1LTIC

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
total genus 13
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1996-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltiC00
1XTCC 1LTSC 1HTLC 1LTIC 1LTTC 1LTBC 1LTAC 1LTGC
chains in the Genus database with same CATH superfamily
1SFCB 1ZW0A 2Y0DA 3L36A 5B66H 1N73C 1JY3P 5KAFH 1A02J 1AQ5A 2QG4A 4IFDK 1N7SC 1EXJA 4H0LB 1GL2A 1GZLA 1KMIZ 1FS0E 1USDA 1YYCA 3H1JE 1Q86Q 1J1DB 2WPVB 2UWJE 2NPSC 1LP1A 1K8AQ 1OVUA 1SQBE 3GHGC 1DEBA 4WBAA 3U1AA 1S2EA 1AV1A 3AE6C 1GL2B 1SQXG 2BASA 1SQQK 2W27A 3G6EP 2O01H 3GF7A 3U59A 3CCRP 3VTPC 1NGMB 1LTJB 1L0NG 1M57D 2FYNB 2O1JA 3M9HA 1KILD 1Y8AA 3FGAD 1KORA 2IFMA 3MD0A 1FZCC 2PAJA 3NMDA 3CC7P 1CSBA 1ZN5A 1W2BO 3OW2O 1EDLA 3EWKA 2HR3A 3FWLA 1SQQJ 3I5CA 3P8CE 5APTA 1EZVD 4YXWH 4TT3H 2XZRA 2HPCB 3VMAA 1DX7A 1EQ7A 5AW1B 2IFNA 3A2AA 1DIPA 3RBXA 1Q90D 5B5EH 1BGYJ 2N9YB 3H1JJ 1T2KD 1P84E 2LXCB 3CCVP 3L70E 3WUTA 1SQQD 1ZLLA 2BEQD 1LTAC 1ZV8A 1S72P 4HJGH 5AW0B 1X0TA 1BCCG 1FJKA 2HPCA 2H7HA 3HD7B 5H2FE 4I7ZB 1LWUB 5BU8B 2YIUC 4U3FJ 4IFFA 3CCQP 1GD2E 3TDKA 1PZQA 3WUUA 2CPBA 1FZCA 2I8DA 3GG2A 3CPWO 2W6AA 2QJPB 3HD7D 5KTBA 1KB9H 3EFGA 5BVZA 3B8EB 3MUDA 1S5LX 4C7NA 2PGDA 3IFMA 1P84I 1IFNA 1YTZT 3L75D 2IBZI 5KAIE 5KLVJ 3CMEP 1GU5A 3CX5I 4YPCA 2RKLA 1VPCA 2M0BA 3NFQA 3N7NA 3C8VA 2JKVA 1JMMA 3SWKA 4ASVA 2YO3A 2Z5HA 3H1HE 1OW6A 1MFTA 1YIJP 1GTWA 5KLVG 1PGPA 4U7JA 3L73D 2IPPA 2IYOA 4PV1B 4UB6E 1T8ZA 2KK7A 5B66E 2FYUD 5KLIC 2C0WA 3CMAP 3KPEA 2JEEA 1VF5B 3AEEC 1KFNA 1KV4A 3A0HE 1KILB 1H0TB 4HYTB 5KLVE 1SFCA 4OGQC 4WVZA 1PP9E 2E74D 2Y0EA 2IBZE 4KT0J 3RGUA 3RK3D 1KB9I 4I1LA 2OYHA 4PJ0E 4GODA 3PP5A 2FYUJ 3BCCG 4NPFX 1P84H 4LC1A 4PJ0H 3SSUA 2HYNA 5DJUB 1L0LD 3RK2C 3CX5H 3HE5A 3L4FA 1Y47A 2L5GB 3V2PA 2J58A 3CCJP 5AW2B 3H1HD 2YO2A 2WZ7A 2ZJSE 4N78D 3WU2H 1NKZB 2BCCE 1GU4A 4CPGA 2P1JA 2KS1A 2N1TC 3AEBC 1NTMG 2AXTH 1M1JB 3L74D 1EZVI 2WSSH 1T6AA 1SFCD 3L75E 2AXTE 2M5AB 3K5BA 4W7ZA 4GIFA 1OW8A 3BRVB 1W2EA 3RK2D 1FZGA 1M1JC 2AEMA 5KAIH 3L72J 1G2CA 2IX7C 3P8MC 5APXA 1S9KE 1D7MA 2Q7CA 4PD4D 2KYVA 2ZYDA 3CI9A 1KQFB 1RH5B 3KHUA 1PP9J 1SQXJ 3TF5A 1VQNP 1FBMA 4OGQD 3KYQA 3AEAC 4OVNF 1KYOE 1G2CB 1SQBK 2GA1A 2E5TA 1LT1A 5L8RJ 2J5UA 1MFZA 3A0HH 3LW5H 1NU1J 3A3YB 3AE4C 1SQQG 3TYYA 1SP4A 1KILC 3TGUD 1RE3C 1EZVE 1GK4A 1ZOYC 1FZBA 3IAOA 1VDFA 2R44A 3H1ID 1H88A 2YKQA 3D71A 5KLIB 2L91A 2PFXA 4D6TG 1SQPD 1T3JA 3R4YA 4WY4D 3CXHD 4XE5B 5KJ7A 4OGQB 4YTPC 3W68A 2WQYC 2B87B 4N78E 2FYUK 4WY4B 4ZKUA 5BU5A 1M90Q 2HLOA 2C9NY 4W7YA 1PPJE 2GUSA 3VOPA 1KTMA 1IFIA 4L73A 2WT7B 4JQ0D 1L0ND 1DD4A 3MTUE 1GW3A 5KJ7D 2OYIA 1E5WA 1NWQA 1SQVK 4ASWA 2A06D 5CBOA 1K04A 2QVAA 2YXRB 3H1JG 2IBZG 1YQ4C 2HG5D 3H1LG 1LNQA 3H6PA 4LLHA 4WB4A 1M1KQ 1RF1B 2FYUE 2OTJP 3B4SA 2QJPC 1SQXK 5B5EE 1PL5A 4C46A 1M7LA 1BDDA 2C0XA 1OWAA 3JSVC 1JY3O 1DEEG 3H1LE 4BXLA 3BCCD 2E76C 1RF1A 2QM8A 2NPSB 4Y99B 3AE1C 3RK3B 1L0LG 1T3UA 2LKMA 4IL6X 3GF3A 4TLFA 1X79B 3WUVA 3AE5C 3PLNA 4JBZA 1HWTC 1M1JA 5TISE 2JP3A 2YNYA 5APQA 4NPEA 1X9VA 4H44B 1L4AA 1MUUA 1LT9B 2FXPA 3AE7C 3B5NC 1SQXE 5AVYB 1RF1C 4RJTA 1VQ9P 1YTZI 3NTNA 4DOJA 3CCMP 1URQB 3Q3DA 1YITP 1URQD 5AW9B 1K73Q 1VQPP 3PRJA 3M0DA 1OVRA 3L70D 3MGNA 1FZCB 3CX5E 3SFEC 3FXDA 2FYNC 2XV5A 1YJWP 3L37A 4DZOA 5KAFE 3E1RA 4XA4A 1GDTA 1AFOA 3PTZA 2FYUG 3BCCJ 2BCCJ 4BWNA 5AVTB 3AEGC 3CWBE 1L4AC 2E75B 2POHA 1RY3A 2AXCA 3GLMA 3RBZA 1R8EA 4EYYQ 3R2PA 4UB8E 1PP9G 5AVXB 1YHQP 1KILE 2WPQA 1YJNP 2E75C 3UIAA 2P2UA 2C9LY 5CJ0A 3H1KE 2WTYA 2KB7P 1YBKA 1PGQA 1YQ3C 3L73E 4JYBA 3Q5SA 3A0BE 1FZFA 2OYHB 4AUWA 2YMYA 1NTZD 4Y99C 1H89A 3I55P 1AVOA 4M3LA 2N1TD 1KN7A 1M8OB 2Y9YA 4Z1MH 3L72G 2A45I 2KXPB 2QM7A 1JMBA 3IR9A 3JCUH 3T97A 3TGUJ 1NTME 5CCGC 1ZRTD 3JCUE 1IFMA 1Z56A 1RQVA 4BRYB 1SS1A 5E79E 3RK2B 1PGJA 2YXQB 3MP7B 1LJ2A 3T97B 4EOTA 5AW4B 4AQRD 1IO4A 2A06G 2CPSA 2ZT9D 3W67A 4HKZH 2OTLP 1L0NJ 1NKNA 2KZIA 1G1JA 1N7LA 2ZYAA 4K3AA 1UIXA 2KOGA 2N9BA 2VRSA 1BCCE 1BE3J 3MHVA 2H8PD 1LTTC 1P84D 3RL0B 1BGYD 2D2CB 3V2NA 4U3FE 2HFED 2JJLA 3VMYA 1Q7YQ 4JYCA 2E5YA 3V5BA 2A45H 2HODB 2Z5IA 1JY2N 1IFPA 2V7QH 1BE3G 3C1LA 3F89A 3H1IG 1KFMA 1KZUB 2KNCA 1QVFO 2N1TA 1AVYA 3V6IA 4U3FD 2QJYB 2ZXXA 1LTGC 1BGYE 1SQVE 2ZAEB 3M9BA 4H13B 1XTCC 2YKOA 1BCCD 1KB9E 3G4SP 1GL2D 3HD7C 4ZKPA 2WSFH 3A7OA 3VMXA 4PV1D 4H44C 2P10A 4Y28J 2Q9IA 2Q5UA 3CLQA 2FYZA 1U7MA 3S1KA 1DH3A 4RESB 2MJZA 2ZXEB 4H13D 2I1KA 2FY8A 1J1EC 1SVFA 4PD4H 1E79H 2B9BA 2KI7B 1FU1A 2M3BA 1W5CE 3H1LJ 1JOCA 2OQQA 1GL2C 4I2LC 3H1JD 4LGDE 3L75G 5CJ4A 2WVRA 1N7SA 4HB1A 3D70A 2O01J 2WMMA 4HH2A 4H44D 2XNXA 3S9OA 4D6TE 2E75D 2P67A 2Y0CA 1HUCA 1QL2A 3FXEA 3H32B 3NXSA 4GKGA 4KJMA 3PJSK 5CCHD 1N73A 1VQLP 1CI6B 3H1LD 1VF5D 3HE5B 3KZIH 1KD1Q 3CWBJ 3H1KD 3AE2C 1N73B 1NHLA 2ZVNB 2OYIB 2KS1B 1IZNB 2G8YA 2SPZA 2RN0A 1J1DC 3M0DC 4PD4I 1VQ5P 3ZDMA 2A06E 3LW5J 4A7PA 2LR2A 2MKVA 3CWBD 1QGKB 5APYA 4RO0A 1NTKE 3II6A 3M91A 2OTKE 5APUA 1PIXA 3M06A 2M8RA 3RL0D 1VQOP 1OX3A 2D2CC 3KQGA 2H43A 2WPRA 5GTHE 2WSCJ 5AVRB 1LTSC 3HTKB 3BRTB 3KDPB 2O01N 2K9YA 3CXHE 1JO5A 4RKUJ 3AEDC 4EI2A 2WITA 4QMAA 1NTMJ 1UIIA 3RL0g 5CCHA 3E7KA 5KJ7C 1Y9BA 3A0BH 1VQ6P 5H2FH 1ZP0C 4C7NB 4I6MC 1VQ8P 2K9JB 4PV1C 5GTIE 3AEFC 3H25A 4GOFA 4R4LA 1JCDA 1URQA 1L2PA 2I1JA 1PGOA 3L71E 3M9QA 1OW7A 3HD7A 3BASA 2FKWB 1NTMK 1OMIA 2B88A 3OAKA 4GDOA 3VN0A 3Q5RA 3F5HA 3M0AA 3V2RA 2XU6A 3Q2YA 1BE3D 2JDIH 1NH4A 3HE4A 2FFDC 3GHGA 2WPSA 1G1IA 2E74C 3HUSC 4YXDC 3U1CA 4DCKA 1U57A 4PD4E 4GOEA 3TGUG 2RH0A 4C7RA 1KQLA 1NU1G 1NTZG 3L72D 3H1IJ 4R4MA 3SFDC 2PRRA 3OJAB 4D6TD 1NU1K 1OXZA 2WSEJ 4JF7A 1IJDB 2JR8A 5TISH 1S1CX 1NTZJ 2KZJA 1NVOA 3KXDA 4NPDA 4N3YB 3B5ND 1NTKD 3L74E 1L0NE 2NPSD 5GTHH 3CC2P 1JCCA 5TJHA 1PPJD 1WT6A 5APWA 2JWAA 3CCEP 5AVUB 3D6ZA 2IZ1A 1KILA 1SQBG 1TU3F 3JC22 2W8ZA 1LTIC 2WT7A 1H0TA 1Q81Q 2QIWA 1IK9A 3V4QA 1BGYG 1S5LE 3B71A 1YJ9P 1NU1E 3L71G 1LWUC 3V4WA 1SQPE 1SQVD 3TGUE 2IBZD 1JTHA 1SQPJ 1HTLC 1LT9C 3G9RA 2K88A 2NPSA 3RK3E 3VMZA 3B5NA 1FC2C 2E76D 3H1KG 4IOIH 4ZNCA 1HGVA 2W90A 1NYHA 5CCHC 4U3FG 3CCUP 1QLED 1JY2P 2CK3H 2W83C 3L73J 4N6JA 4UB8H 1T2KC 1IC2A 3H1KJ 1L4AD 4I7ZC 3CWBG 5APVA 2E76B 3TK1A 2M3EA 1IK7A 1MV8A 2JO1A 3VP8A 1SQPK 1S5LH 4L76A 4OWFA 1LWUA 1FZEA 1JY2O 2Q3IA 1ZR4A 1S9KD 2FFDB 1RE3A 5CMZA 2YIUB 3TSIA 2K37A 1VL2A 1PV3A 1CZQA 1S3JA 1EDIA 2OARA 1JM0A 1N2DC 1XTGB 3EQ2A 1HJBA 1QVGO 2XDJA 3P7KA 4IL6H 3D6YA 2B87A 2D2CD 2QE7H 1CW5A 1BSNA 1FDMA 1AJYA 1NTKK 3L70G 2W6JH 1JUNA 1WMKA 2BCCD 3N4XA 1LTBC 1FOSE 2Q1KA 1OIPA 1N7SB 2GUVA 2K1AA 1X22A 3EFFK 2KSEA 3HUSB 3KZIE 3WU2E 1KC8Q 1FOSF 1R5SA 1AQTA 1RF0A 5CBNA 5KKZC 2IDBA 2J59M 2YMKA 4WWIA 3P8CD 3AE9C 3IF4A 2XNDH 2YKPA 4L75A 2O3JA 1KQGB 1PP9D 1PFIA 5KKZB 2R5BA 5GTIH 1N8RQ 5M1BA 1HVVA 3V2QA 1LP1B 2FXOA 4K35A 5AVVB 3VYIA 1JB0J 1QEXA 1NTMD 2PP6A 1RE4C 1ZXGA 3L74G 3BVHA 5E79H 2ZFCA 2ZVOB 1NAYA 3O6QB 2DW3A 5AVZB 2GM4A 1GMJA 4ZMDA 4H0LC 3GW6A 3L74J 2ITAA 3BATA 2BEZF 1RHZB 1NTZE 3PH0A 2OYHC 3O6QA 3LIEA 2FBWC 1SFCC 1PPJG 2JWDA 3GMAA 2AEFA 3S4RA 1SQXD 1U7JA 2WSEH 4MN4C 1HGZA 1IFDA 3B5NB 3HTKA 1FZAA 5CHXA 1AA0A 1JTHB 2FXMA 3CCLP 3L71D 1QL1A 2WSCH 5AW8B 3G71P 2KNCB 2N1TB 3I56P 1VF5C 1NAFA 3PHLA 3RK3C 1MKMA 1L0NK 3CL3D 1KYOD 1EC5A 1EZVG 2R5DA 1HF9A 4D6TJ 1SQQE 2KLUA 5AW5B 4EDFA 3L71J 3Q1MA 1NU1D 1IFJA 2W6BA 2QJKC 1JEKA 1ZR2A 1SQPG 2WWWA 3Q5PA 5AVWB 2KP8A 3FWNA 1VQMP 1URQC 2Z4EA 2H88C 1K9MQ 2ZT9C 3TNUA 1BSHA 4H13C 2OYIC 2E42A 3SWFA 1VQ7P 3CD6P 2IYPA 2KLVA 2KIKA 1SQBJ 4H0LD 4OH8B 5AW3B 1CI6A 1OVVA 3USSA 3VP9A 1NTKG 2XKMA 1NJIQ 1ZRTE 3O8ZA 2G3AA 1N86A 4IL6E 3H32A 1RF0C 1SQVJ 1SLQA 3TNUB 4DT0A 1USEA 1NO4A 2KUBA 3RL0C 5APSA 1HBWA 4WY4C 3L72E 1NTKJ 3BCCE 4B86A 1SQBD 1EDKA 5AVQB 1EDJA 1LTJA 1SQVG 3HUSA 2R3CA 3QWOC 4W80A 4DJGA 2R32A 1YI2P 1KYOH 1J1EB 3L75J 5KLVD 1BCCJ 1BE3E 3L73G 5AVSB 3H1IE 2P7JA 1Q82Q 5AW6B 1A02F 4L74A 1L0LJ 2A45G 1K05A 3L35A 5CCGA 1X8YA 2WSFJ 3AECC 3ABVC 3FX0A 1WRGA 3L70J 2R3SA 3MIWA 1BDCA 1R5LA 5EFWB 4GT1A 4KHXA 1J2JB 3QH9A 5C39A 3AE8C 2E43A 1FJPA 1FDOA 2QJYC 2M5AA 1HH0A 1OFCX 1H8AA 1RQUA 1LTJC 2O1KA 2OGUA 4BRYA 3CCSP 3WMM0 2K3RA 3OA7A 2B89A 3ITKA 2HODA 3AE3C 3CX5D 5CCGD 1FDIA 1NOHA 2QRXA 1QX8A 1VQKP 3CC4P 3CXHH 2AEJA 2K9JA 1L0LK 3H1HG 2ZT9B 2KSJA 2V4HA 3E1IA 1KYOI 3HRNA 1KB9D 2QSIA 3G3ZA 4O9BA 2RMZA 5KLVK 3MZWB 1JNMA 1OZHA 2Y9ZA 1S4XA 3IN6A 3SWYA 3P32A 4EIJA 1L4AB 2Q3EA 2QJKB 1LT9A 1M56D 2Q6QA 1GK6A 3H1HJ 4IFMA 1KQSO 2E74B 1FAVA 3C9IA 2BCCG 2FFDA 1ZMEC 2P58A 1HJ0A 1MZ9A 5K5GB 2NZ2A 5AW7B 1DD3A 2IZ0A 3MUDC 1Q2NA 2QEXP 1RE4A 2H89C 4XFJA 1EXIA 1FE6A 1N7SD 2LXBA 3A5TA 2NRGA 3HE4B 1L0LE 3GHGB 1LGHB 3LIDA 4UB6H 5DJTB 4JPZB 1JY3N 1VQ4P 2V7QJ 3CXHI 2QA4P 1NTZK 4AYCA 2OYOA 1GW4A 4WY4A 2ZYGA
chains in the Genus database with same CATH topology
1SFCB 3L36A 1N73C 1AQ5A 1JY3P 1A02J 4IFDK 1N7SC 1GL2A 1GZLA 1YYCA 1J1DB 2NPSC 4WBAA 3GHGC 1DEBA 3U1AA 1GL2B 2BASA 1SQQK 2W27A 2O01H 3U59A 3VTPC 1LTJB 2O1JA 3M9HA 1KILD 2IFMA 3MD0A 1FZCC 2PAJA 3NMDA 1CSBA 1ZN5A 3I5CA 3P8CE 1DX7A 2XZRA 2HPCB 1EQ7A 5AW1B 2IFNA 3A2AA 1T2KD 1ZLLA 1LTAC 1ZV8A 5AW0B 1FJKA 2HPCA 2H7HA 3HD7B 1LWUB 5BU8B 4IFFA 1GD2E 1FZCA 2CPBA 2W6AA 5KTBA 3HD7D 3EFGA 5BVZA 3B8EB 3MUDA 4C7NA 3IFMA 1IFNA 1YTZT 1GU5A 1VPCA 3NFQA 3N7NA 1JMMA 2YO3A 2Z5HA 1GTWA 2IPPA 1T8ZA 2C0WA 3KPEA 2JEEA 1KFNA 1KILB 4HYTB 1SFCA 3RK3D 2OYHA 4I1LA 3PP5A 4LC1A 2HYNA 3RK2C 3L4FA 3HE5A 2L5GB 3V2PA 2J58A 5AW2B 2YO2A 2WZ7A 4N78D 1NKZB 1GU4A 2P1JA 2N1TC 2WT7B 1M1JB 4I6MC 4W7ZA 5APTA 5AVTB 1SFCD 4GIFA 3BRVB 1W2EA 3RK2D 1FZGA 1M1JC 1G2CA 2IX7C 3P8MC 5APXA 1S9KE 2Q7CA 2KYVA 3CI9A 1FBMA 3KYQA 1G2CB 1SQBK 1MFZA 3LW5H 3A3YB 3TYYA 1KILC 1SP4A 1RE3C 1H88A 1GK4A 1FZBA 1VDFA 2YKQA 1T3JA 4WY4D 5KJ7A 4XE5B 4N78E 2FYUK 4WY4B 4ZKUA 5BU5A 2C9NY 2HLOA 4W7YA 2GUSA 3VOPA 1IFIA 3MTUE 1GW3A 5KJ7D 2OYIA 1E5WA 1NWQA 1SQVK 4LLHA 2HG5D 4WB4A 3H6PA 1RF1B 1SQXK 4C46A 1M7LA 2C0XA 1OWAA 1JY3O 1RF1A 2QM8A 2NPSB 3RK3B 2LKMA 1T3UA 1X79B 1HWTC 1M1JA 2YNYA 5APQA 1X9VA 1L4AA 1MUUA 1LT9B 5AVYB 1RF1C 3B5NC 1YTZI 3NTNA 4DOJA 1URQB 1URQD 5AW9B 3M0DA 1FZCB 3MGNA 2XV5A 3L37A 4DZOA 4XA4A 1AFOA 1L4AC 2POHA 1RY3A 3R2PA 5AVXB 2WPQA 2C9LY 3UIAA 2P2UA 5CJ0A 2WTYA 2KB7P 4AUWA 4JYBA 1FZFA 2OYHB 2YMYA 4Y99C 1H89A 4M3LA 2N1TD 2A45I 2QM7A 3IR9A 3T97A 5CCGC 1IFMA 1Z56A 3RK2B 4EOTA 5AW4B 4AQRD 1IO4A 2CPSA 1NKNA 1G1JA 1N7LA 2N9BA 2KOGA 2VRSA 3V2NA 2H8PD 1LTTC 3RL0B 2HFED 2JJLA 3VMYA 4JYCA 3V5BA 2A45H 2HODB 2Z5IA 1JY2N 1KFMA 1KZUB 2N1TA 3M9BA 1LTGC 1XTCC 2YKOA 1GL2D 3HD7C 4ZKPA 2WSFH 3A7OA 3VMXA 2Q9IA 2Q5UA 3CLQA 2FYZA 1DH3A 4RESB 2MJZA 2ZXEB 2I1KA 1J1EC 1SVFA 1FU1A 2M3BA 1JOCA 4LGDE 1GL2C 4I2LC 5CJ4A 1N7SA 1FDMA 4HH2A 2XNXA 2P67A 3H32B 1HUCA 1QL2A 3NXSA 4GKGA 1N73A 5CCHD 1CI6B 3HE5B 1N73B 2OYIB 1NHLA 1J1DC 3M0DC 5APYA 3II6A 3M91A 5APUA 3M06A 2M8RA 3RL0D 3KQGA 2H43A 2WPRA 5AVRB 1LTSC 3HTKB 3BRTB 3KDPB 1JO5A 5CCHA 2WITA 5KJ7C 4C7NB 1JCDA 1URQA 2I1JA 3M9QA 3HD7A 3BASA 2FKWB 1NTMK 3OAKA 3VN0A 3M0AA 3V2RA 2XU6A 1NH4A 3HE4A 2FFDC 3GHGA 2WPSA 1G1IA 3HUSC 3U1CA 4C7RA 1KQLA 3OJAB 1NU1K 1OXZA 4JF7A 1IJDB 4N3YB 3B5ND 2NPSD 1JCCA 1WT6A 5APWA 5AVUB 1KILA 2WT7A 1LTIC 1IK9A 3V4QA 1LWUC 3V4WA 1JTHA 3VMZA 1HTLC 1LT9C 2NPSA 3B5NA 1HGVA 5CCHC 1JY2P 4N6JA 1T2KC 1IC2A 1L4AD 5APVA 3TK1A 1MV8A 3VP8A 1SQPK 1LWUA 1FZEA 1JY2O 2Q3IA 1ZR4A 1S9KD 2FFDB 1RE3A 5CMZA 3TSIA 1CZQA 2OARA 1N2DC 3EQ2A 1XTGB 1HJBA 2XDJA 3P7KA 1CW5A 1NTKK 1JUNA 3N4XA 1FOSE 1LTBC 1N7SB 2GUVA 3HUSB 1FOSF 1RF0A 2J59M 3P8CD 2YKPA 1PFIA 2R5BA 1HVVA 3V2QA 3VYIA 5AVVB 2PP6A 1RE4C 3BVHA 2ZFCA 5AVZB 2GM4A 3BATA 2OYHC 3LIEA 1SFCC 2WSEH 1HGZA 1IFDA 3HTKA 3B5NB 1FZAA 5CHXA 1JTHB 2FXMA 1QL1A 2WSCH 5AW8B 2N1TB 1NAFA 3RK3C 1L0NK 3CL3D 2R5DA 5AW5B 1ZR2A 2W6BA 1IFJA 2WWWA 5AVWB 2KP8A 2Z4EA 1URQC 3TNUA 2OYIC 2E42A 3SWFA 2KLVA 5AW3B 4OH8B 1CI6A 3VP9A 2XKMA 3O8ZA 1N86A 3TNUB 3H32A 1RF0C 1SLQA 1NO4A 3RL0C 5APSA 1HBWA 4WY4C 4B86A 5AVQB 1LTJA 3HUSA 2R3CA 4W80A 2R32A 1J1EB 5AVSB 2P7JA 5AW6B 1A02F 2A45G 3L35A 5CCGA 1X8YA 1WRGA 3MIWA 4GT1A 4KHXA 1J2JB 1FJPA 2E43A 1HH0A 1H8AA 1LTJC 2O1KA 3WMM0 3OA7A 2HODA 5CCGD 1NOHA 1L0LK 3HRNA 2KSJA 3E1IA 4O9BA 3G3ZA 1JNMA 5KLVK 3SWYA 3P32A 4EIJA 1L4AB 1GDTA 1LT9A 1GK6A 4IFMA 2FFDA 1FAVA 3C9IA 1MZ9A 5AW7B 1RE4A 3A5TA 1N7SD 3HE4B 3GHGB 1LGHB 3LIDA 1JY3N 1NTZK 4AYCA 1GW4A 4WY4A 4Y99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTC C;  1LTS C;  1HTL C;  1LTI C;  1LTT C;  1LTB C;  1LTA C;  1LTG C; 
#chains in the Genus database with same CATH topology
 1SFC B;  1ZW0 A;  2Y0D A;  3L36 A;  5B66 H;  1N73 C;  1JY3 P;  5KAF H;  1A02 J;  1AQ5 A;  2QG4 A;  4IFD K;  1N7S C;  1EXJ A;  4H0L B;  1GL2 A;  1GZL A;  1KMI Z;  1FS0 E;  1USD A;  1YYC A;  3H1J E;  1Q86 Q;  1J1D B;  2WPV B;  2UWJ E;  2NPS C;  1LP1 A;  1K8A Q;  1OVU A;  1SQB E;  3GHG C;  1DEB A;  4WBA A;  3U1A A;  1S2E A;  1AV1 A;  3AE6 C;  1GL2 B;  1SQX G;  2BAS A;  1SQQ K;  2W27 A;  3G6E P;  2O01 H;  3GF7 A;  3U59 A;  3CCR P;  3VTP C;  1NGM B;  1LTJ B;  1L0N G;  1M57 D;  2FYN B;  2O1J A;  3M9H A;  1KIL D;  1Y8A A;  3FGA D;  1KOR A;  2IFM A;  3MD0 A;  1FZC C;  2PAJ A;  3NMD A;  3CC7 P;  1CSB A;  1ZN5 A;  1W2B O;  3OW2 O;  1EDL A;  3EWK A;  2HR3 A;  3FWL A;  1SQQ J;  3I5C A;  3P8C E;  5APT A;  1EZV D;  4YXW H;  4TT3 H;  2XZR A;  2HPC B;  3VMA A;  1DX7 A;  1EQ7 A;  5AW1 B;  2IFN A;  3A2A A;  1DIP A;  3RBX A;  1Q90 D;  5B5E H;  1BGY J;  2N9Y B;  3H1J J;  1T2K D;  1P84 E;  2LXC B;  3CCV P;  3L70 E;  3WUT A;  1SQQ D;  1ZLL A;  2BEQ D;  1LTA C;  1ZV8 A;  1S72 P;  4HJG H;  5AW0 B;  1X0T A;  1BCC G;  1FJK A;  2HPC A;  2H7H A;  3HD7 B;  5H2F E;  4I7Z B;  1LWU B;  5BU8 B;  2YIU C;  4U3F J;  4IFF A;  3CCQ P;  1GD2 E;  3TDK A;  1PZQ A;  3WUU A;  2CPB A;  1FZC A;  2I8D A;  3GG2 A;  3CPW O;  2W6A A;  2QJP B;  3HD7 D;  5KTB A;  1KB9 H;  3EFG A;  5BVZ A;  3B8E B;  3MUD A;  1S5L X;  4C7N A;  2PGD A;  3IFM A;  1P84 I;  1IFN A;  1YTZ T;  3L75 D;  2IBZ I;  5KAI E;  5KLV J;  3CME P;  1GU5 A;  3CX5 I;  4YPC A;  2RKL A;  1VPC A;  2M0B A;  3NFQ A;  3N7N A;  3C8V A;  2JKV A;  1JMM A;  3SWK A;  4ASV A;  2YO3 A;  2Z5H A;  3H1H E;  1OW6 A;  1MFT A;  1YIJ P;  1GTW A;  5KLV G;  1PGP A;  4U7J A;  3L73 D;  2IPP A;  2IYO A;  4PV1 B;  4UB6 E;  1T8Z A;  2KK7 A;  5B66 E;  2FYU D;  5KLI C;  2C0W A;  3CMA P;  3KPE A;  2JEE A;  1VF5 B;  3AEE C;  1KFN A;  1KV4 A;  3A0H E;  1KIL B;  1H0T B;  4HYT B;  5KLV E;  1SFC A;  4OGQ C;  4WVZ A;  1PP9 E;  2E74 D;  2Y0E A;  2IBZ E;  4KT0 J;  3RGU A;  3RK3 D;  1KB9 I;  4I1L A;  2OYH A;  4PJ0 E;  4GOD A;  3PP5 A;  2FYU J;  3BCC G;  4NPF X;  1P84 H;  4LC1 A;  4PJ0 H;  3SSU A;  2HYN A;  5DJU B;  1L0L D;  3RK2 C;  3CX5 H;  3HE5 A;  3L4F A;  1Y47 A;  2L5G B;  3V2P A;  2J58 A;  3CCJ P;  5AW2 B;  3H1H D;  2YO2 A;  2WZ7 A;  2ZJS E;  4N78 D;  3WU2 H;  1NKZ B;  2BCC E;  1GU4 A;  4CPG A;  2P1J A;  2KS1 A;  2N1T C;  3AEB C;  1NTM G;  2AXT H;  1M1J B;  3L74 D;  1EZV I;  2WSS H;  1T6A A;  1SFC D;  3L75 E;  2AXT E;  2M5A B;  3K5B A;  4W7Z A;  4GIF A;  1OW8 A;  3BRV B;  1W2E A;  3RK2 D;  1FZG A;  1M1J C;  2AEM A;  5KAI H;  3L72 J;  1G2C A;  2IX7 C;  3P8M C;  5APX A;  1S9K E;  1D7M A;  2Q7C A;  4PD4 D;  2KYV A;  2ZYD A;  3CI9 A;  1KQF B;  1RH5 B;  3KHU A;  1PP9 J;  1SQX J;  3TF5 A;  1VQN P;  1FBM A;  4OGQ D;  3KYQ A;  3AEA C;  4OVN F;  1KYO E;  1G2C B;  1SQB K;  2GA1 A;  2E5T A;  1LT1 A;  5L8R J;  2J5U A;  1MFZ A;  3A0H H;  3LW5 H;  1NU1 J;  3A3Y B;  3AE4 C;  1SQQ G;  3TYY A;  1SP4 A;  1KIL C;  3TGU D;  1RE3 C;  1EZV E;  1GK4 A;  1ZOY C;  1FZB A;  3IAO A;  1VDF A;  2R44 A;  3H1I D;  1H88 A;  2YKQ A;  3D71 A;  5KLI B;  2L91 A;  2PFX A;  4D6T G;  1SQP D;  1T3J A;  3R4Y A;  4WY4 D;  3CXH D;  4XE5 B;  5KJ7 A;  4OGQ B;  4YTP C;  3W68 A;  2WQY C;  2B87 B;  4N78 E;  2FYU K;  4WY4 B;  4ZKU A;  5BU5 A;  1M90 Q;  2HLO A;  2C9N Y;  4W7Y A;  1PPJ E;  2GUS A;  3VOP A;  1KTM A;  1IFI A;  4L73 A;  2WT7 B;  4JQ0 D;  1L0N D;  1DD4 A;  3MTU E;  1GW3 A;  5KJ7 D;  2OYI A;  1E5W A;  1NWQ A;  1SQV K;  4ASW A;  2A06 D;  5CBO A;  1K04 A;  2QVA A;  2YXR B;  3H1J G;  2IBZ G;  1YQ4 C;  2HG5 D;  3H1L G;  1LNQ A;  3H6P A;  4LLH A;  4WB4 A;  1M1K Q;  1RF1 B;  2FYU E;  2OTJ P;  3B4S A;  2QJP C;  1SQX K;  5B5E E;  1PL5 A;  4C46 A;  1M7L A;  1BDD A;  2C0X A;  1OWA A;  3JSV C;  1JY3 O;  1DEE G;  3H1L E;  4BXL A;  3BCC D;  2E76 C;  1RF1 A;  2QM8 A;  2NPS B;  4Y99 B;  3AE1 C;  3RK3 B;  1L0L G;  1T3U A;  2LKM A;  4IL6 X;  3GF3 A;  4TLF A;  1X79 B;  3WUV A;  3AE5 C;  3PLN A;  4JBZ A;  1HWT C;  1M1J A;  5TIS E;  2JP3 A;  2YNY A;  5APQ A;  4NPE A;  1X9V A;  4H44 B;  1L4A A;  1MUU A;  1LT9 B;  2FXP A;  3AE7 C;  3B5N C;  1SQX E;  5AVY B;  1RF1 C;  4RJT A;  1VQ9 P;  1YTZ I;  3NTN A;  4DOJ A;  3CCM P;  1URQ B;  3Q3D A;  1YIT P;  1URQ D;  5AW9 B;  1K73 Q;  1VQP P;  3PRJ A;  3M0D A;  1OVR A;  3L70 D;  3MGN A;  1FZC B;  3CX5 E;  3SFE C;  3FXD A;  2FYN C;  2XV5 A;  1YJW P;  3L37 A;  4DZO A;  5KAF E;  3E1R A;  4XA4 A;  1GDT A;  1AFO A;  3PTZ A;  2FYU G;  3BCC J;  2BCC J;  4BWN A;  5AVT B;  3AEG C;  3CWB E;  1L4A C;  2E75 B;  2POH A;  1RY3 A;  2AXC A;  3GLM A;  3RBZ A;  1R8E A;  4EYY Q;  3R2P A;  4UB8 E;  1PP9 G;  5AVX B;  1YHQ P;  1KIL E;  2WPQ A;  1YJN P;  2E75 C;  3UIA A;  2P2U A;  2C9L Y;  5CJ0 A;  3H1K E;  2WTY A;  2KB7 P;  1YBK A;  1PGQ A;  1YQ3 C;  3L73 E;  4JYB A;  3Q5S A;  3A0B E;  1FZF A;  2OYH B;  4AUW A;  2YMY A;  1NTZ D;  4Y99 C;  1H89 A;  3I55 P;  1AVO A;  4M3L A;  2N1T D;  1KN7 A;  1M8O B;  2Y9Y A;  4Z1M H;  3L72 G;  2A45 I;  2KXP B;  2QM7 A;  1JMB A;  3IR9 A;  3JCU H;  3T97 A;  3TGU J;  1NTM E;  5CCG C;  1ZRT D;  3JCU E;  1IFM A;  1Z56 A;  1RQV A;  4BRY B;  1SS1 A;  5E79 E;  3RK2 B;  1PGJ A;  2YXQ B;  3MP7 B;  1LJ2 A;  3T97 B;  4EOT A;  5AW4 B;  4AQR D;  1IO4 A;  2A06 G;  2CPS A;  2ZT9 D;  3W67 A;  4HKZ H;  2OTL P;  1L0N J;  1NKN A;  2KZI A;  1G1J A;  1N7L A;  2ZYA A;  4K3A A;  1UIX A;  2KOG A;  2N9B A;  2VRS A;  1BCC E;  1BE3 J;  3MHV A;  2H8P D;  1LTT C;  1P84 D;  3RL0 B;  1BGY D;  2D2C B;  3V2N A;  4U3F E;  2HFE D;  2JJL A;  3VMY A;  1Q7Y Q;  4JYC A;  2E5Y A;  3V5B A;  2A45 H;  2HOD B;  2Z5I A;  1JY2 N;  1IFP A;  2V7Q H;  1BE3 G;  3C1L A;  3F89 A;  3H1I G;  1KFM A;  1KZU B;  2KNC A;  1QVF O;  2N1T A;  1AVY A;  3V6I A;  4U3F D;  2QJY B;  2ZXX A;  1LTG C;  1BGY E;  1SQV E;  2ZAE B;  3M9B A;  4H13 B;  1XTC C;  2YKO A;  1BCC D;  1KB9 E;  3G4S P;  1GL2 D;  3HD7 C;  4ZKP A;  2WSF H;  3A7O A;  3VMX A;  4PV1 D;  4H44 C;  2P10 A;  4Y28 J;  2Q9I A;  2Q5U A;  3CLQ A;  2FYZ A;  1U7M A;  3S1K A;  1DH3 A;  4RES B;  2MJZ A;  2ZXE B;  4H13 D;  2I1K A;  2FY8 A;  1J1E C;  1SVF A;  4PD4 H;  1E79 H;  2B9B A;  2KI7 B;  1FU1 A;  2M3B A;  1W5C E;  3H1L J;  1JOC A;  2OQQ A;  1GL2 C;  4I2L C;  3H1J D;  4LGD E;  3L75 G;  5CJ4 A;  2WVR A;  1N7S A;  4HB1 A;  3D70 A;  2O01 J;  2WMM A;  4HH2 A;  4H44 D;  2XNX A;  3S9O A;  4D6T E;  2E75 D;  2P67 A;  2Y0C A;  1HUC A;  1QL2 A;  3FXE A;  3H32 B;  3NXS A;  4GKG A;  4KJM A;  3PJS K;  5CCH D;  1N73 A;  1VQL P;  1CI6 B;  3H1L D;  1VF5 D;  3HE5 B;  3KZI H;  1KD1 Q;  3CWB J;  3H1K D;  3AE2 C;  1N73 B;  1NHL A;  2ZVN B;  2OYI B;  2KS1 B;  1IZN B;  2G8Y A;  2SPZ A;  2RN0 A;  1J1D C;  3M0D C;  4PD4 I;  1VQ5 P;  3ZDM A;  2A06 E;  3LW5 J;  4A7P A;  2LR2 A;  2MKV A;  3CWB D;  1QGK B;  5APY A;  4RO0 A;  1NTK E;  3II6 A;  3M91 A;  2OTK E;  5APU A;  1PIX A;  3M06 A;  2M8R A;  3RL0 D;  1VQO P;  1OX3 A;  2D2C C;  3KQG A;  2H43 A;  2WPR A;  5GTH E;  2WSC J;  5AVR B;  1LTS C;  3HTK B;  3BRT B;  3KDP B;  2O01 N;  2K9Y A;  3CXH E;  1JO5 A;  4RKU J;  3AED C;  4EI2 A;  2WIT A;  4QMA A;  1NTM J;  1UII A;  3RL0 g;  5CCH A;  3E7K A;  5KJ7 C;  1Y9B A;  3A0B H;  1VQ6 P;  5H2F H;  1ZP0 C;  4C7N B;  4I6M C;  1VQ8 P;  2K9J B;  4PV1 C;  5GTI E;  3AEF C;  3H25 A;  4GOF A;  4R4L A;  1JCD A;  1URQ A;  1L2P A;  2I1J A;  1PGO A;  3L71 E;  3M9Q A;  1OW7 A;  3HD7 A;  3BAS A;  2FKW B;  1NTM K;  1OMI A;  2B88 A;  3OAK A;  4GDO A;  3VN0 A;  3Q5R A;  3F5H A;  3M0A A;  3V2R A;  2XU6 A;  3Q2Y A;  1BE3 D;  2JDI H;  1NH4 A;  3HE4 A;  2FFD C;  3GHG A;  2WPS A;  1G1I A;  2E74 C;  3HUS C;  4YXD C;  3U1C A;  4DCK A;  1U57 A;  4PD4 E;  4GOE A;  3TGU G;  2RH0 A;  4C7R A;  1KQL A;  1NU1 G;  1NTZ G;  3L72 D;  3H1I J;  4R4M A;  3SFD C;  2PRR A;  3OJA B;  4D6T D;  1NU1 K;  1OXZ A;  2WSE J;  4JF7 A;  1IJD B;  2JR8 A;  5TIS H;  1S1C X;  1NTZ J;  2KZJ A;  1NVO A;  3KXD A;  4NPD A;  4N3Y B;  3B5N D;  1NTK D;  3L74 E;  1L0N E;  2NPS D;  5GTH H;  3CC2 P;  1JCC A;  5TJH A;  1PPJ D;  1WT6 A;  5APW A;  2JWA A;  3CCE P;  5AVU B;  3D6Z A;  2IZ1 A;  1KIL A;  1SQB G;  1TU3 F;  3JC2 2;  2W8Z A;  1LTI C;  2WT7 A;  1H0T A;  1Q81 Q;  2QIW A;  1IK9 A;  3V4Q A;  1BGY G;  1S5L E;  3B71 A;  1YJ9 P;  1NU1 E;  3L71 G;  1LWU C;  3V4W A;  1SQP E;  1SQV D;  3TGU E;  2IBZ D;  1JTH A;  1SQP J;  1HTL C;  1LT9 C;  3G9R A;  2K88 A;  2NPS A;  3RK3 E;  3VMZ A;  3B5N A;  1FC2 C;  2E76 D;  3H1K G;  4IOI H;  4ZNC A;  1HGV A;  2W90 A;  1NYH A;  5CCH C;  4U3F G;  3CCU P;  1QLE D;  1JY2 P;  2CK3 H;  2W83 C;  3L73 J;  4N6J A;  4UB8 H;  1T2K C;  1IC2 A;  3H1K J;  1L4A D;  4I7Z C;  3CWB G;  5APV A;  2E76 B;  3TK1 A;  2M3E A;  1IK7 A;  1MV8 A;  2JO1 A;  3VP8 A;  1SQP K;  1S5L H;  4L76 A;  4OWF A;  1LWU A;  1FZE A;  1JY2 O;  2Q3I A;  1ZR4 A;  1S9K D;  2FFD B;  1RE3 A;  5CMZ A;  2YIU B;  3TSI A;  2K37 A;  1VL2 A;  1PV3 A;  1CZQ A;  1S3J A;  1EDI A;  2OAR A;  1JM0 A;  1N2D C;  1XTG B;  3EQ2 A;  1HJB A;  1QVG O;  2XDJ A;  3P7K A;  4IL6 H;  3D6Y A;  2B87 A;  2D2C D;  2QE7 H;  1CW5 A;  1BSN A;  1FDM A;  1AJY A;  1NTK K;  3L70 G;  2W6J H;  1JUN A;  1WMK A;  2BCC D;  3N4X A;  1LTB C;  1FOS E;  2Q1K A;  1OIP A;  1N7S B;  2GUV A;  2K1A A;  1X22 A;  3EFF K;  2KSE A;  3HUS B;  3KZI E;  3WU2 E;  1KC8 Q;  1FOS F;  1R5S A;  1AQT A;  1RF0 A;  5CBN A;  5KKZ C;  2IDB A;  2J59 M;  2YMK A;  4WWI A;  3P8C D;  3AE9 C;  3IF4 A;  2XND H;  2YKP A;  4L75 A;  2O3J A;  1KQG B;  1PP9 D;  1PFI A;  5KKZ B;  2R5B A;  5GTI H;  1N8R Q;  5M1B A;  1HVV A;  3V2Q A;  1LP1 B;  2FXO A;  4K35 A;  5AVV B;  3VYI A;  1JB0 J;  1QEX A;  1NTM D;  2PP6 A;  1RE4 C;  1ZXG A;  3L74 G;  3BVH A;  5E79 H;  2ZFC A;  2ZVO B;  1NAY A;  3O6Q B;  2DW3 A;  5AVZ B;  2GM4 A;  1GMJ A;  4ZMD A;  4H0L C;  3GW6 A;  3L74 J;  2ITA A;  3BAT A;  2BEZ F;  1RHZ B;  1NTZ E;  3PH0 A;  2OYH C;  3O6Q A;  3LIE A;  2FBW C;  1SFC C;  1PPJ G;  2JWD A;  3GMA A;  2AEF A;  3S4R A;  1SQX D;  1U7J A;  2WSE H;  4MN4 C;  1HGZ A;  1IFD A;  3B5N B;  3HTK A;  1FZA A;  5CHX A;  1AA0 A;  1JTH B;  2FXM A;  3CCL P;  3L71 D;  1QL1 A;  2WSC H;  5AW8 B;  3G71 P;  2KNC B;  2N1T B;  3I56 P;  1VF5 C;  1NAF A;  3PHL A;  3RK3 C;  1MKM A;  1L0N K;  3CL3 D;  1KYO D;  1EC5 A;  1EZV G;  2R5D A;  1HF9 A;  4D6T J;  1SQQ E;  2KLU A;  5AW5 B;  4EDF A;  3L71 J;  3Q1M A;  1NU1 D;  1IFJ A;  2W6B A;  2QJK C;  1JEK A;  1ZR2 A;  1SQP G;  2WWW A;  3Q5P A;  5AVW B;  2KP8 A;  3FWN A;  1VQM P;  1URQ C;  2Z4E A;  2H88 C;  1K9M Q;  2ZT9 C;  3TNU A;  1BSH A;  4H13 C;  2OYI C;  2E42 A;  3SWF A;  1VQ7 P;  3CD6 P;  2IYP A;  2KLV A;  2KIK A;  1SQB J;  4H0L D;  4OH8 B;  5AW3 B;  1CI6 A;  1OVV A;  3USS A;  3VP9 A;  1NTK G;  2XKM A;  1NJI Q;  1ZRT E;  3O8Z A;  2G3A A;  1N86 A;  4IL6 E;  3H32 A;  1RF0 C;  1SQV J;  1SLQ A;  3TNU B;  4DT0 A;  1USE A;  1NO4 A;  2KUB A;  3RL0 C;  5APS A;  1HBW A;  4WY4 C;  3L72 E;  1NTK J;  3BCC E;  4B86 A;  1SQB D;  1EDK A;  5AVQ B;  1EDJ A;  1LTJ A;  1SQV G;  3HUS A;  2R3C A;  3QWO C;  4W80 A;  4DJG A;  2R32 A;  1YI2 P;  1KYO H;  1J1E B;  3L75 J;  5KLV D;  1BCC J;  1BE3 E;  3L73 G;  5AVS B;  3H1I E;  2P7J A;  1Q82 Q;  5AW6 B;  1A02 F;  4L74 A;  1L0L J;  2A45 G;  1K05 A;  3L35 A;  5CCG A;  1X8Y A;  2WSF J;  3AEC C;  3ABV C;  3FX0 A;  1WRG A;  3L70 J;  2R3S A;  3MIW A;  1BDC A;  1R5L A;  5EFW B;  4GT1 A;  4KHX A;  1J2J B;  3QH9 A;  5C39 A;  3AE8 C;  2E43 A;  1FJP A;  1FDO A;  2QJY C;  2M5A A;  1HH0 A;  1OFC X;  1H8A A;  1RQU A;  1LTJ C;  2O1K A;  2OGU A;  4BRY A;  3CCS P;  3WMM 0;  2K3R A;  3OA7 A;  2B89 A;  3ITK A;  2HOD A;  3AE3 C;  3CX5 D;  5CCG D;  1FDI A;  1NOH A;  2QRX A;  1QX8 A;  1VQK P;  3CC4 P;  3CXH H;  2AEJ A;  2K9J A;  1L0L K;  3H1H G;  2ZT9 B;  2KSJ A;  2V4H A;  3E1I A;  1KYO I;  3HRN A;  1KB9 D;  2QSI A;  3G3Z A;  4O9B A;  2RMZ A;  5KLV K;  3MZW B;  1JNM A;  1OZH A;  2Y9Z A;  1S4X A;  3IN6 A;  3SWY A;  3P32 A;  4EIJ A;  1L4A B;  2Q3E A;  2QJK B;  1LT9 A;  1M56 D;  2Q6Q A;  1GK6 A;  3H1H J;  4IFM A;  1KQS O;  2E74 B;  1FAV A;  3C9I A;  2BCC G;  2FFD A;  1ZME C;  2P58 A;  1HJ0 A;  1MZ9 A;  5K5G B;  2NZ2 A;  5AW7 B;  1DD3 A;  2IZ0 A;  3MUD C;  1Q2N A;  2QEX P;  1RE4 A;  2H89 C;  4XFJ A;  1EXI A;  1FE6 A;  1N7S D;  2LXB A;  3A5T A;  2NRG A;  3HE4 B;  1L0L E;  3GHG B;  1LGH B;  3LID A;  4UB6 H;  5DJT B;  4JPZ B;  1JY3 N;  1VQ4 P;  2V7Q J;  3CXH I;  2QA4 P;  1NTZ K;  4AYC A;  2OYO A;  1GW4 A;  4WY4 A;  2ZYG A; 
#chains in the Genus database with same CATH homology
 1SFC B;  3L36 A;  1N73 C;  1AQ5 A;  1JY3 P;  1A02 J;  4IFD K;  1N7S C;  1GL2 A;  1GZL A;  1YYC A;  1J1D B;  2NPS C;  4WBA A;  3GHG C;  1DEB A;  3U1A A;  1GL2 B;  2BAS A;  1SQQ K;  2W27 A;  2O01 H;  3U59 A;  3VTP C;  1LTJ B;  2O1J A;  3M9H A;  1KIL D;  2IFM A;  3MD0 A;  1FZC C;  2PAJ A;  3NMD A;  1CSB A;  1ZN5 A;  3I5C A;  3P8C E;  1DX7 A;  2XZR A;  2HPC B;  1EQ7 A;  5AW1 B;  2IFN A;  3A2A A;  1T2K D;  1ZLL A;  1LTA C;  1ZV8 A;  5AW0 B;  1FJK A;  2HPC A;  2H7H A;  3HD7 B;  1LWU B;  5BU8 B;  4IFF A;  1GD2 E;  1FZC A;  2CPB A;  2W6A A;  5KTB A;  3HD7 D;  3EFG A;  5BVZ A;  3B8E B;  3MUD A;  4C7N A;  3IFM A;  1IFN A;  1YTZ T;  1GU5 A;  1VPC A;  3NFQ A;  3N7N A;  1JMM A;  2YO3 A;  2Z5H A;  1GTW A;  2IPP A;  1T8Z A;  2C0W A;  3KPE A;  2JEE A;  1KFN A;  1KIL B;  4HYT B;  1SFC A;  3RK3 D;  2OYH A;  4I1L A;  3PP5 A;  4LC1 A;  2HYN A;  3RK2 C;  3L4F A;  3HE5 A;  2L5G B;  3V2P A;  2J58 A;  5AW2 B;  2YO2 A;  2WZ7 A;  4N78 D;  1NKZ B;  1GU4 A;  2P1J A;  2N1T C;  2WT7 B;  1M1J B;  4I6M C;  4W7Z A;  5APT A;  5AVT B;  1SFC D;  4GIF A;  3BRV B;  1W2E A;  3RK2 D;  1FZG A;  1M1J C;  1G2C A;  2IX7 C;  3P8M C;  5APX A;  1S9K E;  2Q7C A;  2KYV A;  3CI9 A;  1FBM A;  3KYQ A;  1G2C B;  1SQB K;  1MFZ A;  3LW5 H;  3A3Y B;  3TYY A;  1KIL C;  1SP4 A;  1RE3 C;  1H88 A;  1GK4 A;  1FZB A;  1VDF A;  2YKQ A;  1T3J A;  4WY4 D;  5KJ7 A;  4XE5 B;  4N78 E;  2FYU K;  4WY4 B;  4ZKU A;  5BU5 A;  2C9N Y;  2HLO A;  4W7Y A;  2GUS A;  3VOP A;  1IFI A;  3MTU E;  1GW3 A;  5KJ7 D;  2OYI A;  1E5W A;  1NWQ A;  1SQV K;  4LLH A;  2HG5 D;  4WB4 A;  3H6P A;  1RF1 B;  1SQX K;  4C46 A;  1M7L A;  2C0X A;  1OWA A;  1JY3 O;  1RF1 A;  2QM8 A;  2NPS B;  3RK3 B;  2LKM A;  1T3U A;  1X79 B;  1HWT C;  1M1J A;  2YNY A;  5APQ A;  1X9V A;  1L4A A;  1MUU A;  1LT9 B;  5AVY B;  1RF1 C;  3B5N C;  1YTZ I;  3NTN A;  4DOJ A;  1URQ B;  1URQ D;  5AW9 B;  3M0D A;  1FZC B;  3MGN A;  2XV5 A;  3L37 A;  4DZO A;  4XA4 A;  1AFO A;  1L4A C;  2POH A;  1RY3 A;  3R2P A;  5AVX B;  2WPQ A;  2C9L Y;  3UIA A;  2P2U A;  5CJ0 A;  2WTY A;  2KB7 P;  4AUW A;  4JYB A;  1FZF A;  2OYH B;  2YMY A;  4Y99 C;  1H89 A;  4M3L A;  2N1T D;  2A45 I;  2QM7 A;  3IR9 A;  3T97 A;  5CCG C;  1IFM A;  1Z56 A;  3RK2 B;  4EOT A;  5AW4 B;  4AQR D;  1IO4 A;  2CPS A;  1NKN A;  1G1J A;  1N7L A;  2N9B A;  2KOG A;  2VRS A;  3V2N A;  2H8P D;  1LTT C;  3RL0 B;  2HFE D;  2JJL A;  3VMY A;  4JYC A;  3V5B A;  2A45 H;  2HOD B;  2Z5I A;  1JY2 N;  1KFM A;  1KZU B;  2N1T A;  3M9B A;  1LTG C;  1XTC C;  2YKO A;  1GL2 D;  3HD7 C;  4ZKP A;  2WSF H;  3A7O A;  3VMX A;  2Q9I A;  2Q5U A;  3CLQ A;  2FYZ A;  1DH3 A;  4RES B;  2MJZ A;  2ZXE B;  2I1K A;  1J1E C;  1SVF A;  1FU1 A;  2M3B A;  1JOC A;  4LGD E;  1GL2 C;  4I2L C;  5CJ4 A;  1N7S A;  1FDM A;  4HH2 A;  2XNX A;  2P67 A;  3H32 B;  1HUC A;  1QL2 A;  3NXS A;  4GKG A;  1N73 A;  5CCH D;  1CI6 B;  3HE5 B;  1N73 B;  2OYI B;  1NHL A;  1J1D C;  3M0D C;  5APY A;  3II6 A;  3M91 A;  5APU A;  3M06 A;  2M8R A;  3RL0 D;  3KQG A;  2H43 A;  2WPR A;  5AVR B;  1LTS C;  3HTK B;  3BRT B;  3KDP B;  1JO5 A;  5CCH A;  2WIT A;  5KJ7 C;  4C7N B;  1JCD A;  1URQ A;  2I1J A;  3M9Q A;  3HD7 A;  3BAS A;  2FKW B;  1NTM K;  3OAK A;  3VN0 A;  3M0A A;  3V2R A;  2XU6 A;  1NH4 A;  3HE4 A;  2FFD C;  3GHG A;  2WPS A;  1G1I A;  3HUS C;  3U1C A;  4C7R A;  1KQL A;  3OJA B;  1NU1 K;  1OXZ A;  4JF7 A;  1IJD B;  4N3Y B;  3B5N D;  2NPS D;  1JCC A;  1WT6 A;  5APW A;  5AVU B;  1KIL A;  2WT7 A;  1LTI C;  1IK9 A;  3V4Q A;  1LWU C;  3V4W A;  1JTH A;  3VMZ A;  1HTL C;  1LT9 C;  2NPS A;  3B5N A;  1HGV A;  5CCH C;  1JY2 P;  4N6J A;  1T2K C;  1IC2 A;  1L4A D;  5APV A;  3TK1 A;  1MV8 A;  3VP8 A;  1SQP K;  1LWU A;  1FZE A;  1JY2 O;  2Q3I A;  1ZR4 A;  1S9K D;  2FFD B;  1RE3 A;  5CMZ A;  3TSI A;  1CZQ A;  2OAR A;  1N2D C;  3EQ2 A;  1XTG B;  1HJB A;  2XDJ A;  3P7K A;  1CW5 A;  1NTK K;  1JUN A;  3N4X A;  1FOS E;  1LTB C;  1N7S B;  2GUV A;  3HUS B;  1FOS F;  1RF0 A;  2J59 M;  3P8C D;  2YKP A;  1PFI A;  2R5B A;  1HVV A;  3V2Q A;  3VYI A;  5AVV B;  2PP6 A;  1RE4 C;  3BVH A;  2ZFC A;  5AVZ B;  2GM4 A;  3BAT A;  2OYH C;  3LIE A;  1SFC C;  2WSE H;  1HGZ A;  1IFD A;  3HTK A;  3B5N B;  1FZA A;  5CHX A;  1JTH B;  2FXM A;  1QL1 A;  2WSC H;  5AW8 B;  2N1T B;  1NAF A;  3RK3 C;  1L0N K;  3CL3 D;  2R5D A;  5AW5 B;  1ZR2 A;  2W6B A;  1IFJ A;  2WWW A;  5AVW B;  2KP8 A;  2Z4E A;  1URQ C;  3TNU A;  2OYI C;  2E42 A;  3SWF A;  2KLV A;  5AW3 B;  4OH8 B;  1CI6 A;  3VP9 A;  2XKM A;  3O8Z A;  1N86 A;  3TNU B;  3H32 A;  1RF0 C;  1SLQ A;  1NO4 A;  3RL0 C;  5APS A;  1HBW A;  4WY4 C;  4B86 A;  5AVQ B;  1LTJ A;  3HUS A;  2R3C A;  4W80 A;  2R32 A;  1J1E B;  5AVS B;  2P7J A;  5AW6 B;  1A02 F;  2A45 G;  3L35 A;  5CCG A;  1X8Y A;  1WRG A;  3MIW A;  4GT1 A;  4KHX A;  1J2J B;  1FJP A;  2E43 A;  1HH0 A;  1H8A A;  1LTJ C;  2O1K A;  3WMM 0;  3OA7 A;  2HOD A;  5CCG D;  1NOH A;  1L0L K;  3HRN A;  2KSJ A;  3E1I A;  4O9B A;  3G3Z A;  1JNM A;  5KLV K;  3SWY A;  3P32 A;  4EIJ A;  1L4A B;  1GDT A;  1LT9 A;  1GK6 A;  4IFM A;  2FFD A;  1FAV A;  3C9I A;  1MZ9 A;  5AW7 B;  1RE4 A;  3A5T A;  1N7S D;  3HE4 B;  3GHG B;  1LGH B;  3LID A;  1JY3 N;  1NTZ K;  4AYC A;  1GW4 A;  4WY4 A;  4Y99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...