1LTIC

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
molecule tags Enterotoxin
source organism Escherichia coli
total genus 13
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1996-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltiC00
1LTIC 1LTTC 1LTBC 1LTAC 1LTSC 1HTLC 1XTCC 1LTGC
chains in the Genus database with same CATH superfamily
1SFCA 2O01J 3M0DC 1KC8Q 2L5GB 4JBZA 4PD4I 4ASWA 1L0ND 4WVZA 3W68A 1J1DC 1L4AB 1KQLA 1QVGO 1CI6B 3H1HE 4AYCA 5KAIE 1OW7A 1AVYA 2QJKC 3A7OA 3HE4A 2RN0A 1JY3O 1NAYA 1JY3N 5C39A 1S2EA 2Y9YA 2LKMA 3RBZA 5CJ4A 2IPPA 4I6MC 1S9KE 1SQPJ 1URQB 1GW3A 2R44A 1KD1Q 4H13C 1PZQA 2XKMA 2AEJA 3L73G 1L0NK 1E79H 3H32A 1VF5C 3FGAD 2KIKA 4N78E 4H13B 1NKNA 1VF5B 3SWKA 1Q90D 3PP5A 5CBOA 3MHVA 4C7NA 2W8ZA 3CWBG 1RE3A 3WU2H 2ZT9C 1SLQA 2C0WA 1QGKB 4D6TE 1EZVE 4EYYQ 1FC2C 1M56D 5AW0B 3C9IA 1PGPA 2PRRA 3ZDMA 1KQFB 3CD6P 3CCLP 3HTKA 1YITP 1NTMD 3H1JJ 3AECC 3H1LJ 1BDCA 1JB0J 3AE6C 5L8RJ 1SQXJ 1KB9I 1ZXGA 1X22A 1H0TB 1NTKK 2CK3H 4H44D 2B9BA 2K3RA 1QL1A 2W83C 3L75D 1IFDA 4EOTA 1SQBG 2W6BA 1OIPA 2I1JA 4WWIA 3D6YA 1HJBA 2FYZA 4IOIH 2YNYA 1GK4A 3G71P 2XDJA 2K9JB 1VQ9P 3G3ZA 1EDIA 1KYOD 1NTMK 1MFZA 1NKZB 3TGUE 4W80A 3Q2YA 2L91A 1WT6A 3B8EB 1M1JA 1AQTA 4PD4H 2WPSA 4L75A 3CCMP 2IZ0A 4BRYB 2FXMA 1N73C 4NPDA 1BE3G 2G8YA 2H88C 5AW8B 1J1EC 3HD7C 2D2CB 3V2QA 2A06D 3U1CA 3TYYA 3OAKA 1BE3E 4AQRD 2AXTH 3R4YA 1IFIA 4D6TD 4W7ZA 5AVRB 1SQPG 4KT0J 4MN4C 2QA4P 1UIIA 1WRGA 2MJZA 3L74D 1FDOA 2HPCB 3S4RA 1BGYJ 3TSIA 1K05A 2R32A 1PL5A 3RL0C 4HYTB 4U3FD 3I55P 2KSJA 3CCEP 3EFGA 3RL0B 1AQ5A 2FXPA 2ZVNB 1VQLP 1LTJC 1N7SA 5KLVD 2Y0DA 4Y99C 3L71D 1E5WA 1SFCC 1DEEG 3BATA 5AVUB 1HGVA 3MD0A 4DZOA 2Q6QA 3BRTB 2KLUA 3CCVP 3H1KD 4R4MA 3H1JG 1N7SD 2HYNA 3H1LG 3FX0A 3L72D 3V4WA 3A0HE 2WSCH 1SQXG 2HG5D 4ZKPA 2GA1A 2OARA 3N4XA 1KORA 2E75B 5KLVK 1OZHA 3LIDA 1YTZI 3P8CD 2LXCB 1USDA 2KUBA 2IFNA 5DJUB 1NTKJ 3V4QA 3WUUA 5K5GB 3RGUA 4H0LB 3RK3C 4RKUJ 1S1CX 4ZNCA 1P84I 1L0LE 3A0HH 5B5EH 3RK3B 2B87A 1N86A 4C7NB 1CZQA 3M91A 1GZLA 4OGQD 2K88A 1KQSO 4H44C 1LT9A 1VQ8P 3H1HJ 1GL2A 3MGNA 1H89A 1AVOA 3H1ID 3TNUB 2E74B 1K73Q 3EWKA 1YI2P 5CCGA 1HGZA 1MKMA 4PV1B 3KQGA 3B71A 1NTZD 1GTWA 4O9BA 3RK2C 1T6AA 3V5BA 2OTLP 2P2UA 3AEGC 5CCGD 1FDIA 5CCHA 3RK2B 2KS1A 1IFNA 3KXDA 2QM8A 2XU6A 4JYCA 4QMAA 2M5AA 1M1JC 2JP3A 1GDTA 3W67A 5CCHD 5APUA 3B5NA 1LNQA 1L0NE 2J59M 2QG4A 4D6TJ 5TISH 1L0LD 3Q5SA 1BSNA 1MUUA 2WZ7A 3B5ND 4UB8H 1OX3A 3RL0g 5CJ0A 2E43A 2JWDA 1JOCA 3VP9A 4HB1A 1SS1A 2PAJA 3BVHA 2QM7A 1NH4A 3V2PA 3IN6A 4WY4A 2H8PD 3WUTA 2C9NY 1BCCD 3T97A 2WWWA 3JC22 1NTKG 1L0LK 1M1KQ 3CX5D 1FZGA 3ABVC 1FBMA 4EI2A 3G6EP 2O1KA 4WY4D 3SSUA 3TGUJ 1N7SC 1NTMG 1IK9A 2YO3A 1RF0A 4GOFA 2M8RA 2P10A 1AV1A 2KYVA 4Z1MH 4XFJA 1MFTA 3P7KA 1EZVI 5AVTB 1NTME 3KPEA 2WQYC 1QL2A 3L75G 2M0BA 2FY8A 2FYUD 2ITAA 1JNMA 2DW3A 1JM0A 2Q9IA 4UB6H 1BE3J 2Q1KA 1HJ0A 5AVSB 3CXHD 4BWNA 4N6JA 5AW4B 2A45G 3VTPC 1G1IA 2YKPA 3L75E 3E7KA 1JCDA 2R5DA 3O6QA 1L2PA 1PP9D 2NRGA 3NTNA 2WSFH 3BCCD 4M3LA 1J1DB 2JO1A 3K5BA 1AFOA 3TDKA 3QH9A 1KYOE 2QJKB 2WSCJ 1W5CE 4HH2A 3KZIE 2KNCA 4GDOA 4RESB 1EXIA 1NAFA 2A06G 3CMEP 1SQVD 1NWQA 3E1IA 2E5YA 1VQPP 1ZV8A 2QSIA 1NGMB 1YTZT 2A06E 4D6TG 3M06A 1EZVG 5KAIH 1HUCA 3S9OA 5AW3B 3AEFC 1SQQD 1LP1A 1FZAA 1LT9C 3HE5A 1GL2C 2OYIA 1NVOA 3L74G 2A45H 1CW5A 1KYOH 2Y0CA 3NMDA 3GF3A 3VMAA 1LTIC 2YIUC 2ZT9B 3KZIH 1SQVK 1LT9B 4K35A 1GL2B 2IZ1A 1GD2E 4Y28J 3MIWA 1HF9A 4U3FG 3L74E 2YIUB 2WPQA 2N1TD 3TK1A 2VRSA 3C8VA 4EDFA 2XNXA 4PJ0E 1ZRTE 3WUVA 3GHGA 2R3CA 5CCHC 2Z5HA 4U3FE 1Y47A 3L71G 2Z5IA 2WSSH 1OVUA 4HJGH 4KJMA 3TGUG 2E42A 2OYOA 1VQNP 4DT0A 5KLVE 1KILA 3R2PA 3L72G 1L0LJ 3L71E 2KK7A 1DEBA 1OVRA 3SFEC 5BU5A 1PFIA 4I2LC 2B88A 2UWJE 3H1KE 2KI7B 2W27A 3CCJP 3D71A 1NOHA 3L72E 1KILD 1R5LA 1FZCA 1KZUB 3A5TA 2RMZA 4PJ0H 2KOGA 2IDBA 1N73B 1RQVA 1FOSF 4HKZH 3AEAC 1JY2P 2IFMA 1J1EB 1SVFA 1FS0E 3P8CE 3HD7B 2QIWA 1ZOYC 4LC1A 2K1AA 2NZ2A 4WY4C 1PGQA 3FXDA 3F5HA 3OW2O 4YXDC 4U7JA 2E76D 1Y8AA 2HODB 5KLIC 5BVZA 3IF4A 2SPZA 1IO4A 4OVNF 1MZ9A 1KFNA 3G9RA 5KLIB 3SWYA 1JY3P 2ZXEB 3IR9A 3LIEA 2BEZF 4N3YB 3CWBD 1FOSE 4NPEA 3I56P 3HRNA 1ZRTD 2NPSA 3KYQA 1VQ4P 1RF0C 2E5TA 2FXOA 3A2AA 3H1IG 1JO5A 4CPGA 1L0NJ 1M90Q 2QVAA 2Q7CA 2WMMA 2QJPC 2RKLA 1NHLA 3USSA 2NPSD 1LTSC 3H1IE 1LTJB 1ZN5A 4Y99B 1ZW0A 3UIAA 4BXLA 3HUSA 2V7QH 2O3JA 1N7LA 2XZRA 1SFCB 3GF7A 1VQ6P 1YIJP 1NTZE 2KXPB 5AVYB 1TU3F 1KN7A 1EXJA 2JDIH 3HE4B 1IFPA 1RE4A 1FJKA 1DIPA 5KAFE 3AE8C 1U7JA 1L4AA 1QEXA 1BSHA 2ZXXA 1ZP0C 4ZMDA 4C7RA 1KV4A 1L0LG 2KZIA 4XE5B 5GTHE 1NJIQ 1JMMA 4IL6E 2WSFJ 2P7JA 1KFMA 3H32B 5KJ7D 1L4AD 2YMKA 1IK7A 1YJWP 1FE6A 1EDJA 1URQA 1RE3C 2CPBA 3VYIA 2P67A 1W2BO 1NTMJ 3AE9C 2OYIC 2ZYGA 2N9BA 1HH0A 1BCCG 1URQD 1KB9D 1WMKA 2PFXA 3HE5B 4L74A 1G2CA 2KB7P 3AE7C 1EC5A 1IFJA 1SQPD 1JCCA 2WSEH 1KTMA 4GOEA 3L75J 1KQGB 1BCCE 3HTKB 4H13D 4H44B 5GTHH 4IL6H 3JSVC 5CMZA 5AW5B 1VF5D 3CC2P 3CX5E 1R8EA 2ZYDA 2P1JA 4WBAA 1X79B 5AW7B 4YXWH 3KHUA 2FYNC 4GIFA 5AW9B 1HTLC 1K9MQ 3NXSA 2ZAEB 3I5CA 1OMIA 1SQPK 3MP7B 3PH0A 2FYNB 4GT1A 1DH3A 1H0TA 3CC4P 3M0AA 1L0NG 1OXZA 2Z4EA 5APXA 3H1JD 4W7YA 5BU8B 1FZCC 2K9YA 3H1LD 1R5SA 1PP9G 2FYUE 4XA4A 4DOJA 5CHXA 1LTAC 2PGDA 1K04A 3Q5PA 3BCCG 2K9JA 3AE2C 1NU1E 3GG2A 1M1JB 1NTZK 3CX5H 3CXHE 1SQXD 1IFMA 1RF1A 3LW5H 1PP9E 1NYHA 4I7ZC 2IBZE 2OYHA 3BCCE 3L70D 3N7NA 1Q86Q 3L74J 3PLNA 1QVFO 1VQMP 1LT1A 1PPJD 4I1LA 2A45I 1KYOI 3RBXA 2I8DA 1PIXA 2FKWB 4U3FJ 1YJNP 1SQVE 3NFQA 2BCCE 1VQ5P 2ZJSE 1S5LE 1M8OB 1FU1A 1HWTC 5KLVJ 2D2CD 2NPSC 1S4XA 3CXHH 4L76A 2OTJP 3L71J 1YBKA 3H6PA 3L4FA 1T3UA 2BASA 4DJGA 5AW1B 1SQQE 1X0TA 3FWLA 1W2EA 3H1KJ 1LWUA 5CBNA 1T2KD 3L72J 3GLMA 4EIJA 1A02F 1MV8A 1N7SB 1N8RQ 3HUSC 3O8ZA 3TF5A 1Q82Q 1OW6A 3HUSB 1EQ7A 1EDKA 1BGYD 1LTBC 3EFFK 3JCUE 1NU1D 3L36A 3V2RA 3CCSP 1JY2O 1JY2N 3BRVB 1RE4C 3RL0D 2YO2A 5KTBA 2QEXP 2Y9ZA 1L4AC 2V7QJ 2CPSA 2XV5A 2IBZD 2FBWC 3VN0A 5AVVB 1P84D 3L37A 2N9YB 3M9HA 1AA0A 2Y0EA 1JTHA 1T8ZA 3WU2E 2FYUK 1KMIZ 1SFCD 2HLOA 1FZEA 4OGQC 5H2FE 3PHLA 1YHQP 3CCQP 1NU1K 2JWAA 1URQC 2GM4A 2BCCD 1KILE 1UIXA 3QWOC 4OGQB 1RQUA 1RH5B 3JCUH 2E75D 1ZLLA 2WPVB 3A0BE 3CMAP 1T3JA 4RO0A 2B87B 3P8MC 2YXQB 3H1IJ 4IL6X 2LXBA 3PJSK 2LR2A 4C46A 2N1TA 1G2CB 2IYOA 3L73E 1NTZJ 3ITKA 3KDPB 2WTYA 2XNDH 3P32A 5CCGC 4H0LD 1NTKD 1FZBA 4LGDE 2KP8A 1JUNA 5TJHA 5H2FH 1SP4A 1VQOP 1IZNB 4JPZB 1OWAA 3RK3D 1LTTC 1U57A 2V4HA 3CWBE 1ZR2A 3GMAA 5KLVG 2WSEJ 3VMXA 1IC2A 3A0BH 1VQKP 3TNUA 1SQQK 1H8AA 2W6AA 2J58A 4PD4E 5EFWB 5DJTB 1ZR4A 2KS1B 3M9QA 1G1JA 2G3AA 1XTGB 3H1KG 1N2DC 3B5NC 3H1HD 2E74D 1NO4A 5AW6B 2M5AB 3L70J 3AEDC 4PV1D 3B5NB 2AXTE 1RF1C 2WPRA 3M9BA 1SQBE 2BEQD 2OYHC 2AEMA 1S9KD 5AVWB 1RF1B 5AVQB 3RK2D 2Q3EA 3PRJA 4AUWA 2IYPA 1BCCJ 3VP8A 3BASA 1GMJA 3CCUP 2OYHB 4JQ0D 1CSBA 4KHXA 2D2CC 4N78D 3U59A 2POHA 3FWNA 3LW5J 1GU4A 3L73D 3VMZA 4A7PA 1JMBA 4WY4B 1T2KC 1Q7YQ 4IFMA 3T97B 1X8YA 1VL2A 2FFDA 2WT7A 5APYA 1EZVD 1M7LA 3IFMA 2YMYA 1M57D 1LWUC 2O01N 2KZJA 1OFCX 3AE3C 4IFFA 2FYUJ 3MUDA 3S1KA 1QX8A 4PD4D 1S5LX 1KB9E 1LWUB 3CPWO 4NPFX 1NU1J 3AEBC 3G4SP 1SQPE 1YJ9P 1HBWA 3PTZA 4JF7A 1PP9J 1NTZG 2QE7H 2QJPB 3BCCJ 2O01H 1XTCC 2R3SA 3CX5I 1EDLA 1SQBD 3AE4C 2JEEA 2HFED 2H89C 1K8AQ 3TGUD 2W6JH 3O6QB 1SQVJ 2BCCJ 1LGHB 1VQ7P 3VOPA 2E75C 3H25A 1KB9H 5KJ7A 4K3AA 5B5EE 1FAVA 1CI6A 1LTGC 3M0DA 2JJLA 1JTHB 2KNCB 3H1JE 3IAOA 1D7MA 3H1LE 2MKVA 1DD4A 1SQQJ 5APTA 1Z56A 3L70G 3AE1C 1BE3D 3SWFA 1SQBK 1GK6A 4IFDK 1SQXE 5E79E 1J2JB 1YQ3C 3CXHI 1OW8A 4R4LA 5GTIE 5KKZC 1PPJG 2AXCA 4H0LC 4YTPC 1GU5A 2I1KA 1AJYA 3L70E 2K37A 2KLVA 5KKZB 2O1JA 2YKOA 3OA7A 2IBZI 2N1TC 1OVVA 2C0XA 1FJPA 1RY3A 1LP1B 1PPJE 5KAFH 2OYIB 2Q3IA 2AEFA 3E1RA 2N1TB 3OJAB 1S3JA 3WMM0 1FZFA 3SFDC 3CL3D 2ZVOB 1H88A 1A02J 3F89A 3GHGC 3D6ZA 1U7MA 5E79H 2E74C 4RJTA 3B4SA 2YXRB 5GTIH 4PV1C 4L73A 3GHGB 2OQQA 1Q2NA 1HVVA 1KILC 1PGJA 5M1BA 2FYUG 2ZT9D 5TISE 4GODA 3L35A 1BGYG 1GL2D 1QLED 1IJDB 3Q5RA 1KILB 1NU1G 4UB8E 2JKVA 2YKQA 1DD3A 2OTKE 1S72P 1X9VA 5B66E 3C1LA 1BGYE 1FDMA 2M3BA 4WB4A 2PP6A 2QJYC 2IBZG 1ZMEC 1GW4A 3II6A 4ZKUA 1FZCB 2H7HA 2E76C 3CLQA 3L73J 2QJYB 3D70A 2Q5UA 1BDDA 5AW2B 4TLFA 2E76B 2H43A 1P84E 3CCRP 4BRYA 4LLHA 1SQVG 2BCCG 1VPCA 4I7ZB 3AE5C 1USEA 3CWBJ 1N73A 4B86A 1Q81Q 3EQ2A 4YPCA 4DCKA 4JYBA 2FFDC 2ZFCA 3HD7A 5B66H 1SQXK 2IX7C 1RHZB 1VDFA 3V6IA 2WITA 2B89A 2M3EA 4OWFA 1PGOA 1SQQG 2HR3A 4TT3H 2FFDB 5APSA 2WT7B 2HODA 2ZYAA 3MUDC 4GKGA 3VMYA 1Y9BA 5APQA 5APVA 3HD7D 1JEKA 2NPSB 2P58A 2KSEA 2C9LY 4UB6E 2WVRA 4ASVA 2HPCA 1P84H 2JR8A 5APWA 1YQ4C 5AVXB 2J5UA 2W90A 1SQBJ 1PV3A 2R5BA 1YYCA 2GUSA 3FXEA 1NTKE 3V2NA 3GW6A 3CC7P 2QRXA 2OGUA 3Q3DA 3AEEC 5AVZB 3RK3E 1LJ2A 1S5LH 1DX7A 3CI9A 3MZWB 2RH0A 2GUVA 3U1AA 4OH8B 1LTJA 3H1HG 3Q1MA 3MTUE 5KJ7C 3A3YB
chains in the Genus database with same CATH topology
1NO4A 2QM8A 1SFCA 5AW6B 3M0DC 2L5GB 2XU6A 3B5NB 4JYCA 1RF1C 2WPRA 1M1JC 1J1DC 1L4AB 3HE4B 1KQLA 3M9BA 1GDTA 1CI6B 1RE4A 4AYCA 1FJKA 5CCHD 5APUA 3B5NA 2OYHC 3HE4A 1L4AA 3A7OA 1S9KD 5AVWB 1RF1B 5AVQB 1JY3O 3RK2D 1JY3N 2J59M 4AUWA 4C7RA 3VP8A 3BASA 2OYHB 2LKMA 1CSBA 4KHXA 5CJ4A 4XE5B 2IPPA 4N78D 1JMMA 4I6MC 1MUUA 2WZ7A 3B5ND 1S9KE 2P7JA 3U59A 1KFMA 1URQB 2POHA 3H32B 1GW3A 5KJ7D 1L4AD 5CJ0A 2E43A 2XKMA 1GU4A 1L0NK 1JOCA 3H32A 1URQA 3VP9A 2PAJA 1RE3C 3BVHA 2CPBA 3VMZA 4N78E 2QM7A 4WY4B 3VYIA 1T2KC 2P67A 1NH4A 1NKNA 4IFMA 2OYIC 2N9BA 3V2PA 1X8YA 1HH0A 4WY4A 3PP5A 2H8PD 2FFDA 2C9NY 2WT7A 5APYA 4C7NA 1M7LA 3IFMA 1URQD 3T97A 2WWWA 3HE5B 2YMYA 1RE3A 1G2CA 2KB7P 1L0LK 1LWUC 1FZGA 1IFJA 1FBMA 1SLQA 1JCCA 2WSEH 2C0WA 4IFFA 3MUDA 2O1KA 3HTKB 4WY4D 1LWUB 5AW0B 3C9IA 1N7SC 5CMZA 5AW5B 3HTKA 1HBWA 2P1JA 1IK9A 2YO3A 4JF7A 1RF0A 4WBAA 2M8RA 1X79B 5AW7B 2KYVA 3P7KA 4GIFA 2O01H 5AVTB 5AW9B 1HTLC 1XTCC 3NXSA 3KPEA 1NTKK 3I5CA 1QL2A 1QL1A 1IFDA 1SQPK 4EOTA 1JNMA 4GT1A 1DH3A 2W6BA 2Q9IA 2I1JA 2JEEA 2HFED 3M0AA 1HJBA 1OXZA 2FYZA 5AVSB 2YNYA 2Z4EA 1GK4A 4N6JA 5APXA 5AW4B 2A45G 3VTPC 1G1IA 2XDJA 2YKPA 4W7YA 5BU8B 1FZCC 3G3ZA 1LGHB 1JCDA 2R5DA 4XA4A 1NTMK 4DOJA 5CHXA 3VOPA 1LTAC 1MFZA 5KJ7A 1NKZB 1FAVA 1CI6A 3NTNA 1LTGC 3M0DA 2WSFH 4M3LA 1M1JB 1J1DB 1NTZK 2JJLA 1AFOA 4W80A 1IFMA 1JTHB 1WT6A 1RF1A 3B8EB 1M1JA 3LW5H 4HH2A 2WPSA 2FXMA 1N73C 5APTA 1Z56A 2OYHA 3N7NA 3SWFA 1SQBK 1GK6A 4IFDK 5AW8B 1J1EC 4RESB 1J2JB 3HD7C 1NAFA 3V2QA 3U1CA 1NWQA 3E1IA 4I1LA 3TYYA 2A45I 3OAKA 1GU5A 2I1KA 4AQRD 1ZV8A 2KLVA 2YKOA 2O1JA 2FKWB 3OA7A 2N1TC 1IFIA 2C0XA 1FJPA 1RY3A 1YTZT 3NFQA 3M06A 4W7ZA 1HUCA 1FU1A 5AVRB 2OYIB 2Q3IA 5AW3B 1HWTC 3OJAB 2N1TB 1FZAA 2NPSC 1LT9C 3HE5A 1GL2C 3WMM0 2OYIA 3H6PA 1FZFA 1WRGA 2A45H 2MJZA 1CW5A 2HPCB 3CL3D 3L4FA 1T3UA 3NMDA 3TSIA 1LTIC 2BASA 1SQVK 1H88A 1LT9B 1A02J 5AW1B 1GL2B 2R32A 1W2EA 3GHGC 1GD2E 3MIWA 3RL0C 4HYTB 1LWUA 1T2KD 4EIJA 2WPQA 1A02F 1MV8A 1N7SB 2KSJA 2N1TD 3EFGA 3TK1A 3GHGB 2VRSA 3HUSC 3O8ZA 3RL0B 1AQ5A 2XNXA 1HVVA 1LTJC 1N7SA 1KILC 4Y99C 3GHGA 2R3CA 5CCHC 2Z5HA 2Z5IA 3HUSB 1EQ7A 1E5WA 3L35A 1SFCC 1GL2D 3BATA 1IJDB 5AVUB 1HGVA 3MD0A 4DZOA 1LTBC 1KILB 2E42A 3BRTB 2YKQA 3L36A 3V2RA 1JY2O 1JY2N 1N7SD 2HYNA 1X9VA 1KILA 3BRVB 3R2PA 1RE4C 3V4WA 3RL0D 1DEBA 2YO2A 5KTBA 1FDMA 5BU5A 2M3BA 2WSCH 1PFIA 4WB4A 1L4AC 2XV5A 2CPSA 2PP6A 4I2LC 1GW4A 3II6A 3VN0A 4ZKUA 5AVVB 1FZCB 2H7HA 2HG5D 4ZKPA 3L37A 2OARA 3N4XA 2W27A 3CLQA 1NOHA 5KLVK 1KILD 1FZCA 1KZUB 3LIDA 3M9HA 2Q5UA 1YTZI 1JTHA 5AW2B 3A5TA 1T8ZA 3P8CD 2FYUK 1SFCD 2HLOA 1FZEA 2H43A 4LLHA 1NU1K 2KOGA 1URQC 2IFNA 1VPCA 1N73B 2GM4A 1FOSF 1JY2P 2IFMA 3V4QA 1J1EB 1SVFA 3P8CE 3HD7B 1N73A 1ZLLA 4B86A 4LC1A 3EQ2A 3RK3C 4WY4C 1T3JA 4JYBA 2FFDC 2ZFCA 3HD7A 1SQXK 2IX7C 1VDFA 3P8MC 2WITA 2HODB 5BVZA 3RK3B 1IO4A 1N86A 2FFDB 5APSA 2WT7B 4C7NB 1CZQA 2HODA 1MZ9A 1KFNA 3M91A 4GKGA 4C46A 1GZLA 3VMYA 2N1TA 1G2CB 5APQA 5APVA 3HD7D 3KDPB 1JY3P 2NPSB 2ZXEB 3IR9A 3LIEA 3SWYA 2WTYA 2C9LY 3P32A 4N3YB 5CCGC 2HPCA 1FZBA 1FOSE 4LGDE 2KP8A 1JUNA 3HRNA 2NPSA 1SP4A 3KYQA 1RF0C 5APWA 1LT9A 5AVXB 1GL2A 1OWAA 3MGNA 2R5BA 3RK3D 3A2AA 1H89A 1YYCA 1LTTC 3TNUB 1JO5A 2GUSA 3V2NA 1ZR2A 2Q7CA 5CCGA 3VMXA 1IC2A 1HGZA 3TNUA 1SQQK 1H8AA 1NHLA 3KQGA 2NPSD 5AVZB 1LTSC 2W6AA 2J58A 1DX7A 1GTWA 1LTJB 4O9BA 3RK2C 1ZN5A 3CI9A 4Y99B 3UIAA 1ZR4A 3HUSA 3M9QA 3V5BA 2GUVA 1G1JA 2P2UA 1N7LA 1XTGB 3U1AA 4OH8B 2XZRA 1LTJA 1N2DC 1SFCB 5CCGD 5CCHA 3RK2B 3B5NC 1IFNA 3MTUE 5KJ7C 3A3YB 5AVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTI C;  1LTT C;  1LTB C;  1LTA C;  1LTS C;  1HTL C;  1XTC C;  1LTG C; 
#chains in the Genus database with same CATH topology
 1SFC A;  2O01 J;  3M0D C;  1KC8 Q;  2L5G B;  4JBZ A;  4PD4 I;  4ASW A;  1L0N D;  4WVZ A;  3W68 A;  1J1D C;  1L4A B;  1KQL A;  1QVG O;  1CI6 B;  3H1H E;  4AYC A;  5KAI E;  1OW7 A;  1AVY A;  2QJK C;  3A7O A;  3HE4 A;  2RN0 A;  1JY3 O;  1NAY A;  1JY3 N;  5C39 A;  1S2E A;  2Y9Y A;  2LKM A;  3RBZ A;  5CJ4 A;  2IPP A;  4I6M C;  1S9K E;  1SQP J;  1URQ B;  1GW3 A;  2R44 A;  1KD1 Q;  4H13 C;  1PZQ A;  2XKM A;  2AEJ A;  3L73 G;  1L0N K;  1E79 H;  3H32 A;  1VF5 C;  3FGA D;  2KIK A;  4N78 E;  4H13 B;  1NKN A;  1VF5 B;  3SWK A;  1Q90 D;  3PP5 A;  5CBO A;  3MHV A;  4C7N A;  2W8Z A;  3CWB G;  1RE3 A;  3WU2 H;  2ZT9 C;  1SLQ A;  2C0W A;  1QGK B;  4D6T E;  1EZV E;  4EYY Q;  1FC2 C;  1M56 D;  5AW0 B;  3C9I A;  1PGP A;  2PRR A;  3ZDM A;  1KQF B;  3CD6 P;  3CCL P;  3HTK A;  1YIT P;  1NTM D;  3H1J J;  3AEC C;  3H1L J;  1BDC A;  1JB0 J;  3AE6 C;  5L8R J;  1SQX J;  1KB9 I;  1ZXG A;  1X22 A;  1H0T B;  1NTK K;  2CK3 H;  4H44 D;  2B9B A;  2K3R A;  1QL1 A;  2W83 C;  3L75 D;  1IFD A;  4EOT A;  1SQB G;  2W6B A;  1OIP A;  2I1J A;  4WWI A;  3D6Y A;  1HJB A;  2FYZ A;  4IOI H;  2YNY A;  1GK4 A;  3G71 P;  2XDJ A;  2K9J B;  1VQ9 P;  3G3Z A;  1EDI A;  1KYO D;  1NTM K;  1MFZ A;  1NKZ B;  3TGU E;  4W80 A;  3Q2Y A;  2L91 A;  1WT6 A;  3B8E B;  1M1J A;  1AQT A;  4PD4 H;  2WPS A;  4L75 A;  3CCM P;  2IZ0 A;  4BRY B;  2FXM A;  1N73 C;  4NPD A;  1BE3 G;  2G8Y A;  2H88 C;  5AW8 B;  1J1E C;  3HD7 C;  2D2C B;  3V2Q A;  2A06 D;  3U1C A;  3TYY A;  3OAK A;  1BE3 E;  4AQR D;  2AXT H;  3R4Y A;  1IFI A;  4D6T D;  4W7Z A;  5AVR B;  1SQP G;  4KT0 J;  4MN4 C;  2QA4 P;  1UII A;  1WRG A;  2MJZ A;  3L74 D;  1FDO A;  2HPC B;  3S4R A;  1BGY J;  3TSI A;  1K05 A;  2R32 A;  1PL5 A;  3RL0 C;  4HYT B;  4U3F D;  3I55 P;  2KSJ A;  3CCE P;  3EFG A;  3RL0 B;  1AQ5 A;  2FXP A;  2ZVN B;  1VQL P;  1LTJ C;  1N7S A;  5KLV D;  2Y0D A;  4Y99 C;  3L71 D;  1E5W A;  1SFC C;  1DEE G;  3BAT A;  5AVU B;  1HGV A;  3MD0 A;  4DZO A;  2Q6Q A;  3BRT B;  2KLU A;  3CCV P;  3H1K D;  4R4M A;  3H1J G;  1N7S D;  2HYN A;  3H1L G;  3FX0 A;  3L72 D;  3V4W A;  3A0H E;  2WSC H;  1SQX G;  2HG5 D;  4ZKP A;  2GA1 A;  2OAR A;  3N4X A;  1KOR A;  2E75 B;  5KLV K;  1OZH A;  3LID A;  1YTZ I;  3P8C D;  2LXC B;  1USD A;  2KUB A;  2IFN A;  5DJU B;  1NTK J;  3V4Q A;  3WUU A;  5K5G B;  3RGU A;  4H0L B;  3RK3 C;  4RKU J;  1S1C X;  4ZNC A;  1P84 I;  1L0L E;  3A0H H;  5B5E H;  3RK3 B;  2B87 A;  1N86 A;  4C7N B;  1CZQ A;  3M91 A;  1GZL A;  4OGQ D;  2K88 A;  1KQS O;  4H44 C;  1LT9 A;  1VQ8 P;  3H1H J;  1GL2 A;  3MGN A;  1H89 A;  1AVO A;  3H1I D;  3TNU B;  2E74 B;  1K73 Q;  3EWK A;  1YI2 P;  5CCG A;  1HGZ A;  1MKM A;  4PV1 B;  3KQG A;  3B71 A;  1NTZ D;  1GTW A;  4O9B A;  3RK2 C;  1T6A A;  3V5B A;  2OTL P;  2P2U A;  3AEG C;  5CCG D;  1FDI A;  5CCH A;  3RK2 B;  2KS1 A;  1IFN A;  3KXD A;  2QM8 A;  2XU6 A;  4JYC A;  4QMA A;  2M5A A;  1M1J C;  2JP3 A;  1GDT A;  3W67 A;  5CCH D;  5APU A;  3B5N A;  1LNQ A;  1L0N E;  2J59 M;  2QG4 A;  4D6T J;  5TIS H;  1L0L D;  3Q5S A;  1BSN A;  1MUU A;  2WZ7 A;  3B5N D;  4UB8 H;  1OX3 A;  3RL0 g;  5CJ0 A;  2E43 A;  2JWD A;  1JOC A;  3VP9 A;  4HB1 A;  1SS1 A;  2PAJ A;  3BVH A;  2QM7 A;  1NH4 A;  3V2P A;  3IN6 A;  4WY4 A;  2H8P D;  3WUT A;  2C9N Y;  1BCC D;  3T97 A;  2WWW A;  3JC2 2;  1NTK G;  1L0L K;  1M1K Q;  3CX5 D;  1FZG A;  3ABV C;  1FBM A;  4EI2 A;  3G6E P;  2O1K A;  4WY4 D;  3SSU A;  3TGU J;  1N7S C;  1NTM G;  1IK9 A;  2YO3 A;  1RF0 A;  4GOF A;  2M8R A;  2P10 A;  1AV1 A;  2KYV A;  4Z1M H;  4XFJ A;  1MFT A;  3P7K A;  1EZV I;  5AVT B;  1NTM E;  3KPE A;  2WQY C;  1QL2 A;  3L75 G;  2M0B A;  2FY8 A;  2FYU D;  2ITA A;  1JNM A;  2DW3 A;  1JM0 A;  2Q9I A;  4UB6 H;  1BE3 J;  2Q1K A;  1HJ0 A;  5AVS B;  3CXH D;  4BWN A;  4N6J A;  5AW4 B;  2A45 G;  3VTP C;  1G1I A;  2YKP A;  3L75 E;  3E7K A;  1JCD A;  2R5D A;  3O6Q A;  1L2P A;  1PP9 D;  2NRG A;  3NTN A;  2WSF H;  3BCC D;  4M3L A;  1J1D B;  2JO1 A;  3K5B A;  1AFO A;  3TDK A;  3QH9 A;  1KYO E;  2QJK B;  2WSC J;  1W5C E;  4HH2 A;  3KZI E;  2KNC A;  4GDO A;  4RES B;  1EXI A;  1NAF A;  2A06 G;  3CME P;  1SQV D;  1NWQ A;  3E1I A;  2E5Y A;  1VQP P;  1ZV8 A;  2QSI A;  1NGM B;  1YTZ T;  2A06 E;  4D6T G;  3M06 A;  1EZV G;  5KAI H;  1HUC A;  3S9O A;  5AW3 B;  3AEF C;  1SQQ D;  1LP1 A;  1FZA A;  1LT9 C;  3HE5 A;  1GL2 C;  2OYI A;  1NVO A;  3L74 G;  2A45 H;  1CW5 A;  1KYO H;  2Y0C A;  3NMD A;  3GF3 A;  3VMA A;  1LTI C;  2YIU C;  2ZT9 B;  3KZI H;  1SQV K;  1LT9 B;  4K35 A;  1GL2 B;  2IZ1 A;  1GD2 E;  4Y28 J;  3MIW A;  1HF9 A;  4U3F G;  3L74 E;  2YIU B;  2WPQ A;  2N1T D;  3TK1 A;  2VRS A;  3C8V A;  4EDF A;  2XNX A;  4PJ0 E;  1ZRT E;  3WUV A;  3GHG A;  2R3C A;  5CCH C;  2Z5H A;  4U3F E;  1Y47 A;  3L71 G;  2Z5I A;  2WSS H;  1OVU A;  4HJG H;  4KJM A;  3TGU G;  2E42 A;  2OYO A;  1VQN P;  4DT0 A;  5KLV E;  1KIL A;  3R2P A;  3L72 G;  1L0L J;  3L71 E;  2KK7 A;  1DEB A;  1OVR A;  3SFE C;  5BU5 A;  1PFI A;  4I2L C;  2B88 A;  2UWJ E;  3H1K E;  2KI7 B;  2W27 A;  3CCJ P;  3D71 A;  1NOH A;  3L72 E;  1KIL D;  1R5L A;  1FZC A;  1KZU B;  3A5T A;  2RMZ A;  4PJ0 H;  2KOG A;  2IDB A;  1N73 B;  1RQV A;  1FOS F;  4HKZ H;  3AEA C;  1JY2 P;  2IFM A;  1J1E B;  1SVF A;  1FS0 E;  3P8C E;  3HD7 B;  2QIW A;  1ZOY C;  4LC1 A;  2K1A A;  2NZ2 A;  4WY4 C;  1PGQ A;  3FXD A;  3F5H A;  3OW2 O;  4YXD C;  4U7J A;  2E76 D;  1Y8A A;  2HOD B;  5KLI C;  5BVZ A;  3IF4 A;  2SPZ A;  1IO4 A;  4OVN F;  1MZ9 A;  1KFN A;  3G9R A;  5KLI B;  3SWY A;  1JY3 P;  2ZXE B;  3IR9 A;  3LIE A;  2BEZ F;  4N3Y B;  3CWB D;  1FOS E;  4NPE A;  3I56 P;  3HRN A;  1ZRT D;  2NPS A;  3KYQ A;  1VQ4 P;  1RF0 C;  2E5T A;  2FXO A;  3A2A A;  3H1I G;  1JO5 A;  4CPG A;  1L0N J;  1M90 Q;  2QVA A;  2Q7C A;  2WMM A;  2QJP C;  2RKL A;  1NHL A;  3USS A;  2NPS D;  1LTS C;  3H1I E;  1LTJ B;  1ZN5 A;  4Y99 B;  1ZW0 A;  3UIA A;  4BXL A;  3HUS A;  2V7Q H;  2O3J A;  1N7L A;  2XZR A;  1SFC B;  3GF7 A;  1VQ6 P;  1YIJ P;  1NTZ E;  2KXP B;  5AVY B;  1TU3 F;  1KN7 A;  1EXJ A;  2JDI H;  3HE4 B;  1IFP A;  1RE4 A;  1FJK A;  1DIP A;  5KAF E;  3AE8 C;  1U7J A;  1L4A A;  1QEX A;  1BSH A;  2ZXX A;  1ZP0 C;  4ZMD A;  4C7R A;  1KV4 A;  1L0L G;  2KZI A;  4XE5 B;  5GTH E;  1NJI Q;  1JMM A;  4IL6 E;  2WSF J;  2P7J A;  1KFM A;  3H32 B;  5KJ7 D;  1L4A D;  2YMK A;  1IK7 A;  1YJW P;  1FE6 A;  1EDJ A;  1URQ A;  1RE3 C;  2CPB A;  3VYI A;  2P67 A;  1W2B O;  1NTM J;  3AE9 C;  2OYI C;  2ZYG A;  2N9B A;  1HH0 A;  1BCC G;  1URQ D;  1KB9 D;  1WMK A;  2PFX A;  3HE5 B;  4L74 A;  1G2C A;  2KB7 P;  3AE7 C;  1EC5 A;  1IFJ A;  1SQP D;  1JCC A;  2WSE H;  1KTM A;  4GOE A;  3L75 J;  1KQG B;  1BCC E;  3HTK B;  4H13 D;  4H44 B;  5GTH H;  4IL6 H;  3JSV C;  5CMZ A;  5AW5 B;  1VF5 D;  3CC2 P;  3CX5 E;  1R8E A;  2ZYD A;  2P1J A;  4WBA A;  1X79 B;  5AW7 B;  4YXW H;  3KHU A;  2FYN C;  4GIF A;  5AW9 B;  1HTL C;  1K9M Q;  3NXS A;  2ZAE B;  3I5C A;  1OMI A;  1SQP K;  3MP7 B;  3PH0 A;  2FYN B;  4GT1 A;  1DH3 A;  1H0T A;  3CC4 P;  3M0A A;  1L0N G;  1OXZ A;  2Z4E A;  5APX A;  3H1J D;  4W7Y A;  5BU8 B;  1FZC C;  2K9Y A;  3H1L D;  1R5S A;  1PP9 G;  2FYU E;  4XA4 A;  4DOJ A;  5CHX A;  1LTA C;  2PGD A;  1K04 A;  3Q5P A;  3BCC G;  2K9J A;  3AE2 C;  1NU1 E;  3GG2 A;  1M1J B;  1NTZ K;  3CX5 H;  3CXH E;  1SQX D;  1IFM A;  1RF1 A;  3LW5 H;  1PP9 E;  1NYH A;  4I7Z C;  2IBZ E;  2OYH A;  3BCC E;  3L70 D;  3N7N A;  1Q86 Q;  3L74 J;  3PLN A;  1QVF O;  1VQM P;  1LT1 A;  1PPJ D;  4I1L A;  2A45 I;  1KYO I;  3RBX A;  2I8D A;  1PIX A;  2FKW B;  4U3F J;  1YJN P;  1SQV E;  3NFQ A;  2BCC E;  1VQ5 P;  2ZJS E;  1S5L E;  1M8O B;  1FU1 A;  1HWT C;  5KLV J;  2D2C D;  2NPS C;  1S4X A;  3CXH H;  4L76 A;  2OTJ P;  3L71 J;  1YBK A;  3H6P A;  3L4F A;  1T3U A;  2BAS A;  4DJG A;  5AW1 B;  1SQQ E;  1X0T A;  3FWL A;  1W2E A;  3H1K J;  1LWU A;  5CBN A;  1T2K D;  3L72 J;  3GLM A;  4EIJ A;  1A02 F;  1MV8 A;  1N7S B;  1N8R Q;  3HUS C;  3O8Z A;  3TF5 A;  1Q82 Q;  1OW6 A;  3HUS B;  1EQ7 A;  1EDK A;  1BGY D;  1LTB C;  3EFF K;  3JCU E;  1NU1 D;  3L36 A;  3V2R A;  3CCS P;  1JY2 O;  1JY2 N;  3BRV B;  1RE4 C;  3RL0 D;  2YO2 A;  5KTB A;  2QEX P;  2Y9Z A;  1L4A C;  2V7Q J;  2CPS A;  2XV5 A;  2IBZ D;  2FBW C;  3VN0 A;  5AVV B;  1P84 D;  3L37 A;  2N9Y B;  3M9H A;  1AA0 A;  2Y0E A;  1JTH A;  1T8Z A;  3WU2 E;  2FYU K;  1KMI Z;  1SFC D;  2HLO A;  1FZE A;  4OGQ C;  5H2F E;  3PHL A;  1YHQ P;  3CCQ P;  1NU1 K;  2JWA A;  1URQ C;  2GM4 A;  2BCC D;  1KIL E;  1UIX A;  3QWO C;  4OGQ B;  1RQU A;  1RH5 B;  3JCU H;  2E75 D;  1ZLL A;  2WPV B;  3A0B E;  3CMA P;  1T3J A;  4RO0 A;  2B87 B;  3P8M C;  2YXQ B;  3H1I J;  4IL6 X;  2LXB A;  3PJS K;  2LR2 A;  4C46 A;  2N1T A;  1G2C B;  2IYO A;  3L73 E;  1NTZ J;  3ITK A;  3KDP B;  2WTY A;  2XND H;  3P32 A;  5CCG C;  4H0L D;  1NTK D;  1FZB A;  4LGD E;  2KP8 A;  1JUN A;  5TJH A;  5H2F H;  1SP4 A;  1VQO P;  1IZN B;  4JPZ B;  1OWA A;  3RK3 D;  1LTT C;  1U57 A;  2V4H A;  3CWB E;  1ZR2 A;  3GMA A;  5KLV G;  2WSE J;  3VMX A;  1IC2 A;  3A0B H;  1VQK P;  3TNU A;  1SQQ K;  1H8A A;  2W6A A;  2J58 A;  4PD4 E;  5EFW B;  5DJT B;  1ZR4 A;  2KS1 B;  3M9Q A;  1G1J A;  2G3A A;  1XTG B;  3H1K G;  1N2D C;  3B5N C;  3H1H D;  2E74 D;  1NO4 A;  5AW6 B;  2M5A B;  3L70 J;  3AED C;  4PV1 D;  3B5N B;  2AXT E;  1RF1 C;  2WPR A;  3M9B A;  1SQB E;  2BEQ D;  2OYH C;  2AEM A;  1S9K D;  5AVW B;  1RF1 B;  5AVQ B;  3RK2 D;  2Q3E A;  3PRJ A;  4AUW A;  2IYP A;  1BCC J;  3VP8 A;  3BAS A;  1GMJ A;  3CCU P;  2OYH B;  4JQ0 D;  1CSB A;  4KHX A;  2D2C C;  4N78 D;  3U59 A;  2POH A;  3FWN A;  3LW5 J;  1GU4 A;  3L73 D;  3VMZ A;  4A7P A;  1JMB A;  4WY4 B;  1T2K C;  1Q7Y Q;  4IFM A;  3T97 B;  1X8Y A;  1VL2 A;  2FFD A;  2WT7 A;  5APY A;  1EZV D;  1M7L A;  3IFM A;  2YMY A;  1M57 D;  1LWU C;  2O01 N;  2KZJ A;  1OFC X;  3AE3 C;  4IFF A;  2FYU J;  3MUD A;  3S1K A;  1QX8 A;  4PD4 D;  1S5L X;  1KB9 E;  1LWU B;  3CPW O;  4NPF X;  1NU1 J;  3AEB C;  3G4S P;  1SQP E;  1YJ9 P;  1HBW A;  3PTZ A;  4JF7 A;  1PP9 J;  1NTZ G;  2QE7 H;  2QJP B;  3BCC J;  2O01 H;  1XTC C;  2R3S A;  3CX5 I;  1EDL A;  1SQB D;  3AE4 C;  2JEE A;  2HFE D;  2H89 C;  1K8A Q;  3TGU D;  2W6J H;  3O6Q B;  1SQV J;  2BCC J;  1LGH B;  1VQ7 P;  3VOP A;  2E75 C;  3H25 A;  1KB9 H;  5KJ7 A;  4K3A A;  5B5E E;  1FAV A;  1CI6 A;  1LTG C;  3M0D A;  2JJL A;  1JTH B;  2KNC B;  3H1J E;  3IAO A;  1D7M A;  3H1L E;  2MKV A;  1DD4 A;  1SQQ J;  5APT A;  1Z56 A;  3L70 G;  3AE1 C;  1BE3 D;  3SWF A;  1SQB K;  1GK6 A;  4IFD K;  1SQX E;  5E79 E;  1J2J B;  1YQ3 C;  3CXH I;  1OW8 A;  4R4L A;  5GTI E;  5KKZ C;  1PPJ G;  2AXC A;  4H0L C;  4YTP C;  1GU5 A;  2I1K A;  1AJY A;  3L70 E;  2K37 A;  2KLV A;  5KKZ B;  2O1J A;  2YKO A;  3OA7 A;  2IBZ I;  2N1T C;  1OVV A;  2C0X A;  1FJP A;  1RY3 A;  1LP1 B;  1PPJ E;  5KAF H;  2OYI B;  2Q3I A;  2AEF A;  3E1R A;  2N1T B;  3OJA B;  1S3J A;  3WMM 0;  1FZF A;  3SFD C;  3CL3 D;  2ZVO B;  1H88 A;  1A02 J;  3F89 A;  3GHG C;  3D6Z A;  1U7M A;  5E79 H;  2E74 C;  4RJT A;  3B4S A;  2YXR B;  5GTI H;  4PV1 C;  4L73 A;  3GHG B;  2OQQ A;  1Q2N A;  1HVV A;  1KIL C;  1PGJ A;  5M1B A;  2FYU G;  2ZT9 D;  5TIS E;  4GOD A;  3L35 A;  1BGY G;  1GL2 D;  1QLE D;  1IJD B;  3Q5R A;  1KIL B;  1NU1 G;  4UB8 E;  2JKV A;  2YKQ A;  1DD3 A;  2OTK E;  1S72 P;  1X9V A;  5B66 E;  3C1L A;  1BGY E;  1FDM A;  2M3B A;  4WB4 A;  2PP6 A;  2QJY C;  2IBZ G;  1ZME C;  1GW4 A;  3II6 A;  4ZKU A;  1FZC B;  2H7H A;  2E76 C;  3CLQ A;  3L73 J;  2QJY B;  3D70 A;  2Q5U A;  1BDD A;  5AW2 B;  4TLF A;  2E76 B;  2H43 A;  1P84 E;  3CCR P;  4BRY A;  4LLH A;  1SQV G;  2BCC G;  1VPC A;  4I7Z B;  3AE5 C;  1USE A;  3CWB J;  1N73 A;  4B86 A;  1Q81 Q;  3EQ2 A;  4YPC A;  4DCK A;  4JYB A;  2FFD C;  2ZFC A;  3HD7 A;  5B66 H;  1SQX K;  2IX7 C;  1RHZ B;  1VDF A;  3V6I A;  2WIT A;  2B89 A;  2M3E A;  4OWF A;  1PGO A;  1SQQ G;  2HR3 A;  4TT3 H;  2FFD B;  5APS A;  2WT7 B;  2HOD A;  2ZYA A;  3MUD C;  4GKG A;  3VMY A;  1Y9B A;  5APQ A;  5APV A;  3HD7 D;  1JEK A;  2NPS B;  2P58 A;  2KSE A;  2C9L Y;  4UB6 E;  2WVR A;  4ASV A;  2HPC A;  1P84 H;  2JR8 A;  5APW A;  1YQ4 C;  5AVX B;  2J5U A;  2W90 A;  1SQB J;  1PV3 A;  2R5B A;  1YYC A;  2GUS A;  3FXE A;  1NTK E;  3V2N A;  3GW6 A;  3CC7 P;  2QRX A;  2OGU A;  3Q3D A;  3AEE C;  5AVZ B;  3RK3 E;  1LJ2 A;  1S5L H;  1DX7 A;  3CI9 A;  3MZW B;  2RH0 A;  2GUV A;  3U1A A;  4OH8 B;  1LTJ A;  3H1H G;  3Q1M A;  3MTU E;  5KJ7 C;  3A3Y B; 
#chains in the Genus database with same CATH homology
 1NO4 A;  2QM8 A;  1SFC A;  5AW6 B;  3M0D C;  2L5G B;  2XU6 A;  3B5N B;  4JYC A;  1RF1 C;  2WPR A;  1M1J C;  1J1D C;  1L4A B;  3HE4 B;  1KQL A;  3M9B A;  1GDT A;  1CI6 B;  1RE4 A;  4AYC A;  1FJK A;  5CCH D;  5APU A;  3B5N A;  2OYH C;  3HE4 A;  1L4A A;  3A7O A;  1S9K D;  5AVW B;  1RF1 B;  5AVQ B;  1JY3 O;  3RK2 D;  1JY3 N;  2J59 M;  4AUW A;  4C7R A;  3VP8 A;  3BAS A;  2OYH B;  2LKM A;  1CSB A;  4KHX A;  5CJ4 A;  4XE5 B;  2IPP A;  4N78 D;  1JMM A;  4I6M C;  1MUU A;  2WZ7 A;  3B5N D;  1S9K E;  2P7J A;  3U59 A;  1KFM A;  1URQ B;  2POH A;  3H32 B;  1GW3 A;  5KJ7 D;  1L4A D;  5CJ0 A;  2E43 A;  2XKM A;  1GU4 A;  1L0N K;  1JOC A;  3H32 A;  1URQ A;  3VP9 A;  2PAJ A;  1RE3 C;  3BVH A;  2CPB A;  3VMZ A;  4N78 E;  2QM7 A;  4WY4 B;  3VYI A;  1T2K C;  2P67 A;  1NH4 A;  1NKN A;  4IFM A;  2OYI C;  2N9B A;  3V2P A;  1X8Y A;  1HH0 A;  4WY4 A;  3PP5 A;  2H8P D;  2FFD A;  2C9N Y;  2WT7 A;  5APY A;  4C7N A;  1M7L A;  3IFM A;  1URQ D;  3T97 A;  2WWW A;  3HE5 B;  2YMY A;  1RE3 A;  1G2C A;  2KB7 P;  1L0L K;  1LWU C;  1FZG A;  1IFJ A;  1FBM A;  1SLQ A;  1JCC A;  2WSE H;  2C0W A;  4IFF A;  3MUD A;  2O1K A;  3HTK B;  4WY4 D;  1LWU B;  5AW0 B;  3C9I A;  1N7S C;  5CMZ A;  5AW5 B;  3HTK A;  1HBW A;  2P1J A;  1IK9 A;  2YO3 A;  4JF7 A;  1RF0 A;  4WBA A;  2M8R A;  1X79 B;  5AW7 B;  2KYV A;  3P7K A;  4GIF A;  2O01 H;  5AVT B;  5AW9 B;  1HTL C;  1XTC C;  3NXS A;  3KPE A;  1NTK K;  3I5C A;  1QL2 A;  1QL1 A;  1IFD A;  1SQP K;  4EOT A;  1JNM A;  4GT1 A;  1DH3 A;  2W6B A;  2Q9I A;  2I1J A;  2JEE A;  2HFE D;  3M0A A;  1HJB A;  1OXZ A;  2FYZ A;  5AVS B;  2YNY A;  2Z4E A;  1GK4 A;  4N6J A;  5APX A;  5AW4 B;  2A45 G;  3VTP C;  1G1I A;  2XDJ A;  2YKP A;  4W7Y A;  5BU8 B;  1FZC C;  3G3Z A;  1LGH B;  1JCD A;  2R5D A;  4XA4 A;  1NTM K;  4DOJ A;  5CHX A;  3VOP A;  1LTA C;  1MFZ A;  5KJ7 A;  1NKZ B;  1FAV A;  1CI6 A;  3NTN A;  1LTG C;  3M0D A;  2WSF H;  4M3L A;  1M1J B;  1J1D B;  1NTZ K;  2JJL A;  1AFO A;  4W80 A;  1IFM A;  1JTH B;  1WT6 A;  1RF1 A;  3B8E B;  1M1J A;  3LW5 H;  4HH2 A;  2WPS A;  2FXM A;  1N73 C;  5APT A;  1Z56 A;  2OYH A;  3N7N A;  3SWF A;  1SQB K;  1GK6 A;  4IFD K;  5AW8 B;  1J1E C;  4RES B;  1J2J B;  3HD7 C;  1NAF A;  3V2Q A;  3U1C A;  1NWQ A;  3E1I A;  4I1L A;  3TYY A;  2A45 I;  3OAK A;  1GU5 A;  2I1K A;  4AQR D;  1ZV8 A;  2KLV A;  2YKO A;  2O1J A;  2FKW B;  3OA7 A;  2N1T C;  1IFI A;  2C0X A;  1FJP A;  1RY3 A;  1YTZ T;  3NFQ A;  3M06 A;  4W7Z A;  1HUC A;  1FU1 A;  5AVR B;  2OYI B;  2Q3I A;  5AW3 B;  1HWT C;  3OJA B;  2N1T B;  1FZA A;  2NPS C;  1LT9 C;  3HE5 A;  1GL2 C;  3WMM 0;  2OYI A;  3H6P A;  1FZF A;  1WRG A;  2A45 H;  2MJZ A;  1CW5 A;  2HPC B;  3CL3 D;  3L4F A;  1T3U A;  3NMD A;  3TSI A;  1LTI C;  2BAS A;  1SQV K;  1H88 A;  1LT9 B;  1A02 J;  5AW1 B;  1GL2 B;  2R32 A;  1W2E A;  3GHG C;  1GD2 E;  3MIW A;  3RL0 C;  4HYT B;  1LWU A;  1T2K D;  4EIJ A;  2WPQ A;  1A02 F;  1MV8 A;  1N7S B;  2KSJ A;  2N1T D;  3EFG A;  3TK1 A;  3GHG B;  2VRS A;  3HUS C;  3O8Z A;  3RL0 B;  1AQ5 A;  2XNX A;  1HVV A;  1LTJ C;  1N7S A;  1KIL C;  4Y99 C;  3GHG A;  2R3C A;  5CCH C;  2Z5H A;  2Z5I A;  3HUS B;  1EQ7 A;  1E5W A;  3L35 A;  1SFC C;  1GL2 D;  3BAT A;  1IJD B;  5AVU B;  1HGV A;  3MD0 A;  4DZO A;  1LTB C;  1KIL B;  2E42 A;  3BRT B;  2YKQ A;  3L36 A;  3V2R A;  1JY2 O;  1JY2 N;  1N7S D;  2HYN A;  1X9V A;  1KIL A;  3BRV B;  3R2P A;  1RE4 C;  3V4W A;  3RL0 D;  1DEB A;  2YO2 A;  5KTB A;  1FDM A;  5BU5 A;  2M3B A;  2WSC H;  1PFI A;  4WB4 A;  1L4A C;  2XV5 A;  2CPS A;  2PP6 A;  4I2L C;  1GW4 A;  3II6 A;  3VN0 A;  4ZKU A;  5AVV B;  1FZC B;  2H7H A;  2HG5 D;  4ZKP A;  3L37 A;  2OAR A;  3N4X A;  2W27 A;  3CLQ A;  1NOH A;  5KLV K;  1KIL D;  1FZC A;  1KZU B;  3LID A;  3M9H A;  2Q5U A;  1YTZ I;  1JTH A;  5AW2 B;  3A5T A;  1T8Z A;  3P8C D;  2FYU K;  1SFC D;  2HLO A;  1FZE A;  2H43 A;  4LLH A;  1NU1 K;  2KOG A;  1URQ C;  2IFN A;  1VPC A;  1N73 B;  2GM4 A;  1FOS F;  1JY2 P;  2IFM A;  3V4Q A;  1J1E B;  1SVF A;  3P8C E;  3HD7 B;  1N73 A;  1ZLL A;  4B86 A;  4LC1 A;  3EQ2 A;  3RK3 C;  4WY4 C;  1T3J A;  4JYB A;  2FFD C;  2ZFC A;  3HD7 A;  1SQX K;  2IX7 C;  1VDF A;  3P8M C;  2WIT A;  2HOD B;  5BVZ A;  3RK3 B;  1IO4 A;  1N86 A;  2FFD B;  5APS A;  2WT7 B;  4C7N B;  1CZQ A;  2HOD A;  1MZ9 A;  1KFN A;  3M91 A;  4GKG A;  4C46 A;  1GZL A;  3VMY A;  2N1T A;  1G2C B;  5APQ A;  5APV A;  3HD7 D;  3KDP B;  1JY3 P;  2NPS B;  2ZXE B;  3IR9 A;  3LIE A;  3SWY A;  2WTY A;  2C9L Y;  3P32 A;  4N3Y B;  5CCG C;  2HPC A;  1FZB A;  1FOS E;  4LGD E;  2KP8 A;  1JUN A;  3HRN A;  2NPS A;  1SP4 A;  3KYQ A;  1RF0 C;  5APW A;  1LT9 A;  5AVX B;  1GL2 A;  1OWA A;  3MGN A;  2R5B A;  3RK3 D;  3A2A A;  1H89 A;  1YYC A;  1LTT C;  3TNU B;  1JO5 A;  2GUS A;  3V2N A;  1ZR2 A;  2Q7C A;  5CCG A;  3VMX A;  1IC2 A;  1HGZ A;  3TNU A;  1SQQ K;  1H8A A;  1NHL A;  3KQG A;  2NPS D;  5AVZ B;  1LTS C;  2W6A A;  2J58 A;  1DX7 A;  1GTW A;  1LTJ B;  4O9B A;  3RK2 C;  1ZN5 A;  3CI9 A;  4Y99 B;  3UIA A;  1ZR4 A;  3HUS A;  3M9Q A;  3V5B A;  2GUV A;  1G1J A;  2P2U A;  1N7L A;  1XTG B;  3U1A A;  4OH8 B;  2XZR A;  1LTJ A;  1N2D C;  1SFC B;  5CCG D;  5CCH A;  3RK2 B;  3B5N C;  1IFN A;  3MTU E;  5KJ7 C;  3A3Y B;  5AVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...