1LTRD

Crystal structure of the b subunit of human heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLYAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 108
sequence length 108
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltrD00
4L6TB 2Z8LA 1JWMD 1F77A 1EEFD 1ET9A 1DYQA 2WV6D 1L0XB 1GOZA 1I4GA 4ZYSA 1I4RA 1CT1D 1PYWD 3OWEB 5ELCA 1SE3A 1XTCD 3GP7A 4RHRA 1TY0A 1PRTF 4RGOS 1BCPC 1CK1A 1B1ZA 1EU4A 1SXTA 1LTSD 1KLUD 1AN8A 1TS2A 4RFBA 1V1PA 1V1PB 1FD7D 1SEBD 1TS4A 1HTLD 3BVGA 2AQ3B 1D6EC 1BCPD 3BYYB 1PTOC 3BVMA 1JWUD 4C56C 1B44D 1LTAD 4TSSA 4RCOA 2IJ0A 4K6LA 4OHJA 2RDGA 5ELBA 1PTOD 1EEID 2XNAC 2IPKD 1D5ZC 2ICIA 3EFXD 1FNWA 1LT5D 2XRSD 2SEBD 3R2IA 3SEBA 1LT3D 1SE4A 1CHPD 1PRTC 1JCKB 1LTBD 1AW7A 1S5DD 2NTTA 1I4QA 4L63B 1FNVA 4RHSA 5D3IB 3BVZA 1RF2D 1PRTD 3URYA 3DWPA 1SJHD 3R2TA 3BYTB 1UNSA 1TS5A 1TY2A 1V1OA 1LT4D 1S5CD 1PZID 1PZJD 3MC0B 3BZDB 1ET6A 5D3DA 4RGTA 1CHQD 5FKAC 3EA6A 3MFGA 1KLGD 2QILA 1L0YB 2R61A 2TSSA 1QILA 2QEJC 1ESFA 1LTID 4BWGB 1D5MC 5ELDA 1TS3A 1EWCA 1HQRD 2XN9C 1BCPB 4O1NA 5ELEA 4RGMA 1LO5D 5ELFA 2G9HD 1MD2D 1FNUA 1UUPA 2XRQD 1PTOH 1DJRD 2RDHA 1LT6D 2AQ1B 4UDUC 1HA5A 1PTOB 4DXFA 1RD9D 1EU3A 3KLSX 1G8ZD 1I4PA 2CHBD 1HXYD 1BXTA 1T5XD 1I4HA 2NTSA 1JQYD 1M4VA 1BCPF 1S5FD 2J4XA 1CQVA 1LTGD 1XXGA 4DXGA 2O2LD 1STEA 1LLRD 1SBBB 3DWAA 3V05A 5I4DA 1PRTB 1RCVD 1PZKD 4RGNA 3O13A 1JR0D 1S5BD 1JWSD 1FGBD 1PTOF 1SE2A 2AQ2B 1S5ED 4Z9CB 3R8BA 3W2DA 3CHBD 1I4XA 1LTTD 1RDPD 3DWQA 5FK9C 4RH6A 1SJED 3TSSA 1ENFA 1D5XC 1EFID 1KTKA 5TSSA 1LTRD
chains in the Genus database with same CATH superfamily
2GA4B 4OWXB 1S4ZA 2Z8LA 4G57A 4DV1Q 2L1BA 2I5MX 4ZYSA 2FJ2A 3AEVA 1PH5A 1GHJA 2F4VQ 4LF7Q 4ID6A 3KF6B 5IY0A 2ZM6Q 2A68C 4MN3A 3OOCA 4K0KQ 1HTLD 2Y0SG 1AP0A 3NE5B 1IZ6A 1JWUD 3MXGA 1HUMA 3FEWX 5L37A 1DM0B 4BY1G 1MIUA 2OEOA 4IUTA 5M3FG 4DR5L 2YTYA 3GTJB 2IT1A 1EOTA 2B2VC 3E3XA 3GD7A 3RNUA 1CKNB 1FJGQ 2OXPA 3TZUA 3KYHC 3J80E 3HP3A 3MEFA 1CI3M 1PH1A 3BVZA 4F8MA 1VF5C 5KRUA 1QG7A 3PO2H 3EQLC 1B50A 3JAME 1XNRQ 1H9KA 2F0WA 1EIGA 3GO5A 2L5TA 1U4RA 1UE6A 2CQAA 3FKIG 5IP7H 2VQEQ 5FLMG 5K36H 1EY9A 1K8OA 3L9AX 3I4NG 4JI7Q 1LV9A 3E9HA 1SAPA 2JP1A 1LTID 5C44B 1KAAA 4MHEA 4OELB 1EWCA 2F0NA 2KHIA 1WCMB 5IT9c 4CBVA 1X54A 2K33A 2B2UC 2KENA 3SK6A 4WJ3M 4LFBL 4A3DH 1R4PB 1VQ4A 3CKIB 5CC4A 5CV9A 4K2KA 3LWEA 1J5EL 4BA1I 1LT6D 1YNJC 1TWGH 4UDUC 4OX9L 2DNCA 3F1ZA 4IUVA 4YHHL 4ULLA 2TMPA 1I4HA 4TRDA 4QIWE 4BY7B 1HNWL 1CSQA 2AWOA 1E1TA 2L55A 4DV6L 1B9NA 3I55A 2JSOA 3SK4A 3J7YW 2AQ2B 1VQ8A 3W2DA 3ITPA 4OXPA 3TSSA 4XIGS 5EJWA 3NBIA 2KVMA 3NELA 2QDBA 2JA6H 4DAPA 1ET9A 1C4QA 3T53B 3W1BA 2R7ZH 2JA5H 3NPPA 3SVMA 2JE6I 4WRDA 1NUCA 1XTCD 1UEBA 1SMYD 1UE1A 1EU4A 2Q8RE 1PH3A 1XTDA 1QNKA 4DR5Q 3ZYYX 1A0IA 4HSPA 1B70B 2RHSB 2E8GA 1XPUA 5E4XA 4DV7L 1N32Q 2E5LQ 1O80A 2HHHQ 2CWAA 3CD6A 3S1RH 4Q5VA 5AJ3Q 4YWLA 3S1MB 1BBWA 5LMNL 2RA4A 3C46A 1JJCB 1SNMA 4POFA 3G6EA 2CWPA 5C44G 2WKDA 3G6JB 5IGDA 2F4IA 2SEBD 3SEBA 5G3LF 4K8IA 3DHQA 1J6QA 1WCMG 3A0JA 5M5YH 2BH2A 1F2ZA 3PGZA 4XQJA 1X65A 1SYGA 3DWPA 2QCPX 4P71A 1KIXA 1HZCA 4X3KA 5M9OA 1ET6A 4BY7G 1E3PA 5JPMC 5D3DA 5E7NA 3EA6A 5M5XH 2E2IH 1SRUA 4NXMQ 3S2DH 3ULPA 1N34Q 1D2BA 2F0PA 1HFGA 1VQ6A 3H91A 1JMCA 1I6HB 1SYBA 4BBRB 3L0OA 1PA6A 1CTMA 3HOVH 3GTOB 3NK9A 1HQRD 1Y1WB 1P8LA 3FP9A 4J15A 4PV1C 4JI2Q 1SYCA 2KOLA 2SNSA 1I50B 1IBLL 3RD4A 1X9NA 4IFDI 4HIKA 4A3EH 5JAVA 2RSOA 2D0OA 2JA7B 2F0QA 5IYDH 4DK6C 1XNQL 4JYAL 3TS2A 4MNOA 2D5DA 2MNAA 4NDXA 1YITA 2PYKA 2XIWA 3PF4A 3DWAA 1SBBB 3FDTA 1IBML 1Y14B 1RCVD 1PZKD 3E5SA 3ICEA 2PW7A 2EOTA 5FLXE 2NVTH 2A8VA 1PFMA 4IUQA 3R8BA 1LTTD 2I5LX 1D8LA 2LS01 4RH6A 2KHJA 4A3IB 1VS0A 4B9XA 4B3SL 3OHXC 1LTRD 1IL8A 1YBYA 3PUXA 1NJIC 1F77A 5CMDA 4ZRZA 3I70A 4DNRB 3D4WA 1HA6A 4QIWB 1SNDA 4DF7A 5DM73 3VR5A 4PNYA 4HMJA 3KK7A 1GUTA 4QL5A 5ELOA 3UDFA 1EIYB 3S14H 3K0YA 3T1YQ 5CBAE 1GUSA 1AE2A 1D6EC 2EZVA 3PUYA 1EWHA 1Q46A 3FMCA 3GDEA 5DAUA 3GTQB 2DY8A 1IW7D 1GHKA 2N78A 4FF4A 2VNUD 1A3VA 5ELBA 1CM9A 4BBRG 1HH2P 1PH7A 5I2XA 2D62A 5I9PA 1LT3D 1Y1WG 1HNXL 4KI0A 4H7BA 4FXDA 4DFAA 5BR8Q 1K28A 1X6OA 3KF6A 4DUYL 4C3IH 1STAA 1X3QA 4HAEA 2F0FA 2XWJB 1HR0W 1PRTD 1F2LA 4OWTB 4P75A 4KY6A 4LF5L 4G4KA 1O7YA 5IE8A 2JA7G 3JAMc 4NXNQ 5FO7B 1KRSA 2JYOA 4XYQA 1VF7A 1CKNA 5JPNC 4IOCA 1EYGA 1DCZA 3KOJA 1B3AA 2BH8A 3MXUA 4IOAA 5A35A 1HQMC 1KABA 3U9OA 4A3IG 2F0GA 1MD2D 1WTWA 4P73A 4C3JB 2XRQD 5C4XG 3K57A 1BVSA 3GTPH 1YJ9A 1G6ZA 1AZPA 1PTOB 3J80L 1CKOA 4GN5A 4XT3B 1S72A 2KEEA 4IPDA 2SOBA 1RTOA 1QUQB 1S5FD 4X62Q 1CQVA 2A6EC 2NZOA 1LLRD 4X3SA 4YCVA 3V05A 1GUNA 2J7ZA 1X55A 4JI4L 1F9QA 1M8AA 1YHQA 1RDPD 4O42A 1U4PA 1XMOL 1HPCA 3QG1A 4R9WA 3RUZA 5BN4A 3C2PA 3U9SA 2NYZD 3T16A 2ATWA 1DYQA 2JQOA 2KJXA 4OL7A 4GKJL 1GUOA 4RKBA 4A3FH 4K5VA 4DV4Q 2UUBQ 3PUWA 5CYUA 1V1PA 1XPRA 4B3ML 4A3MH 1BCPD 3MFYA 4ZUJA 2C5CA 4EQOA 3HOXH 3GQBA 1IL2A 5KEEA 3ULLA 4A93H 4TSSA 4JI0L 3MXPA 2Z6BA 3RMHA 2K1BA 2KHSA 5IWAQ 3AQQA 3SXHA 4JBKA 4LF5Q 5J3BA 2PNHA 4XQNA 4KJOA 2ZJPA 1HHVA 3PIPA 5JVG3 5DLQE 4C3JG 3X3MA 4KKUA 3SGIA 4RHSA 3J81E 2NB0A 4ZCKA 1WTXA 5EAYA 1O78A 5C0XI 4EGVA 2ID0A 2JEAI 2EPBA 2V4DA 1KDAA 1VMCA 4XT1B 2Y0SE 3TMEA 1PZID 3PO2B 3MFGA 5F2DA 1X32A 1QILA 3PMFA 4F7XA 3M4PA 2QEJC 2LFNA 2ZTDA 1KDBA 4QGUA 1PH4A 1S3OA 4FXKC 5CV7A 1YEZA 3TREA 5C4JH 3HGBA 1HR0Q 5M5WH 5ISRA 1IKMA 4RGMA 5DNFA 2NWGA 2AKWB 5E1FA 1E2VA 1SROA 3BJUA 2FMMA 1PFNA 4LF4L 3T56B 4BBSG 5C4HA 2EDGA 3TP5A 1KC8C 4A3DB 4NW2A 5C3EH 4A76A 1WTVA 4FF3A 1KRTA 1RL2A 3GV6A 3EROA 1TWGB 2M9VA 2ZT9C 1K73C 2Q2IA 1F9RA 1RODA 2VY3A 3OMGA 4PMBA 2NVYH 1U0LA 2A69D 2NN6G 3O13A 3D3RA 5FLXc 1I4XA 2AHOB 5CR3A 1AFPA 3I90A 1L1OC 2YV5A 2HQLA 1EEFD 2EYPA 4GLXA 5EPKA 3I4LA 2C35B 2K01A 4IPCA 2JA6B 5T1IA 2F0VA 4JI0Q 2L12A 2F0EA 1ZXTA 3N6RA 4DK3C 2R7ZB 1E7ZA 4DV0Q 2JA5B 4C1NK 5IGEA 3M85A 1DOMA 4DAMA 3I72A 3BVGA 1HJPA 3M9BA 4G7ZC 3E0EA 4JVZA 1X3GA 2BE5D 3PO2G 2UXBL 2X6GA 3S1RB 1SFOH 1EQQA 5KYLA 3M4QA 1X3FA 4IQZA 2F52A 5IP7G 4OWWB 5D14A 1Q82C 1PVOA 5K36G 3R3OA 2XRSD 3GTMH 5FLXL 3BS1A 3K6OA 4HEDA 4KMUC 4R4IA 1Y8NB 2MQHA 3TP7A 3Q6SA 1GKHA 4PZ6A 1NCVA 1QE6A 5M5YB 4J1MA 2WIIB 4OO1I 4A3DG 1WTOA 3D4DA 1XMQQ 1L2FA 1K83H 1H95A 3RZDH 2K4KA 4JBWA 2R6GA 2F4VL 2H4OA 1JB7A 4LF7L 1G291 1KLGD 5IYCH 4H0LC 4DV3Q 3S15H 1JT8A 2RQXA 2ZM6L 2N49A 2I0QA 4K0KL 4R1JA 5M5XB 2B63G 3OPOA 2E2IB 3S2DB 2D0PA 4JG2A 2VB3X 1OXUA 1B7YB 3CC7A 3HOVB 1FNUA 4A3GG 1QNUA 4FXGC 4OIKA 1DJRD 4N9TA 2O5IC 4HCSA 2NVQH 4GLAC 1FJGL 4QQBX 2JA6G 4DU9A 3G48A 1G8ZD 1I4PA 3CC2A 2R7ZG 4B3TL 1KHIA 2J4XA 4LK1C 4A3EB 2M00A 3OIPA 3VR3A 3DM3A 5IYBH 2PI2A 3AB9A 3G71A 2MJ8A 5JJLA 1PTOF 5HGQA 4UPAA 2UUCQ 3K0XA 4IFDH 4UP9A 2VQEL 2K75A 3MA2B 1LM0A 3EN2A 1EFID 3GP7A 1KDCA 4JI7L 2NVTB 2LY7A 2HDLA 3OYYA 4GKKQ 4DR6Q 1EY7A 2WV6D 3NQTA 5J22A 2IX1A 4UHVA 3DLLA 3PCOB 4F88A 1T9HA 1QUQA 4QMGA 5LL6S 3M3YH 3I56A 3BZKA 1Y8PB 1Q1EA 2K50A 2EY2A 4B9WA 2AQ3B 1O7IA 2Z4HA 3NBHB 3S14B 2RDFA 1QVCA 2ZTEA 1II3A 1RHPA 4GS3A 4PZ8A 2G9DA 1J9OA 2CCZA 2NVXH 1R9TH 5JJIA 1EEID 4HJ9A 3STBD 3OMCA 5KNDA 4DV5Q 5EKKA 2A5HA 1PYSB 4K5WA 1STNA 2IL8A 1A2UA 1I94Q 1GM5A 3H0GH 2F0TA 4QF4A 3J81c 4C3IB 2AUKA 1CFMA 4DAVA 1LT4D 2MFIA 4FDBA 3T1HQ 1H9RA 1SNQA 4AQYQ 2L11A 2Q2HA 4A3EG 1RTNA 5IYDG 4KD4A 3Q24A 2UXCL 5I9OA 4RWSC 1YNND 1N32L 3CXCA 2E5LL 4TQUS 2HHHL 4KY5A 1OXVA 1UAPA 2NZ1D 3VA5A 5AJ3L 4DR2Q 4B3TQ 2C9OA 1SYEA 3CP0A 4HCEA 4IFDJ 1E2WA 1A15A 1JOKA 5ELEA 5M3MG 2G9HD 2IX3A 1V1QA 4M8AA 2B2YC 3PV0A 4JI3L 3H3VI 4YY3Q 1H9JA 5JOBA 1VQBA 1HA5A 1GD7A 1Q90A 4UP7A 3VYTA 2VUMH 2FINB 1C9OA 3GTPB 3TEHB 2LMCB 3F2UA 5C3WA 3J81L 2O4XA 4LWCA 3QWNA 4RA8A 1DD2A 1EZ6A 2DY7A 3BDOA 3VR6A 4BXXH 1JWSD 2JA8H 1MJCA 1JE4A 1E22A 3DWQA 4NXML 2K6AA 5JJKA 1SJED 1N34L 1AN8A 1SMYC 4MIUA 3RN2A 3OTOQ 3UDXA 1Q7YC 4ME3A 3ND8A 1EUJA 1CK1A 1HNZQ 1GJXA 1EIHA 3I4OA 4A3FB 1V1PB 2B2VA 5T1GA 4YWKA 4C3IG 4JI2L 1FR3A 1K9MC 1TVXA 1VQIA 4S3SA 1A63A 4U673 4AYBB 4A3MB 1V43A 5CV8A 1AE3A 4K6LA 1BBXC 3HOYH 3HOXB 1EQVA 4A93B 1LT5D 2IX0A 4CKCA 5IT9L 3S2HH 1SE4A 1YVCA 4A3BH 1LTBD 4KLKA 1YHAA 1VQDA 2F0IA 1AW7A 3IL8A 2L0CA 1QZGA 1ASYA 4IUUA 2NBFA 5IP9G 2ZJQA 2UXCQ 3DEOA 1PFBA 4X3UA 1NAPA 2QDLA 2Q8IB 3K59A 4HIDA 2HUGA 3HEJA 3R2TA 3UE1A 1UNSA 1TS5A 5KYIA 4KKSA 1Q3LA 2PCFB 2B2UA 4DK1A 3MC0B 1UE5A 2A19A 4HMIA 1K0RA 2TSSA 4JI3Q 4HIOA 5GAHC 3HOUH 1YNJD 3S9WA 4XQQA 3T1YL 1PH8A 5C0XH 1PHJA 2DGYA 1L0WA 5FO9B 4ALPA 3VR4A 3QOJA 4X65L 5G3LD 2PI2E 4ILWA 5C4JB 4ZK9B 1TT2A 2EY5A 3C1EA 5M5WB 4KTAA 3DXJC 1CUKA 1DONA 3D31A 1K3BC 3KLWA 3P7JA 4K14A 2Z6KC 4CJ1B 5BR8L 4CJ0B 4L5RC 4DR7Q 3VYSA 3SR1A 5BN5A 4A3FG 5C3EB 3OW7A 4JI1Q 1TWFH 2OTJA 5KNCA 3ER0A 4A3MG 4RGNA 3VR2A 1FGBD 4NXNL 4KHVA 2HT1A 5LMUQ 1SNCA 2NVYB 3CHBD 3C3LA 3E6ZX 3UE0A 4A93G 1ENFA 4R4CA 1NR2A 2XSCA 2CKZB 2QA4A 4G7OC 2OTLA 3JC66 3EBEA 1ENCA 1K8AC 2A1AA 4L8JA 4P74A 5E3FA 2VZAA 4PMCA 1AEXA 2UU9Q 2F0LA 3HKSA 2N88A 3D6CA 1IW7C 3M4YA 4NPSA 2K5QA 4LF8Q 3PSIA 1QWYA 3MXNB 5C3XA 3VA7A 3BYYB 2A74C 3M7NA 4IO9A 1TWHH 2KCMA 4DGZA 4HIMA 2A6HD 2IW3A 5ELNA 4X62L 3J7AF 2N3SA 4KKTA 4X64Q 4KN7C 3BU2A 3W1GA 5C0XJ 1SFOB 4FYDA 4QUCA 1EY0A 4C1NI 1PRTC 2O5JC 1PH2A 1MKHA 4KY7A 3GTMB 3GTKH 3TP8A 3OW2A 1F2YA 1SJHD 3NBHA 1PLFA 3LX0A 1S5CD 4DV4L 2UUBL 1PZJD 2L4NA 4K8JA 1PH9A 4DR3Q 4X65Q 3A54A 1K83B 3ULJA 1DXMA 3RZDB 4A3JH 2MHVA 2HIVA 1L1OB 2A73B 1K0SA 4YWMA 4JI8Q 2HCIA 1K8MA 4RAUC 4ME5A 3S15B 4OO1H 1D5MC 1WTRA 1Q1BA 4DR4L 3CCSA 1G6PA 3D6WA 5ELFA 2XTIA 3IKJA 5IWAL 4KHZA 4TVAB 1ML0D 4CJ2C 4IPHA 1B3QA 2NN6I 5GADC 4KD3A 4FO2A 1SNPA 3Q0AA 1RD9D 2B39A 2NVQB 2B3GA 4ZQ3A 5EGTA 3VYRA 3HKZB 3HS0C 1FL0A 1KNEA 3L3OC 3M7GA 2VL6A 1M1KC 2E75C 1VQJA 3X3NA 3SDZA 1A6XA 1S5ED 3NWSA 3HZXA 1QZHA 4P2CB 3CCLA 1D1IA 1V9PA 2R92H 3FPUB 2F3IA 1ILQA 4MTKA 4WORA 2FFKB 3RLFA 2OWOA 1HR0L 3C1FA 3NTIA 1IXRA 4DNTB 3CCEA 1DOLA 2BDNA 2RF4A 4GN3B 5C5LA 1BCPC 1B1ZA 4JOIC 1WOCA 3H15A 3PUVA 4O0AA 2P5ZX 3M3YB 1U4LA 3JAML 1NBWA 5I6YA 1SR3A 3I73A 3BDCA 2EYOA 3I8ZA 3K7AH 3EVQA 2RDGA 4CKEA 1MBYA 5IYCG 2F03A 1H9SB 1S40A 1D5ZC 1FNWA 2NVXB 4E6IA 1R9TB 4H44C 1Q8IA 4OIJA 3K5LA 1FNVA 3DM1A 3H3VC 2PW5A 1N9WA 3NWTA 3H0GB 5IOCA 1WTQA 4DR4Q 2D2CC 3UDIA 1BQQT 2H5XA 4K6DA 4ZUIA 2IY5B 2E76C 2VQFQ 3HKZG 4LF9Q 3AMUA 3QOLA 1B4OA 3AYHB 3F2BA 4DV2L 4DV0L 5COYA 1NR4A 1LACA 2HCCA 3U50C 4CKBA 3GV3A 5K5PA 1YHBA 4BWGB 4C3HH 3A8JE 3CCJA 4O1NA 2K5DA 5GAEC 4WFN3 5IYBG 4JOIA 2E74C 5E4WC 4IJHA 3SE0A 1SSOA 2BA1A 4IFDG 1OO9B 2RDHA 1EY5A 3UI2A 1VQ9A 2UXDQ 2XGTA 3EIVA 4DXFA 3MZ5A 5DM63 4XDXA 2WP8J 2EYJA 2VUMB 1R4QB 2A69C 3T51B 5C6AA 2EJGC 5IGFA 2QW7A 2KA7A 1NE3A 1VDZA 3IFDA 1B53A 2MPMA 5I6WA 1XMQL 3H3VH 3DUZA 3GTLH 2AWNA 1SMXA 5JJZA 4JV5L 1JB3A 5JEAH 1XPOA 3A8IE 2OCEA 1XYIA 2ENBA 3S16H 1KNAA 2J0TD 4DV3L 1JC7A 1OTCA 2EIFA 2JA8B 1TKWB 3S17H 5TSSA 2PMZB 3P75A 1Z7TA 3CCRA 1JWMD 2KCNA 1TR5A 5CV6A 1H9MA 4RHRA 3KFUA 2RCNA 4LUOA 1P16A 1C0AA 2SDFA 3WOFA 2BE5C 4BS9A 4GOPB 1CQFA 4LUZA 3KJPA 3H0GG 2WAQB 1Y1VH 4J6HA 1EL0A 3H09A 1A62A 5EPLA 1EY6A 2K03A 2IJ0A 2RSNA 4L5TA 4OHJA 3Q22A 2F0SA 3KJOA 1EYAA 4V190 2B8FA 2EQSA 3RLOA 3FHWA 3HOYB 4DA2A 3PO3H 3QO2A 4DKAC 1F2MA 2ZTCA 3PIOA 4IJLA 3HRZC 1EZ8A 1SLJA 4I7ZC 3E9IA 4DAYB 4DV2Q 2UUCL 3IAYA 2RKSA 2PZTA 4L63B 3S2HB 1JOOA 4A3BB 5J39A 4I65A 4UP8A 4GKKL 4DR6L 3MXNA 1KAWA 2VXWA 4LF6Q 1TWAH 3BYTB 3MEHA 4DPGA 4A3KH 1HUNA 3FRPB 1BUVT 2K52A 3FPPA 2VUMG 3BZDB 2XVSA 1DZ1A 1FVIA 1PMRA 1L0YB 1X56A 2V1CC 4GNXC 3J80i 1VQ7A 2Q2TA 3K58A 4IALA 1W3SA 2I07B 1PDQA 1WTHA 4IPGA 4RMFA 3HOUB 2JN4A 5JEAJ 4A3LH 3CQZH 1JORA 2KEDA 3GTGH 1LO5D 4BXXG 2JA8G 4J8QA 5C4XH 2B2WC 1UUPA 4KHPQ 1CSPA 3JAMi 5J1ZA 4DK0A 2QGQA 3D4RA 4DNIA 3A7LA 4JV5Q 4LFAQ 4DV5L 1ZYRC 3I4MH 1T5EA 1I94L 1B2TA 5CV4A 1L1OA 2CH4A 3CMEA 3AFQA 4JPBW 1Q86C 4LFCQ 1D7QA 2WAQG 1SNOA 2YTVA 4PG3A 4ZAIA 1N36Q 5C4ZA 5H1SE 1TWFB 5I4DA 1S5BD 3T1HL 4Z9CB 3W5OA 4AQYL 4K5XA 3HOYG 4FNFA 4PQXA 1NSNS 1FYCA 1NY4A 4DR2L 2JA5G 2K7VA 1SE3A 1A2TA 2QF7A 4RCNA 1X3EA 4A3BG 1TS2A 1WFQA 3CF5A 3CAMA 2CW0D 3D8GA 5HGTA 4GNXA 3NTKA 3P1HA 4KN4C 1WTPA 1BOSA 4YY3L 1MGSA 3NHHA 2CQOA 4A3CH 2KQ3A 3HOZH 2B8GA 2K05A 4AYBE 2IWHA 4YCWA 2B2WA 1HZBA 1TWHB 3E0JA 5GQOA 1PTOD 1PH6A 1HFNA 5NUCA 2L15A 2F0MA 5EKIA 1KQSA 1PV4A 3UDGA 3KBGA 5C5MA 2Q2UA 3J81j 5JVH3 1CZWA 3S1NH 1BBUA 1TWCH 2JJQA 3M4OH 3DEPA 3K8AA 3HOWH 3URYA 2LSSA 3OTOL 3GTKB 1IHZA 1YNNC 3K81C 1HNZL 1A3UA 4RGTA 1QCBD 1H9SA 2N8NA 5KGUA 3VYUA 4A3JB 2R93H 2F0OA 3BZCA 4CDCC 1TS3A 3NEMA 3A56A 3HOVG 3TRZA 1I3QH 4HJ8A 3BG3A 2FXQA 4BBSH 4LAAA 4HJ7A 2GVAA 4DUZQ 2K04A 5IIFA 1GUWA 2AQ1B 4EVOA 2F0HA 4X66Q 2RVLA 4YIJA 4GOPC 3NQIA 4I7AA 4CDDC 1LTGD 1XJVA 4DXGA 4L5SA 1STEA 1XX8A 1OXXK 1ZEQX 1BF4A 1ILPA 1CKMA 1PRTB 2NN6H 2K5NA 4CHTB 3AFPA 3LWUA 1SE2A 2NUCA 3NENA 3CCUA 3OSOA 3F8TA 3LGJA 1CA5A 3I2ZA 2EY6A 1ICWA 1ENAA 3CRKC 2DUDA 1VQOA 1V8QA 4R4QA 3OWEB 2R92B 4KJNA 2ALYB 2DJGC 1GVPA 3F2DA 2K5WA 3IRBA 1Y69U 1XWEA 2BCOA 3OWFA 3L7ZC 3CPFA 3I91A 2UUAQ 2E2JH 1JJGA 1SYDA 1Q8KA 5A2QE 4DR1L 2WB1B 4DR7L 4F87A 1RKNA 3F2CA 2A68D 2KUMA 1VQNA 1IBKQ 3KDFB 3QJYA 4JI1L 1E1OA 3J7A5 4JI6Q 1Z47A 3ZJYC 2GN5A 4CGYB 4A3JG 2RHQB 3EFXD 3K7AB 2VS1A 1G2TA 4H13C 1N33Q 1QOHA 1CHPD 2WINB 4R4TA 4OO1G 1F9PA 2NTTA 5LMUL 4C2MH 4GOPA 4JI5Q 2HDMA 4AH6A 1NTGA 3H6MA 1Q12A 2EYLA 2R7FA 3QIAA 4TKOB 2F0KA 2PO4A 3G7LA 4NB3A 1PXUA 5FJ8H 1TY2A 2F0UA 2ASBA 2KCCA 3S1QH 3A55A 2B2YA 2QILA 1ONLA 2UU9L 5CBEE 3RLNA 5EQ0A 2B63H 4LF8L 5LMNW 1SN8A 4AIMA 4DAYA 3CW2C 4HR7B 4HTHA 3B6YA 1BCPB 2WKCA 2IHFA 4A3GH 4KV6A 5EBDA 4C3HB 4LNQA 4X64L 3S24A 3AU7A 2B29A 2R7DA 5GROA 2L9HA 1F9SA 1U4MA 1SYFA 2R92G 4R8IA 4BA2I 3QR8A 1HXYD 1UE7A 1TXYA 1DGSA 1IYJB 3HKZE 1Z6HA 1MI2A 4HN7A 1WI5A 4HJ5A 5IGGA 4HJAA 2WB1G 4XTCS 1KXLA 2JXMB 4DR3L 3GTLB 3NTHA 3KF8B 2YTXA 4JI8L 4EQNA 3S16B 1JJ2A 2QKIC 3NP8A 1Q81C 1L0XB 1FGUA 1I4GA 3S17B 4DR1Q 1CT1D 1YIJA 2EJMA 1WD1A 4IURA 2YU9H 2JK8A 4FF2A 1LTSD 1KLUD 1EY8A 1ASZA 1FD7D 3NSWA 4AYBG 2A6HC 4V0BA 3WDNA 3TBIB 1QB5D 5IGBA 4OGQC 1MSGA 5KNBA 1G51A 1WYDA 3HOXG 1B44D 1OXTA 1UWVA 1Y1VB 2WACA 3RZOH 4LFBQ 1IKLA 5KIXA 4QUFA 1ESRA 3D0FA 4H02A 1J5EQ 2XNAC 1STYA 2K28A 1AZQA 1OXSC 2M2LA 3T13A 2FMCA 1JCKB 2CFMA 4OX9Q 1S5DD 2EJFC 4YHHQ 3PO3B 3V2TA 2VW9A 3K5MA 3N52A 4C3HG 1HRJA 3Q23A 1VQCA 1VQGA 3K5NA 5LHY1 1HNWQ 2MP1A 3CCVA 4JBMA 1MSHA 1HCZA 3TN2A 1EFWA 2PQEA 3CC4A 3MVVA 2JEBI 4DV6Q 4BY1H 3K5OA 1STBA 5M3FH 1TWAB 1CHQD 1VQAA 4A3KB 3DMUA 1QVGA 4LMQD 2Z6KA 3H94A 4A75A 1STHA 4QY7A 4Y7NH 2RBMA 5ELDA 1LUZA 1EIFA 3J81i 4CDEC 1VMPA 5M3MH 5JEAG 4PMWA 4LJZC 3CQZB 1WVLA 3GTGB 4JK1C 2LXKA 2X69A 1VQ5A 5C4XB 4DV7Q 5C3EG 1EU3A 1HZAA 2F0DA 3FKIH 1E0BA 5FLMH 1IYVA 3I4NH 5LMNQ 1JOQA 5AFWA 2E2HH 4IUPA 1M4VA 3OIQA 3I4MB 3CCQA 1VQFA 1EWIA 1W6KA 3TS0A 4B08A 2O2LD 2BA0A 3A7AB 3I7FA 2Z1CA 2VQFL 1C8CA 4LF9L 2MUYA 1JR0D 1Y1VG 4MZ9A 3TZDA 5IGCA 3CCMA 3PIP3 1KD1C 2BDOA 2MO1A 2PQAB 1IYUA 1C7YA 2PPBC 4POGA 1VQPA 3RR5A 2PMZE 4K2LA 3KBXA 3Q8DA 2MO0A 1I4RA 2Z9HA 3PO3G 2EXZA 5LL6X 1TY0A 1PRTF 3J80c 2ZXRA 3SK5A 1SXTA 4P72A 4N8FA 4M1UB 2IHEA 4L5QA 4GNXB 2UXDL 3K7UC 2KBNA 1EYDA 2DJFC 2WAQE 3IFTA 4ZLTF 1TIID 2FHTA 4A3KG 3W3AA 3GTJH 2Q8TA 1LTAD 1DOKA 3HOZB 2ZXPA 2JA9A 4EQPA 2N55A 1C48A 5EPJA 2IPKD 2EVBA 1CA6A 1D1KA 1YI2A 1IBLQ 3G4SA 1I4QA 1ICFB 5IP9H 2K5VA 1XNQQ 4A3LG 3PF5A 4JYAQ 2K32A 1QJOA 3S1NB 1TWCB 2ZXOA 3M4OB 4Q0FA 1IBMQ 4MTNA 3HOWB 4IUNA 3KDFA 5FKAC 3CRLC 1U9RA 3I4MG 5C44H 3EJIA 4U68A 4B3SQ 1ESFA 1GO3E 1WCMH 2KECA 2CH4W 4LUVA 2DN8A 5A2QL 1QVFA 4JCVE 1EYCA 3L2PA 3QB3A 1YJWA 2R93B 3TDQA 1SDFA 4FP5D 1SE8A 3PIO3 3P20A 2VB2X 1EOVA 1B8AA 3MHBA 1I3QB 3WOEA 4LW1A 2OQKA 3I3CA 4KK7A 4EX5A 4UAIA 4BBSB 4BY7H 2ZJRA 3HFZB 1VQKA 2E2DC 1T5XD 1BXTA 1YZ6A 2Z0SA 1HTPA 1J8IA 1W2BA 1BCPF 3U4ZA 3ND9A 1K3RA 3A74A 4PZ7A 2EYMA 2RCFA 5I2YA 4LF6L 4IN3A 3A8KE 3PUZA 1EY4A 4IZ8A 1HNXQ 4A3CG 4ODGA 3HOZG 2HIXA 1BNZA 3NXWA 4DUYQ 2A6ED 5FK9C 2EY1A 1PYBA 1NMFA 1KTKA 2B2TC 1MHWC 3KLSA 1E24A 1PYWD 4EQ5A 2K14A 4NKLA 4RFBA 3KLRA 4KHPL 4RG1A 1O7ZA 1ZKOA 4GLVB 1EQTA 1KL9A 1TS4A 3S1MH 4O2DA 1N8RC 4LFAL 2D9UA 4X3TA 3HOWG 1GUGA 3TP6A 2HQEA 4C56C 2AUJD 1W6JA 1VQEA 3LNNA 4RCOA 2E2JB 2AMCB 1JE5A 2PNRC 3KF8A 3CMAA 4OONA 1TU2B 2PZUA 4LFCL 4NP5A 3SK8A 3MAQA 2ICIA 1N36L 5FOBB 1M90C 2X6LA 2R93G 2F0JA 2GVBA 2CVRA 1O7LA 5D3IB 1Z9FA 2LXJA 3CU7A 3V96A 3R93A 4ZKCB 4C2MB 3WWVA 5IODA 1V1OA 3TQYA 4JI4Q 1I6HH 4BBRH 2R61A 4WJ4A 1RIPA 2K5HA 3S1QB 3HG9A 1XMOQ 2B2TA 3ERSX 1A8VA 1VQMA 3GTOH 1Y1WH 2WFWA 2I5HA 4GKJQ 1BKBA 2B63B 2OQ0A 2XN9C 5IT9E 4ABNA 1I50H 4RKLA 4B3MQ 3NUCA 3PQIA 3J7ZC 4A3GB 2JA7H 1A3TA 1E2ZA 1X3PA 5BN3A 2LKVA 2NTSA 4WJWA 2F1MA 1Y8OB 3BDLA 1U5KA 1WJJA 5CGKA 4B3RL 5HY6A 2BOSA 5CORA 1RJTA 4A3IH 1CZGA 2PZWA 2QEXA 1EQRA 1D5XC 4QB4A 1G91A 4APVA 4L6TB 1BDOA 3K80C 1GOZA 2CW0C 3KUPA 1VQLA 5ELCA 2Z4IA 5HURA 4RGOS 1G2SA 4GN4B 1LYLA 5DEHA 5CV5A 2YU9B 2H1EA 4R8NA 4DUZL 1SEBD 2EYFA 2I46A 3GTQH 1VCIA 1NMGA 1WD0A 4DV1L 1PTOC 3BVMA 5FO8B 4G7HC 1PFSA 5FJ8G 1MJEA 3FVQA 4X66L 2PQAA 4CDFC 2WB1E 4DN4M 4FVMA 5EKLA 4JC0A 4LF4Q 1I5FA 3R2IA 3RZOB 3ONAB 3J7AV 5EBCA 2EE1A 2F3WA 2ES2A 3A5ZB 4FF1A 4N8X1 4R4OA 3VDYA 2XWBB 2R3ZA 1RF2D 4ZKBB 1AH9A 4XXEA 1NNXA 4A4IA 3T4AC 2HD3A 1B9MA 2Y0SB 3STBC 4GZYC 4QCLA 1BR9A 1K8GA 4YCUA 4HSVA 4QJFA 1YJNA 1STGA 2KCTA 2OF1A 4JBJA 4BY1B 3A5UA 2MGSA 4OEMB 5M3FB 3HOUG 1VQHA 2F3VA 2UUAL 1ZYRD 5C0XG 4X6AH 4Y52H 3CPWA 4C3JH 2OT2A 1XNRL 4Y7NB 1IBKL 1JICA 1YNXA 4JI6L 4XYOA 1HZ9A 1PTOH 4NMZA 4B3RQ 4JW0A 5M3MB 1I6VC 3U4VA 1LTLA 2SNMA 1N33L 1UEAB 2ICEC 3KLSX 1BO0A 2CHBD 4UY8C 2UXBQ 2NZHA 4JI5L 3U58A 1JQYD 1GXDC 3FKIB 1XXGA 2G5DA 3I4NB 1TQOA 2YYZA 2E2HB 5D65A 2DNEA 2EYHA 5GAGC 3MWYW 4N9PA 3RN5A 3MTSA 3SHLA 1LABA 3ERQA 2EXDA
chains in the Genus database with same CATH topology
2GA4B 1S4ZA 2Z8LA 4G57A 2L1BA 4ZYSA 2FJ2A 1GHJA 4ID6A 2A68C 4MN3A 3OOCA 1HTLD 1AP0A 3NE5B 1JWUD 3MXGA 1HUMA 3FEWX 1DM0B 2OEOA 4IUTA 3GTJB 2IT1A 1EOTA 2B2VC 3GD7A 2OXPA 3TZUA 3J80E 3HP3A 1CI3M 3BVZA 4F8MA 1VF5C 5KRUA 1QG7A 3EQLC 1B50A 3JAME 1H9KA 2F0WA 1EIGA 3GO5A 2L5TA 1U4RA 2CQAA 5K36H 1EY9A 1K8OA 3L9AX 1LV9A 1SAPA 2JP1A 1LTID 5C44B 1KAAA 4MHEA 1EWCA 2F0NA 1WCMB 4CBVA 2K33A 2B2UC 3SK6A 1R4PB 3CKIB 5CC4A 5CV9A 4K2KA 3LWEA 4BA1I 1LT6D 1YNJC 4UDUC 2DNCA 4IUVA 4ULLA 2TMPA 1I4HA 4TRDA 4BY7B 2AWOA 2L55A 1B9NA 2JSOA 3SK4A 3J7YW 2AQ2B 3W2DA 3ITPA 3TSSA 4XIGS 5EJWA 3NBIA 2KVMA 2QDBA 4DAPA 1ET9A 1C4QA 3T53B 3NPPA 3SVMA 2JE6I 4WRDA 1NUCA 1XTCD 1SMYD 1EU4A 2Q8RE 1QNKA 3ZYYX 4HSPA 5E4XA 1O80A 4Q5VA 3S1MB 2RA4A 3C46A 1SNMA 2WKDA 3G6JB 5IGDA 2F4IA 2SEBD 3SEBA 5G3LF 4K8IA 3DHQA 1F2ZA 4XQJA 1SYGA 3DWPA 2QCPX 4X3KA 5M9OA 1ET6A 5JPMC 5D3DA 3EA6A 1D2BA 2F0PA 1HFGA 3H91A 1I6HB 1SYBA 4BBRB 1CTMA 3GTOB 3NK9A 1HQRD 1Y1WB 4PV1C 1SYCA 2KOLA 2SNSA 1I50B 3RD4A 4IFDI 5JAVA 2RSOA 2JA7B 2F0QA 2D5DA 4NDXA 2PYKA 2XIWA 3DWAA 1SBBB 3FDTA 1RCVD 1PZKD 3E5SA 2PW7A 2EOTA 5FLXE 1PFMA 4IUQA 3R8BA 1LTTD 4RH6A 2LS01 4A3IB 4B9XA 3OHXC 1LTRD 1IL8A 3PUXA 1F77A 5CMDA 4ZRZA 3I70A 4DNRB 3D4WA 1HA6A 4QIWB 1SNDA 4DF7A 5DM73 3VR5A 4PNYA 4HMJA 3KK7A 1GUTA 3K0YA 5CBAE 1GUSA 1D6EC 2EZVA 3PUYA 1EWHA 3GTQB 3FMCA 5DAUA 2DY8A 1IW7D 1GHKA 4FF4A 2VNUD 1A3VA 5ELBA 1CM9A 5I2XA 2D62A 5I9PA 1LT3D 4KI0A 4H7BA 4FXDA 4DFAA 1STAA 1X3QA 4HAEA 2F0FA 2XWJB 1PRTD 1F2LA 4KY6A 4G4KA 1O7YA 5FO7B 2JYOA 4XYQA 1VF7A 5JPNC 1DCZA 1B3AA 3MXUA 5A35A 1HQMC 1KABA 3U9OA 2F0GA 1MD2D 1WTWA 4C3JB 2XRQD 3K57A 1G6ZA 1AZPA 1PTOB 3J80L 4XT3B 2KEEA 2SOBA 1RTOA 1S5FD 1CQVA 2A6EC 1LLRD 4X3SA 3V05A 1GUNA 2J7ZA 1F9QA 1M8AA 1RDPD 4O42A 1U4PA 1HPCA 3QG1A 5BN4A 4R9WA 3RUZA 3C2PA 3U9SA 2NYZD 3T16A 1DYQA 2KJXA 4OL7A 1GUOA 4RKBA 4K5VA 3PUWA 5CYUA 1V1PA 1BCPD 3MFYA 4ZUJA 2C5CA 4EQOA 3GQBA 5KEEA 4TSSA 3MXPA 3RMHA 2K1BA 2KHSA 3SXHA 4XQNA 4KJOA 1HHVA 5JVG3 4C3JG 3X3MA 4KKUA 4RHSA 3J81E 2NB0A 1WTXA 1O78A 5C0XI 4EGVA 2ID0A 2JEAI 2EPBA 2V4DA 1KDAA 1VMCA 4XT1B 3TMEA 1PZID 3PO2B 3MFGA 5F2DA 1X32A 1QILA 3PMFA 4F7XA 2QEJC 2LFNA 1KDBA 4FXKC 5CV7A 3HGBA 5ISRA 1IKMA 4RGMA 5DNFA 2NWGA 5E1FA 1E2VA 2FMMA 1PFNA 3T56B 5C4HA 2EDGA 3TP5A 4A3DB 4NW2A 1WTVA 4FF3A 3GV6A 3EROA 1TWGB 2M9VA 2ZT9C 1F9RA 1RODA 3OMGA 4PMBA 2A69D 2NN6G 3O13A 3D3RA 1I4XA 5CR3A 1AFPA 3I90A 1EEFD 2EYPA 5EPKA 3I4LA 2K01A 2JA6B 5T1IA 2F0VA 2L12A 2F0EA 1ZXTA 3N6RA 2R7ZB 2JA5B 4C1NK 5IGEA 3M85A 1DOMA 3I72A 3BVGA 4G7ZC 2BE5D 2X6GA 3S1RB 5KYLA 4IQZA 5D14A 5K36G 3R3OA 2XRSD 5FLXL 3BS1A 3K6OA 4HEDA 4KMUC 1Y8NB 3TP7A 3Q6SA 1NCVA 1QE6A 5M5YB 4J1MA 2WIIB 4OO1I 1WTOA 3D4DA 4JBWA 2R6GA 2H4OA 1G291 1KLGD 4H0LC 2RQXA 5M5XB 2E2IB 3OPOA 3S2DB 2VB3X 1OXUA 3HOVB 1FNUA 1QNUA 4FXGC 4OIKA 1DJRD 4N9TA 2O5IC 4HCSA 4DU9A 1G8ZD 1I4PA 2J4XA 4LK1C 4A3EB 2M00A 3OIPA 3VR3A 3AB9A 2MJ8A 1PTOF 4IFDH 3MA2B 1EFID 3GP7A 1KDCA 2NVTB 2LY7A 2HDLA 1EY7A 2WV6D 3NQTA 5J22A 2IX1A 4F88A 5LL6S 4QMGA 1Y8PB 1Q1EA 2EY2A 4B9WA 2AQ3B 2Z4HA 3S14B 2RDFA 1II3A 1RHPA 2G9DA 1J9OA 1EEID 3OMCA 5KNDA 5EKKA 2A5HA 4K5WA 1STNA 2IL8A 1A2UA 2F0TA 4QF4A 4C3IB 2AUKA 1CFMA 4DAVA 1LT4D 1H9RA 1SNQA 2L11A 1RTNA 4KD4A 3Q24A 5I9OA 4RWSC 1YNND 4TQUS 4KY5A 1OXVA 1UAPA 2NZ1D 3VA5A 2C9OA 1SYEA 4HCEA 4IFDJ 1E2WA 1A15A 1JOKA 5ELEA 2G9HD 2IX3A 4M8AA 2B2YC 3PV0A 1H9JA 5JOBA 1HA5A 1Q90A 3VYTA 2FINB 3GTPB 2LMCB 3F2UA 5C3WA 3J81L 2O4XA 3QWNA 4RA8A 1DD2A 1EZ6A 2DY7A 3BDOA 3VR6A 1JWSD 1JE4A 3DWQA 2K6AA 1SJED 1AN8A 1SMYC 4MIUA 3ND8A 1CK1A 1GJXA 1EIHA 4A3FB 1V1PB 2B2VA 5T1GA 4C3IG 1FR3A 1TVXA 4S3SA 4U673 4AYBB 4A3MB 1V43A 5CV8A 4K6LA 1BBXC 3HOXB 1EQVA 4A93B 1LT5D 2IX0A 4CKCA 5IT9L 1SE4A 1LTBD 3IL8A 2F0IA 1AW7A 2L0CA 4IUUA 2NBFA 3DEOA 1PFBA 4X3UA 1NAPA 3K59A 2Q8IB 2HUGA 3HEJA 3R2TA 1UNSA 1TS5A 5KYIA 4KKSA 1Q3LA 2PCFB 2B2UA 4DK1A 3MC0B 4HMIA 2TSSA 1YNJD 3S9WA 4XQQA 5C0XH 5FO9B 3VR4A 3QOJA 5G3LD 5C4JB 4ILWA 4ZK9B 1TT2A 2EY5A 3C1EA 5M5WB 4KTAA 3DXJC 1DONA 3D31A 3P7JA 4K14A 4CJ1B 4CJ0B 3VYSA 3SR1A 5BN5A 5C3EB 3OW7A 5KNCA 4RGNA 3VR2A 1FGBD 4KHVA 1SNCA 2NVYB 3CHBD 3C3LA 3E6ZX 1ENFA 1NR2A 2XSCA 4G7OC 1ENCA 4L8JA 5E3FA 4PMCA 1AEXA 2F0LA 2N88A 3D6CA 1IW7C 3M4YA 2K5QA 1QWYA 5C3XA 3VA7A 3BYYB 2A74C 3M7NA 4DGZA 2A6HD 2IW3A 3J7AF 4KKTA 4KN7C 1SFOB 5C0XJ 4FYDA 4QUCA 1EY0A 4C1NI 1PRTC 2O5JC 3GTMB 4KY7A 3TP8A 1F2YA 1SJHD 3NBHA 1PLFA 3LX0A 1S5CD 1PZJD 2L4NA 4K8JA 3A54A 1K83B 1DXMA 3RZDB 2MHVA 2A73B 2HCIA 1K8MA 4RAUC 4ME5A 3S15B 4OO1H 1D5MC 1WTRA 1Q1BA 3D6WA 5ELFA 3IKJA 4KHZA 1ML0D 4CJ2C 2NN6I 4KD3A 4FO2A 1SNPA 3Q0AA 1RD9D 2B39A 2NVQB 4ZQ3A 5EGTA 3VYRA 3HKZB 3HS0C 1KNEA 3L3OC 3M7GA 2E75C 3X3NA 3SDZA 1A6XA 1S5ED 3NWSA 3HZXA 4P2CB 1D1IA 3FPUB 1ILQA 4WORA 2FFKB 3RLFA 3C1FA 3NTIA 4DNTB 1DOLA 2BDNA 5C5LA 1BCPC 1B1ZA 3PUVA 3M3YB 1U4LA 3JAML 5I6YA 3I73A 3BDCA 2EYOA 3I8ZA 3EVQA 2RDGA 4CKEA 1MBYA 2F03A 1H9SB 1D5ZC 1FNWA 2NVXB 4E6IA 1R9TB 4H44C 1Q8IA 4OIJA 3K5LA 1FNVA 3DM1A 3H3VC 2PW5A 3NWTA 3H0GB 5IOCA 1WTQA 2D2CC 1BQQT 4K6DA 4ZUIA 2E76C 3AMUA 3QOLA 1B4OA 5COYA 1NR4A 1LACA 2HCCA 4CKBA 3GV3A 5K5PA 4BWGB 3A8JE 4O1NA 2K5DA 4WFN3 2E74C 5E4WC 3SE0A 1SSOA 2BA1A 4IFDG 1OO9B 2RDHA 1EY5A 3UI2A 4DXFA 3MZ5A 5DM63 4XDXA 2WP8J 2EYJA 2VUMB 1R4QB 2A69C 3T51B 5C6AA 2EJGC 5IGFA 2KA7A 1VDZA 3IFDA 1B53A 2MPMA 5I6WA 3DUZA 2AWNA 5JJZA 1JB3A 5JEAH 3A8IE 1XYIA 2ENBA 1KNAA 2J0TD 1JC7A 2JA8B 1TKWB 5TSSA 2PMZB 3P75A 1Z7TA 1JWMD 2KCNA 1TR5A 5CV6A 1H9MA 4RHRA 2SDFA 3WOFA 2BE5C 4BS9A 1CQFA 2WAQB 1EL0A 4J6HA 3H09A 5EPLA 1EY6A 2K03A 2IJ0A 2RSNA 4OHJA 3Q22A 2F0SA 1EYAA 4V190 2B8FA 3HOYB 4DA2A 3QO2A 1F2MA 3HRZC 1EZ8A 4I7ZC 3IAYA 2RKSA 2PZTA 4L63B 3S2HB 1JOOA 4A3BB 5J39A 4I65A 3MXNA 2VXWA 3BYTB 3MEHA 1HUNA 3FRPB 1BUVT 3FPPA 3BZDB 2XVSA 1DZ1A 1PMRA 1L0YB 3K58A 4IALA 2I07B 1PDQA 3HOUB 5JEAJ 1JORA 2KEDA 1LO5D 4J8QA 2B2WC 1UUPA 5J1ZA 4DK0A 3D4RA 3A7LA 1ZYRC 1T5EA 1B2TA 5CV4A 1SNOA 4ZAIA 5C4ZA 1TWFB 5I4DA 1S5BD 4Z9CB 4K5XA 4FNFA 4PQXA 1NSNS 1FYCA 2K7VA 1SE3A 1A2TA 2QF7A 4RCNA 1TS2A 2CW0D 3D8GA 5HGTA 3NTKA 3P1HA 4KN4C 1WTPA 1BOSA 1MGSA 3NHHA 2KQ3A 2B8GA 2K05A 2IWHA 2B2WA 1TWHB 3E0JA 1PTOD 1HFNA 5NUCA 2F0MA 5EKIA 3KBGA 5C5MA 5JVH3 1CZWA 3DEPA 3URYA 3GTKB 1IHZA 1YNNC 1A3UA 4RGTA 1QCBD 1H9SA 5KGUA 3VYUA 4A3JB 2F0OA 1TS3A 3A56A 3BG3A 4LAAA 2K04A 5IIFA 1GUWA 2AQ1B 4EVOA 2F0HA 2RVLA 4YIJA 3NQIA 1LTGD 4DXGA 1STEA 1XX8A 1OXXK 1ZEQX 1BF4A 1ILPA 1PRTB 2NN6H 4CHTB 3LWUA 1SE2A 2NUCA 3OSOA 1CA5A 2EY6A 1ICWA 1ENAA 3CRKC 1V8QA 3OWEB 2R92B 4KJNA 2K5WA 1Y69U 1XWEA 2BCOA 3OWFA 3L7ZC 3I91A 1SYDA 5A2QE 2WB1B 4F87A 1RKNA 2A68D 2KUMA 3QJYA 1Z47A 4CGYB 3EFXD 3K7AB 1G2TA 4H13C 1QOHA 1CHPD 2WINB 4OO1G 1F9PA 2NTTA 2HDMA 3H6MA 1Q12A 2EYLA 3QIAA 4TKOB 2F0KA 2PO4A 3G7LA 1PXUA 1TY2A 2F0UA 2KCCA 3A55A 2B2YA 2QILA 1ONLA 5CBEE 5EQ0A 4DAYA 4HR7B 4HTHA 1BCPB 2WKCA 4KV6A 5EBDA 4C3HB 3AU7A 2L9HA 1F9SA 1U4MA 1SYFA 4R8IA 4BA2I 1HXYD 1Z6HA 1MI2A 4HN7A 5IGGA 4XTCS 2JXMB 3GTLB 3NTHA 4EQNA 3S16B 2QKIC 3NP8A 1L0XB 1I4GA 3S17B 1CT1D 1WD1A 2EJMA 4IURA 4FF2A 1LTSD 1KLUD 1EY8A 1FD7D 3NSWA 2A6HC 4V0BA 3WDNA 3TBIB 1QB5D 5IGBA 4OGQC 1MSGA 5KNBA 1B44D 1OXTA 1Y1VB 2WACA 1IKLA 5KIXA 4QUFA 1ESRA 2XNAC 1STYA 2K28A 1AZQA 1OXSC 2M2LA 3T13A 2FMCA 1JCKB 1S5DD 2EJFC 3PO3B 3V2TA 3K5MA 3N52A 4C3HG 1HRJA 3Q23A 3K5NA 5LHY1 2MP1A 1MSHA 1HCZA 3TN2A 2PQEA 3MVVA 2JEBI 3K5OA 1STBA 1TWAB 1CHQD 4A3KB 3DMUA 4LMQD 3H94A 1STHA 2RBMA 5ELDA 1VMPA 5JEAG 4PMWA 4LJZC 3CQZB 1WVLA 3GTGB 4JK1C 2X69A 5C4XB 1EU3A 2F0DA 1E0BA 1IYVA 1JOQA 5AFWA 4IUPA 1M4VA 3OIQA 3I4MB 1W6KA 4B08A 2O2LD 2BA0A 3A7AB 2Z1CA 1C8CA 2MUYA 1JR0D 3TZDA 5IGCA 3PIP3 2BDOA 1IYUA 2PPBC 4K2LA 3KBXA 1I4RA 2EXZA 5LL6X 1TY0A 1PRTF 2ZXRA 3SK5A 1SXTA 4M1UB 1EYDA 4ZLTF 3IFTA 1TIID 2FHTA 3W3AA 2Q8TA 1LTAD 1DOKA 3HOZB 2ZXPA 4EQPA 2N55A 1C48A 5EPJA 2IPKD 2EVBA 1CA6A 1D1KA 1I4QA 2K32A 1QJOA 3S1NB 1TWCB 2ZXOA 3M4OB 4Q0FA 3HOWB 4IUNA 5FKAC 3CRLC 1U9RA 3EJIA 4U68A 1ESFA 2KECA 5A2QL 2DN8A 1EYCA 3QB3A 2R93B 3TDQA 1SDFA 4FP5D 3PIO3 3P20A 2VB2X 3MHBA 1I3QB 3WOEA 3I3CA 4KK7A 4UAIA 4BBSB 2E2DC 1T5XD 1BXTA 1HTPA 1J8IA 1BCPF 3ND9A 2EYMA 5I2YA 4IN3A 3A8KE 3PUZA 1EY4A 4IZ8A 4ODGA 1BNZA 3NXWA 2A6ED 5FK9C 2EY1A 1KTKA 2B2TC 3KLSA 1PYWD 4NKLA 4RFBA 3KLRA 1O7ZA 1ZKOA 1EQTA 1TS4A 2D9UA 4X3TA 1GUGA 3TP6A 2HQEA 4C56C 2AUJD 1W6JA 3LNNA 4RCOA 2E2JB 2PNRC 3KF8A 1TU2B 2PZUA 4NP5A 3SK8A 3MAQA 2ICIA 5FOBB 2X6LA 2F0JA 2CVRA 1O7LA 5D3IB 3CU7A 3V96A 3R93A 4ZKCB 4C2MB 5IODA 1V1OA 2R61A 3S1QB 3HG9A 2B2TA 2B63B 2XN9C 5IT9E 4ABNA 4RKLA 3NUCA 4A3GB 1A3TA 1E2ZA 1X3PA 5BN3A 2LKVA 2NTSA 4WJWA 2F1MA 1Y8OB 3BDLA 5CGKA 2BOSA 5CORA 1RJTA 1CZGA 2PZWA 1D5XC 4QB4A 1G91A 4L6TB 1BDOA 1GOZA 2CW0C 3KUPA 5ELCA 2Z4IA 5HURA 4RGOS 1G2SA 5DEHA 5CV5A 2YU9B 2H1EA 4R8NA 1SEBD 2EYFA 2I46A 1VCIA 1WD0A 1PTOC 3BVMA 5FO8B 4G7HC 3FVQA 4DN4M 4FVMA 5EKLA 3R2IA 3RZOB 3ONAB 3J7AV 5EBCA 2EE1A 2F3WA 4FF1A 2XWBB 2R3ZA 1RF2D 4ZKBB 4XXEA 3T4AC 4QCLA 1B9MA 2Y0SB 4GZYC 1BR9A 4HSVA 1STGA 2OF1A 4BY1B 2MGSA 5M3FB 2F3VA 1ZYRD 5C0XG 2OT2A 4Y7NB 1JICA 4XYOA 1PTOH 4NMZA 5M3MB 1I6VC 2SNMA 1UEAB 2ICEC 3KLSX 1BO0A 2CHBD 1JQYD 1GXDC 3FKIB 1XXGA 3I4NB 1TQOA 2YYZA 2E2HB 5D65A 2DNEA 2EYHA 3MWYW 4N9PA 3MTSA 3SHLA 1LABA 3ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6T B;  2Z8L A;  1JWM D;  1F77 A;  1EEF D;  1ET9 A;  1DYQ A;  2WV6 D;  1L0X B;  1GOZ A;  1I4G A;  4ZYS A;  1I4R A;  1CT1 D;  1PYW D;  3OWE B;  5ELC A;  1SE3 A;  1XTC D;  3GP7 A;  4RHR A;  1TY0 A;  1PRT F;  4RGO S;  1BCP C;  1CK1 A;  1B1Z A;  1EU4 A;  1SXT A;  1LTS D;  1KLU D;  1AN8 A;  1TS2 A;  4RFB A;  1V1P A;  1V1P B;  1FD7 D;  1SEB D;  1TS4 A;  1HTL D;  3BVG A;  2AQ3 B;  1D6E C;  1BCP D;  3BYY B;  1PTO C;  3BVM A;  1JWU D;  4C56 C;  1B44 D;  1LTA D;  4TSS A;  4RCO A;  2IJ0 A;  4K6L A;  4OHJ A;  2RDG A;  5ELB A;  1PTO D;  1EEI D;  2XNA C;  2IPK D;  1D5Z C;  2ICI A;  3EFX D;  1FNW A;  1LT5 D;  2XRS D;  2SEB D;  3R2I A;  3SEB A;  1LT3 D;  1SE4 A;  1CHP D;  1PRT C;  1JCK B;  1LTB D;  1AW7 A;  1S5D D;  2NTT A;  1I4Q A;  4L63 B;  1FNV A;  4RHS A;  5D3I B;  3BVZ A;  1RF2 D;  1PRT D;  3URY A;  3DWP A;  1SJH D;  3R2T A;  3BYT B;  1UNS A;  1TS5 A;  1TY2 A;  1V1O A;  1LT4 D;  1S5C D;  1PZI D;  1PZJ D;  3MC0 B;  3BZD B;  1ET6 A;  5D3D A;  4RGT A;  1CHQ D;  5FKA C;  3EA6 A;  3MFG A;  1KLG D;  2QIL A;  1L0Y B;  2R61 A;  2TSS A;  1QIL A;  2QEJ C;  1ESF A;  1LTI D;  4BWG B;  1D5M C;  5ELD A;  1TS3 A;  1EWC A;  1HQR D;  2XN9 C;  1BCP B;  4O1N A;  5ELE A;  4RGM A;  1LO5 D;  5ELF A;  2G9H D;  1MD2 D;  1FNU A;  1UUP A;  2XRQ D;  1PTO H;  1DJR D;  2RDH A;  1LT6 D;  2AQ1 B;  4UDU C;  1HA5 A;  1PTO B;  4DXF A;  1RD9 D;  1EU3 A;  3KLS X;  1G8Z D;  1I4P A;  2CHB D;  1HXY D;  1BXT A;  1T5X D;  1I4H A;  2NTS A;  1JQY D;  1M4V A;  1BCP F;  1S5F D;  2J4X A;  1CQV A;  1LTG D;  1XXG A;  4DXG A;  2O2L D;  1STE A;  1LLR D;  1SBB B;  3DWA A;  3V05 A;  5I4D A;  1PRT B;  1RCV D;  1PZK D;  4RGN A;  3O13 A;  1JR0 D;  1S5B D;  1JWS D;  1FGB D;  1PTO F;  1SE2 A;  2AQ2 B;  1S5E D;  4Z9C B;  3R8B A;  3W2D A;  3CHB D;  1I4X A;  1LTT D;  1RDP D;  3DWQ A;  5FK9 C;  4RH6 A;  1SJE D;  3TSS A;  1ENF A;  1D5X C;  1EFI D;  1KTK A;  5TSS A;  1LTR D; 
#chains in the Genus database with same CATH topology
 2GA4 B;  4OWX B;  1S4Z A;  2Z8L A;  4G57 A;  4DV1 Q;  2L1B A;  2I5M X;  4ZYS A;  2FJ2 A;  3AEV A;  1PH5 A;  1GHJ A;  2F4V Q;  4LF7 Q;  4ID6 A;  3KF6 B;  5IY0 A;  2ZM6 Q;  2A68 C;  4MN3 A;  3OOC A;  4K0K Q;  1HTL D;  2Y0S G;  1AP0 A;  3NE5 B;  1IZ6 A;  1JWU D;  3MXG A;  1HUM A;  3FEW X;  5L37 A;  1DM0 B;  4BY1 G;  1MIU A;  2OEO A;  4IUT A;  5M3F G;  4DR5 L;  2YTY A;  3GTJ B;  2IT1 A;  1EOT A;  2B2V C;  3E3X A;  3GD7 A;  3RNU A;  1CKN B;  1FJG Q;  2OXP A;  3TZU A;  3KYH C;  3J80 E;  3HP3 A;  3MEF A;  1CI3 M;  1PH1 A;  3BVZ A;  4F8M A;  1VF5 C;  5KRU A;  1QG7 A;  3PO2 H;  3EQL C;  1B50 A;  3JAM E;  1XNR Q;  1H9K A;  2F0W A;  1EIG A;  3GO5 A;  2L5T A;  1U4R A;  1UE6 A;  2CQA A;  3FKI G;  5IP7 H;  2VQE Q;  5FLM G;  5K36 H;  1EY9 A;  1K8O A;  3L9A X;  3I4N G;  4JI7 Q;  1LV9 A;  3E9H A;  1SAP A;  2JP1 A;  1LTI D;  5C44 B;  1KAA A;  4MHE A;  4OEL B;  1EWC A;  2F0N A;  2KHI A;  1WCM B;  5IT9 c;  4CBV A;  1X54 A;  2K33 A;  2B2U C;  2KEN A;  3SK6 A;  4WJ3 M;  4LFB L;  4A3D H;  1R4P B;  1VQ4 A;  3CKI B;  5CC4 A;  5CV9 A;  4K2K A;  3LWE A;  1J5E L;  4BA1 I;  1LT6 D;  1YNJ C;  1TWG H;  4UDU C;  4OX9 L;  2DNC A;  3F1Z A;  4IUV A;  4YHH L;  4ULL A;  2TMP A;  1I4H A;  4TRD A;  4QIW E;  4BY7 B;  1HNW L;  1CSQ A;  2AWO A;  1E1T A;  2L55 A;  4DV6 L;  1B9N A;  3I55 A;  2JSO A;  3SK4 A;  3J7Y W;  2AQ2 B;  1VQ8 A;  3W2D A;  3ITP A;  4OXP A;  3TSS A;  4XIG S;  5EJW A;  3NBI A;  2KVM A;  3NEL A;  2QDB A;  2JA6 H;  4DAP A;  1ET9 A;  1C4Q A;  3T53 B;  3W1B A;  2R7Z H;  2JA5 H;  3NPP A;  3SVM A;  2JE6 I;  4WRD A;  1NUC A;  1XTC D;  1UEB A;  1SMY D;  1UE1 A;  1EU4 A;  2Q8R E;  1PH3 A;  1XTD A;  1QNK A;  4DR5 Q;  3ZYY X;  1A0I A;  4HSP A;  1B70 B;  2RHS B;  2E8G A;  1XPU A;  5E4X A;  4DV7 L;  1N32 Q;  2E5L Q;  1O80 A;  2HHH Q;  2CWA A;  3CD6 A;  3S1R H;  4Q5V A;  5AJ3 Q;  4YWL A;  3S1M B;  1BBW A;  5LMN L;  2RA4 A;  3C46 A;  1JJC B;  1SNM A;  4POF A;  3G6E A;  2CWP A;  5C44 G;  2WKD A;  3G6J B;  5IGD A;  2F4I A;  2SEB D;  3SEB A;  5G3L F;  4K8I A;  3DHQ A;  1J6Q A;  1WCM G;  3A0J A;  5M5Y H;  2BH2 A;  1F2Z A;  3PGZ A;  4XQJ A;  1X65 A;  1SYG A;  3DWP A;  2QCP X;  4P71 A;  1KIX A;  1HZC A;  4X3K A;  5M9O A;  1ET6 A;  4BY7 G;  1E3P A;  5JPM C;  5D3D A;  5E7N A;  3EA6 A;  5M5X H;  2E2I H;  1SRU A;  4NXM Q;  3S2D H;  3ULP A;  1N34 Q;  1D2B A;  2F0P A;  1HFG A;  1VQ6 A;  3H91 A;  1JMC A;  1I6H B;  1SYB A;  4BBR B;  3L0O A;  1PA6 A;  1CTM A;  3HOV H;  3GTO B;  3NK9 A;  1HQR D;  1Y1W B;  1P8L A;  3FP9 A;  4J15 A;  4PV1 C;  4JI2 Q;  1SYC A;  2KOL A;  2SNS A;  1I50 B;  1IBL L;  3RD4 A;  1X9N A;  4IFD I;  4HIK A;  4A3E H;  5JAV A;  2RSO A;  2D0O A;  2JA7 B;  2F0Q A;  5IYD H;  4DK6 C;  1XNQ L;  4JYA L;  3TS2 A;  4MNO A;  2D5D A;  2MNA A;  4NDX A;  1YIT A;  2PYK A;  2XIW A;  3PF4 A;  3DWA A;  1SBB B;  3FDT A;  1IBM L;  1Y14 B;  1RCV D;  1PZK D;  3E5S A;  3ICE A;  2PW7 A;  2EOT A;  5FLX E;  2NVT H;  2A8V A;  1PFM A;  4IUQ A;  3R8B A;  1LTT D;  2I5L X;  1D8L A;  2LS0 1;  4RH6 A;  2KHJ A;  4A3I B;  1VS0 A;  4B9X A;  4B3S L;  3OHX C;  1LTR D;  1IL8 A;  1YBY A;  3PUX A;  1NJI C;  1F77 A;  5CMD A;  4ZRZ A;  3I70 A;  4DNR B;  3D4W A;  1HA6 A;  4QIW B;  1SND A;  4DF7 A;  5DM7 3;  3VR5 A;  4PNY A;  4HMJ A;  3KK7 A;  1GUT A;  4QL5 A;  5ELO A;  3UDF A;  1EIY B;  3S14 H;  3K0Y A;  3T1Y Q;  5CBA E;  1GUS A;  1AE2 A;  1D6E C;  2EZV A;  3PUY A;  1EWH A;  1Q46 A;  3FMC A;  3GDE A;  5DAU A;  3GTQ B;  2DY8 A;  1IW7 D;  1GHK A;  2N78 A;  4FF4 A;  2VNU D;  1A3V A;  5ELB A;  1CM9 A;  4BBR G;  1HH2 P;  1PH7 A;  5I2X A;  2D62 A;  5I9P A;  1LT3 D;  1Y1W G;  1HNX L;  4KI0 A;  4H7B A;  4FXD A;  4DFA A;  5BR8 Q;  1K28 A;  1X6O A;  3KF6 A;  4DUY L;  4C3I H;  1STA A;  1X3Q A;  4HAE A;  2F0F A;  2XWJ B;  1HR0 W;  1PRT D;  1F2L A;  4OWT B;  4P75 A;  4KY6 A;  4LF5 L;  4G4K A;  1O7Y A;  5IE8 A;  2JA7 G;  3JAM c;  4NXN Q;  5FO7 B;  1KRS A;  2JYO A;  4XYQ A;  1VF7 A;  1CKN A;  5JPN C;  4IOC A;  1EYG A;  1DCZ A;  3KOJ A;  1B3A A;  2BH8 A;  3MXU A;  4IOA A;  5A35 A;  1HQM C;  1KAB A;  3U9O A;  4A3I G;  2F0G A;  1MD2 D;  1WTW A;  4P73 A;  4C3J B;  2XRQ D;  5C4X G;  3K57 A;  1BVS A;  3GTP H;  1YJ9 A;  1G6Z A;  1AZP A;  1PTO B;  3J80 L;  1CKO A;  4GN5 A;  4XT3 B;  1S72 A;  2KEE A;  4IPD A;  2SOB A;  1RTO A;  1QUQ B;  1S5F D;  4X62 Q;  1CQV A;  2A6E C;  2NZO A;  1LLR D;  4X3S A;  4YCV A;  3V05 A;  1GUN A;  2J7Z A;  1X55 A;  4JI4 L;  1F9Q A;  1M8A A;  1YHQ A;  1RDP D;  4O42 A;  1U4P A;  1XMO L;  1HPC A;  3QG1 A;  4R9W A;  3RUZ A;  5BN4 A;  3C2P A;  3U9S A;  2NYZ D;  3T16 A;  2ATW A;  1DYQ A;  2JQO A;  2KJX A;  4OL7 A;  4GKJ L;  1GUO A;  4RKB A;  4A3F H;  4K5V A;  4DV4 Q;  2UUB Q;  3PUW A;  5CYU A;  1V1P A;  1XPR A;  4B3M L;  4A3M H;  1BCP D;  3MFY A;  4ZUJ A;  2C5C A;  4EQO A;  3HOX H;  3GQB A;  1IL2 A;  5KEE A;  3ULL A;  4A93 H;  4TSS A;  4JI0 L;  3MXP A;  2Z6B A;  3RMH A;  2K1B A;  2KHS A;  5IWA Q;  3AQQ A;  3SXH A;  4JBK A;  4LF5 Q;  5J3B A;  2PNH A;  4XQN A;  4KJO A;  2ZJP A;  1HHV A;  3PIP A;  5JVG 3;  5DLQ E;  4C3J G;  3X3M A;  4KKU A;  3SGI A;  4RHS A;  3J81 E;  2NB0 A;  4ZCK A;  1WTX A;  5EAY A;  1O78 A;  5C0X I;  4EGV A;  2ID0 A;  2JEA I;  2EPB A;  2V4D A;  1KDA A;  1VMC A;  4XT1 B;  2Y0S E;  3TME A;  1PZI D;  3PO2 B;  3MFG A;  5F2D A;  1X32 A;  1QIL A;  3PMF A;  4F7X A;  3M4P A;  2QEJ C;  2LFN A;  2ZTD A;  1KDB A;  4QGU A;  1PH4 A;  1S3O A;  4FXK C;  5CV7 A;  1YEZ A;  3TRE A;  5C4J H;  3HGB A;  1HR0 Q;  5M5W H;  5ISR A;  1IKM A;  4RGM A;  5DNF A;  2NWG A;  2AKW B;  5E1F A;  1E2V A;  1SRO A;  3BJU A;  2FMM A;  1PFN A;  4LF4 L;  3T56 B;  4BBS G;  5C4H A;  2EDG A;  3TP5 A;  1KC8 C;  4A3D B;  4NW2 A;  5C3E H;  4A76 A;  1WTV A;  4FF3 A;  1KRT A;  1RL2 A;  3GV6 A;  3ERO A;  1TWG B;  2M9V A;  2ZT9 C;  1K73 C;  2Q2I A;  1F9R A;  1ROD A;  2VY3 A;  3OMG A;  4PMB A;  2NVY H;  1U0L A;  2A69 D;  2NN6 G;  3O13 A;  3D3R A;  5FLX c;  1I4X A;  2AHO B;  5CR3 A;  1AFP A;  3I90 A;  1L1O C;  2YV5 A;  2HQL A;  1EEF D;  2EYP A;  4GLX A;  5EPK A;  3I4L A;  2C35 B;  2K01 A;  4IPC A;  2JA6 B;  5T1I A;  2F0V A;  4JI0 Q;  2L12 A;  2F0E A;  1ZXT A;  3N6R A;  4DK3 C;  2R7Z B;  1E7Z A;  4DV0 Q;  2JA5 B;  4C1N K;  5IGE A;  3M85 A;  1DOM A;  4DAM A;  3I72 A;  3BVG A;  1HJP A;  3M9B A;  4G7Z C;  3E0E A;  4JVZ A;  1X3G A;  2BE5 D;  3PO2 G;  2UXB L;  2X6G A;  3S1R B;  1SFO H;  1EQQ A;  5KYL A;  3M4Q A;  1X3F A;  4IQZ A;  2F52 A;  5IP7 G;  4OWW B;  5D14 A;  1Q82 C;  1PVO A;  5K36 G;  3R3O A;  2XRS D;  3GTM H;  5FLX L;  3BS1 A;  3K6O A;  4HED A;  4KMU C;  4R4I A;  1Y8N B;  2MQH A;  3TP7 A;  3Q6S A;  1GKH A;  4PZ6 A;  1NCV A;  1QE6 A;  5M5Y B;  4J1M A;  2WII B;  4OO1 I;  4A3D G;  1WTO A;  3D4D A;  1XMQ Q;  1L2F A;  1K83 H;  1H95 A;  3RZD H;  2K4K A;  4JBW A;  2R6G A;  2F4V L;  2H4O A;  1JB7 A;  4LF7 L;  1G29 1;  1KLG D;  5IYC H;  4H0L C;  4DV3 Q;  3S15 H;  1JT8 A;  2RQX A;  2ZM6 L;  2N49 A;  2I0Q A;  4K0K L;  4R1J A;  5M5X B;  2B63 G;  3OPO A;  2E2I B;  3S2D B;  2D0P A;  4JG2 A;  2VB3 X;  1OXU A;  1B7Y B;  3CC7 A;  3HOV B;  1FNU A;  4A3G G;  1QNU A;  4FXG C;  4OIK A;  1DJR D;  4N9T A;  2O5I C;  4HCS A;  2NVQ H;  4GLA C;  1FJG L;  4QQB X;  2JA6 G;  4DU9 A;  3G48 A;  1G8Z D;  1I4P A;  3CC2 A;  2R7Z G;  4B3T L;  1KHI A;  2J4X A;  4LK1 C;  4A3E B;  2M00 A;  3OIP A;  3VR3 A;  3DM3 A;  5IYB H;  2PI2 A;  3AB9 A;  3G71 A;  2MJ8 A;  5JJL A;  1PTO F;  5HGQ A;  4UPA A;  2UUC Q;  3K0X A;  4IFD H;  4UP9 A;  2VQE L;  2K75 A;  3MA2 B;  1LM0 A;  3EN2 A;  1EFI D;  3GP7 A;  1KDC A;  4JI7 L;  2NVT B;  2LY7 A;  2HDL A;  3OYY A;  4GKK Q;  4DR6 Q;  1EY7 A;  2WV6 D;  3NQT A;  5J22 A;  2IX1 A;  4UHV A;  3DLL A;  3PCO B;  4F88 A;  1T9H A;  1QUQ A;  4QMG A;  5LL6 S;  3M3Y H;  3I56 A;  3BZK A;  1Y8P B;  1Q1E A;  2K50 A;  2EY2 A;  4B9W A;  2AQ3 B;  1O7I A;  2Z4H A;  3NBH B;  3S14 B;  2RDF A;  1QVC A;  2ZTE A;  1II3 A;  1RHP A;  4GS3 A;  4PZ8 A;  2G9D A;  1J9O A;  2CCZ A;  2NVX H;  1R9T H;  5JJI A;  1EEI D;  4HJ9 A;  3STB D;  3OMC A;  5KND A;  4DV5 Q;  5EKK A;  2A5H A;  1PYS B;  4K5W A;  1STN A;  2IL8 A;  1A2U A;  1I94 Q;  1GM5 A;  3H0G H;  2F0T A;  4QF4 A;  3J81 c;  4C3I B;  2AUK A;  1CFM A;  4DAV A;  1LT4 D;  2MFI A;  4FDB A;  3T1H Q;  1H9R A;  1SNQ A;  4AQY Q;  2L11 A;  2Q2H A;  4A3E G;  1RTN A;  5IYD G;  4KD4 A;  3Q24 A;  2UXC L;  5I9O A;  4RWS C;  1YNN D;  1N32 L;  3CXC A;  2E5L L;  4TQU S;  2HHH L;  4KY5 A;  1OXV A;  1UAP A;  2NZ1 D;  3VA5 A;  5AJ3 L;  4DR2 Q;  4B3T Q;  2C9O A;  1SYE A;  3CP0 A;  4HCE A;  4IFD J;  1E2W A;  1A15 A;  1JOK A;  5ELE A;  5M3M G;  2G9H D;  2IX3 A;  1V1Q A;  4M8A A;  2B2Y C;  3PV0 A;  4JI3 L;  3H3V I;  4YY3 Q;  1H9J A;  5JOB A;  1VQB A;  1HA5 A;  1GD7 A;  1Q90 A;  4UP7 A;  3VYT A;  2VUM H;  2FIN B;  1C9O A;  3GTP B;  3TEH B;  2LMC B;  3F2U A;  5C3W A;  3J81 L;  2O4X A;  4LWC A;  3QWN A;  4RA8 A;  1DD2 A;  1EZ6 A;  2DY7 A;  3BDO A;  3VR6 A;  4BXX H;  1JWS D;  2JA8 H;  1MJC A;  1JE4 A;  1E22 A;  3DWQ A;  4NXM L;  2K6A A;  5JJK A;  1SJE D;  1N34 L;  1AN8 A;  1SMY C;  4MIU A;  3RN2 A;  3OTO Q;  3UDX A;  1Q7Y C;  4ME3 A;  3ND8 A;  1EUJ A;  1CK1 A;  1HNZ Q;  1GJX A;  1EIH A;  3I4O A;  4A3F B;  1V1P B;  2B2V A;  5T1G A;  4YWK A;  4C3I G;  4JI2 L;  1FR3 A;  1K9M C;  1TVX A;  1VQI A;  4S3S A;  1A63 A;  4U67 3;  4AYB B;  4A3M B;  1V43 A;  5CV8 A;  1AE3 A;  4K6L A;  1BBX C;  3HOY H;  3HOX B;  1EQV A;  4A93 B;  1LT5 D;  2IX0 A;  4CKC A;  5IT9 L;  3S2H H;  1SE4 A;  1YVC A;  4A3B H;  1LTB D;  4KLK A;  1YHA A;  1VQD A;  2F0I A;  1AW7 A;  3IL8 A;  2L0C A;  1QZG A;  1ASY A;  4IUU A;  2NBF A;  5IP9 G;  2ZJQ A;  2UXC Q;  3DEO A;  1PFB A;  4X3U A;  1NAP A;  2QDL A;  2Q8I B;  3K59 A;  4HID A;  2HUG A;  3HEJ A;  3R2T A;  3UE1 A;  1UNS A;  1TS5 A;  5KYI A;  4KKS A;  1Q3L A;  2PCF B;  2B2U A;  4DK1 A;  3MC0 B;  1UE5 A;  2A19 A;  4HMI A;  1K0R A;  2TSS A;  4JI3 Q;  4HIO A;  5GAH C;  3HOU H;  1YNJ D;  3S9W A;  4XQQ A;  3T1Y L;  1PH8 A;  5C0X H;  1PHJ A;  2DGY A;  1L0W A;  5FO9 B;  4ALP A;  3VR4 A;  3QOJ A;  4X65 L;  5G3L D;  2PI2 E;  4ILW A;  5C4J B;  4ZK9 B;  1TT2 A;  2EY5 A;  3C1E A;  5M5W B;  4KTA A;  3DXJ C;  1CUK A;  1DON A;  3D31 A;  1K3B C;  3KLW A;  3P7J A;  4K14 A;  2Z6K C;  4CJ1 B;  5BR8 L;  4CJ0 B;  4L5R C;  4DR7 Q;  3VYS A;  3SR1 A;  5BN5 A;  4A3F G;  5C3E B;  3OW7 A;  4JI1 Q;  1TWF H;  2OTJ A;  5KNC A;  3ER0 A;  4A3M G;  4RGN A;  3VR2 A;  1FGB D;  4NXN L;  4KHV A;  2HT1 A;  5LMU Q;  1SNC A;  2NVY B;  3CHB D;  3C3L A;  3E6Z X;  3UE0 A;  4A93 G;  1ENF A;  4R4C A;  1NR2 A;  2XSC A;  2CKZ B;  2QA4 A;  4G7O C;  2OTL A;  3JC6 6;  3EBE A;  1ENC A;  1K8A C;  2A1A A;  4L8J A;  4P74 A;  5E3F A;  2VZA A;  4PMC A;  1AEX A;  2UU9 Q;  2F0L A;  3HKS A;  2N88 A;  3D6C A;  1IW7 C;  3M4Y A;  4NPS A;  2K5Q A;  4LF8 Q;  3PSI A;  1QWY A;  3MXN B;  5C3X A;  3VA7 A;  3BYY B;  2A74 C;  3M7N A;  4IO9 A;  1TWH H;  2KCM A;  4DGZ A;  4HIM A;  2A6H D;  2IW3 A;  5ELN A;  4X62 L;  3J7A F;  2N3S A;  4KKT A;  4X64 Q;  4KN7 C;  3BU2 A;  3W1G A;  5C0X J;  1SFO B;  4FYD A;  4QUC A;  1EY0 A;  4C1N I;  1PRT C;  2O5J C;  1PH2 A;  1MKH A;  4KY7 A;  3GTM B;  3GTK H;  3TP8 A;  3OW2 A;  1F2Y A;  1SJH D;  3NBH A;  1PLF A;  3LX0 A;  1S5C D;  4DV4 L;  2UUB L;  1PZJ D;  2L4N A;  4K8J A;  1PH9 A;  4DR3 Q;  4X65 Q;  3A54 A;  1K83 B;  3ULJ A;  1DXM A;  3RZD B;  4A3J H;  2MHV A;  2HIV A;  1L1O B;  2A73 B;  1K0S A;  4YWM A;  4JI8 Q;  2HCI A;  1K8M A;  4RAU C;  4ME5 A;  3S15 B;  4OO1 H;  1D5M C;  1WTR A;  1Q1B A;  4DR4 L;  3CCS A;  1G6P A;  3D6W A;  5ELF A;  2XTI A;  3IKJ A;  5IWA L;  4KHZ A;  4TVA B;  1ML0 D;  4CJ2 C;  4IPH A;  1B3Q A;  2NN6 I;  5GAD C;  4KD3 A;  4FO2 A;  1SNP A;  3Q0A A;  1RD9 D;  2B39 A;  2NVQ B;  2B3G A;  4ZQ3 A;  5EGT A;  3VYR A;  3HKZ B;  3HS0 C;  1FL0 A;  1KNE A;  3L3O C;  3M7G A;  2VL6 A;  1M1K C;  2E75 C;  1VQJ A;  3X3N A;  3SDZ A;  1A6X A;  1S5E D;  3NWS A;  3HZX A;  1QZH A;  4P2C B;  3CCL A;  1D1I A;  1V9P A;  2R92 H;  3FPU B;  2F3I A;  1ILQ A;  4MTK A;  4WOR A;  2FFK B;  3RLF A;  2OWO A;  1HR0 L;  3C1F A;  3NTI A;  1IXR A;  4DNT B;  3CCE A;  1DOL A;  2BDN A;  2RF4 A;  4GN3 B;  5C5L A;  1BCP C;  1B1Z A;  4JOI C;  1WOC A;  3H15 A;  3PUV A;  4O0A A;  2P5Z X;  3M3Y B;  1U4L A;  3JAM L;  1NBW A;  5I6Y A;  1SR3 A;  3I73 A;  3BDC A;  2EYO A;  3I8Z A;  3K7A H;  3EVQ A;  2RDG A;  4CKE A;  1MBY A;  5IYC G;  2F03 A;  1H9S B;  1S40 A;  1D5Z C;  1FNW A;  2NVX B;  4E6I A;  1R9T B;  4H44 C;  1Q8I A;  4OIJ A;  3K5L A;  1FNV A;  3DM1 A;  3H3V C;  2PW5 A;  1N9W A;  3NWT A;  3H0G B;  5IOC A;  1WTQ A;  4DR4 Q;  2D2C C;  3UDI A;  1BQQ T;  2H5X A;  4K6D A;  4ZUI A;  2IY5 B;  2E76 C;  2VQF Q;  3HKZ G;  4LF9 Q;  3AMU A;  3QOL A;  1B4O A;  3AYH B;  3F2B A;  4DV2 L;  4DV0 L;  5COY A;  1NR4 A;  1LAC A;  2HCC A;  3U50 C;  4CKB A;  3GV3 A;  5K5P A;  1YHB A;  4BWG B;  4C3H H;  3A8J E;  3CCJ A;  4O1N A;  2K5D A;  5GAE C;  4WFN 3;  5IYB G;  4JOI A;  2E74 C;  5E4W C;  4IJH A;  3SE0 A;  1SSO A;  2BA1 A;  4IFD G;  1OO9 B;  2RDH A;  1EY5 A;  3UI2 A;  1VQ9 A;  2UXD Q;  2XGT A;  3EIV A;  4DXF A;  3MZ5 A;  5DM6 3;  4XDX A;  2WP8 J;  2EYJ A;  2VUM B;  1R4Q B;  2A69 C;  3T51 B;  5C6A A;  2EJG C;  5IGF A;  2QW7 A;  2KA7 A;  1NE3 A;  1VDZ A;  3IFD A;  1B53 A;  2MPM A;  5I6W A;  1XMQ L;  3H3V H;  3DUZ A;  3GTL H;  2AWN A;  1SMX A;  5JJZ A;  4JV5 L;  1JB3 A;  5JEA H;  1XPO A;  3A8I E;  2OCE A;  1XYI A;  2ENB A;  3S16 H;  1KNA A;  2J0T D;  4DV3 L;  1JC7 A;  1OTC A;  2EIF A;  2JA8 B;  1TKW B;  3S17 H;  5TSS A;  2PMZ B;  3P75 A;  1Z7T A;  3CCR A;  1JWM D;  2KCN A;  1TR5 A;  5CV6 A;  1H9M A;  4RHR A;  3KFU A;  2RCN A;  4LUO A;  1P16 A;  1C0A A;  2SDF A;  3WOF A;  2BE5 C;  4BS9 A;  4GOP B;  1CQF A;  4LUZ A;  3KJP A;  3H0G G;  2WAQ B;  1Y1V H;  4J6H A;  1EL0 A;  3H09 A;  1A62 A;  5EPL A;  1EY6 A;  2K03 A;  2IJ0 A;  2RSN A;  4L5T A;  4OHJ A;  3Q22 A;  2F0S A;  3KJO A;  1EYA A;  4V19 0;  2B8F A;  2EQS A;  3RLO A;  3FHW A;  3HOY B;  4DA2 A;  3PO3 H;  3QO2 A;  4DKA C;  1F2M A;  2ZTC A;  3PIO A;  4IJL A;  3HRZ C;  1EZ8 A;  1SLJ A;  4I7Z C;  3E9I A;  4DAY B;  4DV2 Q;  2UUC L;  3IAY A;  2RKS A;  2PZT A;  4L63 B;  3S2H B;  1JOO A;  4A3B B;  5J39 A;  4I65 A;  4UP8 A;  4GKK L;  4DR6 L;  3MXN A;  1KAW A;  2VXW A;  4LF6 Q;  1TWA H;  3BYT B;  3MEH A;  4DPG A;  4A3K H;  1HUN A;  3FRP B;  1BUV T;  2K52 A;  3FPP A;  2VUM G;  3BZD B;  2XVS A;  1DZ1 A;  1FVI A;  1PMR A;  1L0Y B;  1X56 A;  2V1C C;  4GNX C;  3J80 i;  1VQ7 A;  2Q2T A;  3K58 A;  4IAL A;  1W3S A;  2I07 B;  1PDQ A;  1WTH A;  4IPG A;  4RMF A;  3HOU B;  2JN4 A;  5JEA J;  4A3L H;  3CQZ H;  1JOR A;  2KED A;  3GTG H;  1LO5 D;  4BXX G;  2JA8 G;  4J8Q A;  5C4X H;  2B2W C;  1UUP A;  4KHP Q;  1CSP A;  3JAM i;  5J1Z A;  4DK0 A;  2QGQ A;  3D4R A;  4DNI A;  3A7L A;  4JV5 Q;  4LFA Q;  4DV5 L;  1ZYR C;  3I4M H;  1T5E A;  1I94 L;  1B2T A;  5CV4 A;  1L1O A;  2CH4 A;  3CME A;  3AFQ A;  4JPB W;  1Q86 C;  4LFC Q;  1D7Q A;  2WAQ G;  1SNO A;  2YTV A;  4PG3 A;  4ZAI A;  1N36 Q;  5C4Z A;  5H1S E;  1TWF B;  5I4D A;  1S5B D;  3T1H L;  4Z9C B;  3W5O A;  4AQY L;  4K5X A;  3HOY G;  4FNF A;  4PQX A;  1NSN S;  1FYC A;  1NY4 A;  4DR2 L;  2JA5 G;  2K7V A;  1SE3 A;  1A2T A;  2QF7 A;  4RCN A;  1X3E A;  4A3B G;  1TS2 A;  1WFQ A;  3CF5 A;  3CAM A;  2CW0 D;  3D8G A;  5HGT A;  4GNX A;  3NTK A;  3P1H A;  4KN4 C;  1WTP A;  1BOS A;  4YY3 L;  1MGS A;  3NHH A;  2CQO A;  4A3C H;  2KQ3 A;  3HOZ H;  2B8G A;  2K05 A;  4AYB E;  2IWH A;  4YCW A;  2B2W A;  1HZB A;  1TWH B;  3E0J A;  5GQO A;  1PTO D;  1PH6 A;  1HFN A;  5NUC A;  2L15 A;  2F0M A;  5EKI A;  1KQS A;  1PV4 A;  3UDG A;  3KBG A;  5C5M A;  2Q2U A;  3J81 j;  5JVH 3;  1CZW A;  3S1N H;  1BBU A;  1TWC H;  2JJQ A;  3M4O H;  3DEP A;  3K8A A;  3HOW H;  3URY A;  2LSS A;  3OTO L;  3GTK B;  1IHZ A;  1YNN C;  3K81 C;  1HNZ L;  1A3U A;  4RGT A;  1QCB D;  1H9S A;  2N8N A;  5KGU A;  3VYU A;  4A3J B;  2R93 H;  2F0O A;  3BZC A;  4CDC C;  1TS3 A;  3NEM A;  3A56 A;  3HOV G;  3TRZ A;  1I3Q H;  4HJ8 A;  3BG3 A;  2FXQ A;  4BBS H;  4LAA A;  4HJ7 A;  2GVA A;  4DUZ Q;  2K04 A;  5IIF A;  1GUW A;  2AQ1 B;  4EVO A;  2F0H A;  4X66 Q;  2RVL A;  4YIJ A;  4GOP C;  3NQI A;  4I7A A;  4CDD C;  1LTG D;  1XJV A;  4DXG A;  4L5S A;  1STE A;  1XX8 A;  1OXX K;  1ZEQ X;  1BF4 A;  1ILP A;  1CKM A;  1PRT B;  2NN6 H;  2K5N A;  4CHT B;  3AFP A;  3LWU A;  1SE2 A;  2NUC A;  3NEN A;  3CCU A;  3OSO A;  3F8T A;  3LGJ A;  1CA5 A;  3I2Z A;  2EY6 A;  1ICW A;  1ENA A;  3CRK C;  2DUD A;  1VQO A;  1V8Q A;  4R4Q A;  3OWE B;  2R92 B;  4KJN A;  2ALY B;  2DJG C;  1GVP A;  3F2D A;  2K5W A;  3IRB A;  1Y69 U;  1XWE A;  2BCO A;  3OWF A;  3L7Z C;  3CPF A;  3I91 A;  2UUA Q;  2E2J H;  1JJG A;  1SYD A;  1Q8K A;  5A2Q E;  4DR1 L;  2WB1 B;  4DR7 L;  4F87 A;  1RKN A;  3F2C A;  2A68 D;  2KUM A;  1VQN A;  1IBK Q;  3KDF B;  3QJY A;  4JI1 L;  1E1O A;  3J7A 5;  4JI6 Q;  1Z47 A;  3ZJY C;  2GN5 A;  4CGY B;  4A3J G;  2RHQ B;  3EFX D;  3K7A B;  2VS1 A;  1G2T A;  4H13 C;  1N33 Q;  1QOH A;  1CHP D;  2WIN B;  4R4T A;  4OO1 G;  1F9P A;  2NTT A;  5LMU L;  4C2M H;  4GOP A;  4JI5 Q;  2HDM A;  4AH6 A;  1NTG A;  3H6M A;  1Q12 A;  2EYL A;  2R7F A;  3QIA A;  4TKO B;  2F0K A;  2PO4 A;  3G7L A;  4NB3 A;  1PXU A;  5FJ8 H;  1TY2 A;  2F0U A;  2ASB A;  2KCC A;  3S1Q H;  3A55 A;  2B2Y A;  2QIL A;  1ONL A;  2UU9 L;  5CBE E;  3RLN A;  5EQ0 A;  2B63 H;  4LF8 L;  5LMN W;  1SN8 A;  4AIM A;  4DAY A;  3CW2 C;  4HR7 B;  4HTH A;  3B6Y A;  1BCP B;  2WKC A;  2IHF A;  4A3G H;  4KV6 A;  5EBD A;  4C3H B;  4LNQ A;  4X64 L;  3S24 A;  3AU7 A;  2B29 A;  2R7D A;  5GRO A;  2L9H A;  1F9S A;  1U4M A;  1SYF A;  2R92 G;  4R8I A;  4BA2 I;  3QR8 A;  1HXY D;  1UE7 A;  1TXY A;  1DGS A;  1IYJ B;  3HKZ E;  1Z6H A;  1MI2 A;  4HN7 A;  1WI5 A;  4HJ5 A;  5IGG A;  4HJA A;  2WB1 G;  4XTC S;  1KXL A;  2JXM B;  4DR3 L;  3GTL B;  3NTH A;  3KF8 B;  2YTX A;  4JI8 L;  4EQN A;  3S16 B;  1JJ2 A;  2QKI C;  3NP8 A;  1Q81 C;  1L0X B;  1FGU A;  1I4G A;  3S17 B;  4DR1 Q;  1CT1 D;  1YIJ A;  2EJM A;  1WD1 A;  4IUR A;  2YU9 H;  2JK8 A;  4FF2 A;  1LTS D;  1KLU D;  1EY8 A;  1ASZ A;  1FD7 D;  3NSW A;  4AYB G;  2A6H C;  4V0B A;  3WDN A;  3TBI B;  1QB5 D;  5IGB A;  4OGQ C;  1MSG A;  5KNB A;  1G51 A;  1WYD A;  3HOX G;  1B44 D;  1OXT A;  1UWV A;  1Y1V B;  2WAC A;  3RZO H;  4LFB Q;  1IKL A;  5KIX A;  4QUF A;  1ESR A;  3D0F A;  4H02 A;  1J5E Q;  2XNA C;  1STY A;  2K28 A;  1AZQ A;  1OXS C;  2M2L A;  3T13 A;  2FMC A;  1JCK B;  2CFM A;  4OX9 Q;  1S5D D;  2EJF C;  4YHH Q;  3PO3 B;  3V2T A;  2VW9 A;  3K5M A;  3N52 A;  4C3H G;  1HRJ A;  3Q23 A;  1VQC A;  1VQG A;  3K5N A;  5LHY 1;  1HNW Q;  2MP1 A;  3CCV A;  4JBM A;  1MSH A;  1HCZ A;  3TN2 A;  1EFW A;  2PQE A;  3CC4 A;  3MVV A;  2JEB I;  4DV6 Q;  4BY1 H;  3K5O A;  1STB A;  5M3F H;  1TWA B;  1CHQ D;  1VQA A;  4A3K B;  3DMU A;  1QVG A;  4LMQ D;  2Z6K A;  3H94 A;  4A75 A;  1STH A;  4QY7 A;  4Y7N H;  2RBM A;  5ELD A;  1LUZ A;  1EIF A;  3J81 i;  4CDE C;  1VMP A;  5M3M H;  5JEA G;  4PMW A;  4LJZ C;  3CQZ B;  1WVL A;  3GTG B;  4JK1 C;  2LXK A;  2X69 A;  1VQ5 A;  5C4X B;  4DV7 Q;  5C3E G;  1EU3 A;  1HZA A;  2F0D A;  3FKI H;  1E0B A;  5FLM H;  1IYV A;  3I4N H;  5LMN Q;  1JOQ A;  5AFW A;  2E2H H;  4IUP A;  1M4V A;  3OIQ A;  3I4M B;  3CCQ A;  1VQF A;  1EWI A;  1W6K A;  3TS0 A;  4B08 A;  2O2L D;  2BA0 A;  3A7A B;  3I7F A;  2Z1C A;  2VQF L;  1C8C A;  4LF9 L;  2MUY A;  1JR0 D;  1Y1V G;  4MZ9 A;  3TZD A;  5IGC A;  3CCM A;  3PIP 3;  1KD1 C;  2BDO A;  2MO1 A;  2PQA B;  1IYU A;  1C7Y A;  2PPB C;  4POG A;  1VQP A;  3RR5 A;  2PMZ E;  4K2L A;  3KBX A;  3Q8D A;  2MO0 A;  1I4R A;  2Z9H A;  3PO3 G;  2EXZ A;  5LL6 X;  1TY0 A;  1PRT F;  3J80 c;  2ZXR A;  3SK5 A;  1SXT A;  4P72 A;  4N8F A;  4M1U B;  2IHE A;  4L5Q A;  4GNX B;  2UXD L;  3K7U C;  2KBN A;  1EYD A;  2DJF C;  2WAQ E;  3IFT A;  4ZLT F;  1TII D;  2FHT A;  4A3K G;  3W3A A;  3GTJ H;  2Q8T A;  1LTA D;  1DOK A;  3HOZ B;  2ZXP A;  2JA9 A;  4EQP A;  2N55 A;  1C48 A;  5EPJ A;  2IPK D;  2EVB A;  1CA6 A;  1D1K A;  1YI2 A;  1IBL Q;  3G4S A;  1I4Q A;  1ICF B;  5IP9 H;  2K5V A;  1XNQ Q;  4A3L G;  3PF5 A;  4JYA Q;  2K32 A;  1QJO A;  3S1N B;  1TWC B;  2ZXO A;  3M4O B;  4Q0F A;  1IBM Q;  4MTN A;  3HOW B;  4IUN A;  3KDF A;  5FKA C;  3CRL C;  1U9R A;  3I4M G;  5C44 H;  3EJI A;  4U68 A;  4B3S Q;  1ESF A;  1GO3 E;  1WCM H;  2KEC A;  2CH4 W;  4LUV A;  2DN8 A;  5A2Q L;  1QVF A;  4JCV E;  1EYC A;  3L2P A;  3QB3 A;  1YJW A;  2R93 B;  3TDQ A;  1SDF A;  4FP5 D;  1SE8 A;  3PIO 3;  3P20 A;  2VB2 X;  1EOV A;  1B8A A;  3MHB A;  1I3Q B;  3WOE A;  4LW1 A;  2OQK A;  3I3C A;  4KK7 A;  4EX5 A;  4UAI A;  4BBS B;  4BY7 H;  2ZJR A;  3HFZ B;  1VQK A;  2E2D C;  1T5X D;  1BXT A;  1YZ6 A;  2Z0S A;  1HTP A;  1J8I A;  1W2B A;  1BCP F;  3U4Z A;  3ND9 A;  1K3R A;  3A74 A;  4PZ7 A;  2EYM A;  2RCF A;  5I2Y A;  4LF6 L;  4IN3 A;  3A8K E;  3PUZ A;  1EY4 A;  4IZ8 A;  1HNX Q;  4A3C G;  4ODG A;  3HOZ G;  2HIX A;  1BNZ A;  3NXW A;  4DUY Q;  2A6E D;  5FK9 C;  2EY1 A;  1PYB A;  1NMF A;  1KTK A;  2B2T C;  1MHW C;  3KLS A;  1E24 A;  1PYW D;  4EQ5 A;  2K14 A;  4NKL A;  4RFB A;  3KLR A;  4KHP L;  4RG1 A;  1O7Z A;  1ZKO A;  4GLV B;  1EQT A;  1KL9 A;  1TS4 A;  3S1M H;  4O2D A;  1N8R C;  4LFA L;  2D9U A;  4X3T A;  3HOW G;  1GUG A;  3TP6 A;  2HQE A;  4C56 C;  2AUJ D;  1W6J A;  1VQE A;  3LNN A;  4RCO A;  2E2J B;  2AMC B;  1JE5 A;  2PNR C;  3KF8 A;  3CMA A;  4OON A;  1TU2 B;  2PZU A;  4LFC L;  4NP5 A;  3SK8 A;  3MAQ A;  2ICI A;  1N36 L;  5FOB B;  1M90 C;  2X6L A;  2R93 G;  2F0J A;  2GVB A;  2CVR A;  1O7L A;  5D3I B;  1Z9F A;  2LXJ A;  3CU7 A;  3V96 A;  3R93 A;  4ZKC B;  4C2M B;  3WWV A;  5IOD A;  1V1O A;  3TQY A;  4JI4 Q;  1I6H H;  4BBR H;  2R61 A;  4WJ4 A;  1RIP A;  2K5H A;  3S1Q B;  3HG9 A;  1XMO Q;  2B2T A;  3ERS X;  1A8V A;  1VQM A;  3GTO H;  1Y1W H;  2WFW A;  2I5H A;  4GKJ Q;  1BKB A;  2B63 B;  2OQ0 A;  2XN9 C;  5IT9 E;  4ABN A;  1I50 H;  4RKL A;  4B3M Q;  3NUC A;  3PQI A;  3J7Z C;  4A3G B;  2JA7 H;  1A3T A;  1E2Z A;  1X3P A;  5BN3 A;  2LKV A;  2NTS A;  4WJW A;  2F1M A;  1Y8O B;  3BDL A;  1U5K A;  1WJJ A;  5CGK A;  4B3R L;  5HY6 A;  2BOS A;  5COR A;  1RJT A;  4A3I H;  1CZG A;  2PZW A;  2QEX A;  1EQR A;  1D5X C;  4QB4 A;  1G91 A;  4APV A;  4L6T B;  1BDO A;  3K80 C;  1GOZ A;  2CW0 C;  3KUP A;  1VQL A;  5ELC A;  2Z4I A;  5HUR A;  4RGO S;  1G2S A;  4GN4 B;  1LYL A;  5DEH A;  5CV5 A;  2YU9 B;  2H1E A;  4R8N A;  4DUZ L;  1SEB D;  2EYF A;  2I46 A;  3GTQ H;  1VCI A;  1NMG A;  1WD0 A;  4DV1 L;  1PTO C;  3BVM A;  5FO8 B;  4G7H C;  1PFS A;  5FJ8 G;  1MJE A;  3FVQ A;  4X66 L;  2PQA A;  4CDF C;  2WB1 E;  4DN4 M;  4FVM A;  5EKL A;  4JC0 A;  4LF4 Q;  1I5F A;  3R2I A;  3RZO B;  3ONA B;  3J7A V;  5EBC A;  2EE1 A;  2F3W A;  2ES2 A;  3A5Z B;  4FF1 A;  4N8X 1;  4R4O A;  3VDY A;  2XWB B;  2R3Z A;  1RF2 D;  4ZKB B;  1AH9 A;  4XXE A;  1NNX A;  4A4I A;  3T4A C;  2HD3 A;  1B9M A;  2Y0S B;  3STB C;  4GZY C;  4QCL A;  1BR9 A;  1K8G A;  4YCU A;  4HSV A;  4QJF A;  1YJN A;  1STG A;  2KCT A;  2OF1 A;  4JBJ A;  4BY1 B;  3A5U A;  2MGS A;  4OEM B;  5M3F B;  3HOU G;  1VQH A;  2F3V A;  2UUA L;  1ZYR D;  5C0X G;  4X6A H;  4Y52 H;  3CPW A;  4C3J H;  2OT2 A;  1XNR L;  4Y7N B;  1IBK L;  1JIC A;  1YNX A;  4JI6 L;  4XYO A;  1HZ9 A;  1PTO H;  4NMZ A;  4B3R Q;  4JW0 A;  5M3M B;  1I6V C;  3U4V A;  1LTL A;  2SNM A;  1N33 L;  1UEA B;  2ICE C;  3KLS X;  1BO0 A;  2CHB D;  4UY8 C;  2UXB Q;  2NZH A;  4JI5 L;  3U58 A;  1JQY D;  1GXD C;  3FKI B;  1XXG A;  2G5D A;  3I4N B;  1TQO A;  2YYZ A;  2E2H B;  5D65 A;  2DNE A;  2EYH A;  5GAG C;  3MWY W;  4N9P A;  3RN5 A;  3MTS A;  3SHL A;  1LAB A;  3ERQ A;  2EXD A; 
#chains in the Genus database with same CATH homology
 2GA4 B;  1S4Z A;  2Z8L A;  4G57 A;  2L1B A;  4ZYS A;  2FJ2 A;  1GHJ A;  4ID6 A;  2A68 C;  4MN3 A;  3OOC A;  1HTL D;  1AP0 A;  3NE5 B;  1JWU D;  3MXG A;  1HUM A;  3FEW X;  1DM0 B;  2OEO A;  4IUT A;  3GTJ B;  2IT1 A;  1EOT A;  2B2V C;  3GD7 A;  2OXP A;  3TZU A;  3J80 E;  3HP3 A;  1CI3 M;  3BVZ A;  4F8M A;  1VF5 C;  5KRU A;  1QG7 A;  3EQL C;  1B50 A;  3JAM E;  1H9K A;  2F0W A;  1EIG A;  3GO5 A;  2L5T A;  1U4R A;  2CQA A;  5K36 H;  1EY9 A;  1K8O A;  3L9A X;  1LV9 A;  1SAP A;  2JP1 A;  1LTI D;  5C44 B;  1KAA A;  4MHE A;  1EWC A;  2F0N A;  1WCM B;  4CBV A;  2K33 A;  2B2U C;  3SK6 A;  1R4P B;  3CKI B;  5CC4 A;  5CV9 A;  4K2K A;  3LWE A;  4BA1 I;  1LT6 D;  1YNJ C;  4UDU C;  2DNC A;  4IUV A;  4ULL A;  2TMP A;  1I4H A;  4TRD A;  4BY7 B;  2AWO A;  2L55 A;  1B9N A;  2JSO A;  3SK4 A;  3J7Y W;  2AQ2 B;  3W2D A;  3ITP A;  3TSS A;  4XIG S;  5EJW A;  3NBI A;  2KVM A;  2QDB A;  4DAP A;  1ET9 A;  1C4Q A;  3T53 B;  3NPP A;  3SVM A;  2JE6 I;  4WRD A;  1NUC A;  1XTC D;  1SMY D;  1EU4 A;  2Q8R E;  1QNK A;  3ZYY X;  4HSP A;  5E4X A;  1O80 A;  4Q5V A;  3S1M B;  2RA4 A;  3C46 A;  1SNM A;  2WKD A;  3G6J B;  5IGD A;  2F4I A;  2SEB D;  3SEB A;  5G3L F;  4K8I A;  3DHQ A;  1F2Z A;  4XQJ A;  1SYG A;  3DWP A;  2QCP X;  4X3K A;  5M9O A;  1ET6 A;  5JPM C;  5D3D A;  3EA6 A;  1D2B A;  2F0P A;  1HFG A;  3H91 A;  1I6H B;  1SYB A;  4BBR B;  1CTM A;  3GTO B;  3NK9 A;  1HQR D;  1Y1W B;  4PV1 C;  1SYC A;  2KOL A;  2SNS A;  1I50 B;  3RD4 A;  4IFD I;  5JAV A;  2RSO A;  2JA7 B;  2F0Q A;  2D5D A;  4NDX A;  2PYK A;  2XIW A;  3DWA A;  1SBB B;  3FDT A;  1RCV D;  1PZK D;  3E5S A;  2PW7 A;  2EOT A;  5FLX E;  1PFM A;  4IUQ A;  3R8B A;  1LTT D;  4RH6 A;  2LS0 1;  4A3I B;  4B9X A;  3OHX C;  1LTR D;  1IL8 A;  3PUX A;  1F77 A;  5CMD A;  4ZRZ A;  3I70 A;  4DNR B;  3D4W A;  1HA6 A;  4QIW B;  1SND A;  4DF7 A;  5DM7 3;  3VR5 A;  4PNY A;  4HMJ A;  3KK7 A;  1GUT A;  3K0Y A;  5CBA E;  1GUS A;  1D6E C;  2EZV A;  3PUY A;  1EWH A;  3GTQ B;  3FMC A;  5DAU A;  2DY8 A;  1IW7 D;  1GHK A;  4FF4 A;  2VNU D;  1A3V A;  5ELB A;  1CM9 A;  5I2X A;  2D62 A;  5I9P A;  1LT3 D;  4KI0 A;  4H7B A;  4FXD A;  4DFA A;  1STA A;  1X3Q A;  4HAE A;  2F0F A;  2XWJ B;  1PRT D;  1F2L A;  4KY6 A;  4G4K A;  1O7Y A;  5FO7 B;  2JYO A;  4XYQ A;  1VF7 A;  5JPN C;  1DCZ A;  1B3A A;  3MXU A;  5A35 A;  1HQM C;  1KAB A;  3U9O A;  2F0G A;  1MD2 D;  1WTW A;  4C3J B;  2XRQ D;  3K57 A;  1G6Z A;  1AZP A;  1PTO B;  3J80 L;  4XT3 B;  2KEE A;  2SOB A;  1RTO A;  1S5F D;  1CQV A;  2A6E C;  1LLR D;  4X3S A;  3V05 A;  1GUN A;  2J7Z A;  1F9Q A;  1M8A A;  1RDP D;  4O42 A;  1U4P A;  1HPC A;  3QG1 A;  5BN4 A;  4R9W A;  3RUZ A;  3C2P A;  3U9S A;  2NYZ D;  3T16 A;  1DYQ A;  2KJX A;  4OL7 A;  1GUO A;  4RKB A;  4K5V A;  3PUW A;  5CYU A;  1V1P A;  1BCP D;  3MFY A;  4ZUJ A;  2C5C A;  4EQO A;  3GQB A;  5KEE A;  4TSS A;  3MXP A;  3RMH A;  2K1B A;  2KHS A;  3SXH A;  4XQN A;  4KJO A;  1HHV A;  5JVG 3;  4C3J G;  3X3M A;  4KKU A;  4RHS A;  3J81 E;  2NB0 A;  1WTX A;  1O78 A;  5C0X I;  4EGV A;  2ID0 A;  2JEA I;  2EPB A;  2V4D A;  1KDA A;  1VMC A;  4XT1 B;  3TME A;  1PZI D;  3PO2 B;  3MFG A;  5F2D A;  1X32 A;  1QIL A;  3PMF A;  4F7X A;  2QEJ C;  2LFN A;  1KDB A;  4FXK C;  5CV7 A;  3HGB A;  5ISR A;  1IKM A;  4RGM A;  5DNF A;  2NWG A;  5E1F A;  1E2V A;  2FMM A;  1PFN A;  3T56 B;  5C4H A;  2EDG A;  3TP5 A;  4A3D B;  4NW2 A;  1WTV A;  4FF3 A;  3GV6 A;  3ERO A;  1TWG B;  2M9V A;  2ZT9 C;  1F9R A;  1ROD A;  3OMG A;  4PMB A;  2A69 D;  2NN6 G;  3O13 A;  3D3R A;  1I4X A;  5CR3 A;  1AFP A;  3I90 A;  1EEF D;  2EYP A;  5EPK A;  3I4L A;  2K01 A;  2JA6 B;  5T1I A;  2F0V A;  2L12 A;  2F0E A;  1ZXT A;  3N6R A;  2R7Z B;  2JA5 B;  4C1N K;  5IGE A;  3M85 A;  1DOM A;  3I72 A;  3BVG A;  4G7Z C;  2BE5 D;  2X6G A;  3S1R B;  5KYL A;  4IQZ A;  5D14 A;  5K36 G;  3R3O A;  2XRS D;  5FLX L;  3BS1 A;  3K6O A;  4HED A;  4KMU C;  1Y8N B;  3TP7 A;  3Q6S A;  1NCV A;  1QE6 A;  5M5Y B;  4J1M A;  2WII B;  4OO1 I;  1WTO A;  3D4D A;  4JBW A;  2R6G A;  2H4O A;  1G29 1;  1KLG D;  4H0L C;  2RQX A;  5M5X B;  2E2I B;  3OPO A;  3S2D B;  2VB3 X;  1OXU A;  3HOV B;  1FNU A;  1QNU A;  4FXG C;  4OIK A;  1DJR D;  4N9T A;  2O5I C;  4HCS A;  4DU9 A;  1G8Z D;  1I4P A;  2J4X A;  4LK1 C;  4A3E B;  2M00 A;  3OIP A;  3VR3 A;  3AB9 A;  2MJ8 A;  1PTO F;  4IFD H;  3MA2 B;  1EFI D;  3GP7 A;  1KDC A;  2NVT B;  2LY7 A;  2HDL A;  1EY7 A;  2WV6 D;  3NQT A;  5J22 A;  2IX1 A;  4F88 A;  5LL6 S;  4QMG A;  1Y8P B;  1Q1E A;  2EY2 A;  4B9W A;  2AQ3 B;  2Z4H A;  3S14 B;  2RDF A;  1II3 A;  1RHP A;  2G9D A;  1J9O A;  1EEI D;  3OMC A;  5KND A;  5EKK A;  2A5H A;  4K5W A;  1STN A;  2IL8 A;  1A2U A;  2F0T A;  4QF4 A;  4C3I B;  2AUK A;  1CFM A;  4DAV A;  1LT4 D;  1H9R A;  1SNQ A;  2L11 A;  1RTN A;  4KD4 A;  3Q24 A;  5I9O A;  4RWS C;  1YNN D;  4TQU S;  4KY5 A;  1OXV A;  1UAP A;  2NZ1 D;  3VA5 A;  2C9O A;  1SYE A;  4HCE A;  4IFD J;  1E2W A;  1A15 A;  1JOK A;  5ELE A;  2G9H D;  2IX3 A;  4M8A A;  2B2Y C;  3PV0 A;  1H9J A;  5JOB A;  1HA5 A;  1Q90 A;  3VYT A;  2FIN B;  3GTP B;  2LMC B;  3F2U A;  5C3W A;  3J81 L;  2O4X A;  3QWN A;  4RA8 A;  1DD2 A;  1EZ6 A;  2DY7 A;  3BDO A;  3VR6 A;  1JWS D;  1JE4 A;  3DWQ A;  2K6A A;  1SJE D;  1AN8 A;  1SMY C;  4MIU A;  3ND8 A;  1CK1 A;  1GJX A;  1EIH A;  4A3F B;  1V1P B;  2B2V A;  5T1G A;  4C3I G;  1FR3 A;  1TVX A;  4S3S A;  4U67 3;  4AYB B;  4A3M B;  1V43 A;  5CV8 A;  4K6L A;  1BBX C;  3HOX B;  1EQV A;  4A93 B;  1LT5 D;  2IX0 A;  4CKC A;  5IT9 L;  1SE4 A;  1LTB D;  3IL8 A;  2F0I A;  1AW7 A;  2L0C A;  4IUU A;  2NBF A;  3DEO A;  1PFB A;  4X3U A;  1NAP A;  3K59 A;  2Q8I B;  2HUG A;  3HEJ A;  3R2T A;  1UNS A;  1TS5 A;  5KYI A;  4KKS A;  1Q3L A;  2PCF B;  2B2U A;  4DK1 A;  3MC0 B;  4HMI A;  2TSS A;  1YNJ D;  3S9W A;  4XQQ A;  5C0X H;  5FO9 B;  3VR4 A;  3QOJ A;  5G3L D;  5C4J B;  4ILW A;  4ZK9 B;  1TT2 A;  2EY5 A;  3C1E A;  5M5W B;  4KTA A;  3DXJ C;  1DON A;  3D31 A;  3P7J A;  4K14 A;  4CJ1 B;  4CJ0 B;  3VYS A;  3SR1 A;  5BN5 A;  5C3E B;  3OW7 A;  5KNC A;  4RGN A;  3VR2 A;  1FGB D;  4KHV A;  1SNC A;  2NVY B;  3CHB D;  3C3L A;  3E6Z X;  1ENF A;  1NR2 A;  2XSC A;  4G7O C;  1ENC A;  4L8J A;  5E3F A;  4PMC A;  1AEX A;  2F0L A;  2N88 A;  3D6C A;  1IW7 C;  3M4Y A;  2K5Q A;  1QWY A;  5C3X A;  3VA7 A;  3BYY B;  2A74 C;  3M7N A;  4DGZ A;  2A6H D;  2IW3 A;  3J7A F;  4KKT A;  4KN7 C;  1SFO B;  5C0X J;  4FYD A;  4QUC A;  1EY0 A;  4C1N I;  1PRT C;  2O5J C;  3GTM B;  4KY7 A;  3TP8 A;  1F2Y A;  1SJH D;  3NBH A;  1PLF A;  3LX0 A;  1S5C D;  1PZJ D;  2L4N A;  4K8J A;  3A54 A;  1K83 B;  1DXM A;  3RZD B;  2MHV A;  2A73 B;  2HCI A;  1K8M A;  4RAU C;  4ME5 A;  3S15 B;  4OO1 H;  1D5M C;  1WTR A;  1Q1B A;  3D6W A;  5ELF A;  3IKJ A;  4KHZ A;  1ML0 D;  4CJ2 C;  2NN6 I;  4KD3 A;  4FO2 A;  1SNP A;  3Q0A A;  1RD9 D;  2B39 A;  2NVQ B;  4ZQ3 A;  5EGT A;  3VYR A;  3HKZ B;  3HS0 C;  1KNE A;  3L3O C;  3M7G A;  2E75 C;  3X3N A;  3SDZ A;  1A6X A;  1S5E D;  3NWS A;  3HZX A;  4P2C B;  1D1I A;  3FPU B;  1ILQ A;  4WOR A;  2FFK B;  3RLF A;  3C1F A;  3NTI A;  4DNT B;  1DOL A;  2BDN A;  5C5L A;  1BCP C;  1B1Z A;  3PUV A;  3M3Y B;  1U4L A;  3JAM L;  5I6Y A;  3I73 A;  3BDC A;  2EYO A;  3I8Z A;  3EVQ A;  2RDG A;  4CKE A;  1MBY A;  2F03 A;  1H9S B;  1D5Z C;  1FNW A;  2NVX B;  4E6I A;  1R9T B;  4H44 C;  1Q8I A;  4OIJ A;  3K5L A;  1FNV A;  3DM1 A;  3H3V C;  2PW5 A;  3NWT A;  3H0G B;  5IOC A;  1WTQ A;  2D2C C;  1BQQ T;  4K6D A;  4ZUI A;  2E76 C;  3AMU A;  3QOL A;  1B4O A;  5COY A;  1NR4 A;  1LAC A;  2HCC A;  4CKB A;  3GV3 A;  5K5P A;  4BWG B;  3A8J E;  4O1N A;  2K5D A;  4WFN 3;  2E74 C;  5E4W C;  3SE0 A;  1SSO A;  2BA1 A;  4IFD G;  1OO9 B;  2RDH A;  1EY5 A;  3UI2 A;  4DXF A;  3MZ5 A;  5DM6 3;  4XDX A;  2WP8 J;  2EYJ A;  2VUM B;  1R4Q B;  2A69 C;  3T51 B;  5C6A A;  2EJG C;  5IGF A;  2KA7 A;  1VDZ A;  3IFD A;  1B53 A;  2MPM A;  5I6W A;  3DUZ A;  2AWN A;  5JJZ A;  1JB3 A;  5JEA H;  3A8I E;  1XYI A;  2ENB A;  1KNA A;  2J0T D;  1JC7 A;  2JA8 B;  1TKW B;  5TSS A;  2PMZ B;  3P75 A;  1Z7T A;  1JWM D;  2KCN A;  1TR5 A;  5CV6 A;  1H9M A;  4RHR A;  2SDF A;  3WOF A;  2BE5 C;  4BS9 A;  1CQF A;  2WAQ B;  1EL0 A;  4J6H A;  3H09 A;  5EPL A;  1EY6 A;  2K03 A;  2IJ0 A;  2RSN A;  4OHJ A;  3Q22 A;  2F0S A;  1EYA A;  4V19 0;  2B8F A;  3HOY B;  4DA2 A;  3QO2 A;  1F2M A;  3HRZ C;  1EZ8 A;  4I7Z C;  3IAY A;  2RKS A;  2PZT A;  4L63 B;  3S2H B;  1JOO A;  4A3B B;  5J39 A;  4I65 A;  3MXN A;  2VXW A;  3BYT B;  3MEH A;  1HUN A;  3FRP B;  1BUV T;  3FPP A;  3BZD B;  2XVS A;  1DZ1 A;  1PMR A;  1L0Y B;  3K58 A;  4IAL A;  2I07 B;  1PDQ A;  3HOU B;  5JEA J;  1JOR A;  2KED A;  1LO5 D;  4J8Q A;  2B2W C;  1UUP A;  5J1Z A;  4DK0 A;  3D4R A;  3A7L A;  1ZYR C;  1T5E A;  1B2T A;  5CV4 A;  1SNO A;  4ZAI A;  5C4Z A;  1TWF B;  5I4D A;  1S5B D;  4Z9C B;  4K5X A;  4FNF A;  4PQX A;  1NSN S;  1FYC A;  2K7V A;  1SE3 A;  1A2T A;  2QF7 A;  4RCN A;  1TS2 A;  2CW0 D;  3D8G A;  5HGT A;  3NTK A;  3P1H A;  4KN4 C;  1WTP A;  1BOS A;  1MGS A;  3NHH A;  2KQ3 A;  2B8G A;  2K05 A;  2IWH A;  2B2W A;  1TWH B;  3E0J A;  1PTO D;  1HFN A;  5NUC A;  2F0M A;  5EKI A;  3KBG A;  5C5M A;  5JVH 3;  1CZW A;  3DEP A;  3URY A;  3GTK B;  1IHZ A;  1YNN C;  1A3U A;  4RGT A;  1QCB D;  1H9S A;  5KGU A;  3VYU A;  4A3J B;  2F0O A;  1TS3 A;  3A56 A;  3BG3 A;  4LAA A;  2K04 A;  5IIF A;  1GUW A;  2AQ1 B;  4EVO A;  2F0H A;  2RVL A;  4YIJ A;  3NQI A;  1LTG D;  4DXG A;  1STE A;  1XX8 A;  1OXX K;  1ZEQ X;  1BF4 A;  1ILP A;  1PRT B;  2NN6 H;  4CHT B;  3LWU A;  1SE2 A;  2NUC A;  3OSO A;  1CA5 A;  2EY6 A;  1ICW A;  1ENA A;  3CRK C;  1V8Q A;  3OWE B;  2R92 B;  4KJN A;  2K5W A;  1Y69 U;  1XWE A;  2BCO A;  3OWF A;  3L7Z C;  3I91 A;  1SYD A;  5A2Q E;  2WB1 B;  4F87 A;  1RKN A;  2A68 D;  2KUM A;  3QJY A;  1Z47 A;  4CGY B;  3EFX D;  3K7A B;  1G2T A;  4H13 C;  1QOH A;  1CHP D;  2WIN B;  4OO1 G;  1F9P A;  2NTT A;  2HDM A;  3H6M A;  1Q12 A;  2EYL A;  3QIA A;  4TKO B;  2F0K A;  2PO4 A;  3G7L A;  1PXU A;  1TY2 A;  2F0U A;  2KCC A;  3A55 A;  2B2Y A;  2QIL A;  1ONL A;  5CBE E;  5EQ0 A;  4DAY A;  4HR7 B;  4HTH A;  1BCP B;  2WKC A;  4KV6 A;  5EBD A;  4C3H B;  3AU7 A;  2L9H A;  1F9S A;  1U4M A;  1SYF A;  4R8I A;  4BA2 I;  1HXY D;  1Z6H A;  1MI2 A;  4HN7 A;  5IGG A;  4XTC S;  2JXM B;  3GTL B;  3NTH A;  4EQN A;  3S16 B;  2QKI C;  3NP8 A;  1L0X B;  1I4G A;  3S17 B;  1CT1 D;  1WD1 A;  2EJM A;  4IUR A;  4FF2 A;  1LTS D;  1KLU D;  1EY8 A;  1FD7 D;  3NSW A;  2A6H C;  4V0B A;  3WDN A;  3TBI B;  1QB5 D;  5IGB A;  4OGQ C;  1MSG A;  5KNB A;  1B44 D;  1OXT A;  1Y1V B;  2WAC A;  1IKL A;  5KIX A;  4QUF A;  1ESR A;  2XNA C;  1STY A;  2K28 A;  1AZQ A;  1OXS C;  2M2L A;  3T13 A;  2FMC A;  1JCK B;  1S5D D;  2EJF C;  3PO3 B;  3V2T A;  3K5M A;  3N52 A;  4C3H G;  1HRJ A;  3Q23 A;  3K5N A;  5LHY 1;  2MP1 A;  1MSH A;  1HCZ A;  3TN2 A;  2PQE A;  3MVV A;  2JEB I;  3K5O A;  1STB A;  1TWA B;  1CHQ D;  4A3K B;  3DMU A;  4LMQ D;  3H94 A;  1STH A;  2RBM A;  5ELD A;  1VMP A;  5JEA G;  4PMW A;  4LJZ C;  3CQZ B;  1WVL A;  3GTG B;  4JK1 C;  2X69 A;  5C4X B;  1EU3 A;  2F0D A;  1E0B A;  1IYV A;  1JOQ A;  5AFW A;  4IUP A;  1M4V A;  3OIQ A;  3I4M B;  1W6K A;  4B08 A;  2O2L D;  2BA0 A;  3A7A B;  2Z1C A;  1C8C A;  2MUY A;  1JR0 D;  3TZD A;  5IGC A;  3PIP 3;  2BDO A;  1IYU A;  2PPB C;  4K2L A;  3KBX A;  1I4R A;  2EXZ A;  5LL6 X;  1TY0 A;  1PRT F;  2ZXR A;  3SK5 A;  1SXT A;  4M1U B;  1EYD A;  4ZLT F;  3IFT A;  1TII D;  2FHT A;  3W3A A;  2Q8T A;  1LTA D;  1DOK A;  3HOZ B;  2ZXP A;  4EQP A;  2N55 A;  1C48 A;  5EPJ A;  2IPK D;  2EVB A;  1CA6 A;  1D1K A;  1I4Q A;  2K32 A;  1QJO A;  3S1N B;  1TWC B;  2ZXO A;  3M4O B;  4Q0F A;  3HOW B;  4IUN A;  5FKA C;  3CRL C;  1U9R A;  3EJI A;  4U68 A;  1ESF A;  2KEC A;  5A2Q L;  2DN8 A;  1EYC A;  3QB3 A;  2R93 B;  3TDQ A;  1SDF A;  4FP5 D;  3PIO 3;  3P20 A;  2VB2 X;  3MHB A;  1I3Q B;  3WOE A;  3I3C A;  4KK7 A;  4UAI A;  4BBS B;  2E2D C;  1T5X D;  1BXT A;  1HTP A;  1J8I A;  1BCP F;  3ND9 A;  2EYM A;  5I2Y A;  4IN3 A;  3A8K E;  3PUZ A;  1EY4 A;  4IZ8 A;  4ODG A;  1BNZ A;  3NXW A;  2A6E D;  5FK9 C;  2EY1 A;  1KTK A;  2B2T C;  3KLS A;  1PYW D;  4NKL A;  4RFB A;  3KLR A;  1O7Z A;  1ZKO A;  1EQT A;  1TS4 A;  2D9U A;  4X3T A;  1GUG A;  3TP6 A;  2HQE A;  4C56 C;  2AUJ D;  1W6J A;  3LNN A;  4RCO A;  2E2J B;  2PNR C;  3KF8 A;  1TU2 B;  2PZU A;  4NP5 A;  3SK8 A;  3MAQ A;  2ICI A;  5FOB B;  2X6L A;  2F0J A;  2CVR A;  1O7L A;  5D3I B;  3CU7 A;  3V96 A;  3R93 A;  4ZKC B;  4C2M B;  5IOD A;  1V1O A;  2R61 A;  3S1Q B;  3HG9 A;  2B2T A;  2B63 B;  2XN9 C;  5IT9 E;  4ABN A;  4RKL A;  3NUC A;  4A3G B;  1A3T A;  1E2Z A;  1X3P A;  5BN3 A;  2LKV A;  2NTS A;  4WJW A;  2F1M A;  1Y8O B;  3BDL A;  5CGK A;  2BOS A;  5COR A;  1RJT A;  1CZG A;  2PZW A;  1D5X C;  4QB4 A;  1G91 A;  4L6T B;  1BDO A;  1GOZ A;  2CW0 C;  3KUP A;  5ELC A;  2Z4I A;  5HUR A;  4RGO S;  1G2S A;  5DEH A;  5CV5 A;  2YU9 B;  2H1E A;  4R8N A;  1SEB D;  2EYF A;  2I46 A;  1VCI A;  1WD0 A;  1PTO C;  3BVM A;  5FO8 B;  4G7H C;  3FVQ A;  4DN4 M;  4FVM A;  5EKL A;  3R2I A;  3RZO B;  3ONA B;  3J7A V;  5EBC A;  2EE1 A;  2F3W A;  4FF1 A;  2XWB B;  2R3Z A;  1RF2 D;  4ZKB B;  4XXE A;  3T4A C;  4QCL A;  1B9M A;  2Y0S B;  4GZY C;  1BR9 A;  4HSV A;  1STG A;  2OF1 A;  4BY1 B;  2MGS A;  5M3F B;  2F3V A;  1ZYR D;  5C0X G;  2OT2 A;  4Y7N B;  1JIC A;  4XYO A;  1PTO H;  4NMZ A;  5M3M B;  1I6V C;  2SNM A;  1UEA B;  2ICE C;  3KLS X;  1BO0 A;  2CHB D;  1JQY D;  1GXD C;  3FKI B;  1XXG A;  3I4N B;  1TQO A;  2YYZ A;  2E2H B;  5D65 A;  2DNE A;  2EYH A;  3MWY W;  4N9P A;  3MTS A;  3SHL A;  1LAB A;  3ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...