH4A 2HODB 2YXRB 3S1KA 4RESB 1LT9B 4ZKPA 3KDPB 3CX5I 2K88A 1PP9D 4O9BA 1GK6A 3R2PA 3AEAC 1FAVA 5AVYB 4PD4D 4KHXA 2Z5IA 4GODA 2QM8A 1MUUA 2YMYA 2E42A 1NTZK 1J1EB 4BWNA 4ASWA 1QGKB 1KORA 1RF1C 3RL0D 2XNDH 3FX0A 1SQBE 1VQ8P 1YYCA 1FS0E 1X79B 2R5BA 1RY3A 2D2CB 3FGAD 2OYHC 2E75C 2E76D 3AE6C 3AEBC 2JP3A 4YXWH 4Y99B 3G71P 3H25A 5KLVG 2NPSC 2V7QJ 1Q86Q 1CI6B 5KTBA 1QL1A 4RJTA 3PHLA 3B5ND 1WT6A 1AQTA 2WSCH 3M9BA 5B5EE 2ZVOB 3TYYA 1BE3E 3VN0A 3P32A 2HLOA 2I1KA 3HD7A 3MUDA 2Y9YA 2WPSA 2B87B 2C9NY 1NOHA 4YTPC 1EDIA 2HODA 1M7LA 1FU1A 1LT9A 2K9JB 1IJDB 1R8EA 1YJNP 3CCVP 3L73J 5BU5A 2ZYGA 2BEZF 2W83C 1RF0C 4IL6E 1L0NK 2FYUK 2E5YA 1OW8A 2M3EA 1ZOYC 3AE5C 1NVOA 2R5DA 3GMAA 3CC4P 3GW6A 3U1CA 1LTTC 2BCCE 1E5WA 2KYVA 1ZRTE 1S5LX 1EZVD 1KILD 1NWQA 4YPCA 1RE3C 3G6EP 2C0WA 4JPZB 1YTZI 3KZIH 1RE4A 5CMZA 4JQ0D 3G4SP 3AEFC 3CXHI 3M06A 4L76A 3T97B 1JEKA 1QL2A 3CMAP 4L74A 2KLUA 3KHUA 2AEMA 3K5BA 3RL0g 3V2PA 1CI6A 1YJ9P 4CPGA 3BCCG 3SFDC 4AQRD 4R4LA 3Q3DA 1Y8AA 1USDA 4Y28J 3OW2O 3CC7P 1HUCA 1K8AQ 1AVYA 2J59M 2J58A 1PL5A 1S9KE 3CMEP 4EIJA 2QIWA 1Y47A 3A7OA 1VQOP 2B87A 3L73D 1L0LE 1SQPE 4WY4B 2K9JA 3CWBJ 4U3FG 2OTLP 1KTMA 1T8ZA 1HGVA 3JCUE 4GIFA 2N9YB 3L36A 4N6JA 3MZWB 3U1AA 3HRNA 4C7RA 3BCCJ 1W5CE 1VQKP 1KYOH 3AE2C 3I55P 2HFED 3D6ZA 1FJPA 1VF5D 1XTCC 1BCCG 3H1JE 2FFDB 2ZFCA 2R3CA 3LIDA 3CLQA 4DOJA 2IFMA 3RBXA 2A45I 3T97A 4U3FJ 1U7JA 2FBWC 4TLFA 3GG2A 4D6TE 1RQVA 3V5BA 3EQ2A 4HJGH 2B9BA 3L70G 3CCJP 3Q5RA 1PPJG 2KSEA 1ZW0A 1YTZT 3TF5A 1JY2P 3V4WA 2E43A 2E74D 1X8YA 3H6PA 2N9BA 2KOGA 1SQVE 3CCRP 4PV1D 3KPEA 1AJYA 1HWTC 1BCCJ 2JWDA 3CCSP 5KAIE 2FY8A 2M3BA 5APYA 3CWBD 2FYUG 3HUSC 1BSNA 4H44D 4WY4A 4QMAA 3B5NC 2QJPC 1KQLA 5DJTB 1VPCA 2P67A 1AFOA 1ZLLA 3HTKB 4L75A 3CX5D 1K04A 1M1JB 4PJ0E 3BCCD 3L70J 1VQ4P 1WRGA 4UB8E 1DH3A 1E79H 2LR2A 1S5LE 2A06E 4DCKA 1JY2O 3B71A 2XDJA 4IFMA 3VMYA 3V2RA 4OGQD 1UIIA 3IR9A 4JYBA 5CBOA 1GU5A 3CD6P 2FFDA 1N86A 2ZT9B 1YHQP 3WU2E 5KKZC 4U3FD 5CCHC 2OGUA 1NTMG 2Y0DA 1EXIA 4IFFA 2XU6A 4WY4D 1FC2C 1N2DC 1JY3P 3CCEP 3SWKA 3AE8C 1KILC 3I56P 2SPZA 1BGYG 5KAFE 1BCCD 4PD4H 3S4RA 1VQ6P 4AUWA 2WPVB 2Q1KA 3AEGC 1BE3D 1HJ0A 3AE9C 5CCGD 3Q5PA 4RO0A 4H13C 1PV3A 3N7NA 1A02F 1HH0A 1MKMA 1NTMJ 1DEBA 4LGDE 2Q6QA 3RK3C 2OYOA 1PPJD 4ZKUA 3HTKA 1HBWA 1M1JA 3A5TA 2KIKA 3V6IA 1JY3O 3RK3E 1BDCA 1IFDA 2PAJA 1LWUC 2LKMA 1AVOA 3WUUA 2ZXXA 2WMMA 2BCCD 2PGDA 1JTHB 3Q2YA 3TGUE 1URQB 1M57D 3U59A 2RMZA 3CL3D 4YXDC 5KLVE 3H1LJ 1GMJA 2IZ1A 3HUSB 2ZVNB 1OIPA 2XV5A 1LT1A 3CXHD 2OTJP 3BASA 1FDIA 1FDOA 2BEQD 1VF5C 3V2QA 4DJGA 3WUVA 2N1TD 2KS1B 1XTGB 1NYHA 1M1KQ 1N7SD 1RH5B 3EFFK 1JCCA 1QLED 1KN7A 1MZ9A 3D6YA 1MFZA 2GA1A 4KT0J 1QVGO 1NTMD 4I7ZB 4N78D 5AVUB 2IZ0A 3C9IA 3B8EB 2IBZG 2OYIB 2FYZA 2ZT9D 1ZR4A 5KKZB 3QH9A 3IN6A 3V2NA 2E74C 1ZV8A 5AVZB 1SQQJ 4PV1C 2WZ7A 2V7QH 3H1HE 3M0DC 3VTPC 2WSSH 1AA0A 3RK2B 5H2FH 5AW8B 3O8ZA 5E79H 1KQSO 4H44C 3L74J 1NTKG 2I8DA 1JTHA 3MD0A 3SFEC 1URQA 2FYNC 2QVAA 4L73A 3H1LD 5GTHE 3LW5J 3V4QA 4AYCA 4JYCA 1KB9D 1NU1G 4H13B 3HUSA 1G1JA 3KZIE 5AW7B 2QA4P 4OGQC 3RK3B 1YITP 4D6TD 1P84D 3L35A 5APSA 3L75E 3SSUA 1SFCD 2R3SA 2KS1A 1FZAA 2KSJA 3L73G 3L71G 1NTKJ 2KI7B 5AVWB 5AVTB 3GHGC 1GL2B 2Y0EA 1BDDA 3PH0A 5KJ7C 2QJYB 1NTZE 3L72G 1URQD 1GZLA 2OYIA 1NU1J 3QWOC 2BASA 1SQQD 1KQFB 3H1IG 1GK4A 1R5SA 3TSIA 4KJMA 1OWAA 3P8CD 3VP9A 2WSEJ 1QVFO 2Q7CA 5CCGC 1FZGA 3L74D 3P7KA 5AW1B 2QJKC 3L71J 1SVFA 1KYOE 2O3JA 3AEDC 4C46A 3GLMA 2IBZD 1KFNA 3PJSK 4R4MA 1SP4A 3L72J 1MV8A 3E7KA 3VMXA 3S9OA 3G9RA 4OWFA 4Z1MH 3H1KJ 3H1IJ 4EYYQ 3AE1C 3D70A 1PFIA 1YJWP 1BSHA 3CX5H 3W67A 1VQPP 2FKWB 2IDBA 1NTKD 3HD7D 1L0NE 2FYUE 3CWBG 1S3JA 1T2KD 4HYTB 1JY2N 2H88C 4UB6H 1NU1D 1GL2A 4RKUJ 2QEXP 2KLVA 2M0BA 1NTMK 1K73Q 2K9YA 2Y9ZA 1FZEA 2O01J 1VQLP 4GOFA 2AEJA 1N7SC 3TK1A 1W2EA 1SS1A 2WVRA 2E5TA 1PZQA 1Q82Q 2OARA 5TJHA 3CCUP 1IO4A 5APUA 1RF1B 2JO1A 1L4AC 3L71D 3JC22 1S72P 2O1KA 5GTIH 2OYHB 1X9VA 2JKVA 2E75B 1NAYA 2D2CD 4H0LC 3L72D 1LNQA 1J1DC 3A0HH 1GD2E 2NPSB 1KV4A 3BATA 3H1KD 1N73C 2WPQA 3H1ID 3CC2P 2RN0A 1GTWA 4U7JA 4OVNF 2JDIH 1JM0A 1KC8Q 1BGYE 3WUTA 2KZIA 1EDKA 2KUBA 2OTKE 5B66E 1FDMA 3NMDA 2YIUC 2YO2A 2PFXA 1JB0J 2WSFJ 1BE3G 3PTZA 1IFJA 4IL6H 1PP9E 1JY3N 1SQBJ 2G8YA 4PD4E 5AW5B 5AW4B 2IYPA 4B86A 4I6MC 3BRVB 2B88A 1NKNA 2M8RA 2ZAEB 3RL0C 2IPPA 1JCDA 3KYQA 2JJLA 1SFCC 1OW6A 1SQQK 2E76C 5AVVB 3CXHH 2BCCG 3FXEA 2JR8A 1RF1A 1BE3J 1IC2A 5CJ4A 1JMMA 4EI2A 1SLQA 1OW7A 5AVRB 4I2LC 2OYHA 1L2PA 4GKGA 1PGPA 3VMAA 5AW2B 1SQXE 1OZHA 3N4XA 2C9LY 2Z5HA 3Q1MA 2NPSA 2HPCB 1TU3F 3M0AA 2IFNA 2G3AA 2WPRA 1IFMA 1VQ5P 2O1JA 1ZXGA 5BU8B 3UIAA 2AEFA 1GW4A 3KQGA 2BCCJ 2KNCB 3E1RA 1VDFA 1SQBD 2YNYA 3HE4B 1NTKK 1IFPA 2XNXA 2MKVA 3ABVC 1L0LG 5DJUB 3FXDA 1SQPG 1JO5A 3G3ZA 1RF0A 1NU1K 4N3YB 1X0TA 1HJBA 2W6AA 1HGZA 3LIEA 5KLIC 3HD7C 1EZVE 3MUDC 2NPSD 1EZVI 1KILE 3WMM0 2RH0A 1YQ4C 2KZJA 4I1LA 2J5UA 1KB9H 1T2KC 2P7JA 3HE5B 3AEEC 1S2EA 3NTNA 2A45H 1LTBC 1LT9C 3MHVA 2XZRA 1P84H 3H1LG 1RE3A 1DEEG 3R4YA 5H2FE 2AXTH 5E79E 1L0LJ 2A45G 2C0XA 1SQPJ 2IX7C 2W8ZA 2NRGA 1IZNB 4D6TG 2HPCA 1J1EC 3RL0B 2JEEA 1X22A 2PRRA 4NPFX 1RHZB 1RE4C 1ZRTD 3L73E 2E76B 2KXPB 2KNCA 1SQVG 5AVQB 3M9QA 1PGQA 1NGMB 3HE4A 4PJ0H 3H1JJ 2XKMA 3B5NB 2Y0CA 2H43A 2QJPB 3RGUA 1SQQG 5AW6B 5CBNA 1KZUB 5TISH 2PP6A 4IL6X 4D6TJ 3LW5H 4NPEA 3L74G 1Q7YQ 3HE5A 2ZYDA 5L8RJ 1S9KD 1EDLA 1SQVJ 2P2UA 4XE5B 1L0LD 2Q5UA 2P10A 1SQPD 3PP5A
chains in the Genus database with same CATH topology
1XTCC 2GM4A 4C7NB 4C46A 5KJ7D 2FFDB 3RK2C 2ZFCA 1KFNA 1NHLA 2QM7A 2R3CA 3LIDA 3CLQA 4DOJA 2IFMA 1SP4A 5APQA 1MV8A 2W27A 3VMXA 2A45I 1FZFA 1KILB 3T97A 3MTUE 1ZR2A 2CPBA 2H7HA 3V5BA 4W7ZA 3EQ2A 3A3YB 2I1JA 2Q3IA 1PFIA 2WSEH 1H89A 3CI9A 2GUVA 1YTZT 1G2CB 1IFIA 2FKWB 3OAKA 1JY2P 3V4WA 1CW5A 3HD7D 2E43A 3VP8A 5APTA 1X8YA 1SQBK 2L5GB 3H6PA 1LTSC 2N9BA 3I5CA 1T2KD 2KOGA 5KLVK 1IFNA 2W6BA 3KPEA 4HYTB 4LLHA 1HWTC 3B5NA 1H8AA 1SFCB 4LC1A 1JY2N 5APVA 2N1TA 3OJAB 5AW9B 1LTAC 1GL2A 2M3BA 5APYA 3A2AA 3L4FA 2KLVA 4WBAA 1FZBA 1N7SA 1H88A 3HUSC 1NTMK 1FZEA 2VRSA 4WY4A 3B5NC 4Y99C 5APWA 1LWUB 1KQLA 1L4AA 1VPCA 2P67A 1AFOA 1ZLLA 3HTKB 1GL2C 1M1JB 1LTJC 1IK9A 5BVZA 1N7SC 3TK1A 1W2EA 1WRGA 1T3JA 2OARA 4WY4C 2WT7A 1IO4A 1DH3A 5APUA 2GUSA 1RF1B 1JY2O 2WTYA 1L4AC 2XDJA 4W80A 4IFMA 3NXSA 3VMYA 2O1KA 3V2RA 3MIWA 3VYIA 5CCHA 1N73A 3IR9A 3H32A 4JYBA 1GU5A 2OYHB 1X9VA 4C7NA 1FZCC 1FOSE 3BVHA 2FFDA 1N86A 1HTLC 1J1DC 3II6A 3NFQA 4M3LA 1N7LA 1GD2E 2NPSB 1OXZA 5CCHC 1HVVA 1EQ7A 3BATA 1N73C 1GDTA 2WPQA 1GTWA 2O01H 1KILA 3E1IA 1DX7A 1A02J 1G1IA 2FFDC 4IFFA 3SWYA 2XU6A 3OA7A 2YO3A 4WY4D 2H8PD 1N2DC 1JY3P 1FDMA 1FJKA 3NMDA 1L4AD 2YO2A 1KILC 2WWWA 1LTGC 4HH2A 4DZOA 1G2CA 1GU4A 1IFJA 2MJZA 3M91A 3P8MC 1ZN5A 1JY3N 1JNMA 3EFGA 3BRTB 2ZXEB 4AUWA 5AW0B 1Z56A 3L37A 4JF7A 5AW4B 5AW5B 1SFCA 3HD7B 4B86A 4I6MC 5AVSB 5CCGD 5CCHD 2KP8A 3BRVB 1CSBA 4IFDK 3M9HA 2R32A 1NKNA 1LTIC 2M8RA 2KB7P 1JUNA 3RL0C 2IPPA 4WB4A 1NH4A 1JCDA 2HODB 1HH0A 3KYQA 3N7NA 1A02F 4RESB 1LT9B 3TNUB 1DEBA 2JJLA 4ZKPA 4LGDE 1SFCC 3RK3C 1LWUA 3KDPB 4ZKUA 3HTKA 1SQQK 1HBWA 1M1JA 3RK2D 4O9BA 1GK6A 3A5TA 3R2PA 1JY3O 5CJ0A 5AVVB 1FAVA 5AVYB 4KHXA 1IFDA 2PAJA 2Z5IA 1RF1A 1LWUC 2P1JA 2WSFH 2LKMA 1IC2A 5CJ4A 1JMMA 1M1JC 2QM8A 1MUUA 1SLQA 5APXA 2YMYA 2E42A 2N1TC 1NTZK 1L0LK 1JTHB 5AVRB 1J1EB 1SQPK 4I2LC 2OYHA 4GKGA 1URQB 1RF1C 3RL0D 2CPSA 4EOTA 1JOCA 5AW2B 3N4XA 2YKOA 3U59A 1YYCA 2Z5HA 4W7YA 2C9LY 3CL3D 1X79B 2NPSA 4OH8B 1FOSF 2HPCB 2R5BA 3RK3D 1LGHB 2Z4EA 1RY3A 3HUSB 3M0AA 2OYHC 2IFNA 2XV5A 1GW3A 3BASA 4Y99B 2WPRA 4N78E 1IFMA 2NPSC 2O1JA 5BU8B 3UIAA 1CI6B 1GW4A 3KQGA 1LTJB 5KTBA 5AW3B 1QL1A 3V2QA 3B5ND 1VDFA 1WT6A 3GHGB 2N1TD 2YNYA 3HE4B 1NTKK 2WSCH 1XTGB 1GL2D 3VMZA 3M9BA 3TYYA 1N7SD 2XNXA 3IFMA 3VN0A 1JCCA 4XA4A 3P32A 2HLOA 2WITA 2I1KA 2HYNA 3HD7A 1MZ9A 3MUDA 1MFZA 1J2JB 1JO5A 3G3ZA 1FZCB 2WPSA 1RF0A 4N78D 5AVUB 2C9NY 1NU1K 1NOHA 4N3YB 3C9IA 3B8EB 1HJBA 2HODA 2OYIB 2W6AA 1M7LA 1HGZA 1FU1A 1LT9A 2FYZA 3LIEA 5AVXB 3TNUA 3M0DA 1ZR4A 1IJDB 3HD7C 3V2NA 3VOPA 2NPSD 3WMM0 5BU5A 4I1LA 1ZV8A 1RF0C 1T2KC 5AVZB 2P7JA 1L0NK 3HE5B 2Q9IA 2FYUK 3NTNA 2A45H 1FBMA 1LTBC 2WZ7A 1SQVK 1LT9C 3M0DC 2R5DA 2XZRA 3VTPC 3RK2B 1RE3A 3U1CA 5AW8B 3O8ZA 1LTTC 2KYVA 1E5WA 1JTHA 3MD0A 3SWFA 1URQA 1KILD 2A45G 2C0XA 1NWQA 2FXMA 2IX7C 1RE3C 2C0WA 1YTZI 3V4QA 2HG5D 1RE4A 2HPCA 4AYCA 4JYCA 5CMZA 1SQXK 1J1EC 5CHXA 3HUSA 3RL0B 3M06A 1G1JA 1URQC 1QL2A 5AW7B 2JEEA 4GT1A 1KFMA 3RK3B 1RE4C 2YKPA 3L35A 3V2PA 1CI6A 1LTJA 1NKZB 5APSA 5AVQB 3M9QA 1SFCD 4AQRD 1AQ5A 3GHGA 3HE4A 1FZAA 5KJ7A 3P8CE 2KSJA 2XKMA 5AVWB 1HUCA 3B5NB 2J59M 2J58A 2H43A 1S9KE 5AVTB 2N1TB 4EIJA 5AW6B 1CZQA 3GHGC 1KZUB 1GL2B 3A7OA 1FZCA 1N7SB 5KJ7C 2PP6A 3LW5H 1URQD 2YKQA 1GZLA 2OYIA 4WY4B 2BASA 5CCGA 1L4AB 1GK4A 3TSIA 1T8ZA 1HGVA 2POHA 1OWAA 3P8CD 3HE5A 3VP9A 4GIFA 3L36A 4N6JA 1NAFA 2OYIC 2Q7CA 2WT7B 3U1AA 3HRNA 1S9KD 3MGNA 4C7RA 5CCGC 1FZGA 1NO4A 1J1DB 1T3UA 3P7KA 2P2UA 5AW1B 4XE5B 2Q5UA 1N73B 2HFED 1FJPA 3PP5A 1SVFA 3H32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB C;  1XTC C;  1HTL C;  1LTA C;  1LTS C;  1LTI C;  1LTG C;  1LTT C; 
#chains in the Genus database with same CATH topology
 4ZMD A;  1S4X A;  4EDF A;  1Q81 Q;  1FE6 A;  1K9M Q;  4A7P A;  5APQ A;  2JWA A;  1VL2 A;  2W27 A;  2YMK A;  1KIL B;  4ZNC A;  3MTU E;  1ZR2 A;  2CPB A;  1U7M A;  2UWJ E;  1ZME C;  4W7Z A;  3A3Y B;  3CWB E;  2I1J A;  2WSE H;  1H89 A;  2OQQ A;  3H1J D;  3IAO A;  1G2C B;  1U57 A;  1CW5 A;  3VP8 A;  1SQB K;  3CX5 E;  1LTS C;  3BCC E;  3I5C A;  1IFN A;  3B5N A;  1OVR A;  1KD1 Q;  5APV A;  3OJA B;  5AW9 B;  1WMK A;  3A2A A;  2ZJS E;  1QEX A;  1H88 A;  1KMI Z;  4UB6 E;  2VRS A;  3F89 A;  1LWU B;  1EC5 A;  3ZDM A;  4BXL A;  1LTJ C;  1IK9 A;  3B4S A;  1SQV D;  4U3F E;  3GF7 A;  4WY4 C;  3A0B H;  2WTY A;  3TGU G;  3NXS A;  3VYI A;  5CCH A;  3H1K G;  5GTI E;  1FZC C;  1FOS E;  3CCQ P;  4M3L A;  1VF5 B;  1BCC E;  1OXZ A;  1SQX D;  1LP1 B;  2O01 H;  3A0H E;  1KIL A;  4MN4 C;  2A06 D;  4DT0 A;  1USE A;  1G1I A;  2FFD C;  3SWY A;  3OA7 A;  2YO3 A;  2QE7 H;  1KYO I;  3O6Q B;  1D7M A;  3IF4 A;  2WWW A;  4HH2 A;  3L70 E;  1G2C A;  1GU4 A;  2MJZ A;  1OVV A;  1R5L A;  3M91 A;  3P8M C;  4XFJ A;  3TGU J;  1PPJ E;  1ZN5 A;  1JNM A;  3BRT B;  5AW0 B;  4JF7 A;  5KLV J;  2E74 B;  5CCH D;  4IFD K;  1CSB A;  2LXB A;  2R32 A;  3EWK A;  1LJ2 A;  3CCM P;  1JUN A;  4PV1 B;  3RBZ A;  3TNU B;  2RKL A;  1LWU A;  5GTH H;  2FXO A;  3H1H G;  2KK7 A;  3RK2 D;  4H44 B;  4HKZ H;  5CJ0 A;  1HF9 A;  2FYN B;  2ITA A;  2P1J A;  2WSF H;  3CXH E;  2WSC J;  1M1J C;  5APX A;  2M5A B;  1MFT A;  1L0L K;  2N1T C;  1N8R Q;  1SQP K;  1Y9B A;  4H13 D;  2WQY C;  2CPS A;  4EOT A;  1JOC A;  1KQG B;  3MP7 B;  4OGQ B;  2YKO A;  4W7Y A;  4OH8 B;  3AE7 C;  1FOS F;  3RK3 D;  1LGH B;  2Z4E A;  3KXD A;  1LP1 A;  1GW3 A;  1H0T B;  1SQB G;  2ZT9 C;  1M90 Q;  3H1H J;  3L75 G;  1NTM E;  4N78 E;  3O6Q A;  4WWI A;  1IK7 A;  1LTJ B;  3TGU D;  5AW3 B;  5B5E H;  3GHG B;  2K3R A;  3AE3 C;  5KLV D;  1GL2 D;  3VMZ A;  3AE4 C;  3IFM A;  1PGJ A;  4XA4 A;  2WIT A;  1NTZ G;  2HYN A;  1J2J B;  1FZC B;  2QG4 A;  4NPD A;  2V4H A;  3TNU A;  5AVX B;  3M0D A;  3C8V A;  4K35 A;  3VOP A;  3H1L E;  5M1B A;  3L75 J;  2QJK B;  2Q9I A;  4PD4 I;  1FBM A;  2HR3 A;  1SQV K;  1KB9 E;  4WVZ A;  1KB9 I;  3TDK A;  1YBK A;  1P84 E;  1PIX A;  2M5A A;  1P84 I;  3Q5S A;  3SWF A;  1VQ9 P;  1ZP0 C;  1NTZ J;  2FXM A;  2AXT E;  2HG5 D;  3H1H D;  1SQX K;  2H89 C;  4HB1 A;  5CHX A;  3AEC C;  1NJI Q;  1URQ C;  1H0T A;  4GT1 A;  1KFM A;  1DIP A;  2YKP A;  1L0N G;  1LTJ A;  1VQN P;  3CCL P;  1NKZ B;  1QX8 A;  1Q90 D;  2P58 A;  3C1L A;  1SQQ E;  1AQ5 A;  3GHG A;  2FXP A;  3D71 A;  2B89 A;  5KJ7 A;  3P8C E;  1PGO A;  4ASV A;  2N1T B;  1CZQ A;  3L74 E;  1FZC A;  1N7S B;  1OMI A;  2YKQ A;  2W6J H;  2O01 N;  1S1C X;  2AXC A;  3L75 D;  5TIS E;  5CCG A;  1EDJ A;  3JCU H;  1L4A B;  2R44 A;  1DD3 A;  3USS A;  2IBZ E;  2POH A;  3PRJ A;  4I7Z C;  2IBZ I;  4GDO A;  4BRY B;  3ITK A;  1NAF A;  2OYI C;  2WT7 B;  1L0N J;  3FWL A;  1VQM P;  1YI2 P;  2FYU J;  3MGN A;  1NO4 A;  4H0L B;  2E75 D;  1J1D B;  1T3U A;  4IOI H;  1AV1 A;  2LXC B;  4K3A A;  1OVU A;  1NTZ D;  5B66 H;  1N73 B;  3H32 B;  1W2B O;  2GM4 A;  4C7N B;  3PLN A;  5KJ7 D;  3RK2 C;  1NHL A;  2QM7 A;  1NTK E;  2L91 A;  2YIU B;  3JSV C;  1FZF A;  3H1J G;  2H7H A;  1NU1 E;  2Q3I A;  1KYO D;  1PP9 G;  3CI9 A;  2GUV A;  1RQU A;  1M8O B;  2Q3E A;  1IFI A;  3OAK A;  5APT A;  3L70 D;  2L5G B;  1YIJ P;  2DW3 A;  5KAI H;  5KLV K;  2W6B A;  4LLH A;  1H8A A;  1SFC B;  1M56 D;  4LC1 A;  2N1T A;  5K5G B;  1LTA C;  1JMB A;  3L71 E;  3L4F A;  1EXJ A;  1K05 A;  4WBA A;  1FZB A;  1N7S A;  2D2C C;  1BGY J;  4Y99 C;  5APW A;  1T6A A;  1L4A A;  1Q2N A;  5EFW B;  1L0N D;  3L72 E;  1GL2 C;  2FYU D;  4UB8 H;  5BVZ A;  2K37 A;  2QJY C;  5C39 A;  4BRY A;  1S5L H;  1OFC X;  3H1K E;  1T3J A;  2W90 A;  3H1I E;  2WT7 A;  1PP9 J;  3FWN A;  1UIX A;  2GUS A;  4W80 A;  3A0B E;  3MIW A;  3CPW O;  1N73 A;  1SQX G;  2IYO A;  2NZ2 A;  3H32 A;  3WU2 H;  4C7N A;  2A06 G;  3GF3 A;  3BVH A;  1HTL C;  2K1A A;  3II6 A;  3NFQ A;  1N7L A;  4GOE A;  2CK3 H;  3F5H A;  1HVV A;  1EQ7 A;  1OX3 A;  1GDT A;  1DD4 A;  2ZYA A;  3E1I A;  1VQ7 P;  1DX7 A;  1A02 J;  2QSI A;  4TT3 H;  2H8P D;  2YXQ B;  4JBZ A;  1FJK A;  5KAF H;  1L4A D;  1LTG C;  4DZO A;  3EFG A;  2ZXE B;  1SQX J;  4H0L D;  3W68 A;  1Z56 A;  3L37 A;  2QRX A;  1SFC A;  5KLI B;  3HD7 B;  1BGY D;  5AVS B;  2KP8 A;  3M9H A;  1YQ3 C;  1LTI C;  1EZV G;  2KB7 P;  4WB4 A;  1NH4 A;  2HOD B;  2YXR B;  3S1K A;  4RES B;  1LT9 B;  4ZKP A;  3KDP B;  3CX5 I;  2K88 A;  1PP9 D;  4O9B A;  1GK6 A;  3R2P A;  3AEA C;  1FAV A;  5AVY B;  4PD4 D;  4KHX A;  2Z5I A;  4GOD A;  2QM8 A;  1MUU A;  2YMY A;  2E42 A;  1NTZ K;  1J1E B;  4BWN A;  4ASW A;  1QGK B;  1KOR A;  1RF1 C;  3RL0 D;  2XND H;  3FX0 A;  1SQB E;  1VQ8 P;  1YYC A;  1FS0 E;  1X79 B;  2R5B A;  1RY3 A;  2D2C B;  3FGA D;  2OYH C;  2E75 C;  2E76 D;  3AE6 C;  3AEB C;  2JP3 A;  4YXW H;  4Y99 B;  3G71 P;  3H25 A;  5KLV G;  2NPS C;  2V7Q J;  1Q86 Q;  1CI6 B;  5KTB A;  1QL1 A;  4RJT A;  3PHL A;  3B5N D;  1WT6 A;  1AQT A;  2WSC H;  3M9B A;  5B5E E;  2ZVO B;  3TYY A;  1BE3 E;  3VN0 A;  3P32 A;  2HLO A;  2I1K A;  3HD7 A;  3MUD A;  2Y9Y A;  2WPS A;  2B87 B;  2C9N Y;  1NOH A;  4YTP C;  1EDI A;  2HOD A;  1M7L A;  1FU1 A;  1LT9 A;  2K9J B;  1IJD B;  1R8E A;  1YJN P;  3CCV P;  3L73 J;  5BU5 A;  2ZYG A;  2BEZ F;  2W83 C;  1RF0 C;  4IL6 E;  1L0N K;  2FYU K;  2E5Y A;  1OW8 A;  2M3E A;  1ZOY C;  3AE5 C;  1NVO A;  2R5D A;  3GMA A;  3CC4 P;  3GW6 A;  3U1C A;  1LTT C;  2BCC E;  1E5W A;  2KYV A;  1ZRT E;  1S5L X;  1EZV D;  1KIL D;  1NWQ A;  4YPC A;  1RE3 C;  3G6E P;  2C0W A;  4JPZ B;  1YTZ I;  3KZI H;  1RE4 A;  5CMZ A;  4JQ0 D;  3G4S P;  3AEF C;  3CXH I;  3M06 A;  4L76 A;  3T97 B;  1JEK A;  1QL2 A;  3CMA P;  4L74 A;  2KLU A;  3KHU A;  2AEM A;  3K5B A;  3RL0 g;  3V2P A;  1CI6 A;  1YJ9 P;  4CPG A;  3BCC G;  3SFD C;  4AQR D;  4R4L A;  3Q3D A;  1Y8A A;  1USD A;  4Y28 J;  3OW2 O;  3CC7 P;  1HUC A;  1K8A Q;  1AVY A;  2J59 M;  2J58 A;  1PL5 A;  1S9K E;  3CME P;  4EIJ A;  2QIW A;  1Y47 A;  3A7O A;  1VQO P;  2B87 A;  3L73 D;  1L0L E;  1SQP E;  4WY4 B;  2K9J A;  3CWB J;  4U3F G;  2OTL P;  1KTM A;  1T8Z A;  1HGV A;  3JCU E;  4GIF A;  2N9Y B;  3L36 A;  4N6J A;  3MZW B;  3U1A A;  3HRN A;  4C7R A;  3BCC J;  1W5C E;  1VQK P;  1KYO H;  3AE2 C;  3I55 P;  2HFE D;  3D6Z A;  1FJP A;  1VF5 D;  1XTC C;  1BCC G;  3H1J E;  2FFD B;  2ZFC A;  2R3C A;  3LID A;  3CLQ A;  4DOJ A;  2IFM A;  3RBX A;  2A45 I;  3T97 A;  4U3F J;  1U7J A;  2FBW C;  4TLF A;  3GG2 A;  4D6T E;  1RQV A;  3V5B A;  3EQ2 A;  4HJG H;  2B9B A;  3L70 G;  3CCJ P;  3Q5R A;  1PPJ G;  2KSE A;  1ZW0 A;  1YTZ T;  3TF5 A;  1JY2 P;  3V4W A;  2E43 A;  2E74 D;  1X8Y A;  3H6P A;  2N9B A;  2KOG A;  1SQV E;  3CCR P;  4PV1 D;  3KPE A;  1AJY A;  1HWT C;  1BCC J;  2JWD A;  3CCS P;  5KAI E;  2FY8 A;  2M3B A;  5APY A;  3CWB D;  2FYU G;  3HUS C;  1BSN A;  4H44 D;  4WY4 A;  4QMA A;  3B5N C;  2QJP C;  1KQL A;  5DJT B;  1VPC A;  2P67 A;  1AFO A;  1ZLL A;  3HTK B;  4L75 A;  3CX5 D;  1K04 A;  1M1J B;  4PJ0 E;  3BCC D;  3L70 J;  1VQ4 P;  1WRG A;  4UB8 E;  1DH3 A;  1E79 H;  2LR2 A;  1S5L E;  2A06 E;  4DCK A;  1JY2 O;  3B71 A;  2XDJ A;  4IFM A;  3VMY A;  3V2R A;  4OGQ D;  1UII A;  3IR9 A;  4JYB A;  5CBO A;  1GU5 A;  3CD6 P;  2FFD A;  1N86 A;  2ZT9 B;  1YHQ P;  3WU2 E;  5KKZ C;  4U3F D;  5CCH C;  2OGU A;  1NTM G;  2Y0D A;  1EXI A;  4IFF A;  2XU6 A;  4WY4 D;  1FC2 C;  1N2D C;  1JY3 P;  3CCE P;  3SWK A;  3AE8 C;  1KIL C;  3I56 P;  2SPZ A;  1BGY G;  5KAF E;  1BCC D;  4PD4 H;  3S4R A;  1VQ6 P;  4AUW A;  2WPV B;  2Q1K A;  3AEG C;  1BE3 D;  1HJ0 A;  3AE9 C;  5CCG D;  3Q5P A;  4RO0 A;  4H13 C;  1PV3 A;  3N7N A;  1A02 F;  1HH0 A;  1MKM A;  1NTM J;  1DEB A;  4LGD E;  2Q6Q A;  3RK3 C;  2OYO A;  1PPJ D;  4ZKU A;  3HTK A;  1HBW A;  1M1J A;  3A5T A;  2KIK A;  3V6I A;  1JY3 O;  3RK3 E;  1BDC A;  1IFD A;  2PAJ A;  1LWU C;  2LKM A;  1AVO A;  3WUU A;  2ZXX A;  2WMM A;  2BCC D;  2PGD A;  1JTH B;  3Q2Y A;  3TGU E;  1URQ B;  1M57 D;  3U59 A;  2RMZ A;  3CL3 D;  4YXD C;  5KLV E;  3H1L J;  1GMJ A;  2IZ1 A;  3HUS B;  2ZVN B;  1OIP A;  2XV5 A;  1LT1 A;  3CXH D;  2OTJ P;  3BAS A;  1FDI A;  1FDO A;  2BEQ D;  1VF5 C;  3V2Q A;  4DJG A;  3WUV A;  2N1T D;  2KS1 B;  1XTG B;  1NYH A;  1M1K Q;  1N7S D;  1RH5 B;  3EFF K;  1JCC A;  1QLE D;  1KN7 A;  1MZ9 A;  3D6Y A;  1MFZ A;  2GA1 A;  4KT0 J;  1QVG O;  1NTM D;  4I7Z B;  4N78 D;  5AVU B;  2IZ0 A;  3C9I A;  3B8E B;  2IBZ G;  2OYI B;  2FYZ A;  2ZT9 D;  1ZR4 A;  5KKZ B;  3QH9 A;  3IN6 A;  3V2N A;  2E74 C;  1ZV8 A;  5AVZ B;  1SQQ J;  4PV1 C;  2WZ7 A;  2V7Q H;  3H1H E;  3M0D C;  3VTP C;  2WSS H;  1AA0 A;  3RK2 B;  5H2F H;  5AW8 B;  3O8Z A;  5E79 H;  1KQS O;  4H44 C;  3L74 J;  1NTK G;  2I8D A;  1JTH A;  3MD0 A;  3SFE C;  1URQ A;  2FYN C;  2QVA A;  4L73 A;  3H1L D;  5GTH E;  3LW5 J;  3V4Q A;  4AYC A;  4JYC A;  1KB9 D;  1NU1 G;  4H13 B;  3HUS A;  1G1J A;  3KZI E;  5AW7 B;  2QA4 P;  4OGQ C;  3RK3 B;  1YIT P;  4D6T D;  1P84 D;  3L35 A;  5APS A;  3L75 E;  3SSU A;  1SFC D;  2R3S A;  2KS1 A;  1FZA A;  2KSJ A;  3L73 G;  3L71 G;  1NTK J;  2KI7 B;  5AVW B;  5AVT B;  3GHG C;  1GL2 B;  2Y0E A;  1BDD A;  3PH0 A;  5KJ7 C;  2QJY B;  1NTZ E;  3L72 G;  1URQ D;  1GZL A;  2OYI A;  1NU1 J;  3QWO C;  2BAS A;  1SQQ D;  1KQF B;  3H1I G;  1GK4 A;  1R5S A;  3TSI A;  4KJM A;  1OWA A;  3P8C D;  3VP9 A;  2WSE J;  1QVF O;  2Q7C A;  5CCG C;  1FZG A;  3L74 D;  3P7K A;  5AW1 B;  2QJK C;  3L71 J;  1SVF A;  1KYO E;  2O3J A;  3AED C;  4C46 A;  3GLM A;  2IBZ D;  1KFN A;  3PJS K;  4R4M A;  1SP4 A;  3L72 J;  1MV8 A;  3E7K A;  3VMX A;  3S9O A;  3G9R A;  4OWF A;  4Z1M H;  3H1K J;  3H1I J;  4EYY Q;  3AE1 C;  3D70 A;  1PFI A;  1YJW P;  1BSH A;  3CX5 H;  3W67 A;  1VQP P;  2FKW B;  2IDB A;  1NTK D;  3HD7 D;  1L0N E;  2FYU E;  3CWB G;  1S3J A;  1T2K D;  4HYT B;  1JY2 N;  2H88 C;  4UB6 H;  1NU1 D;  1GL2 A;  4RKU J;  2QEX P;  2KLV A;  2M0B A;  1NTM K;  1K73 Q;  2K9Y A;  2Y9Z A;  1FZE A;  2O01 J;  1VQL P;  4GOF A;  2AEJ A;  1N7S C;  3TK1 A;  1W2E A;  1SS1 A;  2WVR A;  2E5T A;  1PZQ A;  1Q82 Q;  2OAR A;  5TJH A;  3CCU P;  1IO4 A;  5APU A;  1RF1 B;  2JO1 A;  1L4A C;  3L71 D;  3JC2 2;  1S72 P;  2O1K A;  5GTI H;  2OYH B;  1X9V A;  2JKV A;  2E75 B;  1NAY A;  2D2C D;  4H0L C;  3L72 D;  1LNQ A;  1J1D C;  3A0H H;  1GD2 E;  2NPS B;  1KV4 A;  3BAT A;  3H1K D;  1N73 C;  2WPQ A;  3H1I D;  3CC2 P;  2RN0 A;  1GTW A;  4U7J A;  4OVN F;  2JDI H;  1JM0 A;  1KC8 Q;  1BGY E;  3WUT A;  2KZI A;  1EDK A;  2KUB A;  2OTK E;  5B66 E;  1FDM A;  3NMD A;  2YIU C;  2YO2 A;  2PFX A;  1JB0 J;  2WSF J;  1BE3 G;  3PTZ A;  1IFJ A;  4IL6 H;  1PP9 E;  1JY3 N;  1SQB J;  2G8Y A;  4PD4 E;  5AW5 B;  5AW4 B;  2IYP A;  4B86 A;  4I6M C;  3BRV B;  2B88 A;  1NKN A;  2M8R A;  2ZAE B;  3RL0 C;  2IPP A;  1JCD A;  3KYQ A;  2JJL A;  1SFC C;  1OW6 A;  1SQQ K;  2E76 C;  5AVV B;  3CXH H;  2BCC G;  3FXE A;  2JR8 A;  1RF1 A;  1BE3 J;  1IC2 A;  5CJ4 A;  1JMM A;  4EI2 A;  1SLQ A;  1OW7 A;  5AVR B;  4I2L C;  2OYH A;  1L2P A;  4GKG A;  1PGP A;  3VMA A;  5AW2 B;  1SQX E;  1OZH A;  3N4X A;  2C9L Y;  2Z5H A;  3Q1M A;  2NPS A;  2HPC B;  1TU3 F;  3M0A A;  2IFN A;  2G3A A;  2WPR A;  1IFM A;  1VQ5 P;  2O1J A;  1ZXG A;  5BU8 B;  3UIA A;  2AEF A;  1GW4 A;  3KQG A;  2BCC J;  2KNC B;  3E1R A;  1VDF A;  1SQB D;  2YNY A;  3HE4 B;  1NTK K;  1IFP A;  2XNX A;  2MKV A;  3ABV C;  1L0L G;  5DJU B;  3FXD A;  1SQP G;  1JO5 A;  3G3Z A;  1RF0 A;  1NU1 K;  4N3Y B;  1X0T A;  1HJB A;  2W6A A;  1HGZ A;  3LIE A;  5KLI C;  3HD7 C;  1EZV E;  3MUD C;  2NPS D;  1EZV I;  1KIL E;  3WMM 0;  2RH0 A;  1YQ4 C;  2KZJ A;  4I1L A;  2J5U A;  1KB9 H;  1T2K C;  2P7J A;  3HE5 B;  3AEE C;  1S2E A;  3NTN A;  2A45 H;  1LTB C;  1LT9 C;  3MHV A;  2XZR A;  1P84 H;  3H1L G;  1RE3 A;  1DEE G;  3R4Y A;  5H2F E;  2AXT H;  5E79 E;  1L0L J;  2A45 G;  2C0X A;  1SQP J;  2IX7 C;  2W8Z A;  2NRG A;  1IZN B;  4D6T G;  2HPC A;  1J1E C;  3RL0 B;  2JEE A;  1X22 A;  2PRR A;  4NPF X;  1RHZ B;  1RE4 C;  1ZRT D;  3L73 E;  2E76 B;  2KXP B;  2KNC A;  1SQV G;  5AVQ B;  3M9Q A;  1PGQ A;  1NGM B;  3HE4 A;  4PJ0 H;  3H1J J;  2XKM A;  3B5N B;  2Y0C A;  2H43 A;  2QJP B;  3RGU A;  1SQQ G;  5AW6 B;  5CBN A;  1KZU B;  5TIS H;  2PP6 A;  4IL6 X;  4D6T J;  3LW5 H;  4NPE A;  3L74 G;  1Q7Y Q;  3HE5 A;  2ZYD A;  5L8R J;  1S9K D;  1EDL A;  1SQV J;  2P2U A;  4XE5 B;  1L0L D;  2Q5U A;  2P10 A;  1SQP D;  3PP5 A; 
#chains in the Genus database with same CATH homology
 1XTC C;  2GM4 A;  4C7N B;  4C46 A;  5KJ7 D;  2FFD B;  3RK2 C;  2ZFC A;  1KFN A;  1NHL A;  2QM7 A;  2R3C A;  3LID A;  3CLQ A;  4DOJ A;  2IFM A;  1SP4 A;  5APQ A;  1MV8 A;  2W27 A;  3VMX A;  2A45 I;  1FZF A;  1KIL B;  3T97 A;  3MTU E;  1ZR2 A;  2CPB A;  2H7H A;  3V5B A;  4W7Z A;  3EQ2 A;  3A3Y B;  2I1J A;  2Q3I A;  1PFI A;  2WSE H;  1H89 A;  3CI9 A;  2GUV A;  1YTZ T;  1G2C B;  1IFI A;  2FKW B;  3OAK A;  1JY2 P;  3V4W A;  1CW5 A;  3HD7 D;  2E43 A;  3VP8 A;  5APT A;  1X8Y A;  1SQB K;  2L5G B;  3H6P A;  1LTS C;  2N9B A;  3I5C A;  1T2K D;  2KOG A;  5KLV K;  1IFN A;  2W6B A;  3KPE A;  4HYT B;  4LLH A;  1HWT C;  3B5N A;  1H8A A;  1SFC B;  4LC1 A;  1JY2 N;  5APV A;  2N1T A;  3OJA B;  5AW9 B;  1LTA C;  1GL2 A;  2M3B A;  5APY A;  3A2A A;  3L4F A;  2KLV A;  4WBA A;  1FZB A;  1N7S A;  1H88 A;  3HUS C;  1NTM K;  1FZE A;  2VRS A;  4WY4 A;  3B5N C;  4Y99 C;  5APW A;  1LWU B;  1KQL A;  1L4A A;  1VPC A;  2P67 A;  1AFO A;  1ZLL A;  3HTK B;  1GL2 C;  1M1J B;  1LTJ C;  1IK9 A;  5BVZ A;  1N7S C;  3TK1 A;  1W2E A;  1WRG A;  1T3J A;  2OAR A;  4WY4 C;  2WT7 A;  1IO4 A;  1DH3 A;  5APU A;  2GUS A;  1RF1 B;  1JY2 O;  2WTY A;  1L4A C;  2XDJ A;  4W80 A;  4IFM A;  3NXS A;  3VMY A;  2O1K A;  3V2R A;  3MIW A;  3VYI A;  5CCH A;  1N73 A;  3IR9 A;  3H32 A;  4JYB A;  1GU5 A;  2OYH B;  1X9V A;  4C7N A;  1FZC C;  1FOS E;  3BVH A;  2FFD A;  1N86 A;  1HTL C;  1J1D C;  3II6 A;  3NFQ A;  4M3L A;  1N7L A;  1GD2 E;  2NPS B;  1OXZ A;  5CCH C;  1HVV A;  1EQ7 A;  3BAT A;  1N73 C;  1GDT A;  2WPQ A;  1GTW A;  2O01 H;  1KIL A;  3E1I A;  1DX7 A;  1A02 J;  1G1I A;  2FFD C;  4IFF A;  3SWY A;  2XU6 A;  3OA7 A;  2YO3 A;  4WY4 D;  2H8P D;  1N2D C;  1JY3 P;  1FDM A;  1FJK A;  3NMD A;  1L4A D;  2YO2 A;  1KIL C;  2WWW A;  1LTG C;  4HH2 A;  4DZO A;  1G2C A;  1GU4 A;  1IFJ A;  2MJZ A;  3M91 A;  3P8M C;  1ZN5 A;  1JY3 N;  1JNM A;  3EFG A;  3BRT B;  2ZXE B;  4AUW A;  5AW0 B;  1Z56 A;  3L37 A;  4JF7 A;  5AW4 B;  5AW5 B;  1SFC A;  3HD7 B;  4B86 A;  4I6M C;  5AVS B;  5CCG D;  5CCH D;  2KP8 A;  3BRV B;  1CSB A;  4IFD K;  3M9H A;  2R32 A;  1NKN A;  1LTI C;  2M8R A;  2KB7 P;  1JUN A;  3RL0 C;  2IPP A;  4WB4 A;  1NH4 A;  1JCD A;  2HOD B;  1HH0 A;  3KYQ A;  3N7N A;  1A02 F;  4RES B;  1LT9 B;  3TNU B;  1DEB A;  2JJL A;  4ZKP A;  4LGD E;  1SFC C;  3RK3 C;  1LWU A;  3KDP B;  4ZKU A;  3HTK A;  1SQQ K;  1HBW A;  1M1J A;  3RK2 D;  4O9B A;  1GK6 A;  3A5T A;  3R2P A;  1JY3 O;  5CJ0 A;  5AVV B;  1FAV A;  5AVY B;  4KHX A;  1IFD A;  2PAJ A;  2Z5I A;  1RF1 A;  1LWU C;  2P1J A;  2WSF H;  2LKM A;  1IC2 A;  5CJ4 A;  1JMM A;  1M1J C;  2QM8 A;  1MUU A;  1SLQ A;  5APX A;  2YMY A;  2E42 A;  2N1T C;  1NTZ K;  1L0L K;  1JTH B;  5AVR B;  1J1E B;  1SQP K;  4I2L C;  2OYH A;  4GKG A;  1URQ B;  1RF1 C;  3RL0 D;  2CPS A;  4EOT A;  1JOC A;  5AW2 B;  3N4X A;  2YKO A;  3U59 A;  1YYC A;  2Z5H A;  4W7Y A;  2C9L Y;  3CL3 D;  1X79 B;  2NPS A;  4OH8 B;  1FOS F;  2HPC B;  2R5B A;  3RK3 D;  1LGH B;  2Z4E A;  1RY3 A;  3HUS B;  3M0A A;  2OYH C;  2IFN A;  2XV5 A;  1GW3 A;  3BAS A;  4Y99 B;  2WPR A;  4N78 E;  1IFM A;  2NPS C;  2O1J A;  5BU8 B;  3UIA A;  1CI6 B;  1GW4 A;  3KQG A;  1LTJ B;  5KTB A;  5AW3 B;  1QL1 A;  3V2Q A;  3B5N D;  1VDF A;  1WT6 A;  3GHG B;  2N1T D;  2YNY A;  3HE4 B;  1NTK K;  2WSC H;  1XTG B;  1GL2 D;  3VMZ A;  3M9B A;  3TYY A;  1N7S D;  2XNX A;  3IFM A;  3VN0 A;  1JCC A;  4XA4 A;  3P32 A;  2HLO A;  2WIT A;  2I1K A;  2HYN A;  3HD7 A;  1MZ9 A;  3MUD A;  1MFZ A;  1J2J B;  1JO5 A;  3G3Z A;  1FZC B;  2WPS A;  1RF0 A;  4N78 D;  5AVU B;  2C9N Y;  1NU1 K;  1NOH A;  4N3Y B;  3C9I A;  3B8E B;  1HJB A;  2HOD A;  2OYI B;  2W6A A;  1M7L A;  1HGZ A;  1FU1 A;  1LT9 A;  2FYZ A;  3LIE A;  5AVX B;  3TNU A;  3M0D A;  1ZR4 A;  1IJD B;  3HD7 C;  3V2N A;  3VOP A;  2NPS D;  3WMM 0;  5BU5 A;  4I1L A;  1ZV8 A;  1RF0 C;  1T2K C;  5AVZ B;  2P7J A;  1L0N K;  3HE5 B;  2Q9I A;  2FYU K;  3NTN A;  2A45 H;  1FBM A;  1LTB C;  2WZ7 A;  1SQV K;  1LT9 C;  3M0D C;  2R5D A;  2XZR A;  3VTP C;  3RK2 B;  1RE3 A;  3U1C A;  5AW8 B;  3O8Z A;  1LTT C;  2KYV A;  1E5W A;  1JTH A;  3MD0 A;  3SWF A;  1URQ A;  1KIL D;  2A45 G;  2C0X A;  1NWQ A;  2FXM A;  2IX7 C;  1RE3 C;  2C0W A;  1YTZ I;  3V4Q A;  2HG5 D;  1RE4 A;  2HPC A;  4AYC A;  4JYC A;  5CMZ A;  1SQX K;  1J1E C;  5CHX A;  3HUS A;  3RL0 B;  3M06 A;  1G1J A;  1URQ C;  1QL2 A;  5AW7 B;  2JEE A;  4GT1 A;  1KFM A;  3RK3 B;  1RE4 C;  2YKP A;  3L35 A;  3V2P A;  1CI6 A;  1LTJ A;  1NKZ B;  5APS A;  5AVQ B;  3M9Q A;  1SFC D;  4AQR D;  1AQ5 A;  3GHG A;  3HE4 A;  1FZA A;  5KJ7 A;  3P8C E;  2KSJ A;  2XKM A;  5AVW B;  1HUC A;  3B5N B;  2J59 M;  2J58 A;  2H43 A;  1S9K E;  5AVT B;  2N1T B;  4EIJ A;  5AW6 B;  1CZQ A;  3GHG C;  1KZU B;  1GL2 B;  3A7O A;  1FZC A;  1N7S B;  5KJ7 C;  2PP6 A;  3LW5 H;  1URQ D;  2YKQ A;  1GZL A;  2OYI A;  4WY4 B;  2BAS A;  5CCG A;  1L4A B;  1GK4 A;  3TSI A;  1T8Z A;  1HGV A;  2POH A;  1OWA A;  3P8C D;  3HE5 A;  3VP9 A;  4GIF A;  3L36 A;  4N6J A;  1NAF A;  2OYI C;  2Q7C A;  2WT7 B;  3U1A A;  3HRN A;  1S9K D;  3MGN A;  4C7R A;  5CCG C;  1FZG A;  1NO4 A;  1J1D B;  1T3U A;  3P7K A;  2P2U A;  5AW1 B;  4XE5 B;  2Q5U A;  1N73 B;  2HFE D;  1FJP A;  3PP5 A;  1SVF A;  3H32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...