1LTLA

The dodecamer structure of mcm from archaeal m. thermoautotrophicum
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
VDKSKTLTKFEEFFSLQDYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNIDRLRKNVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQSTNMITEPSLCSECGGRSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRTVRDERTKRFKNFIYGNYTEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication initiator (Cdc21/Cdc54)
publication title The Structure and function of MCM from archaeal M. Thermoautotrophicum
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Replication
total genus 61
structure length 239
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14551 MCM_N MCM N-terminal domain
A PF17207 MCM_OB MCM OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1ltlA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ltlA02
3.30.1640.10 Alpha Beta 2-Layer Sandwich mini-chromosome maintenance (MCM) complex, chain A, domain 1 mini-chromosome maintenance (MCM) complex, chain A, domain 1 1ltlA01
2YTVA 2OWOA 4UY8C 4WJ4A 3LGJA 4BA2I 1Q1BA 1X56A 3G4SA 4A3FH 4DV5Q 1XMOQ 4KHPL 4GLXA 1NNQA 3IRBA 1QYBA 1H7VA 5M3FG 3CD6A 2EQSA 4R4IA 2Q2UA 5GADC 2MO1A 1Y1VH 4UP7A 3L2PA 4GN3B 1T9OA 1RIPA 3S1RH 2HHHL 3KOJA 3U4VA 3KYHC 1Q81C 2UU9Q 1O7IA 1BVSA 1IU5A 3FP9A 4R4OA 3OW2A 3PUVA 1VQMA 3UDFA 3HFZB 4JOIA 3UE1A 3S16H 1YUXA 2K52A 2PQAA 1HR0W 1SMXA 3PUWA 3D0FA 3HOUG 1A63A 5DLQE 3A5UA 4A3EH 5C4XH 3GDEA 3VDYA 1XNRL 3GTOH 2K5HA 3H3VI 3CQZH 3S14H 2CWAA 1WFQA 3GTGH 4GLVB 4BY7G 1YITA 4MNOA 1K9MC 1CKNA 2DSXA 1WOCA 1N8RC 1KD1C 1IZ6A 5BR8L 2GVAA 1BFYA 5GAHC 2Y0SG 1VQGA 3F8TA 2R92G 2MS3A 2D62A 3HKZG 3T1HL 2KCMA 3HOXG 1XNRQ 2R93G 2OTLA 2BH2A 3HOYG 1VQDA 2GN5A 1JE5A 4A3IG 2JA5H 3H0GG 3PO3H 1K8AC 3S17H 1SMMA 2WP8J 1GD7A 5M3MG 1D8LA 3W1BA 3CC2A 2JEAI 1QZGA 1H95A 1HJPA 5BR8Q 4A3MH 2XGTA 4LNQA 4XIGS 5GAEC 4HJ9A 1Q86C 1YEZA 3CC7A 1W2BA 1PH8A 4A3GG 3U4ZA 2MQHA 4UP8A 1IYJB 4DNIA 4B3RL 4NXNL 2VZAA 4EX5A 4IJHA 3I56A 2IHFA 5IE8A 3S2HH 1ASYA 4QGUA 1RB9A 2E2HH 4A3LH 4X6AH 4PZ8A 4DKAC 1K8GA 3MEFA 4A93H 1AE3A 3RN5A 2CKZB 2K5VA 1FL0A 3K8AA 2I5LX 2VY3A 3A74A 3ER0A 4IO9A 2R6GA 1PFSA 1SRUA 1BRFA 4JC0A 5J3BA 5M3FH 1TXYA 5IY0A 1RDGA 3A44A 3OTOL 3H15A 4L5RC 1DVBA 4A3KG 2Z0SA 2PMZE 1IBLL 3FKIG 3CF5A 4GOPC 3K81C 4NXNQ 4YY3L 4LF9Q 2I5HA 5AJ3L 3ERSX 1XMQL 3MPSA 1YVCA 2ATWA 3JAMi 4JI5Q 4DR6L 4R4TA 3KYYA 3I7FA 4IFDI 1V1QA 2BA1A 3CXCA 1HH2P 2LXKA 3BZCA 1IRNA 3G71A 1R9TH 1PH5A 4LF8L 4OX9L 1FJGL 3RN2A 4DR4Q 1Z9FA 4PMWA 2LSSA 3HOUH 4YCWA 6RXNA 1VQEA 4DAMA 2AHOB 2YU9H 1J6QA 3MXNB 1EYGA 1IBLQ 2JA8H 5LMUL 2WAQE 2C35B 2V3BB 2RCNA 2V1CC 4P73A 4A75A 4ALPA 1GM5A 4DR6Q 1LKMA 1P16A 1B13A 2QA4A 3T1YL 4LF6L 1V9PA 1GKHA 3S24A 3E0EA 1VQAA 4OX9Q 2K50A 1PVOA 1FJGQ 4JG2A 3CPWA 2L15A 1VQHA 3TRZA 1KIXA 2E2IH 4PZ7A 1FHMA 4GNXB 2GVBA 1S2ZA 4X62L 2ZJQA 4B3SL 4JI7Q 2R92H 4GKJL 3HOXH 2Q2HA 3DLLA 4XTCS 3K80C 2KBNA 5IYBG 2R93H 4DR3L 4YWLA 2A8VA 1L1OB 1EOVA 2ID0A 2WB1E 5GAGC 5C0XI 1VQ4A 4GLAC 1X3FA 2ZTDA 1SE8A 1R0JA 2HIXA 3H0GH 4X65L 4DV0Q 4A3IH 4LF6Q 2F4VQ 1TWGH 4JI2L 4JBWA 4C3IH 2ZM6L 2KENA 5FJ8G 1QUQA 1KL9A 2YV5A 1PHJA 3PO3G 1PH7A 1SROA 4A3GH 4OWTB 4DV5L 4DR1L 2E5LL 4GKJQ 1XMOL 4HIOA 3CCSA 1YHQA 1JJCB 4A3MG 3I4NH 5M5YH 4DR3Q 5M5XH 2E8GA 1XTDA 1I50H 1G6PA 1UEBA 2UU9L 1Y14B 1YK4A 2MFIA 4MZ9A 3CCMA 1UE1A 4P74A 4JI2Q 1CAAA 3PIOA 4AR6A 2JA9A 1Q82C 4A3LG 2ZM6Q 2RF4A 2KN9A 1VQBA 2NZOA 3M9BA 5FLXc 3BU2A 4A93G 3CW2C 4UPAA 4DR1Q 1HZCA 1Q12A 1L2FA 3DM3A 4A3KH 2MO0A 3FKIH 3JC66 2E5LQ 3S2DH 1UE6A 4A3BG 1SN8A 2OQ0A 1VQ7A 3PUYA 3G6EA 4AR5A 1NJIC 4DV2Q 1Z47A 4JI4L 2PNHA 4OO1G 2UUBL 3TEHB 3NEMA 4JI8L 5JEAG 1E1OA 1MKHA 1YNXA 1B70B 3TS2A 4GNXC 2JA6G 3SGIA 4QIWE 3F2CA 3KLWA 4R4QA 3J80i 4LW1A 3RLFA 4Y7NH 5C3EG 4DR4L 1VQJA 2F52A 4O2DA 4TVAB 4RMFA 4X66Q 2ZTEA 1L1OC 1OXSC 2PVXA 1Q1EA 4BA1I 3CCEA 4DV4Q 1X54A 2HT1A 3S1QH 1PH1A 1VCXA 1E3PA 1EIYB 3HOVH 4JI4Q 3CCLA 1CKOA 2F3IA 2JA8G 2UUBQ 5ELNA 4JI8Q 4GOPB 2IX1A 3U58A 2UXCQ 1SMUA 1YI2A 3KFUA 4MTNA 4ME3A 2RDVA 2CQOA 2N3SA 4QQBX 3KDFA 4NPSA 3KF6A 1B7YB 1IU6A 2LCQA 2AKWB 1X6OA 4IJLA 4KHZA 1PH3A 2OCEA 1XPUA 2QL0A 5IYBH 1N32L 2R7FA 2VNUD 3PV0A 3E9IA 4IPGA 2D0PA 4P75A 1HZBA 4A4IA 5JJLA 2K5NA 1LUZA 4JCVE 4GN4B 3H3VH 2N78A 1R0HA 1WCMG 1LTLA 4EQ5A 1LYLA 1MIUA 4KLKA 1X3GA 2D0OA 3SS2A 4OXPA 1JB7A 3CPFA 5FJ8H 1TWAH 3JAMc 3UDGA 1C0AA 2DGYA 1X3EA 3W1GA 4R4CA 1C7YA 4AYBE 3F2DA 2PI2A 2NN6G 3HOWH 1N32Q 3M7NA 4OONA 4WJ3M 1E22A 3RLOA 5IYDG 4JI6Q 3NENA 4LUVA 1K3RA 1QVCA 2HQLA 3WWVA 2QEXA 4DV1Q 1M90C 3AFQA 1GO3E 1MJEA 1I6HH 4POGA 1T9QA 1IBKL 3I4NG 4LF9L 3PWFA 4JI5L 1B2OA 3RZDH 1T9PA 1HNZQ 1CKNB 3I2ZA 3S1MH 1G291 2OTJA 2JK8A 1G51A 1N34L 1OXTA 3KYVA 1PH9A 2BH8A 1VQKA 4A3BH 1GVPA 2UXDQ 1BKBA 2DUDA 4J15A 3CCVA 3NBHB 4B3RQ 3KYXA 1VQ5A 4B3ML 1XPOA 3GTLH 1EWIA 3PGZA 4KI0A 3PF5A 1YJ9A 2JA7G 1IBKQ 4IOAA 1HNXQ 1JJGA 1EQQA 2JA6H 2MNAA 5C3EH 4OWWB 4DV6Q 3CC4A 5JEAJ 3CAMA 4K9FA 3I4MG 1N34Q 4APVA 1SFOH 1YZ6A 4HIDA 4DR5Q 3OYYA 5E7NA 1S40A 4B3TL 1NE3A 4JI7L 4RG1A 1HNWL 3Q8DA 5RXNA 2ZJRA 4B3MQ 4AIMA 4TPUA 4LUOA 5LMNL 1Y1WG 1A0IA 5IP7G 2Z6KC 4DV0L 1XNQL 2B63H 2A19A 1S24A 3CCUA 4JOIC 3UDXA 4YWMA 4JI1L 1QVGA 4BY1H 3KYUA 2F4VL 5IWAQ 1YJWA 3HOVG 1L1OA 4R1JA 1KRTA 4JBMA 1A62A 1C9OA 4JBKA 4Y52H 1PA6A 4BBRG 1LM0A 2VS1A 2HR5A 1S72A 4RXNA 1J5EL 4B3TQ 3M4OH 4JYAL 4L5SA 1HNWQ 4AH6A 5JJKA 1WCMH 1MJCA 2VW9A 4BBSG 4K0KQ 3I55A 1UE5A 4JBJA 4JV5Q 5LMNQ 2AWNA 7RXNA 4NB3A 1Q8KA 5C44G 1VQOA 2LXJA 2HIVA 3J7A5 2CCZA 1XNQQ 2WAQG 1FHHA 4JI1Q 3M85A 8RXNA 5IYDH 3J80c 2VQEL 2ZJPA 4DUYL 1YHAA 4AQYL 1K83H 5FLMH 3D31A 1J5EQ 4JYAQ 3JC62 1SLJA 2KCTA 1M1KC 3HOWG 3PF4A 1N33Q 2UUAQ 3J81i 2K4KA 3W5OA 2R7ZG 3M3YH 3BZKA 1I5FA 3TQYA 2WFWA 4DV2L 3A0JA 5GQOA 4LWCA 2WB1G 4POFA 1L0WA 3ULJA 2M4YA 4IPDA 4DV3Q 4HJ5A 1B8AA 5IT9c 4LF5L 2ASBA 4BXXH 3EBEA 3KJPA 2VQEQ 4DUYQ 1KC8C 1WI5A 1BE7A 4AQYQ 3RNUA 3GTQH 1R0FA 4X66L 1JT8A 4LFAQ 5M5WH 4JI0Q 4DV4L 3AFPA 3GD7A 4GKKL 3AQQA 5IP9G 3FHWA 4DR7L 4AR4A 1TWHH 4DV7Q 2IHEA 1UE7A 2K14A 3I4MH 3RZ6A 3RYGA 2PYAA 2UXCL 1QZHA 1YUZA 3PSIA 2NVXH 3STBD 2N8NA 3L7ZC 3L0OA 4LF5Q 1KRSA 1VQLA 3K7UC 1XJVA 1KHIA 4C3JH 3B6YA 4GOPA 1LKPA 2VUMH 1Y1WH 1B2JA 1QCVA 1UWVA 5IP7H 2UXBQ 2AWOA 4L5TA 4HJ8A 4GKKQ 4GS3A 2B29A 4DR7Q 1N36L 1NMFA 2N49A 3E9HA 4JI3L 3CCJA 1T9HA 1R0GA 1VCIA 4HJ7A 4A3JG 4BBRH 3J81j 2B63G 4LFBL 3UDIA 1I94L 4DK3C 4IFDG 4BY1G 1VQ6A 1X65A 3RZOH 4YWKA 4O0AA 2ES2A 1NTGA 3PO2G 1K0RA 4BBSH 1D7QA 4JI6L 4FDBA 2Z6KA 5C44H 3BJUA 4DV1L 2Y0SE 1B71A 1C09A 1WJJA 2BA0A 3EIVA 4DK6C 1JYBA 3KJOA 2YTYA 2KHIA 2R7DA 3HKZE 4DUZL 1RDVA 1YJNA 2YTXA 1N36Q 4JI3Q 1IBML 4KHPQ 2CFMA 1HNZL 4DR2L 2JJQA 5HGQA 2RHSB 1XPRA 1HR0L 4LFBQ 2HHHQ 1PH6A 1I94Q 1VS0A 2UXDL 2PQAB 1NMGA 2R7ZH 1E7ZA 4PG3A 2GMGA 1E8JA 2Q2IA 1NBWA 4TQUS 3ULLA 1PYBA 5FLMG 1Q7YC 3AEVA 1KQSA 4YHHL 2RHQB 4DUZQ 1X55A 2KHJA 3RLNA 4H02A 4NXML 3HOZH 3RZTA 1HNXL 4GN5A 4P72A 2JQOA 5C0XG 2I5MX 1IBMQ 1CUKA 1TWCH 2IT1A 3GTPH 4DR2Q 3KDFB 2VQFL 3KF6B 1VQCA 1DX8A 3HKSA 3CCRA 1ZRPA 4DV6L 1HR0Q 1OXVA 4LFCL 1K73C 2I0QA 4LUZA 5IYCH 1P8LA 2IY5B 4A3DH 2PVEA 5GROA 1SR3A 4YCVA 4DR5L 4YCUA 4AYBG 4X64L 4HIKA 4BXXG 5IP9H 1DGSA 3TREA 3EN2A 1A8VA 1Q46A 3RR5A 1VQPA 1E24A 4YHHQ 3KYWA 1PH4A 4NXMQ 1S3OA 4IPHA 4IOCA 1YK5A 1CSQA 1I3QH 1KAWA 3GTJH 1JMCA 1QVFA 2NVQH 1LKOA 3AYHB 2VQFQ 3T1HQ 1VQNA 4A3CH 4OO1I 5IWAL 3ICEA 5K36G 4LFCQ 3GTKH 5HY6A 5C4JH 2NZHA 4P71A 1ASZA 1NY4A 3PCOB 4X64Q 5LMNW 2YYZA 5ELOA 2NVTH 4HJAA 3PUZA 4K0KL 1RYTA 1OXXK 3J81c 2VUMG 1YHBA 1X9NA 1OTCA 4JV5L 1RL2A 4GNXA 1EUJA 3ZJYC 4A3JH 1EIFA 4A3FG 1CSPA 1AH9A 1VQ9A 4L5QA 3JC63 2Q2TA 1AE2A 3G48A 3PO2H 5JJIA 4IPCA 4QJFA 1HZAA 1WYDA 2EIFA 4IFDJ 1HZ9A 1BQ8A 3QVDA 1Y1VG 2KKDA 2JA7H 1N9WA 4DAYB 1N33L 1SMWA 4QY7A 2UUAL 1BQ9A 1E1TA 1PV4A 3OTOQ 1OXUA 1W3SA 4C3HH 3K7AH 3CCQA 5AI2A 4UP9A 3STBC 5AI3A 3PUXA 4DV3L 4PZ6A 2H5XA 1BBUA 1CADA 3CP0A 3J7ZC 4YY3Q 4BY7H 4DPGA 1YBYA 5AJ3Q 1XMQQ 2VL6A 4A3EG 2UUCL 2FXQA 5EAYA 4LF4L 5C4XG 1YV1A 2NN6I 1KXLA 2QGQA 4LF8Q 2E2JH 4LFAL 3M4QA 4JI0L 1U5KA 2JE6I 3PIPA 1U0LA 5H1SE 1IROA 3S1NH 2B3GA 4DV7L 3TS0A 2OQKA 1YIJA 5C0XJ 2CWPA 2K75A 2IX0A 3KF8B 3K0XA 2XTIA 4LF7L 5LMUQ 3HOYH 3HOZG 4A76A 2K2DA 1IXRA 1CKMA 1FGUA 1JJ2A 2NVYH 2UUCQ 2ALYB 5M3MH 3T1YQ 4LF4Q 1IL2A 2EXDA 3GO5A 3S15H 1EFWA 5IYCG 1R0IA 4A3DG 1EQRA 3PZAA 2PI2E 3I4OA 2UXBL 4C2MH 2JA5G 4X62Q 4B3SQ 2AMCB 3CMEA 3F2BA 4HIMA 3ULPA 1RWDA 3GTMH 2A1AA 2JEBI 1PYSB 3F1ZA 4OWXB 4LF7Q 1VQ8A 3CMAA 1S30A 3M4PA 1BBWA 1QUQB 1V43A 3U50C 1FVIA 1VQIA 4X65Q 4QL5A 1TWFH 1VQFA 1PH2A 3A5ZB 3UE0A 3NELA 4A3CG 4AR3A 2ZTCA
chains in the Genus database with same CATH superfamily
3TZDA 2OWOA 3AMUA 1O80A 4WJ4A 1F9RA 4BA2I 1Q1BA 1SAPA 1X56A 4DV5Q 4GLXA 4AI3A 1U4PA 5M3FG 5GADC 2MO1A 5J22A 1CT1D 1HHVA 3H0GL 1KNEA 1EY8A 4R4OA 1JORA 1TWGL 3PUVA 3TN2A 1B4OA 2F0EA 4JOIA 1H9JA 3HEJA 3MZ5A 4C56C 3D0FA 3HOUG 1WD1A 1KLUD 3GDEA 3VDYA 1XNRL 3S14H 5MLC3 4I7AA 4J6HA 1PRTD 2KECA 3CHBD 4ZCKA 1YITA 1SNMA 2DSXA 2A6EC 2F0QA 4CKCA 1WOCA 3OIPA 2SEBD 1QWYA 5GAHC 4A3DB 2Y0SG 1UUPA 4A3KL 3OW7A 2R92G 1PFWA 3T1HL 2KCMA 2XJTA 2BH2A 1TT2A 1VQDA 4EVOA 4RKLA 4A3IG 1I4HA 5D3DA 4FXKC 1D8LA 1QZGA 2EJMA 2C9OA 2L12A 1EU3A 1RF2D 5GAEC 1YEZA 4CBVA 1W2BA 1PH8A 3U4ZA 4UP8A 2VZAA 3OMCA 4EX5A 3I56A 2IHFA 1S5DD 4HEDA 2A68C 1VDZA 5C4ZA 4QGUA 4X6AH 3GTOL 5J1ZA 4DKAC 1K8GA 1AE3A 3RN5A 3A74A 3ER0A 2R6GA 1Y8OB 2K01A 1C8CA 5J3BA 2A69C 1KTKA 3OTOL 4DAYA 1IBLL 1HRJA 3FKIG 4XT3B 1JE4A 4FXGC 3P8BA 1SYFA 2EY6A 3MPSA 1YVCA 2JP1A 2HDMA 2YU9B 1E2ZA 3KYYA 3I7FA 1EIHA 2BE5C 3K59A 2CH4W 4PMWA 4DAVA 1I4RA 2LSSA 4XYQA 1STBA 4A3ML 3MXNB 2NTTA 5LMUL 1ESFA 3D6WA 3ZG6A 1GM5A 3DUZA 1B13A 4DA2A 1GKHA 4A3LL 1FJGQ 4KD3A 3HOYB 3CPWA 5CV5A 4A93L 1VQHA 2E2IH 3GTKL 1S2ZA 1F2ZA 4X62L 2Z4HA 5M3MB 3HOXH 1EY4A 1ZEQX 2R93H 4C3IB 4EQOA 5IYBG 4YWLA 2L1BA 1BCPD 5GAGC 1JWSD 1MSHA 2EOTA 1R0JA 1PZJD 4LF6Q 3K57A 2KEDA 1SROA 1I50B 4A3GH 4GKJQ 2E5LL 2KOLA 4O42A 4HIOA 1DXMA 1JJCB 1A3UA 1RKNA 3R2TA 1K3BC 4HMIA 4DR3Q 1G6PA 2JA8L 3DMUA 3TBIB 2UU9L 3LX0A 4MZ9A 5C4HA 4JI2Q 4P74A 4AR6A 2JA9A 5EPJA 4HTHA 2RF4A 2PZWA 4UPAA 3DM3A 3FRPB 2MO0A 1G91A 4A3BG 3PUYA 3G6EA 2CVRA 1WCML 4AR5A 5EKIA 1DOMA 5C6AA 2QCPX 2RDFA 5JEAG 4IURA 3S1QB 3SGIA 2PMZB 5C3EG 4AHXA 2F52A 4G57A 4TVAB 1GHJA 2ZTEA 1G2TA 1X54A 1PH1A 1VCXA 1E3PA 4RHSA 4ZN3B 4V0BA 4DNRB 2FHTA 3HOVH 1TU2B 1Y8PB 4OGQC 2UUBQ 5ELNA 4GOPB 2KEEA 2A5HA 3KFUA 4MTNA 2CQOA 1B7YB 2LCQA 4IJLA 2XVSA 1XPUA 3VPBE 2SNSA 2QL0A 2F0JA 3N6RA 1ZYRC 3PV0A 2AQ2B 2A6HC 4GN4B 5EKKA 1LTLA 1D1IA 3VR5A 1MIUA 4KLKA 4OXPA 1MD2D 3SS2A 3KK7A 2RA4A 3CPFA 1KABA 1TWAH 1NR4A 3JAMc 4PMCA 1X3EA 5DM63 4AYBE 3RMHA 3DM1A 4WJ3M 4OONA 1E22A 3NENA 4B3RL 3WWVA 2PW5A 1GO3E 1F2MA 1T9QA 3I4NG 1WD0A 3PWFA 4F7XA 4KY5A 3TDQA 4S3SA 2PQEA 1EL0A 4JI5L 1B2OA 3SK5A 1Q8IA 4FO2A 4UY81 4XXEA 1M4VA 1G51A 1BBXC 2Z1CA 4DF7A 1N34L 1VQKA 2EY2A 3OWFA 1EIGA 2DUDA 3NBHB 1VQ5A 4BBSL 2F0VA 2MP1A 1S5BD 2B8GA 3GTLH 1YJ9A 1AFPA 3OPOA 5BN3A 1DONA 4QUFA 1IBKQ 3B08B 4IOAA 1HNXQ 2JA6H 1ICFB 2KHSA 4ID6A 4DV6Q 3CAMA 2L4NA 5E7NA 5A2QE 2CKCA 3FDTA 4JI7L 4QF4A 1HNWL 4C3JG 4QIWB 1Y1WG 2F1MA 2A6ED 5ISRA 2E2IB 4DV0L 5IOCA 4H0LC 3CCUA 4IUQA 4JOIC 1L0YB 4R1JA 1KRTA 3S1ML 4IUUA 3URYA 4BBRG 1LM0A 2HR5A 3M4OH 3TP5A 4JYAL 2XJQA 1RODA 3FMCA 2VW9A 1DM0B 2DN8A 2AWNA 2LXJA 3J7A5 2CCZA 2ERSA 3R3OA 2ICEC 3MWYW 8RXNA 1XYIA 2IPKD 5IYDH 3PIO1 1YHAA 1AN8A 2MPMA 2B39A 2MJ8A 3HOWG 2A68D 2AUJD 3J81i 4M8AA 1DOLA 1EY5A 4F87A 4DV2L 2C6BA 5GQOA 2WB1G 5ELBA 3VR4A 2IX3A 4DV3Q 1B8AA 5M5WB 3E3XA 5IT9c 4LF5L 4DUYQ 3GTQH 1WVLA 1KC8C 1BE7A 4AQYQ 1TWHB 3RNUA 4MIUA 4TKOB 1BO0A 4LFAQ 4DV4L 4GKKL 5IP9G 1PTOB 4AR4A 3I4MH 3RZ6A 3RYGA 1YUZA 2NB0A 3L7ZC 3WWLA 1KRSA 1XJVA 4ME5A 1B2JA 1QCVA 1UWVA 5FLML 4RCNA 2AWOA 2UXBQ 2E2JL 4DR7Q 4R9WA 5MFZA 3E9HA 1FR3A 3HRZC 1VCIA 2HCIA 5CMDA 4A3JG 4KKSA 4BY1G 4O0AA 3R2IA 1IW7D 2Z6KA 5C44H 1DD2A 3P20A 4G7OC 4K5WA 1JYBA 4DUZL 1SSOA 4JI3Q 2L9HA 2R7ZB 2JJQA 2E75C 1I94Q 1NMGA 1E8JA 1PTOC 2EYPA 4DN4M 2RHQB 5IP7L 3HOZH 2JQOA 2LFNA 1CUKA 4K5VA 2VQFL 1TIID 1VQCA 2F3WA 5T1GA 1ZRPA 1P8LA 4DR5L 1SR3A 1D1KA 1XWEA 1I3QB 4HIKA 4BXXG 1CA6A 3TREA 4IALA 1E24A 4YHHQ 4NXMQ 1S3OA 1X3QA 4IPHA 1YK5A 1CSQA 1JMCA 1QVFA 4KHVA 4A3CH 4OO1I 3ICEA 2NVTB 1GXDC 5HY6A 5C4JH 2NZHA 3TZUA 4P71A 1LO5D 4X64Q 4IUPA 3PUZA 1RYTA 2PPTA 2R7ZL 1PRTF 4NDXA 2VUMG 1X9NA 4XT1B 1EUJA 3ZJYC 1AH9A 3LWRB 3IFDA 2JA7B 3JC63 2Q2TA 1AE2A 2JXMB 3NQTA 3C3LA 2A6HD 5ELCA 2EIFA 4C3HB 1BQ8A 3W3AA 2KKDA 4NW2A 4K8IA 1N33L 1SMWA 2JA5L 5D14A 3S17L 1MGSA 4L6TB 5E4XA 1E1TA 3DEOA 3H91A 1OXUA 1W3SA 3T53B 3A56A 3CCQA 5AI2A 2HVYC 3QWNA 4U671 4EGVA 1TS5A 1I3QL 4BY7H 4YY3Q 2FMCA 4DPGA 2KJXA 5CGKA 1XMQQ 2VL6A 1P7PA 3UI2A 1QNUA 5EAYA 5C3WA 4LF4L 3S1NB 3S2HL 1KXLA 4XDXA 4CDEC 2ZIXA 3I72A 1TVXA 5C0XH 4AYBB 1JB3A 5H1SE 4WJWA 3S2DB 2WIIB 1T5EA 2F0MA 5M3FL 3K6OA 2K75A 4LF7L 3L9AX 2PSMC 1JJ2A 1L0XB 3GTMB 1KDCA 4K6LA 5IYCG 1R0IA 1B50A 1NCVA 4C2MH 1EY0A 3DHQA 2AMCB 1TWFB 4HIMA 5DM71 5K36H 3E0JA 5E1FA 1SMYC 1LT5D 3CMAA 1STYA 5KIXA 2EYFA 2AQ1B 1BBWA 1QUQB 5IGCA 4HMJA 1DCZA 1GHKA 1VQFA 1PH2A 2RDHA 4UY8C 2DJFC 1RD9D 4CDDC 2K5WA 4A3FH 3S1RB 4KHPL 5F2DA 1CTMA 4DXFA 1NNQA 2R92L 4CDFC 3PIP3 2Q2UA 4K5XA 1PXUA 3LWVB 3E5SA 3L2PA 3AB9A 3GV6A 1WTPA 3KYHC 2EE1A 1O7IA 4A3IL 1BCPF 3S2DL 2PW7A 1IU5A 3FP9A 4A3EB 3S15L 5C4XB 2QDBA 4IQZA 1QOHA 3HFZB 3UE1A 3FPPA 3GTGB 2K52A 3T4AC 1SMXA 3KUPA 3K5NA 2F0OA 1BDOA 1WTXA 3A5UA 3GTOH 5M5YL 2RSNA 2CWAA 1SJED 1SBBB 3DEPA 5ELFA 3EVQA 3MEHA 4MNOA 1CKNA 4TVMA 2O4XA 3QQCE 4F8MA 5DAUA 3K58A 1A15A 1VQGA 3SK8A 1LV9A 5CR3A 2MS3A 2D62A 4AHZA 2F0UA 3HKZG 3HOXG 3H99A 2R93G 3VR3A 2GN5A 3S1RL 5EBCA 1YNND 2WP8J 1DOKA 2D9UA 4CKEA 4A3MH 1G2SA 5BR8Q 4XIGS 3J81E 1Q86C 3CC7A 4A3GG 5I9PA 2G9DA 4A3LH 4PZ8A 1ZXTA 3CQZL 4A93H 2K5VA 1FL0A 3GTKH 1PFSA 4JC0A 4MN3A 2K05A 1F9SA 5IY0A 4KN4C 3H15A 4L5RC 5IYBL 3BDCA 1STGA 4B9WA 2PMZE 2F03A 3I73A 2CW0C 3K81C 5AJ3L 2JN4A 3ERSX 1KNAA 1TKWB 1W6JA 4IFDI 1V1QA 2BA1A 3CXCA 2LXKA 2H4OA 4LF8L 4DR4Q 1FJGL 4I7ZC 1PH5A 4BY7B 5FK9C 3JR7A 6RXNA 2YU9H 1J6QA 2OXPA 3D3RA 1WTHA 2NWGA 2JA8H 2WAQE 2V3BB 3VYRA 4FF1A 2V1CC 1PFBA 2DY7A 4CJ0B 2QA4A 2G5DA 3T1YL 4LF6L 3BDOA 4HAEA 3E0EA 4OX9Q 1AEXA 2L15A 1M8AA 4KTAA 4DAPA 3TRZA 3LWUA 1ET6A 4PZ7A 2GVBA 3H0GB 4B3SL 4GKJL 4KKUA 3VA7A 2M6PA 2F0NA 2Q2HA 1TWGB 4XTCS 3K80C 4DR3L 2K5DA 4E6IA 2V0FA 1SJHD 4C2MB 3SK6A 4X65L 3CKIB 5G3LD 4JI2L 4C3IH 2AQ3B 3PO3G 3ND8A 1XMOL 5TSSA 1YHQA 1EY6A 4MHEA 1ILPA 2E8GA 1Q90A 3IFTA 4AI0A 1I50H 2B2VA 4OIJA 4A3KB 1Y14B 3QOLA 1II3A 1GUSA 3CCMA 3QB3A 1CAAA 2E76C 2KN9A 1TS2A 2NZOA 2R3ZA 3M9BA 3P2AA 4DR1Q 1Q12A 1L2FA 1LTSD 1ESRA 1SN8A 2OQ0A 3VR6A 1SEBD 1E2VA 2V4DA 1TR5A 1HA5A 1EEFD 1YNJC 1NJIC 2UUBL 1VZGA 2WV6D 1C48A 1YNXA 1D5MC 2JA6G 4QIWE 1HPCA 4R4QA 4FXDA 1VQJA 3GTOB 2NYDA 4X66Q 1ILQA 3GP7A 1OXSC 4G6BA 2LKVA 3S1QH 2PMZP 1Q3LA 3I4NL 1DJRD 3P7JA 4ZUJA 2B2WA 4JI4Q 1CKOA 2I46A 1ML0D 1BR9A 2HD3A 1WJVA 3U58A 5CV9A 2UXCQ 2RDVA 2N3SA 4NPSA 3FPUB 2K1BA 4KHZA 1PH3A 2KA7A 1B2TA 1PDQA 4P75A 4A4IA 2O2LD 2D0PA 2ZXPA 1HZBA 2B2TA 4DGZA 5JJLA 1QG7A 4G4KA 1V8QA 1T5XD 2N78A 4A3MB 3CRLC 1JB7A 2EYJA 1MBYA 5FJ8H 1H9SB 4H44C 5I6WA 2NN6G 1WTVA 2F0HA 1HFGA 3R93A 3M7NA 3RUZA 5IYDG 4JI6Q 4LUVA 1K3RA 1QVCA 2HQLA 2IJ0A 3BYTB 4C3JL 5JVG1 3NBIA 3NXWA 3GTKB 4A93B 5GADc 1Y1WL 1IBKL 5CBEE 4LF9L 1PZXA 3LNNA 1JWUD 4K8JA 3S1MH 2CQAA 1CKNB 4Z9CB 2OTJA 4YIJA 1PZKD 3OWEB 2XWJB 1OXTA 3KYVA 1PH9A 4BBRL 2EY4E 3RZOL 3NQIA 3KYXA 2FJ2A 1EWIA 2Z4IA 1D2BA 4N8FA 5IGGA 3TMEA 1JJGA 2XNAC 3NK9A 1STNA 1EQQA 2X6LA 1RTOA 3FVQA 3H3VC 4OWWB 1H9RA 3CC4A 3HZXA 4K9FA 3I4MG 5CC4A 2JA8B 3ZYYX 5GAHc 3OYYA 1S40A 4RG1A 3HOWL 3Q8DA 1R4QB 5RXNA 4B3MQ 4AIMA 4KJOA 2BCOA 1EY7A 1I6HL 3J7AV 3D4RA 2A19A 4XXBB 1QVGA 4IFDH 4YWMA 2F4VL 1WCMB 4QIWP 3KF8A 1TWCL 1L1OA 1Z7TA 4WORA 4JBKA 3I70A 1LABA 2RCFA 1S72A 4B3TQ 5GAEc 4AH6A 1A3TA 4BWGB 3I55A 5IP9L 1UE5A 5I9OA 4JV5Q 5C44G 1PFVA 4JAGA 3QJYA 1XNQQ 1K0SA 4JK1C 4PNYA 2ERJA 1JICA 3LWQB 3M3YB 2NVQL 4DUYL 1STHA 4AQYL 5FLXE 5FLMH 1J5EQ 1OWBA 3JC62 5I2YA 3PF4A 3W5OA 1I5FA 3SR1A 1CQVA 2WFWA 5K2ME 4POFA 5EJWA 4A3JL 4LHNA 1I4XA 5FO9B 1IYUA 4BY1L 3SXHA 5JVH3 3EBEA 2VQEQ 4ZN1B 1R0FA 4Y52L 1D5ZC 3NP8A 4FVMA 4FYDA 1QNKA 5M5WH 1WTRA 4JI0Q 5JPNC 3AFPA 5H1Sc 4DR7L 5I6YA 3G7LA 1TWHH 4DV7Q 1EYCA 2K14A 3V05A 2L0ZA 2PYAA 5AN9H 3PSIA 4UAIA 4RA8A 3STBD 3L0OA 1PTOH 2XIWA 3M7GA 3B6YA 3IL8A 5KNDA 1K83L 5I2XA 5IP7H 1B44D 5D65A 5GAGc 3A54A 4GS3A 2EJGC 1GOZA 3M3YL 4JI3L 3CCJA 4BBSB 2NZ1D 1T9HA 1LTAD 1LT3D 2B63G 1I94L 2CH4A 2WAQB 4JAEA 4N9PA 4H13C 2EYHA 4BXXL 1K0RA 3PIO3 2NVYL 1F4LA 4DV1L 2Y0SE 1B71A 1EYGA 3LPEB 2YTYA 2KHIA 1YJNA 1N36Q 3C46A 4BS9A 2O5JD 1HNZL 4CKBA 2HDLA 1NXGA 3TSSA 4LFBQ 1PH6A 1SNPA 5CV4A 2UXDL 2R7ZH 3FDJA 3S1MB 1NNXA 1Q7YC 4RGNA 1QQTA 2VUML 4YHHL 4NXML 3RLNA 5C3XA 4P72A 5C0XG 1IBMQ 2K28A 3HKSA 1DX8A 4QCLA 1K73C 2I0QA 4LUZA 5KNBA 3H09A 4N8X1 2PVEA 4AHYA 5BN4A 4WFN1 4X64L 3GTJB 1DGSA 3EN2A 1A8VA 1Q46A 1VQPA 1PH4A 4IOCA 3NUCA 4B9XA 1I3QH 2IWHA 3AYHB 3EFXD 3T1HQ 5K36G 5IWAL 4LFCQ 3D4WA 4NKLA 2B5ID 3S14L 2L5TA 4LK1C 5ELOA 2NVTH 4HJAA 4K0KL 3PO2B 3J81c 4AI1A 1RL2A 2MUYA 4A3FG 4IUNA 1JOKA 4KN7C 3G48A 4LAAA 3GTPL 4LJZC 1WYDA 1D5XC 1HZ9A 3T51B 4IFDJ 3QVDA 5IYCL 2JA7H 4DAYB 5J39A 4KD4A 2UUAL 2Z3QB 1PV4A 3OTOQ 4C3HH 4FF4A 1F2LA 2N55A 3PUXA 3NHHA 1B3QA 1TS3A 2E2JB 2Q8RE 1K28A 2H5XA 3CP0A 1CADA 3GTJL 2RDGA 3Q22A 2B2TC 2EZVA 2FXQA 1LTBD 2QGQA 1FGBD 4EQNA 4L8JA 2NYZD 2P5ZX 4HSVA 1U5KA 2JE6I 2G9HD 4I65A 3S1NH 2A69D 2B8FA 2CWPA 3KF8B 3K0XA 2XTIA 5LMUQ 5CV8A 3KLSX 2EXZA 4AYBP 4OELB 3S2DH 3PO2L 3GO5A 3S15H 1EFWA 1B1ZA 4LHLA 4A3DG 2SOBA 2PI2E 3PZAA 2ICIA 4X62Q 1R4PB 3F2BA 2BE5D 3NTHA 4RWSC 3GTMH 2F4IA 1PYSB 3F1ZA 4OWXB 4AHWA 1HFNA 3F2UA 3U50C 3K5OA 2Z3RB 1TWFH 4MTKA 2M00A 4XGHA 1JOOA 4QUCA 1OO9B 1S5CD 3UE0A 4AR3A 4JVZA 3J7AF 1GUOA 1JQYD 2YTVA 3CRKC 1PTOF 4KY6A 1ONLA 3LGJA 1Y1VB 1B9MA 3IRBA 1QYBA 1H7VA 2EQSA 3HOXL 3X3MA 4IN3A 4U673 3S1RH 2HHHL 1RIPA 2UU9Q 3KOJA 3U4VA 4O1NA 3MXPA 4CHTB 2M6OA 4ZKBB 4RFBA 5G3LF 3UDFA 5FO7B 4KY7A 1A6XA 1YUXA 2PQAA 5DLQE 4A3EH 5C4XH 3U9SA 3H3VI 2DJGC 2SDFA 3CQZH 5KYLA 1WFQA 3GTGH 2L0CA 3T56B 2TSSA 4OL7A 5CV6A 1EQVA 5EBDA 1KD1C 5BR8L 1BFYA 5JPMC 2WKDA 2JA5B 3HJYB 2F0PA 3S17B 5DM73 2EY5A 2K5QA 2Z9HA 1H9MA 3HOYG 1QJOA 1AZQA 3WOFA 1O7ZA 1Y1VL 5KYIA 5M3MG 3CC2A 1H95A 2VB3X 1SE2A 2PNRC 3PQIA 4C3IG 3S2HB 2XGTA 4HJ9A 2V0EA 1K8MA 3QG1A 3S16L 3AU7A 4K14A 4ZKCB 4DNIA 4IJHA 3MXUA 5IE8A 5M3FB 1ASYA 5M9OA 5E3FA 4RGOS 3K8AA 4DR4L 2I5LX 1FD7D 1NUCA 1VMCA 4IO9A 3J80L 1BRFA 1GUTA 1ZKOA 2DNCA 1RDGA 1PFYA 1DVBA 1LTRD 4NXNQ 1ZYRD 4DXGA 5JEAH 3C2PA 4JPBW 2I5HA 5A35A 2ATWA 3HOUB 1BQQT 1ET9A 4JI5Q 4R4TA 4ABNA 1X32A 4OX9L 1HH2P 1IRNA 1H9KA 2AUKA 1TWAL 3RN2A 1Z9FA 3PO3L 2ZT9C 5T1IA 3T16A 3LWOB 4YCWA 4DAMA 2AHOB 3H97A 2C35B 2Y0SB 3KLRA 2RCNA 4P73A 4A75A 4DR6Q 2R92B 2L11A 4XQQA 1V9PA 3S24A 1VQAA 1CM9A 2K50A 3P1HA 5COYA 2E2HL 1RJTA 1B3AA 3HGBA 1PVOA 4Q5VA 1IHZA 1UEAB 2F0FA 4HR7B 4A3IB 1QB5D 4JI7Q 1Y8NB 3X3NA 3DLLA 3S15B 2A8VA 2ID0A 2WB1E 1VQ4A 2XJUA 4GLAC 4ZRZA 3H0GH 4DV0Q 2KQ3A 1TWGH 4JBWA 3SHLA 4RHRA 5M5YB 3J7YW 1CA5A 5EPKA 5FJ8G 1PHJA 3MQKB 1HTPA 1U4LA 4OIKA 1LTTD 1R9TL 4OWTB 4DV5L 4DR1L 3QO2A 1QE6A 5EPLA 3I4NH 2CHBD 2RSOA 3HOUL 1MI2A 4WRDA 5ELDA 1PRTC 1RDPD 4B08A 1XTDA 3FKIB 5I4DA 1MSGA 1O7YA 1Q82C 2ZM6Q 5FLXc 1UAPA 2RKSA 1HZCA 1U4RA 4A3KH 2JI3A 2EYLA 2K03A 3JC66 1UE6A 3M4OL 5KRUA 4Y7NB 3EQLC 4NP5A 4OHJA 3O13A 3BVGA 4DV2Q 4JI4L 1SYDA 5L37A 3TEHB 2QEJC 3NEMA 1MKHA 1B70B 1EQTA 3E6ZX 1FNUA 2HUGA 3F2CA 1I4PA 3J80i 4LW1A 3RLFA 3G6JB 3W2DA 1ENAA 1ODHA 3CQZB 4RMFA 1Q1EA 4BA1I 4DV4Q 4GS7D 5M5XL 3CCLA 1PYWD 4B8CD 2F3IA 1F9PA 2Z8LA 3WWNB 4JI8Q 1SMUA 1YI2A 4ME3A 1W6KA 2KUMA 4QQBX 3A7AB 4RKBA 1PZID 4JAFA 1O7LA 1X6OA 2AKWB 1EEID 5MF6A 2H12A 2R7FA 2XRQD 2J9UB 2VNUD 3E9IA 2J7ZA 4ILWA 5EINC 3H3VH 3FKIL 4EQ5A 2DNEA 4UDUC 3A55A 2PYKA 3NE5B 3W1GA 4R4CA 3MSUA 3HOWH 1N32Q 5KEEA 1JR0D 3D8GA 4Y7NL 3RLOA 1KDBA 1M90C 2WB1P 1I6HH 2F0TA 4A3BB 2F0IA 1EWCA 1T9PA 3I2ZA 1KDAA 1F2YA 1BKBA 1BCPC 5C3EB 2PCFB 4B3ML 5A2QL 1XPOA 3PGZA 1EOTA 3PF5A 4OO1H 3CU7A 1SFOB 2HQEA 1A2UA 3MXNA 5JEAJ 2K32A 2EVBA 4HIDA 4DR5Q 4X3KA 1PMRA 4B3TL 2B63B 4OEMB 3SVMA 2XRSD 4LUOA 4KV6A 5IP7G 2Z6KC 1PTOD 1XNQL 4KJNA 3UDXA 4BY1H 3HOVG 3KYUA 4GZYC 1I6VC 1TY2A 3RZDL 4Y52H 3C1FA 1PA6A 3ERQA 4M1UB 1J5EL 4RXNA 3A8KE 5JJKA 3MA2B 2EYMA 4A3BL 1WCMH 2E74C 1HQMC 4JBJA 5LMNQ 4NB3A 7RXNA 5JVG3 1VQOA 2HIVA 2FFKB 3QIAA 1FHHA 4JI1Q 3Q23A 3I4NB 5C3EL 2X6GA 1TQOA 2VQEL 1K83H 3D31A 1SLJA 1SFOL 3S9WA 1M1KC 1N33Q 1DYQA 2D2CC 3M3YH 2K4KA 2R7ZG 4U68A 2BDNA 3A0JA 4DK0A 3ULJA 4IPDA 4RGTA 2B63L 4KMUC 2ASBA 4BXXH 4FF2A 1JT8A 4K2KA 3LWPB 2QILA 1VZIA 1E2WA 1LTGD 4UHVA 2IHEA 4C3JB 1Y1WB 2AQCA 1QZHA 2OT2A 3DWQA 2K04A 3K7UC 1KHIA 4GOPA 2VUMH 3P75A 4BBRB 2IL8A 3OOCA 2B29A 1N36L 1NMFA 2N49A 3RZOB 3IU3I 3H9BA 1R0GA 1PFNA 3ITPA 3J81j 4LFBL 2EY1A 5LL6S 1X65A 4ZAIA 4BBSH 1NTGA 1F77A 1VF5C 4ZUIA 4FDBA 3BJUA 3K35A 2QDLA 5EQ0A 1WJJA 2JA7G 2WAQP 2A74C 3KJOA 3HKZE 4KHPQ 3HOWB 2YTXA 1IBML 2JI1A 3BVZA 3D6CA 2AYJA 2CFMA 4PV1C 4C3HG 1SYEA 1SNOA 1RHPA 5NUCA 5HGTA 4ULLA 1I6HB 1SMYD 2WB1B 1CK1A 5AFWA 1VS0A 1FNVA 4X3TA 1ENCA 2EJFC 2NVXL 1TWCB 1E7ZA 2GMGA 1A3VA 1OWCA 2Q2IA 3ULLA 1PYBA 5IODA 1KQSA 3MC0B 2FINB 2KHJA 1B53A 2KCCA 4H02A 3RZTA 1HNXL 4A3FL 2XN9C 3GTPH 3NBHA 4DR2Q 3CCRA 4DV6L 4E6YA 1HR0Q 4LFCL 5IYCH 3NPPA 4IUTA 2K7VA 4YCVA 5MGNA 4YCUA 4AYBG 2NVQB 3H9CA 3BDLA 2F0GA 4X3UA 2WINB 3GTJH 1SNDA 1CI3M 4C1NI 1VQNA 3A8JE 3NSWA 2N88A 3EROA 2QF7A 1ASZA 4A3JB 1NY4A 5IGFA 2GA4B 5FO8B 5LMNW 4BY1B 2YYZA 1IYVA 2EDGA 4GNXA 3L3OC 1EIFA 2RFKB 1VQ9A 2VB2X 1NR2A 3PO2H 2LS01 4IPCA 1HZAA 4QJFA 5EIOC 3K7AB 3J80E 4A3DL 3LNLA 3TP6A 1BQ9A 1KAAA 1BUVT 1K83B 4UP9A 5AI3A 1HUMA 2F0LA 4DV3L 1K8OA 4K2LA 4PZ6A 1CZGA 1YBYA 2J4XA 5AJ3Q 4A3EG 5C4XG 2NN6I 3MAQA 4LF8Q 3MVVA 4WFN3 2E2JH 4LFAL 3M4QA 1LACA 3SK4A 3HKZP 2NVYB 2B2YA 2OQKA 1YIJA 2IX0A 3HOZG 2XJRA 2F0WA 1NXEA 3RD4A 3BZDB 4J8QA 4A76A 3K0YA 1IW7C 4FP5D 1FGUA 4L63B 2UUCQ 2ALYB 3T1YQ 2CW0D 3IKJA 2ENBA 3I4OA 5K5PA 2UXBL 2EYOA 4IUVA 3Q6SA 4B3SQ 3ULPA 1RWDA 2A1AA 2JEBI 3VYSA 3A7LA 2XJPA 1VQ8A 2VUMB 2YU9L 3K7AL 1S30A 3M4PA 1FYCA 4X65Q 4QL5A 3DXJC 4A3CG 3JAML 2ZTCA 3QOJA 4CDCC 1HTLD 1X3PA 3G4SA 1XMOQ 4RAUC 3CD6A 1E0BA 4R4IA 4DNTB 5LHY1 3HOYL 1NAPA 1Y1VH 2QW7A 1T9OA 4GN3B 4UP7A 1Q81C 4ZYSA 1BNZA 1QCBD 1BVSA 4N9TA 5M3ML 3K5MA 3OW2A 4C3IL 1VQMA 3S14B 3S16H 1HR0W 2APOB 3PUWA 1O78A 1A63A 5IGDA 1J9OA 1CZWA 4LMQD 2K5HA 2JSOA 1I4QA 3PL5A 4GLVB 4F88A 4BY7G 1I50L 2EPBA 3PKJA 1K9MC 3GTPB 4PQXA 1N8RC 2RQXA 1IZ6A 2PZTA 3VA5A 2GVAA 1J8IA 3GQBA 3F8TA 3J81L 1XNRQ 2OTLA 2Q8TA 4V190 1JE5A 3PO3H 2JA5H 3H0GG 1K8AC 1YNJD 3S17H 1SMMA 2B2VC 1GD7A 3I3CA 2JEAI 3W1BA 3QR8A 2Q8IB 1HJPA 2B2UA 4LNQA 3SEBA 1VF7A 2MQHA 1IYJB 4ODGA 4NXNL 3S1QL 3S2HH 2E2DC 2MHVA 3D4DA 4XYOA 5EGTA 1RB9A 2E2HH 1V1PA 3MEFA 1Z92B 2CKZB 4G7ZC 2VY3A 1SRUA 2XJSA 3HAXC 5M3FH 1TXYA 1DZ1A 3A44A 4A3KG 2Z0SA 1A2TA 1S5ED 3CF5A 4GOPC 4YY3L 4LF9Q 1LT6D 1XMQL 4DR6L 3JAMi 1U4MA 4R8IA 5JVH1 4QMGA 3BZCA 5IT9L 2B2WC 3G71A 1HQRD 1R9TH 5FJ8L 4PMBA 4ZK9B 2LY7A 3HOUH 5CV7A 2M9VA 3HG9A 1VQEA 2CKAA 1STEA 1IBLQ 3DWAA 4ALPA 4KKTA 1LKMA 1P16A 2JYOA 3HKZB 3HOXB 2R93B 4X6AL 4JG2A 2Y0SP 1KIXA 1FHMA 4GNXB 2ZJQA 2R92H 4QB4A 4V196 2KBNA 1L1OB 1EOVA 5IIFA 5C0XI 2XJVA 1X3FA 2ZTDA 1SE8A 2HIXA 4A3IH 4A3GB 2XSCA 1RTNA 2NN6H 2F4VQ 2ZM6L 2KENA 1QUQA 1KL9A 2YV5A 4CJ2C 2J0TD 5DNFA 1SE3A 1PH7A 3PKIA 3CCSA 4A3MG 3NTKA 5M5YH 5M5XH 2IW3A 3MHBA 3Q24A 1G6ZA 1EY9A 5BN5A 1UEBA 1YK4A 2MFIA 5DM61 1UE1A 1JC7A 2X69A 4C1NK 3TP8A 3DWPA 3PIOA 4A3LG 5CORA 1VQBA 4A93G 3BU2A 3EA6A 2NBFA 4EQPA 3CW2C 2E5LQ 2PZUA 1IL8A 2E2IL 3FKIH 1U9RA 2C6AA 1VQ7A 3BYYB 2K6AA 4ZQ3A 2R93L 3MFGA 1Z47A 1YNNC 4XQJA 2PNHA 3S16B 5EKLA 4OO1G 5E4WC 4JI8L 1E1OA 2L55A 3TS2A 4GNXC 3KLWA 3VYUA 4Y7NH 5MFPA 3BVMA 1SNQA 4O2DA 3HOVB 3NWSA 1L1OC 3H6MA 2F3VA 1EYAA 4A3GL 2PVXA 2HCCA 2HT1A 3CCEA 1WTWA 3J7Z1 4HCSA 3IAYA 1EIYB 2JA8G 3I4LA 3BG3A 2IX1A 5JOBA 5CBAE 3KDFA 3KF6A 1IU6A 4TRDA 1N32L 2OCEA 5IYBH 2DY8A 4IPGA 1TWAB 3PO3B 2K5NA 1LUZA 1RYQA 4JCVE 1HA6A 1R0HA 1TS4A 1WCMG 5M5WL 1LYLA 2O5IC 2VXWA 1C4QA 1JWMD 1X3GA 2D0OA 3PMFA 1C0AA 1LTID 1TWHL 3UDGA 2DGYA 1C7YA 2B2YC 2PI2A 3F2DA 4JADA 2E2HB 3EJIA 4DV1Q 1MJEA 2QEXA 3AFQA 3SE0A 4POGA 3K5LA 3MFYA 2RVLA 1JCKB 1XTCD 2I07B 4RCOA 3MTSA 1AZPA 5LL6X 3HOVL 3RZDH 1HNZQ 2ZXOA 1G291 2MGSA 2JK8A 2R61A 1QILA 3GTLB 5D3IB 2OEOA 3U9OA 2BH8A 4A3BH 1LT4D 1BXTA 1GVPA 2BOSA 2JA6B 2UXDQ 1XX8A 4J15A 3CCVA 2H1EA 4B3RQ 1CFMA 3LWEA 4KI0A 1R9TB 4K6DA 1KLGD 4ZLTF 3TP7A 5IGEA 1PRTB 1EU4A 2MNAA 1GUNA 5C3EH 3BS1A 3MXGA 1AW7A 3B0AB 1N34Q 4DK1A 4APVA 1SFOH 1YZ6A 1NE3A 4C2M1 3M4YA 2OF1A 2ZJRA 4RH6A 2RBMA 4TPUA 1G8ZD 4FF3A 1EFID 5LMNL 1A0IA 1V1PB 2ZXRA 2B63H 3M4OB 1HCZA 1S24A 1PFUA 4JI1L 1UNSA 5IWAQ 1YJWA 4JBMA 1A62A 1C9OA 4Q0FA 1SXTA 2VS1A 3KBGA 4IZ8A 3OMGA 1CHPD 4L5SA 1HNWQ 1MJCA 5FLXL 4BBSG 4K0KQ 3NTIA 1Q8KA 4DFAA 3GTLL 2WAQG 3M85A 1SE4A 1Z6HA 2JA6L 5M5XB 3WOEA 3J80c 2ZJPA 4HSPA 3HS0C 3I90A 4JYAQ 2KCTA 2BDOA 1HUNA 3T13A 2PPBC 2UUAQ 2K33A 3BZKA 1BOSA 3A8IE 2NVTL 3GTQB 3TQYA 1GUWA 4LWCA 2TMPA 1L0WA 2M4YA 4HJ5A 2B2UC 1AP0A 3KJPA 1WI5A 4X66L 1EWHA 3I4MB 3GD7A 2JA7L 4HN7A 3AQQA 1WTOA 2FMMA 3FHWA 1B9NA 2WKCA 3KBXA 1UE7A 1IKLA 1IKMA 4C3HL 4CJ1B 2F0SA 2UXCL 1MHWC 2NVXH 1EZ6A 2N8NA 4LF5Q 1VQLA 4C3JH 5IYDL 4P2CB 1SYCA 1LKPA 1Y1WH 1BCPB 4L5TA 3Q0AA 4HJ8A 4GKKQ 4AI2A 3S1NL 5C44B 4HJ7A 1S5FD 4BBRH 3GV3A 3JAME 3UDIA 4DK3C 4IFDG 1VQ6A 1Y69U 3RZOH 4YWKA 2ES2A 3PO2G 1D7QA 4JI6L 3GTQL 2JI2A 1H9SA 1C09A 3EIVA 2BA0A 4JW0A 3VR2A 4DK6C 2R7DA 2KVMA 1STAA 1RDVA 1I4GA 1VZHA 1F9QA 1EYDA 4DR2L 5HGQA 2RHSB 3GTML 2XWBB 3FEWX 3I91A 3N52A 3I4ML 1XPRA 3OIQA 1HR0L 2HHHQ 5FOBB 3HOZB 2NUCA 3J7Y1 2PQAB 1TWFL 4PG3A 3RZDB 4RGMA 1NBWA 4TQUS 5FLMG 3AEVA 1SYGA 3SDZA 4DUZQ 1X55A 1GJXA 4H7BA 4GN5A 5KNCA 1BF4A 5HURA 2I5MX 2IT1A 1TWCH 5JJZA 3KDFB 3KF6B 3WDNA 5JAVA 1OXVA 2IY5B 2WACA 4A3DH 5GROA 2PO4A 2F0DA 5IP9H 3RR5A 3H3VM 2AUSB 3KYWA 5C4JB 5C44L 1KAWA 2NVQH 3NWTA 1LKOA 3NFPI 2VQFQ 1HXYD 4A3EL 5KGUA 5C4XL 3HP3A 3V2TA 3V96A 4CGYB 3I8ZA 1SNCA 3PCOB 5DEHA 3GTGL 2F0KA 1LLRD 1JOQA 1NSNS 1OXXK 4JV5L 2M4VA 1YHBA 1OTCA 5C5LA 4A3JH 1WTQA 4KK7A 1ICWA 1CSPA 3HJWB 3HOZL 4L5QA 5FKAC 1PLFA 3R8BA 5JJIA 3OHXC 4XQNA 2NTSA 1Y1VG 2KCNA 1N9WA 1SYBA 4QY7A 1FNWA 1V1OA 2D5DA 3K7AH 3PIP1 5ELEA 3ND9A 3STBC 3VYTA 4TSSA 1BBUA 3J7ZC 4FNFA 1CQFA 1SDFA 3OSOA 5IT9E 4A3CL 2UUCL 1YV1A 2C5CA 5C4JL 1EZ8A 2LMCB 5IGBA 3ONAB 1S4ZA 4JI0L 1VMPA 3PIPA 1U0LA 2A73B 1IROA 4HCEA 2B3GA 2M2LA 4DV7L 3TS0A 4R8NA 5C5MA 5C0XJ 1ENFA 3HOYH 2K2DA 1IXRA 1CKMA 2NVYH 4LF4Q 4NMZA 5M3MH 1RCVD 1IL2A 1TY0A 2EXDA 2QKIC 4X3SA 1EQRA 3C1EA 2CR8A 4J1MA 5CYUA 2O5JC 2JA5G 2NVXB 3CMEA 3KLSA 1PFMA 2Z6BA 4LF7Q 1CHQD 1D6EC 4DU9A 1XXGA 1V43A 3H94A 4A3FB 1FVIA 1VQIA 1GUGA 4BY7L 3A5ZB 3NELA 4G7HC 2SNMA
chains in the Genus database with same CATH topology
2OWOA 4WJ4A 4BA2I 1Q1BA 1X56A 4DV5Q 4GLXA 4AI3A 5M3FG 5GADC 2MO1A 4R4OA 3PUVA 4JOIA 3D0FA 3HOUG 3GDEA 3VDYA 1XNRL 3S14H 5MLC3 1YITA 2DSXA 1WOCA 5GAHC 2Y0SG 2R92G 3T1HL 2KCMA 2XJTA 2BH2A 1VQDA 4A3IG 1D8LA 1QZGA 5GAEC 1YEZA 1W2BA 1PH8A 3U4ZA 4UP8A 2VZAA 4EX5A 3I56A 2IHFA 4QGUA 4X6AH 4DKAC 1K8GA 1AE3A 3RN5A 3A74A 3ER0A 2R6GA 5J3BA 3OTOL 1IBLL 3FKIG 3P8BA 3MPSA 1YVCA 3KYYA 3I7FA 4PMWA 2LSSA 3MXNB 5LMUL 3ZG6A 1GM5A 1B13A 1GKHA 1FJGQ 3CPWA 1VQHA 2E2IH 1S2ZA 4X62L 3HOXH 2R93H 5IYBG 4YWLA 5GAGC 1R0JA 4LF6Q 1SROA 4A3GH 4GKJQ 2E5LL 4HIOA 1JJCB 4DR3Q 1G6PA 2UU9L 4MZ9A 4JI2Q 4P74A 4AR6A 2JA9A 2RF4A 4UPAA 3DM3A 2MO0A 4A3BG 3PUYA 3G6EA 4AR5A 5JEAG 3SGIA 5C3EG 4AHXA 2F52A 4TVAB 2ZTEA 1X54A 1PH1A 1VCXA 1E3PA 4ZN3B 3HOVH 2UUBQ 5ELNA 4GOPB 3KFUA 4MTNA 2CQOA 1B7YB 2LCQA 4IJLA 1XPUA 3VPBE 2QL0A 3PV0A 4GN4B 1LTLA 1MIUA 4KLKA 4OXPA 3SS2A 3CPFA 3JAMc 1TWAH 1X3EA 4AYBE 4WJ3M 4OONA 1E22A 3NENA 4B3RL 3WWVA 1GO3E 1T9QA 3I4NG 3PWFA 4JI5L 1B2OA 4UY81 1G51A 1N34L 1VQKA 2DUDA 3NBHB 1VQ5A 3GTLH 1YJ9A 1IBKQ 3B08B 4IOAA 1HNXQ 2JA6H 4DV6Q 3CAMA 5E7NA 2CKCA 4JI7L 1HNWL 1Y1WG 2A6ED 4DV0L 3CCUA 4JOIC 4R1JA 1KRTA 4BBRG 1LM0A 2HR5A 3M4OH 4JYAL 2XJQA 2VW9A 2AWNA 2LXJA 3J7A5 2CCZA 2ERSA 8RXNA 5IYDH 3PIO1 1YHAA 3HOWG 2A68D 3J81i 4DV2L 2C6BA 5GQOA 2WB1G 4DV3Q 1B8AA 5IT9c 4LF5L 4DUYQ 3GTQH 1KC8C 1BE7A 4AQYQ 3RNUA 4LFAQ 4DV4L 4GKKL 5IP9G 4AR4A 3I4MH 3RZ6A 3RYGA 1YUZA 3L7ZC 3WWLA 1KRSA 1XJVA 1B2JA 1QCVA 1UWVA 2UXBQ 2AWOA 4DR7Q 5MFZA 3E9HA 1VCIA 4A3JG 4BY1G 4O0AA 1IW7D 2Z6KA 5C44H 1JYBA 4DUZL 4JI3Q 2JJQA 1I94Q 1NMGA 1E8JA 2RHQB 3HOZH 2JQOA 1CUKA 2VQFL 1VQCA 1ZRPA 1P8LA 4DR5L 1SR3A 4HIKA 4BXXG 3TREA 1E24A 4YHHQ 4NXMQ 1S3OA 4IPHA 1YK5A 1CSQA 1JMCA 1QVFA 4A3CH 4OO1I 3ICEA 5HY6A 5C4JH 2NZHA 4P71A 4X64Q 3PUZA 1RYTA 2PPTA 2VUMG 1X9NA 1EUJA 3ZJYC 1AH9A 3JC63 2Q2TA 1AE2A 2A6HD 2EIFA 1BQ8A 2KKDA 1N33L 1SMWA 1E1TA 1OXUA 1W3SA 3CCQA 5AI2A 4U671 4BY7H 4YY3Q 4DPGA 1XMQQ 2VL6A 4LF4L 5EAYA 1KXLA 2ZIXA 5H1SE 2K75A 4LF7L 2PSMC 1JJ2A 5IYCG 1R0IA 4C2MH 2AMCB 4HIMA 5DM71 3CMAA 1BBWA 1QUQB 1VQFA 1PH2A 4UY8C 4A3FH 4KHPL 1NNQA 2Q2UA 3L2PA 3KYHC 1O7IA 1IU5A 3FP9A 3HFZB 3UE1A 2K52A 1SMXA 3A5UA 3GTOH 2CWAA 4MNOA 1CKNA 4TVMA 3QQCE 1VQGA 2MS3A 2D62A 4AHZA 3HKZG 3HOXG 2R93G 2GN5A 2WP8J 4A3MH 5BR8Q 4XIGS 1Q86C 3CC7A 4A3GG 4A3LH 4PZ8A 4A93H 2K5VA 1FL0A 3GTKH 1PFSA 4JC0A 5IY0A 3H15A 4L5RC 2PMZE 3K81C 5AJ3L 3ERSX 4IFDI 1V1QA 2BA1A 3CXCA 2LXKA 4LF8L 4DR4Q 1FJGL 1PH5A 6RXNA 2YU9H 1J6QA 2JA8H 2WAQE 2V3BB 2V1CC 2QA4A 4LF6L 3T1YL 3E0EA 4OX9Q 2L15A 3TRZA 4PZ7A 2GVBA 4B3SL 4GKJL 2M6PA 2Q2HA 4XTCS 3K80C 4DR3L 2V0FA 4X65L 4JI2L 4C3IH 3PO3G 1XMOL 1YHQA 2E8GA 4AI0A 1I50H 1Y14B 3CCMA 1CAAA 2KN9A 2NZOA 3M9BA 3P2AA 4DR1Q 1Q12A 1L2FA 1SN8A 2OQ0A 1NJIC 2UUBL 1VZGA 1YNXA 2JA6G 4QIWE 4R4QA 1VQJA 2NYDA 4X66Q 1OXSC 4G6BA 3S1QH 4JI4Q 1CKOA 1WJVA 3U58A 2UXCQ 2RDVA 2N3SA 4NPSA 4KHZA 1PH3A 4P75A 4A4IA 5JJLA 2D0PA 1HZBA 2N78A 1JB7A 5FJ8H 2NN6G 3M7NA 5IYDG 4JI6Q 4LUVA 1K3RA 1QVCA 2HQLA 5JVG1 5GADc 1IBKL 4LF9L 3S1MH 1CKNB 2OTJA 1OXTA 3KYVA 1PH9A 3KYXA 1EWIA 1JJGA 1EQQA 4OWWB 3CC4A 4K9FA 3I4MG 5GAHc 3OYYA 1S40A 4RG1A 3Q8DA 5RXNA 4B3MQ 4AIMA 2A19A 4XXBB 1QVGA 4YWMA 2F4VL 1L1OA 4JBKA 1S72A 4B3TQ 5GAEc 4AH6A 3I55A 1UE5A 4JV5Q 5C44G 4JAGA 1XNQQ 2ERJA 4DUYL 4AQYL 5FLMH 1J5EQ 1OWBA 3JC62 3PF4A 3W5OA 1I5FA 2WFWA 5K2ME 4POFA 4LHNA 3EBEA 2VQEQ 4ZN1B 1R0FA 5M5WH 4JI0Q 3AFPA 5H1Sc 4DR7L 1TWHH 4DV7Q 2K14A 2L0ZA 2PYAA 5AN9H 3PSIA 3STBD 3L0OA 3B6YA 5IP7H 5GAGc 4GS3A 4JI3L 3CCJA 1T9HA 2B63G 1I94L 4JAEA 1K0RA 4DV1L 2Y0SE 1B71A 1EYGA 3LPEB 2YTYA 2KHIA 1YJNA 1N36Q 2O5JD 1HNZL 1NXGA 4LFBQ 1PH6A 2UXDL 2R7ZH 1Q7YC 4YHHL 4NXML 3RLNA 4P72A 5C0XG 1IBMQ 3HKSA 1DX8A 1K73C 2I0QA 4LUZA 2PVEA 4AHYA 4WFN1 4X64L 1DGSA 3EN2A 1A8VA 1Q46A 1VQPA 1PH4A 4IOCA 1I3QH 3AYHB 3T1HQ 5K36G 5IWAL 4LFCQ 2B5ID 5ELOA 2NVTH 4HJAA 4K0KL 3J81c 4AI1A 1RL2A 4A3FG 3G48A 1WYDA 4IFDJ 1HZ9A 3QVDA 2JA7H 4DAYB 2UUAL 2Z3QB 1PV4A 3OTOQ 4C3HH 3PUXA 2H5XA 3CP0A 1CADA 2FXQA 2QGQA 1U5KA 2JE6I 3S1NH 2A69D 2CWPA 3KF8B 3K0XA 2XTIA 5LMUQ 3S2DH 3GO5A 3S15H 1EFWA 4LHLA 4A3DG 2PI2E 3PZAA 4X62Q 3F2BA 2BE5D 3GTMH 1PYSB 3F1ZA 4OWXB 4AHWA 3U50C 2Z3RB 1TWFH 4XGHA 3UE0A 4AR3A 2YTVA 3LGJA 3IRBA 1QYBA 1H7VA 2EQSA 3S1RH 2HHHL 1RIPA 2UU9Q 3KOJA 3U4VA 2M6OA 3UDFA 1YUXA 2PQAA 5DLQE 4A3EH 5C4XH 3H3VI 3CQZH 1WFQA 3GTGH 1KD1C 5BR8L 1BFYA 3HOYG 5M3MG 3CC2A 1H95A 2XGTA 4HJ9A 2V0EA 4DNIA 4IJHA 5IE8A 1ASYA 3K8AA 4DR4L 2I5LX 4IO9A 1BRFA 1RDGA 1DVBA 4NXNQ 2I5HA 2ATWA 4JI5Q 4R4TA 4OX9L 1HH2P 1IRNA 3RN2A 1Z9FA 4YCWA 4DAMA 2AHOB 2C35B 2RCNA 4P73A 4A75A 4DR6Q 1V9PA 3S24A 1VQAA 2K50A 1PVOA 4JI7Q 3DLLA 2A8VA 2ID0A 2WB1E 1VQ4A 2XJUA 4GLAC 3H0GH 4DV0Q 1TWGH 4JBWA 5FJ8G 1PHJA 4OWTB 4DV5L 4DR1L 3I4NH 1XTDA 1Q82C 2ZM6Q 5FLXc 4A3KH 1HZCA 2JI3A 3JC66 1UE6A 4JI4L 4DV2Q 3TEHB 3NEMA 1MKHA 1B70B 3F2CA 3J80i 4LW1A 3RLFA 1ODHA 4RMFA 1Q1EA 4BA1I 4DV4Q 4GS7D 3CCLA 4B8CD 2F3IA 4JI8Q 3WWNB 1SMUA 1YI2A 4ME3A 4QQBX 4JAFA 2AKWB 1X6OA 5MF6A 2H12A 2R7FA 2J9UB 2VNUD 3E9IA 5EINC 3H3VH 4EQ5A 3W1GA 4R4CA 3MSUA 3HOWH 1N32Q 3RLOA 1M90C 1I6HH 1T9PA 3I2ZA 1BKBA 4B3ML 1XPOA 3PGZA 3PF5A 5JEAJ 4HIDA 4DR5Q 4B3TL 4LUOA 5IP7G 2Z6KC 1XNQL 3UDXA 4BY1H 3HOVG 3KYUA 4Y52H 1PA6A 1J5EL 4RXNA 5JJKA 1WCMH 4JBJA 5LMNQ 4NB3A 7RXNA 1VQOA 2HIVA 1FHHA 4JI1Q 2VQEL 1K83H 3D31A 1SLJA 1M1KC 1N33Q 3M3YH 2K4KA 2R7ZG 3A0JA 3ULJA 4IPDA 2ASBA 4BXXH 1JT8A 1VZIA 2IHEA 1QZHA 3K7UC 1KHIA 4GOPA 2VUMH 2B29A 1N36L 1NMFA 2N49A 3IU3I 1R0GA 3J81j 4LFBL 1X65A 4BBSH 1NTGA 4FDBA 3BJUA 3K35A 1WJJA 2JA7G 3KJOA 3HKZE 4KHPQ 2YTXA 1IBML 2JI1A 2AYJA 2CFMA 1VS0A 1E7ZA 2GMGA 1OWCA 2Q2IA 3ULLA 1PYBA 1KQSA 2KHJA 4H02A 3RZTA 1HNXL 3GTPH 4DR2Q 3CCRA 4DV6L 4E6YA 1HR0Q 4LFCL 5IYCH 4YCVA 5MGNA 4YCUA 4AYBG 3GTJH 1VQNA 1ASZA 1NY4A 5LMNW 2YYZA 4GNXA 1EIFA 1VQ9A 3PO2H 4IPCA 4QJFA 1HZAA 5EIOC 3LNLA 1BQ9A 4UP9A 5AI3A 4DV3L 4PZ6A 1YBYA 5AJ3Q 4A3EG 5C4XG 2NN6I 4LF8Q 2E2JH 4LFAL 3M4QA 2OQKA 1YIJA 2IX0A 3HOZG 2XJRA 1NXEA 4A76A 1FGUA 2UUCQ 2ALYB 3T1YQ 3I4OA 2UXBL 4B3SQ 3ULPA 1RWDA 2A1AA 2JEBI 2XJPA 1VQ8A 1S30A 3M4PA 4X65Q 4QL5A 4A3CG 2ZTCA 3G4SA 1XMOQ 3CD6A 4R4IA 1Y1VH 4UP7A 4GN3B 1T9OA 1Q81C 1BVSA 3OW2A 1VQMA 3S16H 1HR0W 3PUWA 1A63A 2K5HA 4GLVB 4BY7G 3PKJA 1K9MC 1N8RC 1IZ6A 2GVAA 3F8TA 1XNRQ 2OTLA 1JE5A 3PO3H 2JA5H 3H0GG 1K8AC 3S17H 1SMMA 1GD7A 2JEAI 3W1BA 1HJPA 4LNQA 2MQHA 1IYJB 4NXNL 3S2HH 1RB9A 2E2HH 3MEFA 1Z92B 2CKZB 2VY3A 1SRUA 2XJSA 5M3FH 1TXYA 3A44A 4A3KG 2Z0SA 3CF5A 4GOPC 4YY3L 4LF9Q 1XMQL 4DR6L 3JAMi 5JVH1 3BZCA 3G71A 1R9TH 3HOUH 1VQEA 2CKAA 1IBLQ 4ALPA 1LKMA 1P16A 4JG2A 1KIXA 1FHMA 4GNXB 2ZJQA 2R92H 4V196 2KBNA 1L1OB 1EOVA 5C0XI 2XJVA 1X3FA 2ZTDA 1SE8A 2HIXA 4A3IH 2F4VQ 2ZM6L 2KENA 1QUQA 1KL9A 2YV5A 1PH7A 3PKIA 3CCSA 4A3MG 5M5YH 5M5XH 1UEBA 1YK4A 2MFIA 5DM61 1UE1A 3PIOA 4A3LG 1VQBA 4A93G 3BU2A 3CW2C 2E5LQ 3FKIH 2C6AA 1VQ7A 1Z47A 2PNHA 4OO1G 4JI8L 1E1OA 3TS2A 4GNXC 3KLWA 4Y7NH 5MFPA 4O2DA 1L1OC 2PVXA 2HT1A 3CCEA 3J7Z1 1EIYB 2JA8G 2IX1A 3KDFA 3KF6A 1IU6A 1N32L 2OCEA 5IYBH 4IPGA 2K5NA 1LUZA 1RYQA 4JCVE 1R0HA 1WCMG 1LYLA 1X3GA 2D0OA 1C0AA 3UDGA 2DGYA 1C7YA 3F2DA 2PI2A 4JADA 4DV1Q 1MJEA 2QEXA 3AFQA 4POGA 3RZDH 1HNZQ 1G291 2JK8A 2BH8A 4A3BH 1GVPA 2UXDQ 4J15A 3CCVA 4B3RQ 4KI0A 2MNAA 5C3EH 1N34Q 3B0AB 4APVA 1SFOH 1YZ6A 1NE3A 2ZJRA 4TPUA 5LMNL 1A0IA 2B63H 1S24A 4JI1L 5IWAQ 1YJWA 4JBMA 1A62A 1C9OA 2VS1A 4L5SA 1HNWQ 1MJCA 4BBSG 4K0KQ 1Q8KA 2WAQG 3M85A 3J80c 2ZJPA 4JYAQ 2KCTA 2UUAQ 3BZKA 3TQYA 4LWCA 1L0WA 2M4YA 4HJ5A 3KJPA 1WI5A 4X66L 3GD7A 3AQQA 3FHWA 1UE7A 2UXCL 2NVXH 4LF5Q 2N8NA 1VQLA 4C3JH 1LKPA 1Y1WH 4L5TA 4HJ8A 4GKKQ 4AI2A 4HJ7A 4BBRH 3UDIA 4DK3C 4IFDG 1VQ6A 3RZOH 4YWKA 2ES2A 3PO2G 1D7QA 4JI6L 2JI2A 1C09A 3EIVA 2BA0A 4DK6C 2R7DA 1RDVA 1VZHA 4DR2L 5HGQA 2RHSB 1XPRA 1HR0L 2HHHQ 3J7Y1 2PQAB 4PG3A 1NBWA 4TQUS 5FLMG 3AEVA 4DUZQ 1X55A 4GN5A 2I5MX 2IT1A 1TWCH 3KDFB 3KF6B 1OXVA 2IY5B 4A3DH 5GROA 5IP9H 3RR5A 3KYWA 1KAWA 2NVQH 1LKOA 3NFPI 2VQFQ 3PCOB 1OXXK 4JV5L 2M4VA 1YHBA 1OTCA 4A3JH 1CSPA 4L5QA 5JJIA 1Y1VG 1N9WA 4QY7A 3K7AH 3PIP1 3STBC 1BBUA 3J7ZC 2UUCL 1YV1A 4JI0L 3PIPA 1U0LA 1IROA 2B3GA 4DV7L 3TS0A 5C0XJ 3HOYH 2K2DA 1IXRA 1CKMA 2NVYH 4LF4Q 5M3MH 1IL2A 2EXDA 1EQRA 2CR8A 2JA5G 3CMEA 4LF7Q 1V43A 1FVIA 1VQIA 3A5ZB 3NELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTV A;  2OWO A;  4UY8 C;  4WJ4 A;  3LGJ A;  4BA2 I;  1Q1B A;  1X56 A;  3G4S A;  4A3F H;  4DV5 Q;  1XMO Q;  4KHP L;  4GLX A;  1NNQ A;  3IRB A;  1QYB A;  1H7V A;  5M3F G;  3CD6 A;  2EQS A;  4R4I A;  2Q2U A;  5GAD C;  2MO1 A;  1Y1V H;  4UP7 A;  3L2P A;  4GN3 B;  1T9O A;  1RIP A;  3S1R H;  2HHH L;  3KOJ A;  3U4V A;  3KYH C;  1Q81 C;  2UU9 Q;  1O7I A;  1BVS A;  1IU5 A;  3FP9 A;  4R4O A;  3OW2 A;  3PUV A;  1VQM A;  3UDF A;  3HFZ B;  4JOI A;  3UE1 A;  3S16 H;  1YUX A;  2K52 A;  2PQA A;  1HR0 W;  1SMX A;  3PUW A;  3D0F A;  3HOU G;  1A63 A;  5DLQ E;  3A5U A;  4A3E H;  5C4X H;  3GDE A;  3VDY A;  1XNR L;  3GTO H;  2K5H A;  3H3V I;  3CQZ H;  3S14 H;  2CWA A;  1WFQ A;  3GTG H;  4GLV B;  4BY7 G;  1YIT A;  4MNO A;  1K9M C;  1CKN A;  2DSX A;  1WOC A;  1N8R C;  1KD1 C;  1IZ6 A;  5BR8 L;  2GVA A;  1BFY A;  5GAH C;  2Y0S G;  1VQG A;  3F8T A;  2R92 G;  2MS3 A;  2D62 A;  3HKZ G;  3T1H L;  2KCM A;  3HOX G;  1XNR Q;  2R93 G;  2OTL A;  2BH2 A;  3HOY G;  1VQD A;  2GN5 A;  1JE5 A;  4A3I G;  2JA5 H;  3H0G G;  3PO3 H;  1K8A C;  3S17 H;  1SMM A;  2WP8 J;  1GD7 A;  5M3M G;  1D8L A;  3W1B A;  3CC2 A;  2JEA I;  1QZG A;  1H95 A;  1HJP A;  5BR8 Q;  4A3M H;  2XGT A;  4LNQ A;  4XIG S;  5GAE C;  4HJ9 A;  1Q86 C;  1YEZ A;  3CC7 A;  1W2B A;  1PH8 A;  4A3G G;  3U4Z A;  2MQH A;  4UP8 A;  1IYJ B;  4DNI A;  4B3R L;  4NXN L;  2VZA A;  4EX5 A;  4IJH A;  3I56 A;  2IHF A;  5IE8 A;  3S2H H;  1ASY A;  4QGU A;  1RB9 A;  2E2H H;  4A3L H;  4X6A H;  4PZ8 A;  4DKA C;  1K8G A;  3MEF A;  4A93 H;  1AE3 A;  3RN5 A;  2CKZ B;  2K5V A;  1FL0 A;  3K8A A;  2I5L X;  2VY3 A;  3A74 A;  3ER0 A;  4IO9 A;  2R6G A;  1PFS A;  1SRU A;  1BRF A;  4JC0 A;  5J3B A;  5M3F H;  1TXY A;  5IY0 A;  1RDG A;  3A44 A;  3OTO L;  3H15 A;  4L5R C;  1DVB A;  4A3K G;  2Z0S A;  2PMZ E;  1IBL L;  3FKI G;  3CF5 A;  4GOP C;  3K81 C;  4NXN Q;  4YY3 L;  4LF9 Q;  2I5H A;  5AJ3 L;  3ERS X;  1XMQ L;  3MPS A;  1YVC A;  2ATW A;  3JAM i;  4JI5 Q;  4DR6 L;  4R4T A;  3KYY A;  3I7F A;  4IFD I;  1V1Q A;  2BA1 A;  3CXC A;  1HH2 P;  2LXK A;  3BZC A;  1IRN A;  3G71 A;  1R9T H;  1PH5 A;  4LF8 L;  4OX9 L;  1FJG L;  3RN2 A;  4DR4 Q;  1Z9F A;  4PMW A;  2LSS A;  3HOU H;  4YCW A;  6RXN A;  1VQE A;  4DAM A;  2AHO B;  2YU9 H;  1J6Q A;  3MXN B;  1EYG A;  1IBL Q;  2JA8 H;  5LMU L;  2WAQ E;  2C35 B;  2V3B B;  2RCN A;  2V1C C;  4P73 A;  4A75 A;  4ALP A;  1GM5 A;  4DR6 Q;  1LKM A;  1P16 A;  1B13 A;  2QA4 A;  3T1Y L;  4LF6 L;  1V9P A;  1GKH A;  3S24 A;  3E0E A;  1VQA A;  4OX9 Q;  2K50 A;  1PVO A;  1FJG Q;  4JG2 A;  3CPW A;  2L15 A;  1VQH A;  3TRZ A;  1KIX A;  2E2I H;  4PZ7 A;  1FHM A;  4GNX B;  2GVB A;  1S2Z A;  4X62 L;  2ZJQ A;  4B3S L;  4JI7 Q;  2R92 H;  4GKJ L;  3HOX H;  2Q2H A;  3DLL A;  4XTC S;  3K80 C;  2KBN A;  5IYB G;  2R93 H;  4DR3 L;  4YWL A;  2A8V A;  1L1O B;  1EOV A;  2ID0 A;  2WB1 E;  5GAG C;  5C0X I;  1VQ4 A;  4GLA C;  1X3F A;  2ZTD A;  1SE8 A;  1R0J A;  2HIX A;  3H0G H;  4X65 L;  4DV0 Q;  4A3I H;  4LF6 Q;  2F4V Q;  1TWG H;  4JI2 L;  4JBW A;  4C3I H;  2ZM6 L;  2KEN A;  5FJ8 G;  1QUQ A;  1KL9 A;  2YV5 A;  1PHJ A;  3PO3 G;  1PH7 A;  1SRO A;  4A3G H;  4OWT B;  4DV5 L;  4DR1 L;  2E5L L;  4GKJ Q;  1XMO L;  4HIO A;  3CCS A;  1YHQ A;  1JJC B;  4A3M G;  3I4N H;  5M5Y H;  4DR3 Q;  5M5X H;  2E8G A;  1XTD A;  1I50 H;  1G6P A;  1UEB A;  2UU9 L;  1Y14 B;  1YK4 A;  2MFI A;  4MZ9 A;  3CCM A;  1UE1 A;  4P74 A;  4JI2 Q;  1CAA A;  3PIO A;  4AR6 A;  2JA9 A;  1Q82 C;  4A3L G;  2ZM6 Q;  2RF4 A;  2KN9 A;  1VQB A;  2NZO A;  3M9B A;  5FLX c;  3BU2 A;  4A93 G;  3CW2 C;  4UPA A;  4DR1 Q;  1HZC A;  1Q12 A;  1L2F A;  3DM3 A;  4A3K H;  2MO0 A;  3FKI H;  3JC6 6;  2E5L Q;  3S2D H;  1UE6 A;  4A3B G;  1SN8 A;  2OQ0 A;  1VQ7 A;  3PUY A;  3G6E A;  4AR5 A;  1NJI C;  4DV2 Q;  1Z47 A;  4JI4 L;  2PNH A;  4OO1 G;  2UUB L;  3TEH B;  3NEM A;  4JI8 L;  5JEA G;  1E1O A;  1MKH A;  1YNX A;  1B70 B;  3TS2 A;  4GNX C;  2JA6 G;  3SGI A;  4QIW E;  3F2C A;  3KLW A;  4R4Q A;  3J80 i;  4LW1 A;  3RLF A;  4Y7N H;  5C3E G;  4DR4 L;  1VQJ A;  2F52 A;  4O2D A;  4TVA B;  4RMF A;  4X66 Q;  2ZTE A;  1L1O C;  1OXS C;  2PVX A;  1Q1E A;  4BA1 I;  3CCE A;  4DV4 Q;  1X54 A;  2HT1 A;  3S1Q H;  1PH1 A;  1VCX A;  1E3P A;  1EIY B;  3HOV H;  4JI4 Q;  3CCL A;  1CKO A;  2F3I A;  2JA8 G;  2UUB Q;  5ELN A;  4JI8 Q;  4GOP B;  2IX1 A;  3U58 A;  2UXC Q;  1SMU A;  1YI2 A;  3KFU A;  4MTN A;  4ME3 A;  2RDV A;  2CQO A;  2N3S A;  4QQB X;  3KDF A;  4NPS A;  3KF6 A;  1B7Y B;  1IU6 A;  2LCQ A;  2AKW B;  1X6O A;  4IJL A;  4KHZ A;  1PH3 A;  2OCE A;  1XPU A;  2QL0 A;  5IYB H;  1N32 L;  2R7F A;  2VNU D;  3PV0 A;  3E9I A;  4IPG A;  2D0P A;  4P75 A;  1HZB A;  4A4I A;  5JJL A;  2K5N A;  1LUZ A;  4JCV E;  4GN4 B;  3H3V H;  2N78 A;  1R0H A;  1WCM G;  1LTL A;  4EQ5 A;  1LYL A;  1MIU A;  4KLK A;  1X3G A;  2D0O A;  3SS2 A;  4OXP A;  1JB7 A;  3CPF A;  5FJ8 H;  1TWA H;  3JAM c;  3UDG A;  1C0A A;  2DGY A;  1X3E A;  3W1G A;  4R4C A;  1C7Y A;  4AYB E;  3F2D A;  2PI2 A;  2NN6 G;  3HOW H;  1N32 Q;  3M7N A;  4OON A;  4WJ3 M;  1E22 A;  3RLO A;  5IYD G;  4JI6 Q;  3NEN A;  4LUV A;  1K3R A;  1QVC A;  2HQL A;  3WWV A;  2QEX A;  4DV1 Q;  1M90 C;  3AFQ A;  1GO3 E;  1MJE A;  1I6H H;  4POG A;  1T9Q A;  1IBK L;  3I4N G;  4LF9 L;  3PWF A;  4JI5 L;  1B2O A;  3RZD H;  1T9P A;  1HNZ Q;  1CKN B;  3I2Z A;  3S1M H;  1G29 1;  2OTJ A;  2JK8 A;  1G51 A;  1N34 L;  1OXT A;  3KYV A;  1PH9 A;  2BH8 A;  1VQK A;  4A3B H;  1GVP A;  2UXD Q;  1BKB A;  2DUD A;  4J15 A;  3CCV A;  3NBH B;  4B3R Q;  3KYX A;  1VQ5 A;  4B3M L;  1XPO A;  3GTL H;  1EWI A;  3PGZ A;  4KI0 A;  3PF5 A;  1YJ9 A;  2JA7 G;  1IBK Q;  4IOA A;  1HNX Q;  1JJG A;  1EQQ A;  2JA6 H;  2MNA A;  5C3E H;  4OWW B;  4DV6 Q;  3CC4 A;  5JEA J;  3CAM A;  4K9F A;  3I4M G;  1N34 Q;  4APV A;  1SFO H;  1YZ6 A;  4HID A;  4DR5 Q;  3OYY A;  5E7N A;  1S40 A;  4B3T L;  1NE3 A;  4JI7 L;  4RG1 A;  1HNW L;  3Q8D A;  5RXN A;  2ZJR A;  4B3M Q;  4AIM A;  4TPU A;  4LUO A;  5LMN L;  1Y1W G;  1A0I A;  5IP7 G;  2Z6K C;  4DV0 L;  1XNQ L;  2B63 H;  2A19 A;  1S24 A;  3CCU A;  4JOI C;  3UDX A;  4YWM A;  4JI1 L;  1QVG A;  4BY1 H;  3KYU A;  2F4V L;  5IWA Q;  1YJW A;  3HOV G;  1L1O A;  4R1J A;  1KRT A;  4JBM A;  1A62 A;  1C9O A;  4JBK A;  4Y52 H;  1PA6 A;  4BBR G;  1LM0 A;  2VS1 A;  2HR5 A;  1S72 A;  4RXN A;  1J5E L;  4B3T Q;  3M4O H;  4JYA L;  4L5S A;  1HNW Q;  4AH6 A;  5JJK A;  1WCM H;  1MJC A;  2VW9 A;  4BBS G;  4K0K Q;  3I55 A;  1UE5 A;  4JBJ A;  4JV5 Q;  5LMN Q;  2AWN A;  7RXN A;  4NB3 A;  1Q8K A;  5C44 G;  1VQO A;  2LXJ A;  2HIV A;  3J7A 5;  2CCZ A;  1XNQ Q;  2WAQ G;  1FHH A;  4JI1 Q;  3M85 A;  8RXN A;  5IYD H;  3J80 c;  2VQE L;  2ZJP A;  4DUY L;  1YHA A;  4AQY L;  1K83 H;  5FLM H;  3D31 A;  1J5E Q;  4JYA Q;  3JC6 2;  1SLJ A;  2KCT A;  1M1K C;  3HOW G;  3PF4 A;  1N33 Q;  2UUA Q;  3J81 i;  2K4K A;  3W5O A;  2R7Z G;  3M3Y H;  3BZK A;  1I5F A;  3TQY A;  2WFW A;  4DV2 L;  3A0J A;  5GQO A;  4LWC A;  2WB1 G;  4POF A;  1L0W A;  3ULJ A;  2M4Y A;  4IPD A;  4DV3 Q;  4HJ5 A;  1B8A A;  5IT9 c;  4LF5 L;  2ASB A;  4BXX H;  3EBE A;  3KJP A;  2VQE Q;  4DUY Q;  1KC8 C;  1WI5 A;  1BE7 A;  4AQY Q;  3RNU A;  3GTQ H;  1R0F A;  4X66 L;  1JT8 A;  4LFA Q;  5M5W H;  4JI0 Q;  4DV4 L;  3AFP A;  3GD7 A;  4GKK L;  3AQQ A;  5IP9 G;  3FHW A;  4DR7 L;  4AR4 A;  1TWH H;  4DV7 Q;  2IHE A;  1UE7 A;  2K14 A;  3I4M H;  3RZ6 A;  3RYG A;  2PYA A;  2UXC L;  1QZH A;  1YUZ A;  3PSI A;  2NVX H;  3STB D;  2N8N A;  3L7Z C;  3L0O A;  4LF5 Q;  1KRS A;  1VQL A;  3K7U C;  1XJV A;  1KHI A;  4C3J H;  3B6Y A;  4GOP A;  1LKP A;  2VUM H;  1Y1W H;  1B2J A;  1QCV A;  1UWV A;  5IP7 H;  2UXB Q;  2AWO A;  4L5T A;  4HJ8 A;  4GKK Q;  4GS3 A;  2B29 A;  4DR7 Q;  1N36 L;  1NMF A;  2N49 A;  3E9H A;  4JI3 L;  3CCJ A;  1T9H A;  1R0G A;  1VCI A;  4HJ7 A;  4A3J G;  4BBR H;  3J81 j;  2B63 G;  4LFB L;  3UDI A;  1I94 L;  4DK3 C;  4IFD G;  4BY1 G;  1VQ6 A;  1X65 A;  3RZO H;  4YWK A;  4O0A A;  2ES2 A;  1NTG A;  3PO2 G;  1K0R A;  4BBS H;  1D7Q A;  4JI6 L;  4FDB A;  2Z6K A;  5C44 H;  3BJU A;  4DV1 L;  2Y0S E;  1B71 A;  1C09 A;  1WJJ A;  2BA0 A;  3EIV A;  4DK6 C;  1JYB A;  3KJO A;  2YTY A;  2KHI A;  2R7D A;  3HKZ E;  4DUZ L;  1RDV A;  1YJN A;  2YTX A;  1N36 Q;  4JI3 Q;  1IBM L;  4KHP Q;  2CFM A;  1HNZ L;  4DR2 L;  2JJQ A;  5HGQ A;  2RHS B;  1XPR A;  1HR0 L;  4LFB Q;  2HHH Q;  1PH6 A;  1I94 Q;  1VS0 A;  2UXD L;  2PQA B;  1NMG A;  2R7Z H;  1E7Z A;  4PG3 A;  2GMG A;  1E8J A;  2Q2I A;  1NBW A;  4TQU S;  3ULL A;  1PYB A;  5FLM G;  1Q7Y C;  3AEV A;  1KQS A;  4YHH L;  2RHQ B;  4DUZ Q;  1X55 A;  2KHJ A;  3RLN A;  4H02 A;  4NXM L;  3HOZ H;  3RZT A;  1HNX L;  4GN5 A;  4P72 A;  2JQO A;  5C0X G;  2I5M X;  1IBM Q;  1CUK A;  1TWC H;  2IT1 A;  3GTP H;  4DR2 Q;  3KDF B;  2VQF L;  3KF6 B;  1VQC A;  1DX8 A;  3HKS A;  3CCR A;  1ZRP A;  4DV6 L;  1HR0 Q;  1OXV A;  4LFC L;  1K73 C;  2I0Q A;  4LUZ A;  5IYC H;  1P8L A;  2IY5 B;  4A3D H;  2PVE A;  5GRO A;  1SR3 A;  4YCV A;  4DR5 L;  4YCU A;  4AYB G;  4X64 L;  4HIK A;  4BXX G;  5IP9 H;  1DGS A;  3TRE A;  3EN2 A;  1A8V A;  1Q46 A;  3RR5 A;  1VQP A;  1E24 A;  4YHH Q;  3KYW A;  1PH4 A;  4NXM Q;  1S3O A;  4IPH A;  4IOC A;  1YK5 A;  1CSQ A;  1I3Q H;  1KAW A;  3GTJ H;  1JMC A;  1QVF A;  2NVQ H;  1LKO A;  3AYH B;  2VQF Q;  3T1H Q;  1VQN A;  4A3C H;  4OO1 I;  5IWA L;  3ICE A;  5K36 G;  4LFC Q;  3GTK H;  5HY6 A;  5C4J H;  2NZH A;  4P71 A;  1ASZ A;  1NY4 A;  3PCO B;  4X64 Q;  5LMN W;  2YYZ A;  5ELO A;  2NVT H;  4HJA A;  3PUZ A;  4K0K L;  1RYT A;  1OXX K;  3J81 c;  2VUM G;  1YHB A;  1X9N A;  1OTC A;  4JV5 L;  1RL2 A;  4GNX A;  1EUJ A;  3ZJY C;  4A3J H;  1EIF A;  4A3F G;  1CSP A;  1AH9 A;  1VQ9 A;  4L5Q A;  3JC6 3;  2Q2T A;  1AE2 A;  3G48 A;  3PO2 H;  5JJI A;  4IPC A;  4QJF A;  1HZA A;  1WYD A;  2EIF A;  4IFD J;  1HZ9 A;  1BQ8 A;  3QVD A;  1Y1V G;  2KKD A;  2JA7 H;  1N9W A;  4DAY B;  1N33 L;  1SMW A;  4QY7 A;  2UUA L;  1BQ9 A;  1E1T A;  1PV4 A;  3OTO Q;  1OXU A;  1W3S A;  4C3H H;  3K7A H;  3CCQ A;  5AI2 A;  4UP9 A;  3STB C;  5AI3 A;  3PUX A;  4DV3 L;  4PZ6 A;  2H5X A;  1BBU A;  1CAD A;  3CP0 A;  3J7Z C;  4YY3 Q;  4BY7 H;  4DPG A;  1YBY A;  5AJ3 Q;  1XMQ Q;  2VL6 A;  4A3E G;  2UUC L;  2FXQ A;  5EAY A;  4LF4 L;  5C4X G;  1YV1 A;  2NN6 I;  1KXL A;  2QGQ A;  4LF8 Q;  2E2J H;  4LFA L;  3M4Q A;  4JI0 L;  1U5K A;  2JE6 I;  3PIP A;  1U0L A;  5H1S E;  1IRO A;  3S1N H;  2B3G A;  4DV7 L;  3TS0 A;  2OQK A;  1YIJ A;  5C0X J;  2CWP A;  2K75 A;  2IX0 A;  3KF8 B;  3K0X A;  2XTI A;  4LF7 L;  5LMU Q;  3HOY H;  3HOZ G;  4A76 A;  2K2D A;  1IXR A;  1CKM A;  1FGU A;  1JJ2 A;  2NVY H;  2UUC Q;  2ALY B;  5M3M H;  3T1Y Q;  4LF4 Q;  1IL2 A;  2EXD A;  3GO5 A;  3S15 H;  1EFW A;  5IYC G;  1R0I A;  4A3D G;  1EQR A;  3PZA A;  2PI2 E;  3I4O A;  2UXB L;  4C2M H;  2JA5 G;  4X62 Q;  4B3S Q;  2AMC B;  3CME A;  3F2B A;  4HIM A;  3ULP A;  1RWD A;  3GTM H;  2A1A A;  2JEB I;  1PYS B;  3F1Z A;  4OWX B;  4LF7 Q;  1VQ8 A;  3CMA A;  1S30 A;  3M4P A;  1BBW A;  1QUQ B;  1V43 A;  3U50 C;  1FVI A;  1VQI A;  4X65 Q;  4QL5 A;  1TWF H;  1VQF A;  1PH2 A;  3A5Z B;  3UE0 A;  3NEL A;  4A3C G;  4AR3 A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 3TZD A;  2OWO A;  3AMU A;  1O80 A;  4WJ4 A;  1F9R A;  4BA2 I;  1Q1B A;  1SAP A;  1X56 A;  4DV5 Q;  4GLX A;  4AI3 A;  1U4P A;  5M3F G;  5GAD C;  2MO1 A;  5J22 A;  1CT1 D;  1HHV A;  3H0G L;  1KNE A;  1EY8 A;  4R4O A;  1JOR A;  1TWG L;  3PUV A;  3TN2 A;  1B4O A;  2F0E A;  4JOI A;  1H9J A;  3HEJ A;  3MZ5 A;  4C56 C;  3D0F A;  3HOU G;  1WD1 A;  1KLU D;  3GDE A;  3VDY A;  1XNR L;  3S14 H;  5MLC 3;  4I7A A;  4J6H A;  1PRT D;  2KEC A;  3CHB D;  4ZCK A;  1YIT A;  1SNM A;  2DSX A;  2A6E C;  2F0Q A;  4CKC A;  1WOC A;  3OIP A;  2SEB D;  1QWY A;  5GAH C;  4A3D B;  2Y0S G;  1UUP A;  4A3K L;  3OW7 A;  2R92 G;  1PFW A;  3T1H L;  2KCM A;  2XJT A;  2BH2 A;  1TT2 A;  1VQD A;  4EVO A;  4RKL A;  4A3I G;  1I4H A;  5D3D A;  4FXK C;  1D8L A;  1QZG A;  2EJM A;  2C9O A;  2L12 A;  1EU3 A;  1RF2 D;  5GAE C;  1YEZ A;  4CBV A;  1W2B A;  1PH8 A;  3U4Z A;  4UP8 A;  2VZA A;  3OMC A;  4EX5 A;  3I56 A;  2IHF A;  1S5D D;  4HED A;  2A68 C;  1VDZ A;  5C4Z A;  4QGU A;  4X6A H;  3GTO L;  5J1Z A;  4DKA C;  1K8G A;  1AE3 A;  3RN5 A;  3A74 A;  3ER0 A;  2R6G A;  1Y8O B;  2K01 A;  1C8C A;  5J3B A;  2A69 C;  1KTK A;  3OTO L;  4DAY A;  1IBL L;  1HRJ A;  3FKI G;  4XT3 B;  1JE4 A;  4FXG C;  3P8B A;  1SYF A;  2EY6 A;  3MPS A;  1YVC A;  2JP1 A;  2HDM A;  2YU9 B;  1E2Z A;  3KYY A;  3I7F A;  1EIH A;  2BE5 C;  3K59 A;  2CH4 W;  4PMW A;  4DAV A;  1I4R A;  2LSS A;  4XYQ A;  1STB A;  4A3M L;  3MXN B;  2NTT A;  5LMU L;  1ESF A;  3D6W A;  3ZG6 A;  1GM5 A;  3DUZ A;  1B13 A;  4DA2 A;  1GKH A;  4A3L L;  1FJG Q;  4KD3 A;  3HOY B;  3CPW A;  5CV5 A;  4A93 L;  1VQH A;  2E2I H;  3GTK L;  1S2Z A;  1F2Z A;  4X62 L;  2Z4H A;  5M3M B;  3HOX H;  1EY4 A;  1ZEQ X;  2R93 H;  4C3I B;  4EQO A;  5IYB G;  4YWL A;  2L1B A;  1BCP D;  5GAG C;  1JWS D;  1MSH A;  2EOT A;  1R0J A;  1PZJ D;  4LF6 Q;  3K57 A;  2KED A;  1SRO A;  1I50 B;  4A3G H;  4GKJ Q;  2E5L L;  2KOL A;  4O42 A;  4HIO A;  1DXM A;  1JJC B;  1A3U A;  1RKN A;  3R2T A;  1K3B C;  4HMI A;  4DR3 Q;  1G6P A;  2JA8 L;  3DMU A;  3TBI B;  2UU9 L;  3LX0 A;  4MZ9 A;  5C4H A;  4JI2 Q;  4P74 A;  4AR6 A;  2JA9 A;  5EPJ A;  4HTH A;  2RF4 A;  2PZW A;  4UPA A;  3DM3 A;  3FRP B;  2MO0 A;  1G91 A;  4A3B G;  3PUY A;  3G6E A;  2CVR A;  1WCM L;  4AR5 A;  5EKI A;  1DOM A;  5C6A A;  2QCP X;  2RDF A;  5JEA G;  4IUR A;  3S1Q B;  3SGI A;  2PMZ B;  5C3E G;  4AHX A;  2F52 A;  4G57 A;  4TVA B;  1GHJ A;  2ZTE A;  1G2T A;  1X54 A;  1PH1 A;  1VCX A;  1E3P A;  4RHS A;  4ZN3 B;  4V0B A;  4DNR B;  2FHT A;  3HOV H;  1TU2 B;  1Y8P B;  4OGQ C;  2UUB Q;  5ELN A;  4GOP B;  2KEE A;  2A5H A;  3KFU A;  4MTN A;  2CQO A;  1B7Y B;  2LCQ A;  4IJL A;  2XVS A;  1XPU A;  3VPB E;  2SNS A;  2QL0 A;  2F0J A;  3N6R A;  1ZYR C;  3PV0 A;  2AQ2 B;  2A6H C;  4GN4 B;  5EKK A;  1LTL A;  1D1I A;  3VR5 A;  1MIU A;  4KLK A;  4OXP A;  1MD2 D;  3SS2 A;  3KK7 A;  2RA4 A;  3CPF A;  1KAB A;  1TWA H;  1NR4 A;  3JAM c;  4PMC A;  1X3E A;  5DM6 3;  4AYB E;  3RMH A;  3DM1 A;  4WJ3 M;  4OON A;  1E22 A;  3NEN A;  4B3R L;  3WWV A;  2PW5 A;  1GO3 E;  1F2M A;  1T9Q A;  3I4N G;  1WD0 A;  3PWF A;  4F7X A;  4KY5 A;  3TDQ A;  4S3S A;  2PQE A;  1EL0 A;  4JI5 L;  1B2O A;  3SK5 A;  1Q8I A;  4FO2 A;  4UY8 1;  4XXE A;  1M4V A;  1G51 A;  1BBX C;  2Z1C A;  4DF7 A;  1N34 L;  1VQK A;  2EY2 A;  3OWF A;  1EIG A;  2DUD A;  3NBH B;  1VQ5 A;  4BBS L;  2F0V A;  2MP1 A;  1S5B D;  2B8G A;  3GTL H;  1YJ9 A;  1AFP A;  3OPO A;  5BN3 A;  1DON A;  4QUF A;  1IBK Q;  3B08 B;  4IOA A;  1HNX Q;  2JA6 H;  1ICF B;  2KHS A;  4ID6 A;  4DV6 Q;  3CAM A;  2L4N A;  5E7N A;  5A2Q E;  2CKC A;  3FDT A;  4JI7 L;  4QF4 A;  1HNW L;  4C3J G;  4QIW B;  1Y1W G;  2F1M A;  2A6E D;  5ISR A;  2E2I B;  4DV0 L;  5IOC A;  4H0L C;  3CCU A;  4IUQ A;  4JOI C;  1L0Y B;  4R1J A;  1KRT A;  3S1M L;  4IUU A;  3URY A;  4BBR G;  1LM0 A;  2HR5 A;  3M4O H;  3TP5 A;  4JYA L;  2XJQ A;  1ROD A;  3FMC A;  2VW9 A;  1DM0 B;  2DN8 A;  2AWN A;  2LXJ A;  3J7A 5;  2CCZ A;  2ERS A;  3R3O A;  2ICE C;  3MWY W;  8RXN A;  1XYI A;  2IPK D;  5IYD H;  3PIO 1;  1YHA A;  1AN8 A;  2MPM A;  2B39 A;  2MJ8 A;  3HOW G;  2A68 D;  2AUJ D;  3J81 i;  4M8A A;  1DOL A;  1EY5 A;  4F87 A;  4DV2 L;  2C6B A;  5GQO A;  2WB1 G;  5ELB A;  3VR4 A;  2IX3 A;  4DV3 Q;  1B8A A;  5M5W B;  3E3X A;  5IT9 c;  4LF5 L;  4DUY Q;  3GTQ H;  1WVL A;  1KC8 C;  1BE7 A;  4AQY Q;  1TWH B;  3RNU A;  4MIU A;  4TKO B;  1BO0 A;  4LFA Q;  4DV4 L;  4GKK L;  5IP9 G;  1PTO B;  4AR4 A;  3I4M H;  3RZ6 A;  3RYG A;  1YUZ A;  2NB0 A;  3L7Z C;  3WWL A;  1KRS A;  1XJV A;  4ME5 A;  1B2J A;  1QCV A;  1UWV A;  5FLM L;  4RCN A;  2AWO A;  2UXB Q;  2E2J L;  4DR7 Q;  4R9W A;  5MFZ A;  3E9H A;  1FR3 A;  3HRZ C;  1VCI A;  2HCI A;  5CMD A;  4A3J G;  4KKS A;  4BY1 G;  4O0A A;  3R2I A;  1IW7 D;  2Z6K A;  5C44 H;  1DD2 A;  3P20 A;  4G7O C;  4K5W A;  1JYB A;  4DUZ L;  1SSO A;  4JI3 Q;  2L9H A;  2R7Z B;  2JJQ A;  2E75 C;  1I94 Q;  1NMG A;  1E8J A;  1PTO C;  2EYP A;  4DN4 M;  2RHQ B;  5IP7 L;  3HOZ H;  2JQO A;  2LFN A;  1CUK A;  4K5V A;  2VQF L;  1TII D;  1VQC A;  2F3W A;  5T1G A;  1ZRP A;  1P8L A;  4DR5 L;  1SR3 A;  1D1K A;  1XWE A;  1I3Q B;  4HIK A;  4BXX G;  1CA6 A;  3TRE A;  4IAL A;  1E24 A;  4YHH Q;  4NXM Q;  1S3O A;  1X3Q A;  4IPH A;  1YK5 A;  1CSQ A;  1JMC A;  1QVF A;  4KHV A;  4A3C H;  4OO1 I;  3ICE A;  2NVT B;  1GXD C;  5HY6 A;  5C4J H;  2NZH A;  3TZU A;  4P71 A;  1LO5 D;  4X64 Q;  4IUP A;  3PUZ A;  1RYT A;  2PPT A;  2R7Z L;  1PRT F;  4NDX A;  2VUM G;  1X9N A;  4XT1 B;  1EUJ A;  3ZJY C;  1AH9 A;  3LWR B;  3IFD A;  2JA7 B;  3JC6 3;  2Q2T A;  1AE2 A;  2JXM B;  3NQT A;  3C3L A;  2A6H D;  5ELC A;  2EIF A;  4C3H B;  1BQ8 A;  3W3A A;  2KKD A;  4NW2 A;  4K8I A;  1N33 L;  1SMW A;  2JA5 L;  5D14 A;  3S17 L;  1MGS A;  4L6T B;  5E4X A;  1E1T A;  3DEO A;  3H91 A;  1OXU A;  1W3S A;  3T53 B;  3A56 A;  3CCQ A;  5AI2 A;  2HVY C;  3QWN A;  4U67 1;  4EGV A;  1TS5 A;  1I3Q L;  4BY7 H;  4YY3 Q;  2FMC A;  4DPG A;  2KJX A;  5CGK A;  1XMQ Q;  2VL6 A;  1P7P A;  3UI2 A;  1QNU A;  5EAY A;  5C3W A;  4LF4 L;  3S1N B;  3S2H L;  1KXL A;  4XDX A;  4CDE C;  2ZIX A;  3I72 A;  1TVX A;  5C0X H;  4AYB B;  1JB3 A;  5H1S E;  4WJW A;  3S2D B;  2WII B;  1T5E A;  2F0M A;  5M3F L;  3K6O A;  2K75 A;  4LF7 L;  3L9A X;  2PSM C;  1JJ2 A;  1L0X B;  3GTM B;  1KDC A;  4K6L A;  5IYC G;  1R0I A;  1B50 A;  1NCV A;  4C2M H;  1EY0 A;  3DHQ A;  2AMC B;  1TWF B;  4HIM A;  5DM7 1;  5K36 H;  3E0J A;  5E1F A;  1SMY C;  1LT5 D;  3CMA A;  1STY A;  5KIX A;  2EYF A;  2AQ1 B;  1BBW A;  1QUQ B;  5IGC A;  4HMJ A;  1DCZ A;  1GHK A;  1VQF A;  1PH2 A;  2RDH A;  4UY8 C;  2DJF C;  1RD9 D;  4CDD C;  2K5W A;  4A3F H;  3S1R B;  4KHP L;  5F2D A;  1CTM A;  4DXF A;  1NNQ A;  2R92 L;  4CDF C;  3PIP 3;  2Q2U A;  4K5X A;  1PXU A;  3LWV B;  3E5S A;  3L2P A;  3AB9 A;  3GV6 A;  1WTP A;  3KYH C;  2EE1 A;  1O7I A;  4A3I L;  1BCP F;  3S2D L;  2PW7 A;  1IU5 A;  3FP9 A;  4A3E B;  3S15 L;  5C4X B;  2QDB A;  4IQZ A;  1QOH A;  3HFZ B;  3UE1 A;  3FPP A;  3GTG B;  2K52 A;  3T4A C;  1SMX A;  3KUP A;  3K5N A;  2F0O A;  1BDO A;  1WTX A;  3A5U A;  3GTO H;  5M5Y L;  2RSN A;  2CWA A;  1SJE D;  1SBB B;  3DEP A;  5ELF A;  3EVQ A;  3MEH A;  4MNO A;  1CKN A;  4TVM A;  2O4X A;  3QQC E;  4F8M A;  5DAU A;  3K58 A;  1A15 A;  1VQG A;  3SK8 A;  1LV9 A;  5CR3 A;  2MS3 A;  2D62 A;  4AHZ A;  2F0U A;  3HKZ G;  3HOX G;  3H99 A;  2R93 G;  3VR3 A;  2GN5 A;  3S1R L;  5EBC A;  1YNN D;  2WP8 J;  1DOK A;  2D9U A;  4CKE A;  4A3M H;  1G2S A;  5BR8 Q;  4XIG S;  3J81 E;  1Q86 C;  3CC7 A;  4A3G G;  5I9P A;  2G9D A;  4A3L H;  4PZ8 A;  1ZXT A;  3CQZ L;  4A93 H;  2K5V A;  1FL0 A;  3GTK H;  1PFS A;  4JC0 A;  4MN3 A;  2K05 A;  1F9S A;  5IY0 A;  4KN4 C;  3H15 A;  4L5R C;  5IYB L;  3BDC A;  1STG A;  4B9W A;  2PMZ E;  2F03 A;  3I73 A;  2CW0 C;  3K81 C;  5AJ3 L;  2JN4 A;  3ERS X;  1KNA A;  1TKW B;  1W6J A;  4IFD I;  1V1Q A;  2BA1 A;  3CXC A;  2LXK A;  2H4O A;  4LF8 L;  4DR4 Q;  1FJG L;  4I7Z C;  1PH5 A;  4BY7 B;  5FK9 C;  3JR7 A;  6RXN A;  2YU9 H;  1J6Q A;  2OXP A;  3D3R A;  1WTH A;  2NWG A;  2JA8 H;  2WAQ E;  2V3B B;  3VYR A;  4FF1 A;  2V1C C;  1PFB A;  2DY7 A;  4CJ0 B;  2QA4 A;  2G5D A;  3T1Y L;  4LF6 L;  3BDO A;  4HAE A;  3E0E A;  4OX9 Q;  1AEX A;  2L15 A;  1M8A A;  4KTA A;  4DAP A;  3TRZ A;  3LWU A;  1ET6 A;  4PZ7 A;  2GVB A;  3H0G B;  4B3S L;  4GKJ L;  4KKU A;  3VA7 A;  2M6P A;  2F0N A;  2Q2H A;  1TWG B;  4XTC S;  3K80 C;  4DR3 L;  2K5D A;  4E6I A;  2V0F A;  1SJH D;  4C2M B;  3SK6 A;  4X65 L;  3CKI B;  5G3L D;  4JI2 L;  4C3I H;  2AQ3 B;  3PO3 G;  3ND8 A;  1XMO L;  5TSS A;  1YHQ A;  1EY6 A;  4MHE A;  1ILP A;  2E8G A;  1Q90 A;  3IFT A;  4AI0 A;  1I50 H;  2B2V A;  4OIJ A;  4A3K B;  1Y14 B;  3QOL A;  1II3 A;  1GUS A;  3CCM A;  3QB3 A;  1CAA A;  2E76 C;  2KN9 A;  1TS2 A;  2NZO A;  2R3Z A;  3M9B A;  3P2A A;  4DR1 Q;  1Q12 A;  1L2F A;  1LTS D;  1ESR A;  1SN8 A;  2OQ0 A;  3VR6 A;  1SEB D;  1E2V A;  2V4D A;  1TR5 A;  1HA5 A;  1EEF D;  1YNJ C;  1NJI C;  2UUB L;  1VZG A;  2WV6 D;  1C48 A;  1YNX A;  1D5M C;  2JA6 G;  4QIW E;  1HPC A;  4R4Q A;  4FXD A;  1VQJ A;  3GTO B;  2NYD A;  4X66 Q;  1ILQ A;  3GP7 A;  1OXS C;  4G6B A;  2LKV A;  3S1Q H;  2PMZ P;  1Q3L A;  3I4N L;  1DJR D;  3P7J A;  4ZUJ A;  2B2W A;  4JI4 Q;  1CKO A;  2I46 A;  1ML0 D;  1BR9 A;  2HD3 A;  1WJV A;  3U58 A;  5CV9 A;  2UXC Q;  2RDV A;  2N3S A;  4NPS A;  3FPU B;  2K1B A;  4KHZ A;  1PH3 A;  2KA7 A;  1B2T A;  1PDQ A;  4P75 A;  4A4I A;  2O2L D;  2D0P A;  2ZXP A;  1HZB A;  2B2T A;  4DGZ A;  5JJL A;  1QG7 A;  4G4K A;  1V8Q A;  1T5X D;  2N78 A;  4A3M B;  3CRL C;  1JB7 A;  2EYJ A;  1MBY A;  5FJ8 H;  1H9S B;  4H44 C;  5I6W A;  2NN6 G;  1WTV A;  2F0H A;  1HFG A;  3R93 A;  3M7N A;  3RUZ A;  5IYD G;  4JI6 Q;  4LUV A;  1K3R A;  1QVC A;  2HQL A;  2IJ0 A;  3BYT B;  4C3J L;  5JVG 1;  3NBI A;  3NXW A;  3GTK B;  4A93 B;  5GAD c;  1Y1W L;  1IBK L;  5CBE E;  4LF9 L;  1PZX A;  3LNN A;  1JWU D;  4K8J A;  3S1M H;  2CQA A;  1CKN B;  4Z9C B;  2OTJ A;  4YIJ A;  1PZK D;  3OWE B;  2XWJ B;  1OXT A;  3KYV A;  1PH9 A;  4BBR L;  2EY4 E;  3RZO L;  3NQI A;  3KYX A;  2FJ2 A;  1EWI A;  2Z4I A;  1D2B A;  4N8F A;  5IGG A;  3TME A;  1JJG A;  2XNA C;  3NK9 A;  1STN A;  1EQQ A;  2X6L A;  1RTO A;  3FVQ A;  3H3V C;  4OWW B;  1H9R A;  3CC4 A;  3HZX A;  4K9F A;  3I4M G;  5CC4 A;  2JA8 B;  3ZYY X;  5GAH c;  3OYY A;  1S40 A;  4RG1 A;  3HOW L;  3Q8D A;  1R4Q B;  5RXN A;  4B3M Q;  4AIM A;  4KJO A;  2BCO A;  1EY7 A;  1I6H L;  3J7A V;  3D4R A;  2A19 A;  4XXB B;  1QVG A;  4IFD H;  4YWM A;  2F4V L;  1WCM B;  4QIW P;  3KF8 A;  1TWC L;  1L1O A;  1Z7T A;  4WOR A;  4JBK A;  3I70 A;  1LAB A;  2RCF A;  1S72 A;  4B3T Q;  5GAE c;  4AH6 A;  1A3T A;  4BWG B;  3I55 A;  5IP9 L;  1UE5 A;  5I9O A;  4JV5 Q;  5C44 G;  1PFV A;  4JAG A;  3QJY A;  1XNQ Q;  1K0S A;  4JK1 C;  4PNY A;  2ERJ A;  1JIC A;  3LWQ B;  3M3Y B;  2NVQ L;  4DUY L;  1STH A;  4AQY L;  5FLX E;  5FLM H;  1J5E Q;  1OWB A;  3JC6 2;  5I2Y A;  3PF4 A;  3W5O A;  1I5F A;  3SR1 A;  1CQV A;  2WFW A;  5K2M E;  4POF A;  5EJW A;  4A3J L;  4LHN A;  1I4X A;  5FO9 B;  1IYU A;  4BY1 L;  3SXH A;  5JVH 3;  3EBE A;  2VQE Q;  4ZN1 B;  1R0F A;  4Y52 L;  1D5Z C;  3NP8 A;  4FVM A;  4FYD A;  1QNK A;  5M5W H;  1WTR A;  4JI0 Q;  5JPN C;  3AFP A;  5H1S c;  4DR7 L;  5I6Y A;  3G7L A;  1TWH H;  4DV7 Q;  1EYC A;  2K14 A;  3V05 A;  2L0Z A;  2PYA A;  5AN9 H;  3PSI A;  4UAI A;  4RA8 A;  3STB D;  3L0O A;  1PTO H;  2XIW A;  3M7G A;  3B6Y A;  3IL8 A;  5KND A;  1K83 L;  5I2X A;  5IP7 H;  1B44 D;  5D65 A;  5GAG c;  3A54 A;  4GS3 A;  2EJG C;  1GOZ A;  3M3Y L;  4JI3 L;  3CCJ A;  4BBS B;  2NZ1 D;  1T9H A;  1LTA D;  1LT3 D;  2B63 G;  1I94 L;  2CH4 A;  2WAQ B;  4JAE A;  4N9P A;  4H13 C;  2EYH A;  4BXX L;  1K0R A;  3PIO 3;  2NVY L;  1F4L A;  4DV1 L;  2Y0S E;  1B71 A;  1EYG A;  3LPE B;  2YTY A;  2KHI A;  1YJN A;  1N36 Q;  3C46 A;  4BS9 A;  2O5J D;  1HNZ L;  4CKB A;  2HDL A;  1NXG A;  3TSS A;  4LFB Q;  1PH6 A;  1SNP A;  5CV4 A;  2UXD L;  2R7Z H;  3FDJ A;  3S1M B;  1NNX A;  1Q7Y C;  4RGN A;  1QQT A;  2VUM L;  4YHH L;  4NXM L;  3RLN A;  5C3X A;  4P72 A;  5C0X G;  1IBM Q;  2K28 A;  3HKS A;  1DX8 A;  4QCL A;  1K73 C;  2I0Q A;  4LUZ A;  5KNB A;  3H09 A;  4N8X 1;  2PVE A;  4AHY A;  5BN4 A;  4WFN 1;  4X64 L;  3GTJ B;  1DGS A;  3EN2 A;  1A8V A;  1Q46 A;  1VQP A;  1PH4 A;  4IOC A;  3NUC A;  4B9X A;  1I3Q H;  2IWH A;  3AYH B;  3EFX D;  3T1H Q;  5K36 G;  5IWA L;  4LFC Q;  3D4W A;  4NKL A;  2B5I D;  3S14 L;  2L5T A;  4LK1 C;  5ELO A;  2NVT H;  4HJA A;  4K0K L;  3PO2 B;  3J81 c;  4AI1 A;  1RL2 A;  2MUY A;  4A3F G;  4IUN A;  1JOK A;  4KN7 C;  3G48 A;  4LAA A;  3GTP L;  4LJZ C;  1WYD A;  1D5X C;  1HZ9 A;  3T51 B;  4IFD J;  3QVD A;  5IYC L;  2JA7 H;  4DAY B;  5J39 A;  4KD4 A;  2UUA L;  2Z3Q B;  1PV4 A;  3OTO Q;  4C3H H;  4FF4 A;  1F2L A;  2N55 A;  3PUX A;  3NHH A;  1B3Q A;  1TS3 A;  2E2J B;  2Q8R E;  1K28 A;  2H5X A;  3CP0 A;  1CAD A;  3GTJ L;  2RDG A;  3Q22 A;  2B2T C;  2EZV A;  2FXQ A;  1LTB D;  2QGQ A;  1FGB D;  4EQN A;  4L8J A;  2NYZ D;  2P5Z X;  4HSV A;  1U5K A;  2JE6 I;  2G9H D;  4I65 A;  3S1N H;  2A69 D;  2B8F A;  2CWP A;  3KF8 B;  3K0X A;  2XTI A;  5LMU Q;  5CV8 A;  3KLS X;  2EXZ A;  4AYB P;  4OEL B;  3S2D H;  3PO2 L;  3GO5 A;  3S15 H;  1EFW A;  1B1Z A;  4LHL A;  4A3D G;  2SOB A;  2PI2 E;  3PZA A;  2ICI A;  4X62 Q;  1R4P B;  3F2B A;  2BE5 D;  3NTH A;  4RWS C;  3GTM H;  2F4I A;  1PYS B;  3F1Z A;  4OWX B;  4AHW A;  1HFN A;  3F2U A;  3U50 C;  3K5O A;  2Z3R B;  1TWF H;  4MTK A;  2M00 A;  4XGH A;  1JOO A;  4QUC A;  1OO9 B;  1S5C D;  3UE0 A;  4AR3 A;  4JVZ A;  3J7A F;  1GUO A;  1JQY D;  2YTV A;  3CRK C;  1PTO F;  4KY6 A;  1ONL A;  3LGJ A;  1Y1V B;  1B9M A;  3IRB A;  1QYB A;  1H7V A;  2EQS A;  3HOX L;  3X3M A;  4IN3 A;  4U67 3;  3S1R H;  2HHH L;  1RIP A;  2UU9 Q;  3KOJ A;  3U4V A;  4O1N A;  3MXP A;  4CHT B;  2M6O A;  4ZKB B;  4RFB A;  5G3L F;  3UDF A;  5FO7 B;  4KY7 A;  1A6X A;  1YUX A;  2PQA A;  5DLQ E;  4A3E H;  5C4X H;  3U9S A;  3H3V I;  2DJG C;  2SDF A;  3CQZ H;  5KYL A;  1WFQ A;  3GTG H;  2L0C A;  3T56 B;  2TSS A;  4OL7 A;  5CV6 A;  1EQV A;  5EBD A;  1KD1 C;  5BR8 L;  1BFY A;  5JPM C;  2WKD A;  2JA5 B;  3HJY B;  2F0P A;  3S17 B;  5DM7 3;  2EY5 A;  2K5Q A;  2Z9H A;  1H9M A;  3HOY G;  1QJO A;  1AZQ A;  3WOF A;  1O7Z A;  1Y1V L;  5KYI A;  5M3M G;  3CC2 A;  1H95 A;  2VB3 X;  1SE2 A;  2PNR C;  3PQI A;  4C3I G;  3S2H B;  2XGT A;  4HJ9 A;  2V0E A;  1K8M A;  3QG1 A;  3S16 L;  3AU7 A;  4K14 A;  4ZKC B;  4DNI A;  4IJH A;  3MXU A;  5IE8 A;  5M3F B;  1ASY A;  5M9O A;  5E3F A;  4RGO S;  3K8A A;  4DR4 L;  2I5L X;  1FD7 D;  1NUC A;  1VMC A;  4IO9 A;  3J80 L;  1BRF A;  1GUT A;  1ZKO A;  2DNC A;  1RDG A;  1PFY A;  1DVB A;  1LTR D;  4NXN Q;  1ZYR D;  4DXG A;  5JEA H;  3C2P A;  4JPB W;  2I5H A;  5A35 A;  2ATW A;  3HOU B;  1BQQ T;  1ET9 A;  4JI5 Q;  4R4T A;  4ABN A;  1X32 A;  4OX9 L;  1HH2 P;  1IRN A;  1H9K A;  2AUK A;  1TWA L;  3RN2 A;  1Z9F A;  3PO3 L;  2ZT9 C;  5T1I A;  3T16 A;  3LWO B;  4YCW A;  4DAM A;  2AHO B;  3H97 A;  2C35 B;  2Y0S B;  3KLR A;  2RCN A;  4P73 A;  4A75 A;  4DR6 Q;  2R92 B;  2L11 A;  4XQQ A;  1V9P A;  3S24 A;  1VQA A;  1CM9 A;  2K50 A;  3P1H A;  5COY A;  2E2H L;  1RJT A;  1B3A A;  3HGB A;  1PVO A;  4Q5V A;  1IHZ A;  1UEA B;  2F0F A;  4HR7 B;  4A3I B;  1QB5 D;  4JI7 Q;  1Y8N B;  3X3N A;  3DLL A;  3S15 B;  2A8V A;  2ID0 A;  2WB1 E;  1VQ4 A;  2XJU A;  4GLA C;  4ZRZ A;  3H0G H;  4DV0 Q;  2KQ3 A;  1TWG H;  4JBW A;  3SHL A;  4RHR A;  5M5Y B;  3J7Y W;  1CA5 A;  5EPK A;  5FJ8 G;  1PHJ A;  3MQK B;  1HTP A;  1U4L A;  4OIK A;  1LTT D;  1R9T L;  4OWT B;  4DV5 L;  4DR1 L;  3QO2 A;  1QE6 A;  5EPL A;  3I4N H;  2CHB D;  2RSO A;  3HOU L;  1MI2 A;  4WRD A;  5ELD A;  1PRT C;  1RDP D;  4B08 A;  1XTD A;  3FKI B;  5I4D A;  1MSG A;  1O7Y A;  1Q82 C;  2ZM6 Q;  5FLX c;  1UAP A;  2RKS A;  1HZC A;  1U4R A;  4A3K H;  2JI3 A;  2EYL A;  2K03 A;  3JC6 6;  1UE6 A;  3M4O L;  5KRU A;  4Y7N B;  3EQL C;  4NP5 A;  4OHJ A;  3O13 A;  3BVG A;  4DV2 Q;  4JI4 L;  1SYD A;  5L37 A;  3TEH B;  2QEJ C;  3NEM A;  1MKH A;  1B70 B;  1EQT A;  3E6Z X;  1FNU A;  2HUG A;  3F2C A;  1I4P A;  3J80 i;  4LW1 A;  3RLF A;  3G6J B;  3W2D A;  1ENA A;  1ODH A;  3CQZ B;  4RMF A;  1Q1E A;  4BA1 I;  4DV4 Q;  4GS7 D;  5M5X L;  3CCL A;  1PYW D;  4B8C D;  2F3I A;  1F9P A;  2Z8L A;  3WWN B;  4JI8 Q;  1SMU A;  1YI2 A;  4ME3 A;  1W6K A;  2KUM A;  4QQB X;  3A7A B;  4RKB A;  1PZI D;  4JAF A;  1O7L A;  1X6O A;  2AKW B;  1EEI D;  5MF6 A;  2H12 A;  2R7F A;  2XRQ D;  2J9U B;  2VNU D;  3E9I A;  2J7Z A;  4ILW A;  5EIN C;  3H3V H;  3FKI L;  4EQ5 A;  2DNE A;  4UDU C;  3A55 A;  2PYK A;  3NE5 B;  3W1G A;  4R4C A;  3MSU A;  3HOW H;  1N32 Q;  5KEE A;  1JR0 D;  3D8G A;  4Y7N L;  3RLO A;  1KDB A;  1M90 C;  2WB1 P;  1I6H H;  2F0T A;  4A3B B;  2F0I A;  1EWC A;  1T9P A;  3I2Z A;  1KDA A;  1F2Y A;  1BKB A;  1BCP C;  5C3E B;  2PCF B;  4B3M L;  5A2Q L;  1XPO A;  3PGZ A;  1EOT A;  3PF5 A;  4OO1 H;  3CU7 A;  1SFO B;  2HQE A;  1A2U A;  3MXN A;  5JEA J;  2K32 A;  2EVB A;  4HID A;  4DR5 Q;  4X3K A;  1PMR A;  4B3T L;  2B63 B;  4OEM B;  3SVM A;  2XRS D;  4LUO A;  4KV6 A;  5IP7 G;  2Z6K C;  1PTO D;  1XNQ L;  4KJN A;  3UDX A;  4BY1 H;  3HOV G;  3KYU A;  4GZY C;  1I6V C;  1TY2 A;  3RZD L;  4Y52 H;  3C1F A;  1PA6 A;  3ERQ A;  4M1U B;  1J5E L;  4RXN A;  3A8K E;  5JJK A;  3MA2 B;  2EYM A;  4A3B L;  1WCM H;  2E74 C;  1HQM C;  4JBJ A;  5LMN Q;  4NB3 A;  7RXN A;  5JVG 3;  1VQO A;  2HIV A;  2FFK B;  3QIA A;  1FHH A;  4JI1 Q;  3Q23 A;  3I4N B;  5C3E L;  2X6G A;  1TQO A;  2VQE L;  1K83 H;  3D31 A;  1SLJ A;  1SFO L;  3S9W A;  1M1K C;  1N33 Q;  1DYQ A;  2D2C C;  3M3Y H;  2K4K A;  2R7Z G;  4U68 A;  2BDN A;  3A0J A;  4DK0 A;  3ULJ A;  4IPD A;  4RGT A;  2B63 L;  4KMU C;  2ASB A;  4BXX H;  4FF2 A;  1JT8 A;  4K2K A;  3LWP B;  2QIL A;  1VZI A;  1E2W A;  1LTG D;  4UHV A;  2IHE A;  4C3J B;  1Y1W B;  2AQC A;  1QZH A;  2OT2 A;  3DWQ A;  2K04 A;  3K7U C;  1KHI A;  4GOP A;  2VUM H;  3P75 A;  4BBR B;  2IL8 A;  3OOC A;  2B29 A;  1N36 L;  1NMF A;  2N49 A;  3RZO B;  3IU3 I;  3H9B A;  1R0G A;  1PFN A;  3ITP A;  3J81 j;  4LFB L;  2EY1 A;  5LL6 S;  1X65 A;  4ZAI A;  4BBS H;  1NTG A;  1F77 A;  1VF5 C;  4ZUI A;  4FDB A;  3BJU A;  3K35 A;  2QDL A;  5EQ0 A;  1WJJ A;  2JA7 G;  2WAQ P;  2A74 C;  3KJO A;  3HKZ E;  4KHP Q;  3HOW B;  2YTX A;  1IBM L;  2JI1 A;  3BVZ A;  3D6C A;  2AYJ A;  2CFM A;  4PV1 C;  4C3H G;  1SYE A;  1SNO A;  1RHP A;  5NUC A;  5HGT A;  4ULL A;  1I6H B;  1SMY D;  2WB1 B;  1CK1 A;  5AFW A;  1VS0 A;  1FNV A;  4X3T A;  1ENC A;  2EJF C;  2NVX L;  1TWC B;  1E7Z A;  2GMG A;  1A3V A;  1OWC A;  2Q2I A;  3ULL A;  1PYB A;  5IOD A;  1KQS A;  3MC0 B;  2FIN B;  2KHJ A;  1B53 A;  2KCC A;  4H02 A;  3RZT A;  1HNX L;  4A3F L;  2XN9 C;  3GTP H;  3NBH A;  4DR2 Q;  3CCR A;  4DV6 L;  4E6Y A;  1HR0 Q;  4LFC L;  5IYC H;  3NPP A;  4IUT A;  2K7V A;  4YCV A;  5MGN A;  4YCU A;  4AYB G;  2NVQ B;  3H9C A;  3BDL A;  2F0G A;  4X3U A;  2WIN B;  3GTJ H;  1SND A;  1CI3 M;  4C1N I;  1VQN A;  3A8J E;  3NSW A;  2N88 A;  3ERO A;  2QF7 A;  1ASZ A;  4A3J B;  1NY4 A;  5IGF A;  2GA4 B;  5FO8 B;  5LMN W;  4BY1 B;  2YYZ A;  1IYV A;  2EDG A;  4GNX A;  3L3O C;  1EIF A;  2RFK B;  1VQ9 A;  2VB2 X;  1NR2 A;  3PO2 H;  2LS0 1;  4IPC A;  1HZA A;  4QJF A;  5EIO C;  3K7A B;  3J80 E;  4A3D L;  3LNL A;  3TP6 A;  1BQ9 A;  1KAA A;  1BUV T;  1K83 B;  4UP9 A;  5AI3 A;  1HUM A;  2F0L A;  4DV3 L;  1K8O A;  4K2L A;  4PZ6 A;  1CZG A;  1YBY A;  2J4X A;  5AJ3 Q;  4A3E G;  5C4X G;  2NN6 I;  3MAQ A;  4LF8 Q;  3MVV A;  4WFN 3;  2E2J H;  4LFA L;  3M4Q A;  1LAC A;  3SK4 A;  3HKZ P;  2NVY B;  2B2Y A;  2OQK A;  1YIJ A;  2IX0 A;  3HOZ G;  2XJR A;  2F0W A;  1NXE A;  3RD4 A;  3BZD B;  4J8Q A;  4A76 A;  3K0Y A;  1IW7 C;  4FP5 D;  1FGU A;  4L63 B;  2UUC Q;  2ALY B;  3T1Y Q;  2CW0 D;  3IKJ A;  2ENB A;  3I4O A;  5K5P A;  2UXB L;  2EYO A;  4IUV A;  3Q6S A;  4B3S Q;  3ULP A;  1RWD A;  2A1A A;  2JEB I;  3VYS A;  3A7L A;  2XJP A;  1VQ8 A;  2VUM B;  2YU9 L;  3K7A L;  1S30 A;  3M4P A;  1FYC A;  4X65 Q;  4QL5 A;  3DXJ C;  4A3C G;  3JAM L;  2ZTC A;  3QOJ A;  4CDC C;  1HTL D;  1X3P A;  3G4S A;  1XMO Q;  4RAU C;  3CD6 A;  1E0B A;  4R4I A;  4DNT B;  5LHY 1;  3HOY L;  1NAP A;  1Y1V H;  2QW7 A;  1T9O A;  4GN3 B;  4UP7 A;  1Q81 C;  4ZYS A;  1BNZ A;  1QCB D;  1BVS A;  4N9T A;  5M3M L;  3K5M A;  3OW2 A;  4C3I L;  1VQM A;  3S14 B;  3S16 H;  1HR0 W;  2APO B;  3PUW A;  1O78 A;  1A63 A;  5IGD A;  1J9O A;  1CZW A;  4LMQ D;  2K5H A;  2JSO A;  1I4Q A;  3PL5 A;  4GLV B;  4F88 A;  4BY7 G;  1I50 L;  2EPB A;  3PKJ A;  1K9M C;  3GTP B;  4PQX A;  1N8R C;  2RQX A;  1IZ6 A;  2PZT A;  3VA5 A;  2GVA A;  1J8I A;  3GQB A;  3F8T A;  3J81 L;  1XNR Q;  2OTL A;  2Q8T A;  4V19 0;  1JE5 A;  3PO3 H;  2JA5 H;  3H0G G;  1K8A C;  1YNJ D;  3S17 H;  1SMM A;  2B2V C;  1GD7 A;  3I3C A;  2JEA I;  3W1B A;  3QR8 A;  2Q8I B;  1HJP A;  2B2U A;  4LNQ A;  3SEB A;  1VF7 A;  2MQH A;  1IYJ B;  4ODG A;  4NXN L;  3S1Q L;  3S2H H;  2E2D C;  2MHV A;  3D4D A;  4XYO A;  5EGT A;  1RB9 A;  2E2H H;  1V1P A;  3MEF A;  1Z92 B;  2CKZ B;  4G7Z C;  2VY3 A;  1SRU A;  2XJS A;  3HAX C;  5M3F H;  1TXY A;  1DZ1 A;  3A44 A;  4A3K G;  2Z0S A;  1A2T A;  1S5E D;  3CF5 A;  4GOP C;  4YY3 L;  4LF9 Q;  1LT6 D;  1XMQ L;  4DR6 L;  3JAM i;  1U4M A;  4R8I A;  5JVH 1;  4QMG A;  3BZC A;  5IT9 L;  2B2W C;  3G71 A;  1HQR D;  1R9T H;  5FJ8 L;  4PMB A;  4ZK9 B;  2LY7 A;  3HOU H;  5CV7 A;  2M9V A;  3HG9 A;  1VQE A;  2CKA A;  1STE A;  1IBL Q;  3DWA A;  4ALP A;  4KKT A;  1LKM A;  1P16 A;  2JYO A;  3HKZ B;  3HOX B;  2R93 B;  4X6A L;  4JG2 A;  2Y0S P;  1KIX A;  1FHM A;  4GNX B;  2ZJQ A;  2R92 H;  4QB4 A;  4V19 6;  2KBN A;  1L1O B;  1EOV A;  5IIF A;  5C0X I;  2XJV A;  1X3F A;  2ZTD A;  1SE8 A;  2HIX A;  4A3I H;  4A3G B;  2XSC A;  1RTN A;  2NN6 H;  2F4V Q;  2ZM6 L;  2KEN A;  1QUQ A;  1KL9 A;  2YV5 A;  4CJ2 C;  2J0T D;  5DNF A;  1SE3 A;  1PH7 A;  3PKI A;  3CCS A;  4A3M G;  3NTK A;  5M5Y H;  5M5X H;  2IW3 A;  3MHB A;  3Q24 A;  1G6Z A;  1EY9 A;  5BN5 A;  1UEB A;  1YK4 A;  2MFI A;  5DM6 1;  1UE1 A;  1JC7 A;  2X69 A;  4C1N K;  3TP8 A;  3DWP A;  3PIO A;  4A3L G;  5COR A;  1VQB A;  4A93 G;  3BU2 A;  3EA6 A;  2NBF A;  4EQP A;  3CW2 C;  2E5L Q;  2PZU A;  1IL8 A;  2E2I L;  3FKI H;  1U9R A;  2C6A A;  1VQ7 A;  3BYY B;  2K6A A;  4ZQ3 A;  2R93 L;  3MFG A;  1Z47 A;  1YNN C;  4XQJ A;  2PNH A;  3S16 B;  5EKL A;  4OO1 G;  5E4W C;  4JI8 L;  1E1O A;  2L55 A;  3TS2 A;  4GNX C;  3KLW A;  3VYU A;  4Y7N H;  5MFP A;  3BVM A;  1SNQ A;  4O2D A;  3HOV B;  3NWS A;  1L1O C;  3H6M A;  2F3V A;  1EYA A;  4A3G L;  2PVX A;  2HCC A;  2HT1 A;  3CCE A;  1WTW A;  3J7Z 1;  4HCS A;  3IAY A;  1EIY B;  2JA8 G;  3I4L A;  3BG3 A;  2IX1 A;  5JOB A;  5CBA E;  3KDF A;  3KF6 A;  1IU6 A;  4TRD A;  1N32 L;  2OCE A;  5IYB H;  2DY8 A;  4IPG A;  1TWA B;  3PO3 B;  2K5N A;  1LUZ A;  1RYQ A;  4JCV E;  1HA6 A;  1R0H A;  1TS4 A;  1WCM G;  5M5W L;  1LYL A;  2O5I C;  2VXW A;  1C4Q A;  1JWM D;  1X3G A;  2D0O A;  3PMF A;  1C0A A;  1LTI D;  1TWH L;  3UDG A;  2DGY A;  1C7Y A;  2B2Y C;  2PI2 A;  3F2D A;  4JAD A;  2E2H B;  3EJI A;  4DV1 Q;  1MJE A;  2QEX A;  3AFQ A;  3SE0 A;  4POG A;  3K5L A;  3MFY A;  2RVL A;  1JCK B;  1XTC D;  2I07 B;  4RCO A;  3MTS A;  1AZP A;  5LL6 X;  3HOV L;  3RZD H;  1HNZ Q;  2ZXO A;  1G29 1;  2MGS A;  2JK8 A;  2R61 A;  1QIL A;  3GTL B;  5D3I B;  2OEO A;  3U9O A;  2BH8 A;  4A3B H;  1LT4 D;  1BXT A;  1GVP A;  2BOS A;  2JA6 B;  2UXD Q;  1XX8 A;  4J15 A;  3CCV A;  2H1E A;  4B3R Q;  1CFM A;  3LWE A;  4KI0 A;  1R9T B;  4K6D A;  1KLG D;  4ZLT F;  3TP7 A;  5IGE A;  1PRT B;  1EU4 A;  2MNA A;  1GUN A;  5C3E H;  3BS1 A;  3MXG A;  1AW7 A;  3B0A B;  1N34 Q;  4DK1 A;  4APV A;  1SFO H;  1YZ6 A;  1NE3 A;  4C2M 1;  3M4Y A;  2OF1 A;  2ZJR A;  4RH6 A;  2RBM A;  4TPU A;  1G8Z D;  4FF3 A;  1EFI D;  5LMN L;  1A0I A;  1V1P B;  2ZXR A;  2B63 H;  3M4O B;  1HCZ A;  1S24 A;  1PFU A;  4JI1 L;  1UNS A;  5IWA Q;  1YJW A;  4JBM A;  1A62 A;  1C9O A;  4Q0F A;  1SXT A;  2VS1 A;  3KBG A;  4IZ8 A;  3OMG A;  1CHP D;  4L5S A;  1HNW Q;  1MJC A;  5FLX L;  4BBS G;  4K0K Q;  3NTI A;  1Q8K A;  4DFA A;  3GTL L;  2WAQ G;  3M85 A;  1SE4 A;  1Z6H A;  2JA6 L;  5M5X B;  3WOE A;  3J80 c;  2ZJP A;  4HSP A;  3HS0 C;  3I90 A;  4JYA Q;  2KCT A;  2BDO A;  1HUN A;  3T13 A;  2PPB C;  2UUA Q;  2K33 A;  3BZK A;  1BOS A;  3A8I E;  2NVT L;  3GTQ B;  3TQY A;  1GUW A;  4LWC A;  2TMP A;  1L0W A;  2M4Y A;  4HJ5 A;  2B2U C;  1AP0 A;  3KJP A;  1WI5 A;  4X66 L;  1EWH A;  3I4M B;  3GD7 A;  2JA7 L;  4HN7 A;  3AQQ A;  1WTO A;  2FMM A;  3FHW A;  1B9N A;  2WKC A;  3KBX A;  1UE7 A;  1IKL A;  1IKM A;  4C3H L;  4CJ1 B;  2F0S A;  2UXC L;  1MHW C;  2NVX H;  1EZ6 A;  2N8N A;  4LF5 Q;  1VQL A;  4C3J H;  5IYD L;  4P2C B;  1SYC A;  1LKP A;  1Y1W H;  1BCP B;  4L5T A;  3Q0A A;  4HJ8 A;  4GKK Q;  4AI2 A;  3S1N L;  5C44 B;  4HJ7 A;  1S5F D;  4BBR H;  3GV3 A;  3JAM E;  3UDI A;  4DK3 C;  4IFD G;  1VQ6 A;  1Y69 U;  3RZO H;  4YWK A;  2ES2 A;  3PO2 G;  1D7Q A;  4JI6 L;  3GTQ L;  2JI2 A;  1H9S A;  1C09 A;  3EIV A;  2BA0 A;  4JW0 A;  3VR2 A;  4DK6 C;  2R7D A;  2KVM A;  1STA A;  1RDV A;  1I4G A;  1VZH A;  1F9Q A;  1EYD A;  4DR2 L;  5HGQ A;  2RHS B;  3GTM L;  2XWB B;  3FEW X;  3I91 A;  3N52 A;  3I4M L;  1XPR A;  3OIQ A;  1HR0 L;  2HHH Q;  5FOB B;  3HOZ B;  2NUC A;  3J7Y 1;  2PQA B;  1TWF L;  4PG3 A;  3RZD B;  4RGM A;  1NBW A;  4TQU S;  5FLM G;  3AEV A;  1SYG A;  3SDZ A;  4DUZ Q;  1X55 A;  1GJX A;  4H7B A;  4GN5 A;  5KNC A;  1BF4 A;  5HUR A;  2I5M X;  2IT1 A;  1TWC H;  5JJZ A;  3KDF B;  3KF6 B;  3WDN A;  5JAV A;  1OXV A;  2IY5 B;  2WAC A;  4A3D H;  5GRO A;  2PO4 A;  2F0D A;  5IP9 H;  3RR5 A;  3H3V M;  2AUS B;  3KYW A;  5C4J B;  5C44 L;  1KAW A;  2NVQ H;  3NWT A;  1LKO A;  3NFP I;  2VQF Q;  1HXY D;  4A3E L;  5KGU A;  5C4X L;  3HP3 A;  3V2T A;  3V96 A;  4CGY B;  3I8Z A;  1SNC A;  3PCO B;  5DEH A;  3GTG L;  2F0K A;  1LLR D;  1JOQ A;  1NSN S;  1OXX K;  4JV5 L;  2M4V A;  1YHB A;  1OTC A;  5C5L A;  4A3J H;  1WTQ A;  4KK7 A;  1ICW A;  1CSP A;  3HJW B;  3HOZ L;  4L5Q A;  5FKA C;  1PLF A;  3R8B A;  5JJI A;  3OHX C;  4XQN A;  2NTS A;  1Y1V G;  2KCN A;  1N9W A;  1SYB A;  4QY7 A;  1FNW A;  1V1O A;  2D5D A;  3K7A H;  3PIP 1;  5ELE A;  3ND9 A;  3STB C;  3VYT A;  4TSS A;  1BBU A;  3J7Z C;  4FNF A;  1CQF A;  1SDF A;  3OSO A;  5IT9 E;  4A3C L;  2UUC L;  1YV1 A;  2C5C A;  5C4J L;  1EZ8 A;  2LMC B;  5IGB A;  3ONA B;  1S4Z A;  4JI0 L;  1VMP A;  3PIP A;  1U0L A;  2A73 B;  1IRO A;  4HCE A;  2B3G A;  2M2L A;  4DV7 L;  3TS0 A;  4R8N A;  5C5M A;  5C0X J;  1ENF A;  3HOY H;  2K2D A;  1IXR A;  1CKM A;  2NVY H;  4LF4 Q;  4NMZ A;  5M3M H;  1RCV D;  1IL2 A;  1TY0 A;  2EXD A;  2QKI C;  4X3S A;  1EQR A;  3C1E A;  2CR8 A;  4J1M A;  5CYU A;  2O5J C;  2JA5 G;  2NVX B;  3CME A;  3KLS A;  1PFM A;  2Z6B A;  4LF7 Q;  1CHQ D;  1D6E C;  4DU9 A;  1XXG A;  1V43 A;  3H94 A;  4A3F B;  1FVI A;  1VQI A;  1GUG A;  4BY7 L;  3A5Z B;  3NEL A;  4G7H C;  2SNM A; 
#chains in the Genus database with same CATH homology
 2OWO A;  4WJ4 A;  4BA2 I;  1Q1B A;  1X56 A;  4DV5 Q;  4GLX A;  4AI3 A;  5M3F G;  5GAD C;  2MO1 A;  4R4O A;  3PUV A;  4JOI A;  3D0F A;  3HOU G;  3GDE A;  3VDY A;  1XNR L;  3S14 H;  5MLC 3;  1YIT A;  2DSX A;  1WOC A;  5GAH C;  2Y0S G;  2R92 G;  3T1H L;  2KCM A;  2XJT A;  2BH2 A;  1VQD A;  4A3I G;  1D8L A;  1QZG A;  5GAE C;  1YEZ A;  1W2B A;  1PH8 A;  3U4Z A;  4UP8 A;  2VZA A;  4EX5 A;  3I56 A;  2IHF A;  4QGU A;  4X6A H;  4DKA C;  1K8G A;  1AE3 A;  3RN5 A;  3A74 A;  3ER0 A;  2R6G A;  5J3B A;  3OTO L;  1IBL L;  3FKI G;  3P8B A;  3MPS A;  1YVC A;  3KYY A;  3I7F A;  4PMW A;  2LSS A;  3MXN B;  5LMU L;  3ZG6 A;  1GM5 A;  1B13 A;  1GKH A;  1FJG Q;  3CPW A;  1VQH A;  2E2I H;  1S2Z A;  4X62 L;  3HOX H;  2R93 H;  5IYB G;  4YWL A;  5GAG C;  1R0J A;  4LF6 Q;  1SRO A;  4A3G H;  4GKJ Q;  2E5L L;  4HIO A;  1JJC B;  4DR3 Q;  1G6P A;  2UU9 L;  4MZ9 A;  4JI2 Q;  4P74 A;  4AR6 A;  2JA9 A;  2RF4 A;  4UPA A;  3DM3 A;  2MO0 A;  4A3B G;  3PUY A;  3G6E A;  4AR5 A;  5JEA G;  3SGI A;  5C3E G;  4AHX A;  2F52 A;  4TVA B;  2ZTE A;  1X54 A;  1PH1 A;  1VCX A;  1E3P A;  4ZN3 B;  3HOV H;  2UUB Q;  5ELN A;  4GOP B;  3KFU A;  4MTN A;  2CQO A;  1B7Y B;  2LCQ A;  4IJL A;  1XPU A;  3VPB E;  2QL0 A;  3PV0 A;  4GN4 B;  1LTL A;  1MIU A;  4KLK A;  4OXP A;  3SS2 A;  3CPF A;  3JAM c;  1TWA H;  1X3E A;  4AYB E;  4WJ3 M;  4OON A;  1E22 A;  3NEN A;  4B3R L;  3WWV A;  1GO3 E;  1T9Q A;  3I4N G;  3PWF A;  4JI5 L;  1B2O A;  4UY8 1;  1G51 A;  1N34 L;  1VQK A;  2DUD A;  3NBH B;  1VQ5 A;  3GTL H;  1YJ9 A;  1IBK Q;  3B08 B;  4IOA A;  1HNX Q;  2JA6 H;  4DV6 Q;  3CAM A;  5E7N A;  2CKC A;  4JI7 L;  1HNW L;  1Y1W G;  2A6E D;  4DV0 L;  3CCU A;  4JOI C;  4R1J A;  1KRT A;  4BBR G;  1LM0 A;  2HR5 A;  3M4O H;  4JYA L;  2XJQ A;  2VW9 A;  2AWN A;  2LXJ A;  3J7A 5;  2CCZ A;  2ERS A;  8RXN A;  5IYD H;  3PIO 1;  1YHA A;  3HOW G;  2A68 D;  3J81 i;  4DV2 L;  2C6B A;  5GQO A;  2WB1 G;  4DV3 Q;  1B8A A;  5IT9 c;  4LF5 L;  4DUY Q;  3GTQ H;  1KC8 C;  1BE7 A;  4AQY Q;  3RNU A;  4LFA Q;  4DV4 L;  4GKK L;  5IP9 G;  4AR4 A;  3I4M H;  3RZ6 A;  3RYG A;  1YUZ A;  3L7Z C;  3WWL A;  1KRS A;  1XJV A;  1B2J A;  1QCV A;  1UWV A;  2UXB Q;  2AWO A;  4DR7 Q;  5MFZ A;  3E9H A;  1VCI A;  4A3J G;  4BY1 G;  4O0A A;  1IW7 D;  2Z6K A;  5C44 H;  1JYB A;  4DUZ L;  4JI3 Q;  2JJQ A;  1I94 Q;  1NMG A;  1E8J A;  2RHQ B;  3HOZ H;  2JQO A;  1CUK A;  2VQF L;  1VQC A;  1ZRP A;  1P8L A;  4DR5 L;  1SR3 A;  4HIK A;  4BXX G;  3TRE A;  1E24 A;  4YHH Q;  4NXM Q;  1S3O A;  4IPH A;  1YK5 A;  1CSQ A;  1JMC A;  1QVF A;  4A3C H;  4OO1 I;  3ICE A;  5HY6 A;  5C4J H;  2NZH A;  4P71 A;  4X64 Q;  3PUZ A;  1RYT A;  2PPT A;  2VUM G;  1X9N A;  1EUJ A;  3ZJY C;  1AH9 A;  3JC6 3;  2Q2T A;  1AE2 A;  2A6H D;  2EIF A;  1BQ8 A;  2KKD A;  1N33 L;  1SMW A;  1E1T A;  1OXU A;  1W3S A;  3CCQ A;  5AI2 A;  4U67 1;  4BY7 H;  4YY3 Q;  4DPG A;  1XMQ Q;  2VL6 A;  4LF4 L;  5EAY A;  1KXL A;  2ZIX A;  5H1S E;  2K75 A;  4LF7 L;  2PSM C;  1JJ2 A;  5IYC G;  1R0I A;  4C2M H;  2AMC B;  4HIM A;  5DM7 1;  3CMA A;  1BBW A;  1QUQ B;  1VQF A;  1PH2 A;  4UY8 C;  4A3F H;  4KHP L;  1NNQ A;  2Q2U A;  3L2P A;  3KYH C;  1O7I A;  1IU5 A;  3FP9 A;  3HFZ B;  3UE1 A;  2K52 A;  1SMX A;  3A5U A;  3GTO H;  2CWA A;  4MNO A;  1CKN A;  4TVM A;  3QQC E;  1VQG A;  2MS3 A;  2D62 A;  4AHZ A;  3HKZ G;  3HOX G;  2R93 G;  2GN5 A;  2WP8 J;  4A3M H;  5BR8 Q;  4XIG S;  1Q86 C;  3CC7 A;  4A3G G;  4A3L H;  4PZ8 A;  4A93 H;  2K5V A;  1FL0 A;  3GTK H;  1PFS A;  4JC0 A;  5IY0 A;  3H15 A;  4L5R C;  2PMZ E;  3K81 C;  5AJ3 L;  3ERS X;  4IFD I;  1V1Q A;  2BA1 A;  3CXC A;  2LXK A;  4LF8 L;  4DR4 Q;  1FJG L;  1PH5 A;  6RXN A;  2YU9 H;  1J6Q A;  2JA8 H;  2WAQ E;  2V3B B;  2V1C C;  2QA4 A;  4LF6 L;  3T1Y L;  3E0E A;  4OX9 Q;  2L15 A;  3TRZ A;  4PZ7 A;  2GVB A;  4B3S L;  4GKJ L;  2M6P A;  2Q2H A;  4XTC S;  3K80 C;  4DR3 L;  2V0F A;  4X65 L;  4JI2 L;  4C3I H;  3PO3 G;  1XMO L;  1YHQ A;  2E8G A;  4AI0 A;  1I50 H;  1Y14 B;  3CCM A;  1CAA A;  2KN9 A;  2NZO A;  3M9B A;  3P2A A;  4DR1 Q;  1Q12 A;  1L2F A;  1SN8 A;  2OQ0 A;  1NJI C;  2UUB L;  1VZG A;  1YNX A;  2JA6 G;  4QIW E;  4R4Q A;  1VQJ A;  2NYD A;  4X66 Q;  1OXS C;  4G6B A;  3S1Q H;  4JI4 Q;  1CKO A;  1WJV A;  3U58 A;  2UXC Q;  2RDV A;  2N3S A;  4NPS A;  4KHZ A;  1PH3 A;  4P75 A;  4A4I A;  5JJL A;  2D0P A;  1HZB A;  2N78 A;  1JB7 A;  5FJ8 H;  2NN6 G;  3M7N A;  5IYD G;  4JI6 Q;  4LUV A;  1K3R A;  1QVC A;  2HQL A;  5JVG 1;  5GAD c;  1IBK L;  4LF9 L;  3S1M H;  1CKN B;  2OTJ A;  1OXT A;  3KYV A;  1PH9 A;  3KYX A;  1EWI A;  1JJG A;  1EQQ A;  4OWW B;  3CC4 A;  4K9F A;  3I4M G;  5GAH c;  3OYY A;  1S40 A;  4RG1 A;  3Q8D A;  5RXN A;  4B3M Q;  4AIM A;  2A19 A;  4XXB B;  1QVG A;  4YWM A;  2F4V L;  1L1O A;  4JBK A;  1S72 A;  4B3T Q;  5GAE c;  4AH6 A;  3I55 A;  1UE5 A;  4JV5 Q;  5C44 G;  4JAG A;  1XNQ Q;  2ERJ A;  4DUY L;  4AQY L;  5FLM H;  1J5E Q;  1OWB A;  3JC6 2;  3PF4 A;  3W5O A;  1I5F A;  2WFW A;  5K2M E;  4POF A;  4LHN A;  3EBE A;  2VQE Q;  4ZN1 B;  1R0F A;  5M5W H;  4JI0 Q;  3AFP A;  5H1S c;  4DR7 L;  1TWH H;  4DV7 Q;  2K14 A;  2L0Z A;  2PYA A;  5AN9 H;  3PSI A;  3STB D;  3L0O A;  3B6Y A;  5IP7 H;  5GAG c;  4GS3 A;  4JI3 L;  3CCJ A;  1T9H A;  2B63 G;  1I94 L;  4JAE A;  1K0R A;  4DV1 L;  2Y0S E;  1B71 A;  1EYG A;  3LPE B;  2YTY A;  2KHI A;  1YJN A;  1N36 Q;  2O5J D;  1HNZ L;  1NXG A;  4LFB Q;  1PH6 A;  2UXD L;  2R7Z H;  1Q7Y C;  4YHH L;  4NXM L;  3RLN A;  4P72 A;  5C0X G;  1IBM Q;  3HKS A;  1DX8 A;  1K73 C;  2I0Q A;  4LUZ A;  2PVE A;  4AHY A;  4WFN 1;  4X64 L;  1DGS A;  3EN2 A;  1A8V A;  1Q46 A;  1VQP A;  1PH4 A;  4IOC A;  1I3Q H;  3AYH B;  3T1H Q;  5K36 G;  5IWA L;  4LFC Q;  2B5I D;  5ELO A;  2NVT H;  4HJA A;  4K0K L;  3J81 c;  4AI1 A;  1RL2 A;  4A3F G;  3G48 A;  1WYD A;  4IFD J;  1HZ9 A;  3QVD A;  2JA7 H;  4DAY B;  2UUA L;  2Z3Q B;  1PV4 A;  3OTO Q;  4C3H H;  3PUX A;  2H5X A;  3CP0 A;  1CAD A;  2FXQ A;  2QGQ A;  1U5K A;  2JE6 I;  3S1N H;  2A69 D;  2CWP A;  3KF8 B;  3K0X A;  2XTI A;  5LMU Q;  3S2D H;  3GO5 A;  3S15 H;  1EFW A;  4LHL A;  4A3D G;  2PI2 E;  3PZA A;  4X62 Q;  3F2B A;  2BE5 D;  3GTM H;  1PYS B;  3F1Z A;  4OWX B;  4AHW A;  3U50 C;  2Z3R B;  1TWF H;  4XGH A;  3UE0 A;  4AR3 A;  2YTV A;  3LGJ A;  3IRB A;  1QYB A;  1H7V A;  2EQS A;  3S1R H;  2HHH L;  1RIP A;  2UU9 Q;  3KOJ A;  3U4V A;  2M6O A;  3UDF A;  1YUX A;  2PQA A;  5DLQ E;  4A3E H;  5C4X H;  3H3V I;  3CQZ H;  1WFQ A;  3GTG H;  1KD1 C;  5BR8 L;  1BFY A;  3HOY G;  5M3M G;  3CC2 A;  1H95 A;  2XGT A;  4HJ9 A;  2V0E A;  4DNI A;  4IJH A;  5IE8 A;  1ASY A;  3K8A A;  4DR4 L;  2I5L X;  4IO9 A;  1BRF A;  1RDG A;  1DVB A;  4NXN Q;  2I5H A;  2ATW A;  4JI5 Q;  4R4T A;  4OX9 L;  1HH2 P;  1IRN A;  3RN2 A;  1Z9F A;  4YCW A;  4DAM A;  2AHO B;  2C35 B;  2RCN A;  4P73 A;  4A75 A;  4DR6 Q;  1V9P A;  3S24 A;  1VQA A;  2K50 A;  1PVO A;  4JI7 Q;  3DLL A;  2A8V A;  2ID0 A;  2WB1 E;  1VQ4 A;  2XJU A;  4GLA C;  3H0G H;  4DV0 Q;  1TWG H;  4JBW A;  5FJ8 G;  1PHJ A;  4OWT B;  4DV5 L;  4DR1 L;  3I4N H;  1XTD A;  1Q82 C;  2ZM6 Q;  5FLX c;  4A3K H;  1HZC A;  2JI3 A;  3JC6 6;  1UE6 A;  4JI4 L;  4DV2 Q;  3TEH B;  3NEM A;  1MKH A;  1B70 B;  3F2C A;  3J80 i;  4LW1 A;  3RLF A;  1ODH A;  4RMF A;  1Q1E A;  4BA1 I;  4DV4 Q;  4GS7 D;  3CCL A;  4B8C D;  2F3I A;  4JI8 Q;  3WWN B;  1SMU A;  1YI2 A;  4ME3 A;  4QQB X;  4JAF A;  2AKW B;  1X6O A;  5MF6 A;  2H12 A;  2R7F A;  2J9U B;  2VNU D;  3E9I A;  5EIN C;  3H3V H;  4EQ5 A;  3W1G A;  4R4C A;  3MSU A;  3HOW H;  1N32 Q;  3RLO A;  1M90 C;  1I6H H;  1T9P A;  3I2Z A;  1BKB A;  4B3M L;  1XPO A;  3PGZ A;  3PF5 A;  5JEA J;  4HID A;  4DR5 Q;  4B3T L;  4LUO A;  5IP7 G;  2Z6K C;  1XNQ L;  3UDX A;  4BY1 H;  3HOV G;  3KYU A;  4Y52 H;  1PA6 A;  1J5E L;  4RXN A;  5JJK A;  1WCM H;  4JBJ A;  5LMN Q;  4NB3 A;  7RXN A;  1VQO A;  2HIV A;  1FHH A;  4JI1 Q;  2VQE L;  1K83 H;  3D31 A;  1SLJ A;  1M1K C;  1N33 Q;  3M3Y H;  2K4K A;  2R7Z G;  3A0J A;  3ULJ A;  4IPD A;  2ASB A;  4BXX H;  1JT8 A;  1VZI A;  2IHE A;  1QZH A;  3K7U C;  1KHI A;  4GOP A;  2VUM H;  2B29 A;  1N36 L;  1NMF A;  2N49 A;  3IU3 I;  1R0G A;  3J81 j;  4LFB L;  1X65 A;  4BBS H;  1NTG A;  4FDB A;  3BJU A;  3K35 A;  1WJJ A;  2JA7 G;  3KJO A;  3HKZ E;  4KHP Q;  2YTX A;  1IBM L;  2JI1 A;  2AYJ A;  2CFM A;  1VS0 A;  1E7Z A;  2GMG A;  1OWC A;  2Q2I A;  3ULL A;  1PYB A;  1KQS A;  2KHJ A;  4H02 A;  3RZT A;  1HNX L;  3GTP H;  4DR2 Q;  3CCR A;  4DV6 L;  4E6Y A;  1HR0 Q;  4LFC L;  5IYC H;  4YCV A;  5MGN A;  4YCU A;  4AYB G;  3GTJ H;  1VQN A;  1ASZ A;  1NY4 A;  5LMN W;  2YYZ A;  4GNX A;  1EIF A;  1VQ9 A;  3PO2 H;  4IPC A;  4QJF A;  1HZA A;  5EIO C;  3LNL A;  1BQ9 A;  4UP9 A;  5AI3 A;  4DV3 L;  4PZ6 A;  1YBY A;  5AJ3 Q;  4A3E G;  5C4X G;  2NN6 I;  4LF8 Q;  2E2J H;  4LFA L;  3M4Q A;  2OQK A;  1YIJ A;  2IX0 A;  3HOZ G;  2XJR A;  1NXE A;  4A76 A;  1FGU A;  2UUC Q;  2ALY B;  3T1Y Q;  3I4O A;  2UXB L;  4B3S Q;  3ULP A;  1RWD A;  2A1A A;  2JEB I;  2XJP A;  1VQ8 A;  1S30 A;  3M4P A;  4X65 Q;  4QL5 A;  4A3C G;  2ZTC A;  3G4S A;  1XMO Q;  3CD6 A;  4R4I A;  1Y1V H;  4UP7 A;  4GN3 B;  1T9O A;  1Q81 C;  1BVS A;  3OW2 A;  1VQM A;  3S16 H;  1HR0 W;  3PUW A;  1A63 A;  2K5H A;  4GLV B;  4BY7 G;  3PKJ A;  1K9M C;  1N8R C;  1IZ6 A;  2GVA A;  3F8T A;  1XNR Q;  2OTL A;  1JE5 A;  3PO3 H;  2JA5 H;  3H0G G;  1K8A C;  3S17 H;  1SMM A;  1GD7 A;  2JEA I;  3W1B A;  1HJP A;  4LNQ A;  2MQH A;  1IYJ B;  4NXN L;  3S2H H;  1RB9 A;  2E2H H;  3MEF A;  1Z92 B;  2CKZ B;  2VY3 A;  1SRU A;  2XJS A;  5M3F H;  1TXY A;  3A44 A;  4A3K G;  2Z0S A;  3CF5 A;  4GOP C;  4YY3 L;  4LF9 Q;  1XMQ L;  4DR6 L;  3JAM i;  5JVH 1;  3BZC A;  3G71 A;  1R9T H;  3HOU H;  1VQE A;  2CKA A;  1IBL Q;  4ALP A;  1LKM A;  1P16 A;  4JG2 A;  1KIX A;  1FHM A;  4GNX B;  2ZJQ A;  2R92 H;  4V19 6;  2KBN A;  1L1O B;  1EOV A;  5C0X I;  2XJV A;  1X3F A;  2ZTD A;  1SE8 A;  2HIX A;  4A3I H;  2F4V Q;  2ZM6 L;  2KEN A;  1QUQ A;  1KL9 A;  2YV5 A;  1PH7 A;  3PKI A;  3CCS A;  4A3M G;  5M5Y H;  5M5X H;  1UEB A;  1YK4 A;  2MFI A;  5DM6 1;  1UE1 A;  3PIO A;  4A3L G;  1VQB A;  4A93 G;  3BU2 A;  3CW2 C;  2E5L Q;  3FKI H;  2C6A A;  1VQ7 A;  1Z47 A;  2PNH A;  4OO1 G;  4JI8 L;  1E1O A;  3TS2 A;  4GNX C;  3KLW A;  4Y7N H;  5MFP A;  4O2D A;  1L1O C;  2PVX A;  2HT1 A;  3CCE A;  3J7Z 1;  1EIY B;  2JA8 G;  2IX1 A;  3KDF A;  3KF6 A;  1IU6 A;  1N32 L;  2OCE A;  5IYB H;  4IPG A;  2K5N A;  1LUZ A;  1RYQ A;  4JCV E;  1R0H A;  1WCM G;  1LYL A;  1X3G A;  2D0O A;  1C0A A;  3UDG A;  2DGY A;  1C7Y A;  3F2D A;  2PI2 A;  4JAD A;  4DV1 Q;  1MJE A;  2QEX A;  3AFQ A;  4POG A;  3RZD H;  1HNZ Q;  1G29 1;  2JK8 A;  2BH8 A;  4A3B H;  1GVP A;  2UXD Q;  4J15 A;  3CCV A;  4B3R Q;  4KI0 A;  2MNA A;  5C3E H;  1N34 Q;  3B0A B;  4APV A;  1SFO H;  1YZ6 A;  1NE3 A;  2ZJR A;  4TPU A;  5LMN L;  1A0I A;  2B63 H;  1S24 A;  4JI1 L;  5IWA Q;  1YJW A;  4JBM A;  1A62 A;  1C9O A;  2VS1 A;  4L5S A;  1HNW Q;  1MJC A;  4BBS G;  4K0K Q;  1Q8K A;  2WAQ G;  3M85 A;  3J80 c;  2ZJP A;  4JYA Q;  2KCT A;  2UUA Q;  3BZK A;  3TQY A;  4LWC A;  1L0W A;  2M4Y A;  4HJ5 A;  3KJP A;  1WI5 A;  4X66 L;  3GD7 A;  3AQQ A;  3FHW A;  1UE7 A;  2UXC L;  2NVX H;  4LF5 Q;  2N8N A;  1VQL A;  4C3J H;  1LKP A;  1Y1W H;  4L5T A;  4HJ8 A;  4GKK Q;  4AI2 A;  4HJ7 A;  4BBR H;  3UDI A;  4DK3 C;  4IFD G;  1VQ6 A;  3RZO H;  4YWK A;  2ES2 A;  3PO2 G;  1D7Q A;  4JI6 L;  2JI2 A;  1C09 A;  3EIV A;  2BA0 A;  4DK6 C;  2R7D A;  1RDV A;  1VZH A;  4DR2 L;  5HGQ A;  2RHS B;  1XPR A;  1HR0 L;  2HHH Q;  3J7Y 1;  2PQA B;  4PG3 A;  1NBW A;  4TQU S;  5FLM G;  3AEV A;  4DUZ Q;  1X55 A;  4GN5 A;  2I5M X;  2IT1 A;  1TWC H;  3KDF B;  3KF6 B;  1OXV A;  2IY5 B;  4A3D H;  5GRO A;  5IP9 H;  3RR5 A;  3KYW A;  1KAW A;  2NVQ H;  1LKO A;  3NFP I;  2VQF Q;  3PCO B;  1OXX K;  4JV5 L;  2M4V A;  1YHB A;  1OTC A;  4A3J H;  1CSP A;  4L5Q A;  5JJI A;  1Y1V G;  1N9W A;  4QY7 A;  3K7A H;  3PIP 1;  3STB C;  1BBU A;  3J7Z C;  2UUC L;  1YV1 A;  4JI0 L;  3PIP A;  1U0L A;  1IRO A;  2B3G A;  4DV7 L;  3TS0 A;  5C0X J;  3HOY H;  2K2D A;  1IXR A;  1CKM A;  2NVY H;  4LF4 Q;  5M3M H;  1IL2 A;  2EXD A;  1EQR A;  2CR8 A;  2JA5 G;  3CME A;  4LF7 Q;  1V43 A;  1FVI A;  1VQI A;  3A5Z B;  3NEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...