1LTIC

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
41
structure length
41
Chain Sequence
b'GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 13
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1996-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltiC00
1HTLC 1LTTC 1LTSC 1LTAC 1LTGC 1XTCC 1LTIC 1LTBC
chains in the Genus database with same CATH superfamily
3O8ZA 1YTZT 2FXPA 5APSA 2AEMA 2M3BA 1KB9E 4OWFA 5AVQB 1FZEA 1KB9H 1QL1A 3Q5SA 3IN6A 1T8ZA 2YXRB 1IK9A 2IFNA 4U3FG 4LLHA 5DJUB 2FXOA 2M5AB 2O01J 2XNDH 5AVYB 1SQVG 3EFFK 1P84D 4XFJA 1K73Q 3CC2P 4TLFA 2R5BA 2BCCJ 3HUSA 2ZYGA 1FZAA 1J2JB 2K9JB 3HD7A 1HGVA 2N1TD 1FS0E 1NTMK 2V7QH 4I7ZB 1SQPE 3VMAA 1RQVA 1NTZD 3HE4A 2JWDA 3H32B 4BXLA 3H25A 2A45I 1ZMEC 1NTKE 1JY3O 1JTHA 4K3AA 2NPSA 1G1IA 4GIFA 1PP9G 3ABVC 1GL2B 1G2CA 3RK3C 3NXSA 3AEEC 1FU1A 2HLOA 4JYBA 3L70J 5APQA 1ZOYC 1DH3A 2C0XA 3M0AA 1VQ4P 1L0LJ 4JQ0D 1FZCB 3CWBG 1FOSF 1VQMP 3N4XA 3E1IA 1BCCE 2BEQD 3L74D 3H1KG 2H43A 3L37A 4YPCA 1VL2A 3MGNA 2VRSA 4OH8B 1JCDA 3L73D 1RE4C 4PV1D 2KSEA 1IFJA 1S5LE 1VDFA 3CCUP 1OVVA 1SQQD 1S5LH 4GODA 2JKVA 1OXZA 4TT3H 3SSUA 3GG2A 1SFCB 3D6YA 2ZFCA 1DD3A 1ZR4A 1KYOE 1NTME 1L0NE 2XU6A 1LWUA 4GKGA 3OW2O 1T3UA 3MD0A 5DJTB 1BGYJ 1KYOH 3KHUA 2ZT9D 3M0DA 3H1LG 1BE3J 1R5SA 2B88A 5AW8B 3CMAP 2QM7A 1GK4A 1QEXA 2M3EA 4I7ZC 3G9RA 2OYHB 1M1KQ 1SQXD 1ZXGA 3K5BA 2D2CD 3V2RA 5KLVD 2K88A 3O6QA 3H1JD 3RL0B 3OJAB 2E76D 2PP6A 1GL2C 2OYIA 2N1TA 4K35A 2JEEA 3PHLA 3UIAA 1N86A 3MTUE 3FWLA 3V4WA 5GTHE 3VP9A 1HUCA 2L91A 4N6JA 1JOCA 5GTHH 3WU2H 4RO0A 3KXDA 1AFOA 2IBZI 3CXHI 1KILE 1FAVA 1AVOA 4PD4D 1JY2P 1LTGC 1R5LA 5AVTB 1OW6A 4ZKUA 2RN0A 3CX5D 1NKZB 1SQBE 3VYIA 2POHA 4ASWA 5AW6B 3TGUD 1T6AA 2C9NY 1SQVK 1LNQA 2Q3EA 4DCKA 4AUWA 5AVSB 2E74D 1AV1A 3P32A 3GHGB 5H2FE 4XA4A 4EYYQ 1SQPJ 1T3JA 5H2FH 2I8DA 1IC2A 4NPDA 2LXBA 3CCJP 2W27A 1YYCA 1RF0A 1WT6A 1NTZG 3MZWB 3AE4C 1NTKJ 2QJPB 1GMJA 1LTJA 1FDOA 1GU5A 5CCGD 1W2EA 1RF1A 3KQGA 1S9KE 1IFIA 2P7JA 1IK7A 1FE6A 3RK3E 2FYUK 4O9BA 1EZVE 1S5LX 2Q6QA 4LC1A 1GK6A 2OYHC 1IFNA 3CCEP 1JUNA 4R4MA 2QJYB 2KZIA 1H8AA 3V5BA 4U3FD 1Z56A 5KAFH 1KN7A 1E5WA 1EDJA 3L74G 3Q2YA 3B4SA 2A45H 4DOJA 4PJ0E 3IFMA 2O01N 2FBWC 2O01H 2KUBA 1JY3P 3B8EB 1CZQA 3L73G 4IL6E 4GT1A 1H89A 5B5EH 2BCCD 2HPCB 1SLQA 2YKOA 4IL6H 1SQVE 1OVUA 4GOEA 5AW4B 4Y99B 3SWKA 3F5HA 1NTMJ 3VTPC 1L0NJ 2C0WA 3MUDA 4WY4B 2ZVNB 3GLMA 3P8CD 3KPEA 1G1JA 4N78E 1HF9A 3U59A 1PP9D 1EDKA 1RE3C 3A5TA 3G6EP 1YJWP 5GTIE 1OIPA 2MKVA 2YKPA 3GHGC 3VMZA 2JO1A 1Q90D 3BVHA 2FYUE 4U7JA 5APYA 1OVRA 2IX7C 3CPWO 1VQ6P 1PL5A 2FFDA 1LTAC 4LGDE 1SQXG 1KILB 2KYVA 1NU1K 3H1JG 1GL2D 4JBZA 1ZRTE 2BASA 3HE5B 3AE5C 3D70A 1RY3A 5CCHD 1FJPA 1HVVA 1NAFA 3KYQA 2FY8A 1Q81Q 2Q3IA 1NHLA 3TDKA 1IFMA 2IDBA 2QJYC 3PH0A 1KC8Q 3CCRP 4R4LA 4HH2A 5CCGA 3AECC 2A06D 3AEBC 1JM0A 2HODA 5KJ7C 1NOHA 2KNCB 2I1KA 1HH0A 1SQBJ 2E75D 3TYYA 2Z4EA 5AW9B 1BGYD 3GW6A 1H88A 3KDPB 3H1LD 2O1JA 1BE3D 1AA0A 3TGUG 4YXWH 2LKMA 4BRYB 5CJ4A 3RK3B 2J5UA 1KQLA 1N8RQ 1KQSO 2PFXA 3IF4A 5B66E 1SFCD 2P1JA 4ZMDA 2IBZE 3CXHE 1VQNP 4WY4C 3B5NB 1YIJP 2HG5D 3CXHH 5C39A 1NJIQ 5BU8B 4C7NB 1URQD 1EC5A 3LW5J 2KOGA 3HTKA 2IPPA 4JYCA 1N7SB 1NTZK 1HTLC 5AVXB 3TNUB 3B71A 1TU3F 3CLQA 2M5AA 1XTCC 1NU1E 2YO2A 1FDIA 1GTWA 3L4FA 5EFWB 3V2QA 4IL6X 4EIJA 2W6BA 3QH9A 1KB9D 2JR8A 4PD4I 4L74A 4H44B 1NO4A 3L35A 3L75E 2K9JA 3RL0D 4UB8E 1KILC 4OVNF 4L76A 3D71A 2WSEJ 2IYPA 2ZAEB 1S3JA 4H0LC 4JPZB 2YMKA 2KSJA 2Q7CA 2WT7B 1CI6B 3H32A 2WWWA 1M1JA 2BCCG 3A0BE 1PGJA 1SQVJ 3I56P 1EZVI 1LTSC 1GL2A 1S2EA 2MJZA 1PGOA 4W7ZA 4B86A 1W5CE 1SQQK 5CCHA 3A7OA 4NPFX 2LR2A 3A3YB 3NTNA 1FZCA 1YJNP 3W67A 1PGPA 2Q9IA 1J1EB 3SFDC 2B9BA 1NTZE 2FYUJ 3RK2B 3L70G 2GUSA 3PTZA 5AVRB 2GA1A 2H88C 3AEFC 3B5NC 3HD7B 1QVGO 1L0LG 1BCCD 2OYOA 1N7SC 1VQOP 2OTJP 1SFCA 1WMKA 1SQXK 1JTHB 5KLVK 3FWNA 2NPSB 3CWBJ 4H44C 1URQA 3CD6P 4IOIH 5K5GB 2ZYAA 1LT9C 1AQTA 2R44A 2XNXA 1GW4A 4DT0A 2JP3A 5APWA 2QM8A 2LXCB 1VQKP 2L5GB 2NZ2A 3AE6C 1J1DB 2A06G 1L4AD 3OA7A 1KYOD 1L0ND 2AXTE 2O3JA 3BATA 1SQQE 2AXTH 1OW7A 1BGYG 2B87A 1MFZA 1JMMA 1BE3G 3R2PA 3Q3DA 2E5YA 1HWTC 3JCUE 3M9HA 2WZ7A 3FGAD 5CBNA 2YXQB 3JCUH 1BDCA 1U7JA 2WPRA 3FXDA 2OGUA 3GF3A 1X79B 4WY4D 3HRNA 2B89A 1K05A 1H0TA 3VN0A 2WPVB 1N2DC 4HYTB 3H1HE 1JB0J 3VMXA 2W6AA 1NU1J 1NVOA 1J1EC 1MFTA 2QG4A 1LJ2A 4D6TD 1N73A 3RK2C 3AE1C 1K9MQ 3HUSC 2KS1B 3GF7A 5KLVE 3HD7C 3L75J 4RKUJ 2XZRA 1VQLP 1KILD 1RHZB 1EDIA 2XV5A 2P2UA 1HBWA 3L71E 1SS1A 3L72E 1S4XA 2W90A 1PPJD 3KZIE 5AVZB 1SQBD 4KHXA 3SWYA 3KZIH 2NPSC 3II6A 2WTYA 1YI2P 2OYIB 2N1TB 4GDOA 2E5TA 3RBZA 2NRGA 1VF5B 4PD4E 2OTKE 2W83C 2DW3A 1PFIA 1PV3A 1J1DC 3CX5E 2CPSA 1Q2NA 1KFMA 3TF5A 3TGUE 1BSHA 3BRTB 2IZ0A 4ZKPA 2Y9YA 3H1IE 3RK3D 3LW5H 1DX7A 1NTZJ 3CCMP 3EWKA 1L4AA 1LP1B 1PIXA 3M9BA 2IZ1A 5APUA 3BCCE 2R32A 2WMMA 3E7KA 3ZDMA 2QIWA 1IZNB 1ZW0A 1QX8A 2FKWB 2SPZA 5APXA 5KAIE 1P84I 2HPCA 3CMEP 4Z1MH 3CC7P 2M8RA 2ZJSE 1N7SD 5E79E 1BCCG 4PV1B 1LWUC 5E79H 1X22A 1XTGB 2WSEH 3MP7B 3AE8C 4PJ0H 1NH4A 3MIWA 4WY4A 1K8AQ 2QRXA 4H44D 4BWNA 3CCVP 4U3FE 1JMBA 5CMZA 4XE5B 1JNMA 4DJGA 3N7NA 4QMAA 5CHXA 1L2PA 2JDIH 2ZT9B 1JY2N 1L0NG 1SQQJ 3VP8A 3WMM0 3M91A 5AW2B 3V2PA 2OYIC 2N1TC 1LT1A 1KILA 2KP8A 1VF5C 1YITP 3CI9A 3Q5RA 2N9YB 2GM4A 1X9VA 3HE5A 5GTIH 3L70D 1GW3A 2Y0EA 2YKQA 5APTA 2UWJE 1JEKA 1PP9E 1L0LD 2P10A 3H1HJ 1T2KC 1HJBA 3PRJA 3P7KA 3TSIA 4A7PA 4H0LB 2FYNB 3S1KA 1Y9BA 4GOFA 4Y28J 2KNCA 1EDLA 4D6TG 4AQRD 3A0HE 1SP4A 1LTBC 2OQQA 5KLVJ 3RBXA 3CWBE 5M1BA 4M3LA 3R4YA 5BU5A 3H1KE 4BRYA 1VQ9P 3L71J 3SFEC 1IO4A 4EDFA 3L72J 1RF0C 4YXDC 4PV1C 1DEBA 1PPJG 2V4HA 5AW0B 1OW8A 2PGDA 1SQBG 2YIUB 1X8YA 1RF1C 1CSBA 3CCLP 3PP5A 4C7NA 1JY3N 3T97A 2WITA 3D6ZA 1N7SA 3A2AA 1ZLLA 2R3CA 2C9LY 3EQ2A 3U1AA 2IBZD 3CXHD 3RGUA 5AW3B 5B66H 2ZT9C 4IFDK 3TGUJ 1RE4A 2O1KA 3H1LE 3C8VA 4WWIA 3USSA 1KV4A 1VQ7P 2K3RA 3Q1MA 3H1IJ 2ZVOB 1JY2O 2K9YA 2WSFJ 3RL0g 2IFMA 2FXMA 2QE7H 3BCCJ 1RH5B 4C46A 2YNYA 2E76C 1QVFO 4DZOA 3AE7C 3CX5I 2HFED 1LT9B 1ZN5A 5L8RJ 2A45G 4UB8H 2WSCH 3M9QA 5BVZA 2FYNC 3MUDC 2OTLP 3V4QA 1EQ7A 2KLUA 1USEA 1OFCX 3HTKB 2E43A 1R8EA 1GDTA 5KTBA 4U3FJ 1K04A 5APVA 1QL2A 3U1CA 2I1JA 1M57D 4ZNCA 3JC22 3NMDA 3A0BH 1BDDA 3CCQP 1P84E 1SQPD 1P84H 2FFDC 1VQ5P 2G8YA 2YIUC 4H13B 1NTKD 1Q7YQ 2K37A 3FX0A 2E74C 1ZV8A 4OGQB 1VF5D 3PLNA 1L0NK 1Y8AA 2QVAA 2RMZA 4WB4A 3G3ZA 1M1JB 4JF7A 2FYUG 1JCCA 1Q82Q 3HUSB 2G3AA 1MUUA 1PP9J 4MN4C 1VQPP 5CCGC 3OAKA 1T2KD 4IFFA 3CL3D 2AXCA 1U57A 3AE9C 3ITKA 1AQ5A 3HE4B 2RKLA 2HR3A 2K1AA 3V2NA 2E42A 1G2CB 3GMAA 1YBKA 1PGQA 1S72P 3H1KJ 1GU4A 2P67A 4W80A 1E79H 3L74E 2WPQA 1EXJA 5KLIB 2E75B 2KZJA 5KJ7D 1UIXA 3L73E 1NTMD 1OZHA 1KTMA 2ZXXA 2OYHA 2KK7A 1KMIZ 1WRGA 3S4RA 1N7LA 2JWAA 2CPBA 4EOTA 3V6IA 2QEXP 2WVRA 1QGKB 1OWAA 1SQBK 5TJHA 1KZUB 1HGZA 2IBZG 3VOPA 1URQB 3H1LJ 3I5CA 2KS1A 1BSNA 2Y9ZA 4HB1A 4H13C 2KIKA 3H1HD 4NPEA 4OGQC 1Q86Q 2J58A 1DIPA 1JO5A 2PRRA 1NU1G 2M0BA 4L73A 1LWUB 1MZ9A 4I2LC 1M1JC 3AE3C 2B87B 1SQXE 2R3SA 3G4SP 3PJSK 3LIEA 3H1JE 3L75G 2WSCJ 2OARA 2XDJA 5TISE 1RE3A 1IFDA 1MKMA 3L71D 3VMYA 3QWOC 4UB6E 3L72D 3L36A 5CCHC 3Q5PA 5TISH 3GHGA 4H0LD 4D6TE 1NYHA 4UB6H 3WU2E 4WBAA 5AW5B 1H0TB 1VPCA 4I6MC 3O6QB 1FZCC 2H7HA 2Q5UA 2HYNA 4L75A 2KXPB 3AEGC 3IAOA 2WQYC 1M8OB 2KB7P 1N73B 1M7LA 4N3YB 3EFGA 1PPJE 4PD4H 5KLIC 2E75C 1W2BO 4HJGH 1DEEG 3TK1A 3IR9A 1LP1A 1SQPG 1FDMA 2GUVA 3CX5H 1OMIA 1X0TA 4WVZA 2P58A 5KKZB 2V7QJ 1NTKG 2Z5IA 2AEFA 1KB9I 3H1ID 2KLVA 3P8MC 1KQFB 1SFCC 1S9KD 4KJMA 1U7MA 1RQUA 1EZVD 3FXEA 1YQ3C 5KJ7A 3BCCD 2R5DA 1YQ4C 1KQGB 2XKMA 2WSFH 1URQC 2JJLA 1S1CX 2N9BA 2BEZF 3B5ND 2QJKB 2W8ZA 1YTZI 4W7YA 5KAIH 1VQ8P 3CC4P 1GZLA 5CBOA 1NAYA 4RJTA 2QA4P 3BRVB 3H6PA 3NFQA 3LIDA 1MV8A 1FZFA 1L0LK 1LTJB 1NKNA 3M0DC 5KAFE 1IFPA 1AJYA 1KORA 3RL0C 1RF1B 1GD2E 2H89C 1BCCJ 1LGHB 2RH0A 1SQVD 3L74J 1FC2C 1L4AB 2IYOA 1FJKA 2ITAA 1AVYA 5B5EE 1YHQP 3L73J 5AVWB 1D7MA 1LTIC 1DD4A 2Y0DA 5AVVB 1KFNA 1NTMG 3M06A 2BCCE 2H8PD 3SWFA 1SQQG 4N78D 3WUVA 1M56D 4YTPC 1FZBA 5AW7B 1CW5A 1N73C 3BASA 1PZQA 2FYUD 2ZYDA 4RESB 1QLED 1HJ0A 3C1LA 4IFMA 1YJ9P 3P8CE 2D2CB 1A02J 3AE2C 5CJ0A 4H13D 3WUUA 2E76B 4HKZH 5KKZC 2AEJA 1KD1Q 3H1HG 5AW1B 4OGQD 1FOSE 1FZGA 1ZRTD 3L70E 2FYZA 5AVUB 1Y47A 3S9OA 2CK3H 3RK2D 1A02F 1SQXJ 2QJPC 2Z5HA 1L0LE 3CWBD 2YMYA 3H1JJ 2Q1KA 5KLVG 3HD7D 2QJKC 3A0HH 1KYOI 3H1KD 3JSVC 2ZXEB 1ZP0C 4D6TJ 3L71G 3L72G 3MHVA 3C9IA 4ASVA 2FFDB 1UIIA 1LTJC 2NPSD 2WPSA 3B5NA 2PAJA 3AEDC 2E74B 1USDA 1M90Q 3G71P 3I55P 4KT0J 2A06E 1L4AC 3TNUA 1SVFA 4EI2A 2WSSH 1LTTC 4C7RA 1FBMA 1EXIA 3WUTA 2KI7B 1BGYE 4CPGA 2YO3A 1BE3E 4I1LA 3E1RA 2W6JH 1SQPK 1OX3A 3F89A 1LT9A 3H1IG 2HODB 1NWQA 4Y99C 1NGMB 1IJDB 1NU1D 3AEAC 1NTKK 1EZVG 2QSIA 2Y0CA 3BCCG 3T97B 2WT7A 1CI6A 2D2CC 4AYCA 1ZR2A 3W68A 2J59M 3L75D 3CCSP
chains in the Genus database with same CATH topology
3O8ZA 2P67A 1YTZT 4W80A 5APSA 3A5TA 2YKPA 2WPQA 3GHGC 3VMZA 1PFIA 3BVHA 1J1DC 2M3BA 5APYA 2CPSA 2IX7C 5KJ7D 5AVQB 1FZEA 1KFMA 2OYHA 2FFDA 1QL1A 1LTAC 3BRTB 4LGDE 1T8ZA 1WRGA 4ZKPA 1IK9A 1KILB 2KYVA 1N7LA 2IFNA 1NU1K 4LLHA 2CPBA 1GL2D 4EOTA 3RK3D 3LW5H 5AVYB 1OWAA 1SQBK 2BASA 1DX7A 3HE5B 1L4AA 1RY3A 5CCHD 1FJPA 3M9BA 1HVVA 1KZUB 1NAFA 5APUA 1HGZA 2R32A 3KYQA 3VOPA 1URQB 2Q3IA 1NHLA 2R5BA 3I5CA 1IFMA 3HUSA 1FZAA 1J2JB 2FKWB 5APXA 2HPCA 4HH2A 5CCGA 3HD7A 1HGVA 2N1TD 2M8RA 1N7SD 2J58A 1JO5A 1NTMK 2HODA 5KJ7C 1NOHA 1LWUC 1LWUB 1XTGB 3HE4A 1HH0A 2I1KA 2WSEH 3H32B 1MZ9A 4I2LC 3TYYA 1M1JC 2Z4EA 5AW9B 2A45I 1NH4A 3MIWA 4WY4A 1JY3O 1H88A 3KDPB 1JTHA 2NPSA 2O1JA 1G1IA 4GIFA 3LIEA 2LKMA 1GL2B 1G2CA 5CMZA 5CJ4A 3RK3C 4XE5B 2OARA 3RK3B 1KQLA 2XDJA 3NXSA 1JNMA 1RE3A 1IFDA 3VMYA 1SFCD 1FU1A 2HLOA 4JYBA 3L36A 5APQA 5CCHC 3GHGA 2P1JA 3N7NA 5CHXA 1DH3A 2C0XA 4WBAA 1JY2N 3M0AA 5AW5B 4WY4C 3B5NB 2HG5D 1VPCA 3VP8A 5BU8B 4I6MC 3WMM0 3M91A 1FZCC 4C7NB 2H7HA 2Q5UA 1URQD 2HYNA 5AW2B 1FZCB 3V2PA 2OYIC 2KOGA 3HTKA 2N1TC 2IPPA 1FOSF 3N4XA 4JYCA 1N7SB 1KILA 2KP8A 3E1IA 1NTZK 1HTLC 3CI9A 5AVXB 3TNUB 2H43A 3CLQA 3L37A 2YO2A 1XTCC 2KB7P 3MGNA 2VRSA 4OH8B 1N73B 1M7LA 1GTWA 3L4FA 4N3YB 3V2QA 3EFGA 2GM4A 1X9VA 2W6BA 1JCDA 3HE5A 4EIJA 1GW3A 3TK1A 1RE4C 3IR9A 1IFJA 2YKQA 1FDMA 1VDFA 2GUVA 5APTA 1NO4A 3L35A 2Z5IA 3RL0D 1T2KC 1KILC 1HJBA 1OXZA 2KLVA 3P8MC 1SFCC 1S9KD 3P7KA 1SFCB 3TSIA 2ZFCA 2KSJA 2Q7CA 1ZR4A 5KJ7A 2XU6A 1LWUA 4GKGA 1T3UA 2R5DA 3MD0A 1CI6B 2WT7B 3H32A 4AQRD 1SP4A 2WWWA 2XKMA 1LTBC 2WSFH 1URQC 1M1JA 2JJLA 3M0DA 2N9BA 3B5ND 1YTZI 5AW8B 4M3LA 1LTSC 4W7YA 5BU5A 1GL2A 2QM7A 1GZLA 1GK4A 2MJZA 1IO4A 4W7ZA 4B86A 3BRVB 3H6PA 1RF0C 3NFQA 1SQQK 3LIDA 5CCHA 2OYHB 1MV8A 1FZFA 1L0LK 3A7OA 1DEBA 5AW0B 1LTJB 1NKNA 3M0DC 1X8YA 1RF1C 1CSBA 3RL0C 3V2RA 1RF1B 1GD2E 3RL0B 3PP5A 3A3YB 3NTNA 4C7NA 1LGHB 3OJAB 1JY3N 1FZCA 3T97A 2PP6A 2WITA 1GL2C 2OYIA 2Q9IA 2N1TA 1N7SA 3A2AA 1L4AB 1ZLLA 1J1EB 1FJKA 2JEEA 2R3CA 2C9LY 3EQ2A 3U1AA 3RK2B 3UIAA 5AVWB 1N86A 1LTIC 5AW3B 2GUSA 3MTUE 5AVVB 1KFNA 3V4WA 4IFDK 5AVRB 3VP9A 1RE4A 2O1KA 1HUCA 3B5NC 3HD7B 2H8PD 3M06A 4N6JA 1JOCA 3SWFA 4N78D 1AFOA 1FZBA 5AW7B 1N7SC 1FAVA 1CW5A 1JY2P 1JY2O 1LTGC 1SFCA 1N73C 5AVTB 1SQXK 4ZKUA 3BASA 2IFMA 2FXMA 4RESB 1NKZB 1JTHB 5KLVK 2NPSB 4IFMA 3VYIA 2POHA 3P8CE 5AW6B 2C9NY 1A02J 4C46A 1SQVK 2YNYA 5CJ0A 1URQA 4DZOA 4AUWA 5AVSB 1LT9C 2HFED 2XNXA 5AW1B 1LT9B 1ZN5A 1GW4A 3P32A 3GHGB 1FOSE 5APWA 2QM8A 4XA4A 2A45G 2L5GB 2WSCH 1T3JA 1FZGA 3M9QA 1J1DB 1L4AD 5BVZA 1IC2A 3OA7A 2FYZA 3V4QA 2W27A 5AVUB 1EQ7A 1YYCA 1RF0A 1WT6A 3RK2D 1A02F 3BATA 3HTKB 2E43A 2Z5HA 1LTJA 1GDTA 5KTBA 2YMYA 5APVA 1GU5A 1QL2A 1MFZA 1JMMA 2I1JA 1W2EA 3HD7D 5CCGD 3U1CA 1RF1A 3KQGA 3R2PA 2ZXEB 1S9KE 1HWTC 1IFIA 2P7JA 3M9HA 3NMDA 2FYUK 2WZ7A 4O9BA 4LC1A 1GK6A 2OYHC 2WPRA 2FFDC 1IFNA 3C9IA 1X79B 2FFDB 1JUNA 4WY4D 3HRNA 1LTJC 2NPSD 1H8AA 2WPSA 3B5NA 3VN0A 3V5BA 1N2DC 4HYTB 2PAJA 1Z56A 1ZV8A 3VMXA 1E5WA 2W6AA 1L0NK 1L4AC 1J1EC 2A45H 3TNUA 4DOJA 1SVFA 4WB4A 3IFMA 3G3ZA 1LTTC 1N73A 4C7RA 3RK2C 2O01H 1M1JB 1FBMA 4JF7A 1JY3P 3HUSC 1JCCA 3B8EB 1CZQA 3HUSB 4GT1A 1H89A 1MUUA 2HPCB 1SLQA 5CCGC 2YO3A 3HD7C 2YKOA 3OAKA 2XZRA 4I1LA 1T2KD 1KILD 2XV5A 4IFFA 3CL3D 2P2UA 1SQPK 5AW4B 1LT9A 2HODB 1NWQA 4Y99C 1HBWA 1IJDB 4Y99B 1AQ5A 3HE4B 3VTPC 2C0WA 1NTKK 5AVZB 4KHXA 3MUDA 4WY4B 3SWYA 3P8CD 3KPEA 2NPSC 3II6A 1G1JA 2WTYA 4N78E 2WT7A 1CI6A 3V2NA 3U59A 2OYIB 4AYCA 2E42A 2N1TB 1G2CB 1ZR2A 2J59M 1GU4A 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL C;  1LTT C;  1LTS C;  1LTA C;  1LTG C;  1XTC C;  1LTI C;  1LTB C; 
#chains in the Genus database with same CATH topology
 3O8Z A;  1YTZ T;  2FXP A;  5APS A;  2AEM A;  2M3B A;  1KB9 E;  4OWF A;  5AVQ B;  1FZE A;  1KB9 H;  1QL1 A;  3Q5S A;  3IN6 A;  1T8Z A;  2YXR B;  1IK9 A;  2IFN A;  4U3F G;  4LLH A;  5DJU B;  2FXO A;  2M5A B;  2O01 J;  2XND H;  5AVY B;  1SQV G;  3EFF K;  1P84 D;  4XFJ A;  1K73 Q;  3CC2 P;  4TLF A;  2R5B A;  2BCC J;  3HUS A;  2ZYG A;  1FZA A;  1J2J B;  2K9J B;  3HD7 A;  1HGV A;  2N1T D;  1FS0 E;  1NTM K;  2V7Q H;  4I7Z B;  1SQP E;  3VMA A;  1RQV A;  1NTZ D;  3HE4 A;  2JWD A;  3H32 B;  4BXL A;  3H25 A;  2A45 I;  1ZME C;  1NTK E;  1JY3 O;  1JTH A;  4K3A A;  2NPS A;  1G1I A;  4GIF A;  1PP9 G;  3ABV C;  1GL2 B;  1G2C A;  3RK3 C;  3NXS A;  3AEE C;  1FU1 A;  2HLO A;  4JYB A;  3L70 J;  5APQ A;  1ZOY C;  1DH3 A;  2C0X A;  3M0A A;  1VQ4 P;  1L0L J;  4JQ0 D;  1FZC B;  3CWB G;  1FOS F;  1VQM P;  3N4X A;  3E1I A;  1BCC E;  2BEQ D;  3L74 D;  3H1K G;  2H43 A;  3L37 A;  4YPC A;  1VL2 A;  3MGN A;  2VRS A;  4OH8 B;  1JCD A;  3L73 D;  1RE4 C;  4PV1 D;  2KSE A;  1IFJ A;  1S5L E;  1VDF A;  3CCU P;  1OVV A;  1SQQ D;  1S5L H;  4GOD A;  2JKV A;  1OXZ A;  4TT3 H;  3SSU A;  3GG2 A;  1SFC B;  3D6Y A;  2ZFC A;  1DD3 A;  1ZR4 A;  1KYO E;  1NTM E;  1L0N E;  2XU6 A;  1LWU A;  4GKG A;  3OW2 O;  1T3U A;  3MD0 A;  5DJT B;  1BGY J;  1KYO H;  3KHU A;  2ZT9 D;  3M0D A;  3H1L G;  1BE3 J;  1R5S A;  2B88 A;  5AW8 B;  3CMA P;  2QM7 A;  1GK4 A;  1QEX A;  2M3E A;  4I7Z C;  3G9R A;  2OYH B;  1M1K Q;  1SQX D;  1ZXG A;  3K5B A;  2D2C D;  3V2R A;  5KLV D;  2K88 A;  3O6Q A;  3H1J D;  3RL0 B;  3OJA B;  2E76 D;  2PP6 A;  1GL2 C;  2OYI A;  2N1T A;  4K35 A;  2JEE A;  3PHL A;  3UIA A;  1N86 A;  3MTU E;  3FWL A;  3V4W A;  5GTH E;  3VP9 A;  1HUC A;  2L91 A;  4N6J A;  1JOC A;  5GTH H;  3WU2 H;  4RO0 A;  3KXD A;  1AFO A;  2IBZ I;  3CXH I;  1KIL E;  1FAV A;  1AVO A;  4PD4 D;  1JY2 P;  1LTG C;  1R5L A;  5AVT B;  1OW6 A;  4ZKU A;  2RN0 A;  3CX5 D;  1NKZ B;  1SQB E;  3VYI A;  2POH A;  4ASW A;  5AW6 B;  3TGU D;  1T6A A;  2C9N Y;  1SQV K;  1LNQ A;  2Q3E A;  4DCK A;  4AUW A;  5AVS B;  2E74 D;  1AV1 A;  3P32 A;  3GHG B;  5H2F E;  4XA4 A;  4EYY Q;  1SQP J;  1T3J A;  5H2F H;  2I8D A;  1IC2 A;  4NPD A;  2LXB A;  3CCJ P;  2W27 A;  1YYC A;  1RF0 A;  1WT6 A;  1NTZ G;  3MZW B;  3AE4 C;  1NTK J;  2QJP B;  1GMJ A;  1LTJ A;  1FDO A;  1GU5 A;  5CCG D;  1W2E A;  1RF1 A;  3KQG A;  1S9K E;  1IFI A;  2P7J A;  1IK7 A;  1FE6 A;  3RK3 E;  2FYU K;  4O9B A;  1EZV E;  1S5L X;  2Q6Q A;  4LC1 A;  1GK6 A;  2OYH C;  1IFN A;  3CCE P;  1JUN A;  4R4M A;  2QJY B;  2KZI A;  1H8A A;  3V5B A;  4U3F D;  1Z56 A;  5KAF H;  1KN7 A;  1E5W A;  1EDJ A;  3L74 G;  3Q2Y A;  3B4S A;  2A45 H;  4DOJ A;  4PJ0 E;  3IFM A;  2O01 N;  2FBW C;  2O01 H;  2KUB A;  1JY3 P;  3B8E B;  1CZQ A;  3L73 G;  4IL6 E;  4GT1 A;  1H89 A;  5B5E H;  2BCC D;  2HPC B;  1SLQ A;  2YKO A;  4IL6 H;  1SQV E;  1OVU A;  4GOE A;  5AW4 B;  4Y99 B;  3SWK A;  3F5H A;  1NTM J;  3VTP C;  1L0N J;  2C0W A;  3MUD A;  4WY4 B;  2ZVN B;  3GLM A;  3P8C D;  3KPE A;  1G1J A;  4N78 E;  1HF9 A;  3U59 A;  1PP9 D;  1EDK A;  1RE3 C;  3A5T A;  3G6E P;  1YJW P;  5GTI E;  1OIP A;  2MKV A;  2YKP A;  3GHG C;  3VMZ A;  2JO1 A;  1Q90 D;  3BVH A;  2FYU E;  4U7J A;  5APY A;  1OVR A;  2IX7 C;  3CPW O;  1VQ6 P;  1PL5 A;  2FFD A;  1LTA C;  4LGD E;  1SQX G;  1KIL B;  2KYV A;  1NU1 K;  3H1J G;  1GL2 D;  4JBZ A;  1ZRT E;  2BAS A;  3HE5 B;  3AE5 C;  3D70 A;  1RY3 A;  5CCH D;  1FJP A;  1HVV A;  1NAF A;  3KYQ A;  2FY8 A;  1Q81 Q;  2Q3I A;  1NHL A;  3TDK A;  1IFM A;  2IDB A;  2QJY C;  3PH0 A;  1KC8 Q;  3CCR P;  4R4L A;  4HH2 A;  5CCG A;  3AEC C;  2A06 D;  3AEB C;  1JM0 A;  2HOD A;  5KJ7 C;  1NOH A;  2KNC B;  2I1K A;  1HH0 A;  1SQB J;  2E75 D;  3TYY A;  2Z4E A;  5AW9 B;  1BGY D;  3GW6 A;  1H88 A;  3KDP B;  3H1L D;  2O1J A;  1BE3 D;  1AA0 A;  3TGU G;  4YXW H;  2LKM A;  4BRY B;  5CJ4 A;  3RK3 B;  2J5U A;  1KQL A;  1N8R Q;  1KQS O;  2PFX A;  3IF4 A;  5B66 E;  1SFC D;  2P1J A;  4ZMD A;  2IBZ E;  3CXH E;  1VQN P;  4WY4 C;  3B5N B;  1YIJ P;  2HG5 D;  3CXH H;  5C39 A;  1NJI Q;  5BU8 B;  4C7N B;  1URQ D;  1EC5 A;  3LW5 J;  2KOG A;  3HTK A;  2IPP A;  4JYC A;  1N7S B;  1NTZ K;  1HTL C;  5AVX B;  3TNU B;  3B71 A;  1TU3 F;  3CLQ A;  2M5A A;  1XTC C;  1NU1 E;  2YO2 A;  1FDI A;  1GTW A;  3L4F A;  5EFW B;  3V2Q A;  4IL6 X;  4EIJ A;  2W6B A;  3QH9 A;  1KB9 D;  2JR8 A;  4PD4 I;  4L74 A;  4H44 B;  1NO4 A;  3L35 A;  3L75 E;  2K9J A;  3RL0 D;  4UB8 E;  1KIL C;  4OVN F;  4L76 A;  3D71 A;  2WSE J;  2IYP A;  2ZAE B;  1S3J A;  4H0L C;  4JPZ B;  2YMK A;  2KSJ A;  2Q7C A;  2WT7 B;  1CI6 B;  3H32 A;  2WWW A;  1M1J A;  2BCC G;  3A0B E;  1PGJ A;  1SQV J;  3I56 P;  1EZV I;  1LTS C;  1GL2 A;  1S2E A;  2MJZ A;  1PGO A;  4W7Z A;  4B86 A;  1W5C E;  1SQQ K;  5CCH A;  3A7O A;  4NPF X;  2LR2 A;  3A3Y B;  3NTN A;  1FZC A;  1YJN P;  3W67 A;  1PGP A;  2Q9I A;  1J1E B;  3SFD C;  2B9B A;  1NTZ E;  2FYU J;  3RK2 B;  3L70 G;  2GUS A;  3PTZ A;  5AVR B;  2GA1 A;  2H88 C;  3AEF C;  3B5N C;  3HD7 B;  1QVG O;  1L0L G;  1BCC D;  2OYO A;  1N7S C;  1VQO P;  2OTJ P;  1SFC A;  1WMK A;  1SQX K;  1JTH B;  5KLV K;  3FWN A;  2NPS B;  3CWB J;  4H44 C;  1URQ A;  3CD6 P;  4IOI H;  5K5G B;  2ZYA A;  1LT9 C;  1AQT A;  2R44 A;  2XNX A;  1GW4 A;  4DT0 A;  2JP3 A;  5APW A;  2QM8 A;  2LXC B;  1VQK P;  2L5G B;  2NZ2 A;  3AE6 C;  1J1D B;  2A06 G;  1L4A D;  3OA7 A;  1KYO D;  1L0N D;  2AXT E;  2O3J A;  3BAT A;  1SQQ E;  2AXT H;  1OW7 A;  1BGY G;  2B87 A;  1MFZ A;  1JMM A;  1BE3 G;  3R2P A;  3Q3D A;  2E5Y A;  1HWT C;  3JCU E;  3M9H A;  2WZ7 A;  3FGA D;  5CBN A;  2YXQ B;  3JCU H;  1BDC A;  1U7J A;  2WPR A;  3FXD A;  2OGU A;  3GF3 A;  1X79 B;  4WY4 D;  3HRN A;  2B89 A;  1K05 A;  1H0T A;  3VN0 A;  2WPV B;  1N2D C;  4HYT B;  3H1H E;  1JB0 J;  3VMX A;  2W6A A;  1NU1 J;  1NVO A;  1J1E C;  1MFT A;  2QG4 A;  1LJ2 A;  4D6T D;  1N73 A;  3RK2 C;  3AE1 C;  1K9M Q;  3HUS C;  2KS1 B;  3GF7 A;  5KLV E;  3HD7 C;  3L75 J;  4RKU J;  2XZR A;  1VQL P;  1KIL D;  1RHZ B;  1EDI A;  2XV5 A;  2P2U A;  1HBW A;  3L71 E;  1SS1 A;  3L72 E;  1S4X A;  2W90 A;  1PPJ D;  3KZI E;  5AVZ B;  1SQB D;  4KHX A;  3SWY A;  3KZI H;  2NPS C;  3II6 A;  2WTY A;  1YI2 P;  2OYI B;  2N1T B;  4GDO A;  2E5T A;  3RBZ A;  2NRG A;  1VF5 B;  4PD4 E;  2OTK E;  2W83 C;  2DW3 A;  1PFI A;  1PV3 A;  1J1D C;  3CX5 E;  2CPS A;  1Q2N A;  1KFM A;  3TF5 A;  3TGU E;  1BSH A;  3BRT B;  2IZ0 A;  4ZKP A;  2Y9Y A;  3H1I E;  3RK3 D;  3LW5 H;  1DX7 A;  1NTZ J;  3CCM P;  3EWK A;  1L4A A;  1LP1 B;  1PIX A;  3M9B A;  2IZ1 A;  5APU A;  3BCC E;  2R32 A;  2WMM A;  3E7K A;  3ZDM A;  2QIW A;  1IZN B;  1ZW0 A;  1QX8 A;  2FKW B;  2SPZ A;  5APX A;  5KAI E;  1P84 I;  2HPC A;  3CME P;  4Z1M H;  3CC7 P;  2M8R A;  2ZJS E;  1N7S D;  5E79 E;  1BCC G;  4PV1 B;  1LWU C;  5E79 H;  1X22 A;  1XTG B;  2WSE H;  3MP7 B;  3AE8 C;  4PJ0 H;  1NH4 A;  3MIW A;  4WY4 A;  1K8A Q;  2QRX A;  4H44 D;  4BWN A;  3CCV P;  4U3F E;  1JMB A;  5CMZ A;  4XE5 B;  1JNM A;  4DJG A;  3N7N A;  4QMA A;  5CHX A;  1L2P A;  2JDI H;  2ZT9 B;  1JY2 N;  1L0N G;  1SQQ J;  3VP8 A;  3WMM 0;  3M91 A;  5AW2 B;  3V2P A;  2OYI C;  2N1T C;  1LT1 A;  1KIL A;  2KP8 A;  1VF5 C;  1YIT P;  3CI9 A;  3Q5R A;  2N9Y B;  2GM4 A;  1X9V A;  3HE5 A;  5GTI H;  3L70 D;  1GW3 A;  2Y0E A;  2YKQ A;  5APT A;  2UWJ E;  1JEK A;  1PP9 E;  1L0L D;  2P10 A;  3H1H J;  1T2K C;  1HJB A;  3PRJ A;  3P7K A;  3TSI A;  4A7P A;  4H0L B;  2FYN B;  3S1K A;  1Y9B A;  4GOF A;  4Y28 J;  2KNC A;  1EDL A;  4D6T G;  4AQR D;  3A0H E;  1SP4 A;  1LTB C;  2OQQ A;  5KLV J;  3RBX A;  3CWB E;  5M1B A;  4M3L A;  3R4Y A;  5BU5 A;  3H1K E;  4BRY A;  1VQ9 P;  3L71 J;  3SFE C;  1IO4 A;  4EDF A;  3L72 J;  1RF0 C;  4YXD C;  4PV1 C;  1DEB A;  1PPJ G;  2V4H A;  5AW0 B;  1OW8 A;  2PGD A;  1SQB G;  2YIU B;  1X8Y A;  1RF1 C;  1CSB A;  3CCL P;  3PP5 A;  4C7N A;  1JY3 N;  3T97 A;  2WIT A;  3D6Z A;  1N7S A;  3A2A A;  1ZLL A;  2R3C A;  2C9L Y;  3EQ2 A;  3U1A A;  2IBZ D;  3CXH D;  3RGU A;  5AW3 B;  5B66 H;  2ZT9 C;  4IFD K;  3TGU J;  1RE4 A;  2O1K A;  3H1L E;  3C8V A;  4WWI A;  3USS A;  1KV4 A;  1VQ7 P;  2K3R A;  3Q1M A;  3H1I J;  2ZVO B;  1JY2 O;  2K9Y A;  2WSF J;  3RL0 g;  2IFM A;  2FXM A;  2QE7 H;  3BCC J;  1RH5 B;  4C46 A;  2YNY A;  2E76 C;  1QVF O;  4DZO A;  3AE7 C;  3CX5 I;  2HFE D;  1LT9 B;  1ZN5 A;  5L8R J;  2A45 G;  4UB8 H;  2WSC H;  3M9Q A;  5BVZ A;  2FYN C;  3MUD C;  2OTL P;  3V4Q A;  1EQ7 A;  2KLU A;  1USE A;  1OFC X;  3HTK B;  2E43 A;  1R8E A;  1GDT A;  5KTB A;  4U3F J;  1K04 A;  5APV A;  1QL2 A;  3U1C A;  2I1J A;  1M57 D;  4ZNC A;  3JC2 2;  3NMD A;  3A0B H;  1BDD A;  3CCQ P;  1P84 E;  1SQP D;  1P84 H;  2FFD C;  1VQ5 P;  2G8Y A;  2YIU C;  4H13 B;  1NTK D;  1Q7Y Q;  2K37 A;  3FX0 A;  2E74 C;  1ZV8 A;  4OGQ B;  1VF5 D;  3PLN A;  1L0N K;  1Y8A A;  2QVA A;  2RMZ A;  4WB4 A;  3G3Z A;  1M1J B;  4JF7 A;  2FYU G;  1JCC A;  1Q82 Q;  3HUS B;  2G3A A;  1MUU A;  1PP9 J;  4MN4 C;  1VQP P;  5CCG C;  3OAK A;  1T2K D;  4IFF A;  3CL3 D;  2AXC A;  1U57 A;  3AE9 C;  3ITK A;  1AQ5 A;  3HE4 B;  2RKL A;  2HR3 A;  2K1A A;  3V2N A;  2E42 A;  1G2C B;  3GMA A;  1YBK A;  1PGQ A;  1S72 P;  3H1K J;  1GU4 A;  2P67 A;  4W80 A;  1E79 H;  3L74 E;  2WPQ A;  1EXJ A;  5KLI B;  2E75 B;  2KZJ A;  5KJ7 D;  1UIX A;  3L73 E;  1NTM D;  1OZH A;  1KTM A;  2ZXX A;  2OYH A;  2KK7 A;  1KMI Z;  1WRG A;  3S4R A;  1N7L A;  2JWA A;  2CPB A;  4EOT A;  3V6I A;  2QEX P;  2WVR A;  1QGK B;  1OWA A;  1SQB K;  5TJH A;  1KZU B;  1HGZ A;  2IBZ G;  3VOP A;  1URQ B;  3H1L J;  3I5C A;  2KS1 A;  1BSN A;  2Y9Z A;  4HB1 A;  4H13 C;  2KIK A;  3H1H D;  4NPE A;  4OGQ C;  1Q86 Q;  2J58 A;  1DIP A;  1JO5 A;  2PRR A;  1NU1 G;  2M0B A;  4L73 A;  1LWU B;  1MZ9 A;  4I2L C;  1M1J C;  3AE3 C;  2B87 B;  1SQX E;  2R3S A;  3G4S P;  3PJS K;  3LIE A;  3H1J E;  3L75 G;  2WSC J;  2OAR A;  2XDJ A;  5TIS E;  1RE3 A;  1IFD A;  1MKM A;  3L71 D;  3VMY A;  3QWO C;  4UB6 E;  3L72 D;  3L36 A;  5CCH C;  3Q5P A;  5TIS H;  3GHG A;  4H0L D;  4D6T E;  1NYH A;  4UB6 H;  3WU2 E;  4WBA A;  5AW5 B;  1H0T B;  1VPC A;  4I6M C;  3O6Q B;  1FZC C;  2H7H A;  2Q5U A;  2HYN A;  4L75 A;  2KXP B;  3AEG C;  3IAO A;  2WQY C;  1M8O B;  2KB7 P;  1N73 B;  1M7L A;  4N3Y B;  3EFG A;  1PPJ E;  4PD4 H;  5KLI C;  2E75 C;  1W2B O;  4HJG H;  1DEE G;  3TK1 A;  3IR9 A;  1LP1 A;  1SQP G;  1FDM A;  2GUV A;  3CX5 H;  1OMI A;  1X0T A;  4WVZ A;  2P58 A;  5KKZ B;  2V7Q J;  1NTK G;  2Z5I A;  2AEF A;  1KB9 I;  3H1I D;  2KLV A;  3P8M C;  1KQF B;  1SFC C;  1S9K D;  4KJM A;  1U7M A;  1RQU A;  1EZV D;  3FXE A;  1YQ3 C;  5KJ7 A;  3BCC D;  2R5D A;  1YQ4 C;  1KQG B;  2XKM A;  2WSF H;  1URQ C;  2JJL A;  1S1C X;  2N9B A;  2BEZ F;  3B5N D;  2QJK B;  2W8Z A;  1YTZ I;  4W7Y A;  5KAI H;  1VQ8 P;  3CC4 P;  1GZL A;  5CBO A;  1NAY A;  4RJT A;  2QA4 P;  3BRV B;  3H6P A;  3NFQ A;  3LID A;  1MV8 A;  1FZF A;  1L0L K;  1LTJ B;  1NKN A;  3M0D C;  5KAF E;  1IFP A;  1AJY A;  1KOR A;  3RL0 C;  1RF1 B;  1GD2 E;  2H89 C;  1BCC J;  1LGH B;  2RH0 A;  1SQV D;  3L74 J;  1FC2 C;  1L4A B;  2IYO A;  1FJK A;  2ITA A;  1AVY A;  5B5E E;  1YHQ P;  3L73 J;  5AVW B;  1D7M A;  1LTI C;  1DD4 A;  2Y0D A;  5AVV B;  1KFN A;  1NTM G;  3M06 A;  2BCC E;  2H8P D;  3SWF A;  1SQQ G;  4N78 D;  3WUV A;  1M56 D;  4YTP C;  1FZB A;  5AW7 B;  1CW5 A;  1N73 C;  3BAS A;  1PZQ A;  2FYU D;  2ZYD A;  4RES B;  1QLE D;  1HJ0 A;  3C1L A;  4IFM A;  1YJ9 P;  3P8C E;  2D2C B;  1A02 J;  3AE2 C;  5CJ0 A;  4H13 D;  3WUU A;  2E76 B;  4HKZ H;  5KKZ C;  2AEJ A;  1KD1 Q;  3H1H G;  5AW1 B;  4OGQ D;  1FOS E;  1FZG A;  1ZRT D;  3L70 E;  2FYZ A;  5AVU B;  1Y47 A;  3S9O A;  2CK3 H;  3RK2 D;  1A02 F;  1SQX J;  2QJP C;  2Z5H A;  1L0L E;  3CWB D;  2YMY A;  3H1J J;  2Q1K A;  5KLV G;  3HD7 D;  2QJK C;  3A0H H;  1KYO I;  3H1K D;  3JSV C;  2ZXE B;  1ZP0 C;  4D6T J;  3L71 G;  3L72 G;  3MHV A;  3C9I A;  4ASV A;  2FFD B;  1UII A;  1LTJ C;  2NPS D;  2WPS A;  3B5N A;  2PAJ A;  3AED C;  2E74 B;  1USD A;  1M90 Q;  3G71 P;  3I55 P;  4KT0 J;  2A06 E;  1L4A C;  3TNU A;  1SVF A;  4EI2 A;  2WSS H;  1LTT C;  4C7R A;  1FBM A;  1EXI A;  3WUT A;  2KI7 B;  1BGY E;  4CPG A;  2YO3 A;  1BE3 E;  4I1L A;  3E1R A;  2W6J H;  1SQP K;  1OX3 A;  3F89 A;  1LT9 A;  3H1I G;  2HOD B;  1NWQ A;  4Y99 C;  1NGM B;  1IJD B;  1NU1 D;  3AEA C;  1NTK K;  1EZV G;  2QSI A;  2Y0C A;  3BCC G;  3T97 B;  2WT7 A;  1CI6 A;  2D2C C;  4AYC A;  1ZR2 A;  3W68 A;  2J59 M;  3L75 D;  3CCS P; 
#chains in the Genus database with same CATH homology
 3O8Z A;  2P67 A;  1YTZ T;  4W80 A;  5APS A;  3A5T A;  2YKP A;  2WPQ A;  3GHG C;  3VMZ A;  1PFI A;  3BVH A;  1J1D C;  2M3B A;  5APY A;  2CPS A;  2IX7 C;  5KJ7 D;  5AVQ B;  1FZE A;  1KFM A;  2OYH A;  2FFD A;  1QL1 A;  1LTA C;  3BRT B;  4LGD E;  1T8Z A;  1WRG A;  4ZKP A;  1IK9 A;  1KIL B;  2KYV A;  1N7L A;  2IFN A;  1NU1 K;  4LLH A;  2CPB A;  1GL2 D;  4EOT A;  3RK3 D;  3LW5 H;  5AVY B;  1OWA A;  1SQB K;  2BAS A;  1DX7 A;  3HE5 B;  1L4A A;  1RY3 A;  5CCH D;  1FJP A;  3M9B A;  1HVV A;  1KZU B;  1NAF A;  5APU A;  1HGZ A;  2R32 A;  3KYQ A;  3VOP A;  1URQ B;  2Q3I A;  1NHL A;  2R5B A;  3I5C A;  1IFM A;  3HUS A;  1FZA A;  1J2J B;  2FKW B;  5APX A;  2HPC A;  4HH2 A;  5CCG A;  3HD7 A;  1HGV A;  2N1T D;  2M8R A;  1N7S D;  2J58 A;  1JO5 A;  1NTM K;  2HOD A;  5KJ7 C;  1NOH A;  1LWU C;  1LWU B;  1XTG B;  3HE4 A;  1HH0 A;  2I1K A;  2WSE H;  3H32 B;  1MZ9 A;  4I2L C;  3TYY A;  1M1J C;  2Z4E A;  5AW9 B;  2A45 I;  1NH4 A;  3MIW A;  4WY4 A;  1JY3 O;  1H88 A;  3KDP B;  1JTH A;  2NPS A;  2O1J A;  1G1I A;  4GIF A;  3LIE A;  2LKM A;  1GL2 B;  1G2C A;  5CMZ A;  5CJ4 A;  3RK3 C;  4XE5 B;  2OAR A;  3RK3 B;  1KQL A;  2XDJ A;  3NXS A;  1JNM A;  1RE3 A;  1IFD A;  3VMY A;  1SFC D;  1FU1 A;  2HLO A;  4JYB A;  3L36 A;  5APQ A;  5CCH C;  3GHG A;  2P1J A;  3N7N A;  5CHX A;  1DH3 A;  2C0X A;  4WBA A;  1JY2 N;  3M0A A;  5AW5 B;  4WY4 C;  3B5N B;  2HG5 D;  1VPC A;  3VP8 A;  5BU8 B;  4I6M C;  3WMM 0;  3M91 A;  1FZC C;  4C7N B;  2H7H A;  2Q5U A;  1URQ D;  2HYN A;  5AW2 B;  1FZC B;  3V2P A;  2OYI C;  2KOG A;  3HTK A;  2N1T C;  2IPP A;  1FOS F;  3N4X A;  4JYC A;  1N7S B;  1KIL A;  2KP8 A;  3E1I A;  1NTZ K;  1HTL C;  3CI9 A;  5AVX B;  3TNU B;  2H43 A;  3CLQ A;  3L37 A;  2YO2 A;  1XTC C;  2KB7 P;  3MGN A;  2VRS A;  4OH8 B;  1N73 B;  1M7L A;  1GTW A;  3L4F A;  4N3Y B;  3V2Q A;  3EFG A;  2GM4 A;  1X9V A;  2W6B A;  1JCD A;  3HE5 A;  4EIJ A;  1GW3 A;  3TK1 A;  1RE4 C;  3IR9 A;  1IFJ A;  2YKQ A;  1FDM A;  1VDF A;  2GUV A;  5APT A;  1NO4 A;  3L35 A;  2Z5I A;  3RL0 D;  1T2K C;  1KIL C;  1HJB A;  1OXZ A;  2KLV A;  3P8M C;  1SFC C;  1S9K D;  3P7K A;  1SFC B;  3TSI A;  2ZFC A;  2KSJ A;  2Q7C A;  1ZR4 A;  5KJ7 A;  2XU6 A;  1LWU A;  4GKG A;  1T3U A;  2R5D A;  3MD0 A;  1CI6 B;  2WT7 B;  3H32 A;  4AQR D;  1SP4 A;  2WWW A;  2XKM A;  1LTB C;  2WSF H;  1URQ C;  1M1J A;  2JJL A;  3M0D A;  2N9B A;  3B5N D;  1YTZ I;  5AW8 B;  4M3L A;  1LTS C;  4W7Y A;  5BU5 A;  1GL2 A;  2QM7 A;  1GZL A;  1GK4 A;  2MJZ A;  1IO4 A;  4W7Z A;  4B86 A;  3BRV B;  3H6P A;  1RF0 C;  3NFQ A;  1SQQ K;  3LID A;  5CCH A;  2OYH B;  1MV8 A;  1FZF A;  1L0L K;  3A7O A;  1DEB A;  5AW0 B;  1LTJ B;  1NKN A;  3M0D C;  1X8Y A;  1RF1 C;  1CSB A;  3RL0 C;  3V2R A;  1RF1 B;  1GD2 E;  3RL0 B;  3PP5 A;  3A3Y B;  3NTN A;  4C7N A;  1LGH B;  3OJA B;  1JY3 N;  1FZC A;  3T97 A;  2PP6 A;  2WIT A;  1GL2 C;  2OYI A;  2Q9I A;  2N1T A;  1N7S A;  3A2A A;  1L4A B;  1ZLL A;  1J1E B;  1FJK A;  2JEE A;  2R3C A;  2C9L Y;  3EQ2 A;  3U1A A;  3RK2 B;  3UIA A;  5AVW B;  1N86 A;  1LTI C;  5AW3 B;  2GUS A;  3MTU E;  5AVV B;  1KFN A;  3V4W A;  4IFD K;  5AVR B;  3VP9 A;  1RE4 A;  2O1K A;  1HUC A;  3B5N C;  3HD7 B;  2H8P D;  3M06 A;  4N6J A;  1JOC A;  3SWF A;  4N78 D;  1AFO A;  1FZB A;  5AW7 B;  1N7S C;  1FAV A;  1CW5 A;  1JY2 P;  1JY2 O;  1LTG C;  1SFC A;  1N73 C;  5AVT B;  1SQX K;  4ZKU A;  3BAS A;  2IFM A;  2FXM A;  4RES B;  1NKZ B;  1JTH B;  5KLV K;  2NPS B;  4IFM A;  3VYI A;  2POH A;  3P8C E;  5AW6 B;  2C9N Y;  1A02 J;  4C46 A;  1SQV K;  2YNY A;  5CJ0 A;  1URQ A;  4DZO A;  4AUW A;  5AVS B;  1LT9 C;  2HFE D;  2XNX A;  5AW1 B;  1LT9 B;  1ZN5 A;  1GW4 A;  3P32 A;  3GHG B;  1FOS E;  5APW A;  2QM8 A;  4XA4 A;  2A45 G;  2L5G B;  2WSC H;  1T3J A;  1FZG A;  3M9Q A;  1J1D B;  1L4A D;  5BVZ A;  1IC2 A;  3OA7 A;  2FYZ A;  3V4Q A;  2W27 A;  5AVU B;  1EQ7 A;  1YYC A;  1RF0 A;  1WT6 A;  3RK2 D;  1A02 F;  3BAT A;  3HTK B;  2E43 A;  2Z5H A;  1LTJ A;  1GDT A;  5KTB A;  2YMY A;  5APV A;  1GU5 A;  1QL2 A;  1MFZ A;  1JMM A;  2I1J A;  1W2E A;  3HD7 D;  5CCG D;  3U1C A;  1RF1 A;  3KQG A;  3R2P A;  2ZXE B;  1S9K E;  1HWT C;  1IFI A;  2P7J A;  3M9H A;  3NMD A;  2FYU K;  2WZ7 A;  4O9B A;  4LC1 A;  1GK6 A;  2OYH C;  2WPR A;  2FFD C;  1IFN A;  3C9I A;  1X79 B;  2FFD B;  1JUN A;  4WY4 D;  3HRN A;  1LTJ C;  2NPS D;  1H8A A;  2WPS A;  3B5N A;  3VN0 A;  3V5B A;  1N2D C;  4HYT B;  2PAJ A;  1Z56 A;  1ZV8 A;  3VMX A;  1E5W A;  2W6A A;  1L0N K;  1L4A C;  1J1E C;  2A45 H;  3TNU A;  4DOJ A;  1SVF A;  4WB4 A;  3IFM A;  3G3Z A;  1LTT C;  1N73 A;  4C7R A;  3RK2 C;  2O01 H;  1M1J B;  1FBM A;  4JF7 A;  1JY3 P;  3HUS C;  1JCC A;  3B8E B;  1CZQ A;  3HUS B;  4GT1 A;  1H89 A;  1MUU A;  2HPC B;  1SLQ A;  5CCG C;  2YO3 A;  3HD7 C;  2YKO A;  3OAK A;  2XZR A;  4I1L A;  1T2K D;  1KIL D;  2XV5 A;  4IFF A;  3CL3 D;  2P2U A;  1SQP K;  5AW4 B;  1LT9 A;  2HOD B;  1NWQ A;  4Y99 C;  1HBW A;  1IJD B;  4Y99 B;  1AQ5 A;  3HE4 B;  3VTP C;  2C0W A;  1NTK K;  5AVZ B;  4KHX A;  3MUD A;  4WY4 B;  3SWY A;  3P8C D;  3KPE A;  2NPS C;  3II6 A;  1G1J A;  2WTY A;  4N78 E;  2WT7 A;  1CI6 A;  3V2N A;  3U59 A;  2OYI B;  4AYC A;  2E42 A;  2N1T B;  1G2C B;  1ZR2 A;  2J59 M;  1GU4 A;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...