1LTRD

Crystal structure of the b subunit of human heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLYAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 108
sequence length 108
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltrD00
2RDGA 1ENFA 1LTBD 1EU4A 5ELFA 1AN8A 1BCPD 1RD9D 1I4RA 1TS4A 2XRSD 3O13A 1TS2A 1CQVA 1PRTC 1BCPF 2RDHA 1D5MC 1PZJD 1SE4A 2AQ1B 1PTOB 1S5FD 1L0YB 3W2DA 1LT5D 4RGOS 1EEFD 2G9HD 2Z8LA 5FK9C 1PZKD 4RGNA 4RH6A 1SJED 4DXFA 1HTLD 1RDPD 1HQRD 4RHRA 1DJRD 1D6EC 5ELDA 3TSSA 2J4XA 1LT4D 3DWAA 1KLGD 3BVMA 1FNUA 1T5XD 1XXGA 1JCKB 1I4PA 1PTOH 1PTOC 1FGBD 1GOZA 5TSSA 2IPKD 1S5ED 4RFBA 1ET6A 4L6TB 1KLUD 1UNSA 2CHBD 1JWSD 1JQYD 1XTCD 2QEJC 1PRTD 3MC0B 1LTGD 3EFXD 3GP7A 1JWUD 3V05A 1PYWD 5FKAC 1B44D 1SXTA 1PRTF 2ICIA 4RGMA 3R8BA 1I4QA 3DWQA 1G8ZD 2XN9C 1SE2A 4TSSA 1S5DD 5ELCA 1FD7D 2AQ3B 1LTSD 1JWMD 2WV6D 1LTRD 1CHPD 1UUPA 1S5CD 1KTKA 4K6LA 2QILA 3R2TA 1LT3D 1PTOD 4BWGB 3BVGA 2IJ0A 1LTID 1BCPB 1V1PB 3URYA 1LTTD 1RCVD 1LO5D 3BZDB 3BYYB 1EWCA 1PTOF 4Z9CB 4ZYSA 2NTSA 1TS3A 2XNAC 3EA6A 2R61A 1CHQD 1LLRD 1SEBD 1V1PA 4DXGA 2TSSA 1EFID 3MFGA 5D3IB 1I4GA 1CK1A 4OHJA 1D5ZC 1ESFA 1ET9A 1I4HA 1F77A 2AQ2B 1BCPC 1CT1D 3DWPA 1L0XB 1SBBB 1PZID 5ELEA 1RF2D 1B1ZA 1HA5A 3OWEB 4RCOA 1QILA 1AW7A 1LTAD 5D3DA 2NTTA 2XRQD 3KLSX 1MD2D 2SEBD 4O1NA 1FNVA 1JR0D 4UDUC 3SEBA 5I4DA 1EU3A 4C56C 3BVZA 1HXYD 1V1OA 1I4XA 1FNWA 1TS5A 1PRTB 1D5XC 1M4VA 1LT6D 1SE3A 1TY0A 3BYTB 2O2LD 4RGTA 1BXTA 1EEID 1SJHD 1TY2A 3R2IA 5ELBA 1S5BD 3CHBD 4L63B 1STEA 1DYQA 4RHSA
chains in the Genus database with same CATH superfamily
1VMPA 1W6KA 1AN8A 2CH4W 1TS4A 3CRLC 5E7NA 5J39A 2D5DA 3S1MH 1D5MC 4FXGC 3J80i 2F0NA 3HOUH 3HKZG 2B2VC 1ICWA 5I6YA 2JN4A 2L1BA 4RHRA 4JI7L 4BBRG 2UUBQ 2HCIA 2QW7A 3PO3G 3HOVB 4L5QA 3T53B 2OEOA 4I7AA 5JEAH 1N34L 3E9HA 2B29A 1EQTA 4L5SA 1PTOH 1Y1WB 1VQIA 1WCMH 1IL2A 1K8MA 3A8JE 2JA6B 1HZ9A 4G7HC 2LS01 4POFA 2SOBA 1XMQQ 3X3NA 1XNRQ 1E2ZA 4LFAL 1UE1A 3G6EA 2WAQG 3CCLA 4KHPL 2K5WA 2L9HA 1H9SA 3NEMA 5FJ8G 3SK6A 1A62A 3S1QB 5EJWA 4NPSA 3WOFA 1O7IA 1X3PA 4X65Q 2UXDQ 4PV1C 1UUPA 4DA2A 4F8MA 2QILA 3M7NA 1E2WA 1LT3D 2CWPA 2I46A 2NVXH 3RLOA 2JYOA 2IHEA 1CQFA 3KBGA 1JOKA 3RLNA 1L1OC 3GO5A 1QNKA 1I4GA 4KLKA 4HCSA 4DV3Q 5CV8A 2UU9L 2CW0C 2DY7A 4CDFC 4KHVA 3CMEA 3S15H 1YBYA 2IHFA 1VQ4A 1X55A 4A3EH 5M5YH 3T1HL 2L15A 1EY7A 1SRUA 5BN4A 1JMCA 4A3DB 3MFYA 2SEBD 3A74A 3UDFA 1CFMA 2QA4A 3F2BA 2FMCA 3S14H 5EQ0A 1U5KA 2A68C 5M5XH 5IYBG 5EBDA 2SDFA 1TY2A 1EQVA 4K6DA 1EUJA 3JAMi 2NVTB 1JJGA 1SLJA 2A6EC 1H95A 5HURA 4LF8L 3CW2C 1JICA 1VQLA 2NWGA 1VQMA 1GUSA 4BBSH 1PZJD 1W3SA 3OYYA 4YY3L 4C3JH 1NY4A 4R4QA 3B6YA 4GKJQ 5DEHA 1EOVA 3IFTA 5BN5A 4G7ZC 4C3HH 1AZQA 1SNPA 1WD1A 3BVMA 1NTGA 5FO9B 2CKZB 3TDQA 1Z6HA 3KLWA 2F3WA 2D0OA 4WRDA 4A3MB 1PTOC 5GADC 1SMYD 4FVMA 1VQ5A 1XTCD 1STHA 4KKTA 3PO2B 3MC0B 4KI0A 4X62Q 2BCOA 1JWUD 4L8JA 3VR5A 2HHHQ 4LUOA 1PYWD 1NBWA 1KABA 3RZDB 4C2MH 1R9TH 1VQ6A 1L1OB 1ZXTA 2A6HD 4DR4Q 3DEOA 2JA7B 1FD7D 3KJOA 2F0OA 2FMMA 1O7YA 4K5VA 5GAEC 1MJEA 1PA6A 2EE1A 1U0LA 4BWGB 4PQXA 1LTID 1V1PB 2F0WA 1LTTD 4IALA 3BZDB 3TEHB 4XT3B 1GJXA 3CPFA 3NWTA 2B2UA 4JK1C 5KYLA 5EAYA 2X69A 3AEVA 2R93G 2ICEC 2XNAC 2IX3A 1EYAA 3N52A 2VUMH 4NDXA 1LLRD 1TWAB 2HUGA 4R8IA 2F0JA 4ZRZA 3LNNA 3SHLA 1FGUA 2R92H 5M3MH 1SDFA 1Y1VG 4OWWB 1R4QB 3L2PA 4O2DA 5I6WA 2ZJRA 2B2WA 4DR5Q 4I7ZC 4RCOA 3OWEB 5I2YA 3ULJA 1OXVA 1STYA 3ULPA 4MHEA 1HR0L 4K14A 4OGQC 4O1NA 3W5OA 2K33A 2VW9A 4HEDA 5JPNC 4C56C 1STNA 5LMUL 2XGTA 1W6JA 2Q8TA 4LW1A 2UUAL 3C1EA 1S3OA 1VQ7A 1GUNA 1B3QA 2LXKA 3FKIH 4BXXH 1H9MA 1HZBA 2RBMA 4CHTB 3HOZH 2VQFL 2BH8A 2N49A 2OQKA 3HOYH 3DLLA 4A3IH 1M1KC 3GTMH 1PRTC 4JI5L 1PTOB 1L0YB 1NAPA 4K0KL 1VQDA 1ZYRD 4LF9L 3I4OA 3FMCA 1WCMB 1LACA 4G7OC 2ZXRA 1FJGL 2J4XA 1N33L 4K2KA 1D2BA 1D8LA 4LNQA 1O7LA 1JT8A 1GUWA 2PZUA 1PH2A 4DAPA 4A3BG 1XPRA 4AH6A 3VR4A 1KLUD 3L0OA 2QEJC 3RZOH 3OMGA 3FHWA 2F0TA 2CWAA 4DFAA 3DHQA 5JEAJ 1I50H 4IOAA 2HCCA 1QB5D 3J7A5 5JJIA 1BDOA 1IL8A 1RODA 1G8ZD 1HUNA 4IPDA 2AWOA 1CSPA 4JI1Q 3GTQB 3AQQA 3OIQA 3PQIA 2EVBA 2L4NA 3R2TA 5A2QL 1HPCA 3ITPA 4NXML 2WKCA 3S15B 3KF6B 3NBHA 1CKOA 4K2LA 1A2TA 4Q0FA 5M5YB 3VR3A 1Q86C 5FLMH 2F0DA 2EY5A 4GKKQ 1IHZA 2F0EA 2M2LA 1GVPA 1ET9A 1VQFA 3CCJA 4DV5Q 1DXMA 5M5XB 5KNDA 1CT1D 4BY1H 2HT1A 1SBBB 1F9QA 1LTAD 2F0GA 2OQ0A 4ME5A 1UE7A 1B50A 3MA2B 3K6OA 1TS5A 1D1KA 1PRTB 1Q7YC 5IGBA 4BBSB 1TWCB 1KQSA 4V190 4QY7A 4C3JB 1BXTA 4DV6L 2JA8G 4QB4A 3GTPH 1H9JA 3TREA 3AFQA 3SXHA 2WKDA 2NVQB 1KC8C 4DR6L 2D62A 3ND8A 5DM63 1LTBD 1M90C 4C3HB 3HOWH 1I94L 1G6ZA 2K03A 2XTIA 4MZ9A 4A3CG 1OTCA 4C1NK 2D0PA 5C3EG 4OL7A 3J7AF 4X64Q 1WOCA 4DV2Q 2UXBQ 5IT9L 4DR5L 3H94A 3OW7A 1QZHA 4X6AH 1TWHH 1YNJC 1F2LA 1O78A 4JI3L 1KLGD 3TP7A 4S3SA 1R9TB 4C2MB 3ULLA 1OXUA 2Z4HA 4PZ7A 3S2DH 1SROA 4DR3Q 5IYCH 4AQYQ 4PZ6A 4H02A 3G4SA 3CKIB 3T4AC 4FYDA 4HIMA 4NW2A 4A93H 2AHOB 4ZCKA 1SMXA 1C4QA 3GP7A 4IUNA 3U9OA 1H9SB 4CKEA 2I0QA 3ICEA 2A1AA 2ICIA 1XMOQ 3L3OC 3J80c 1N36Q 1K0SA 2QCPX 3UE1A 1X65A 2VUMB 4JYAQ 3K0XA 5A2QE 2JA5H 5K36H 2R92B 5M3MB 1F9PA 1KAAA 4WJ4A 3PUWA 1JOOA 3RN5A 1WD0A 4DGZA 3UDGA 4F87A 3V2TA 2ZT9C 5FLXc 1PTOF 3ZJYC 1J6QA 1TS3A 2I5HA 3EA6A 2R61A 4QF4A 4FDBA 5DM73 2F4VL 5CMDA 3PV0A 4JI6L 1D5ZC 1OXTA 1IYUA 2B2UC 4IUUA 3K57A 3PF4A 4DF7A 1F77A 3NSWA 1JOQA 1MI2A 1VQJA 1KIXA 3FKIB 1B1ZA 2NTTA 2XRQD 2NUCA 3BDCA 3K58A 3SEBA 1EYGA 1LM0A 5CYUA 3BJUA 4OO1G 3HOYB 2NN6G 1PFBA 4A3IB 2B2WC 2R7ZH 3GTMB 4B3TQ 4IOCA 4JI1L 1SE8A 4KY7A 3BDLA 4CKBA 4IO9A 3J81L 1SJHD 4KK7A 1QUQB 5J1ZA 1STEA 4DR1Q 2KECA 1ENFA 4A3JH 3H0GG 1BCPD 1YNNC 3NP8A 5KNCA 2RCNA 1A15A 2C9OA 1MSGA 1N8RC 3FP9A 4HIKA 2KCCA 2B3GA 4OWXB 1H9KA 2AQ1B 4M8AA 2K04A 1IKMA 5IT9E 2CFMA 4APVA 4BBRH 4PNYA 4TQUS 3PO3H 1U9RA 3IRBA 2BA0A 1QWYA 1UAPA 4R1JA 5CGKA 1AP0A 3QWNA 4DK0A 4LFBL 1Q8KA 1Y8NB 3CC4A 5C3WA 1I50B 4DUZL 2JEAI 1EIHA 4LF6L 2XSCA 2RA4A 1PYSB 2ZM6Q 1IBMQ 3A8IE 3JAMc 2ATWA 5GQOA 1NR4A 2G9DA 1KDBA 3GV3A 2K5QA 3H6MA 2EZVA 2EYHA 3I4NH 5C4HA 3CCVA 3HZXA 3SDZA 4NB3A 5FJ8H 1B44D 1PRTF 3STBD 1NMFA 3F2UA 3EJIA 2X6GA 3SR1A 1Y69U 5A35A 5EPLA 1B3AA 1XTDA 5BR8L 2ALYB 5GAHC 1WYDA 3RD4A 1G51A 4K5XA 4GOPA 3PIP3 1II3A 4ZKBB 1XNQL 1STGA 4UP9A 3CU7A 4DV4L 1QOHA 2B2TA 1ZEQX 5CBAE 2VNUD 4DXGA 2GVAA 1XPOA 4R4CA 4LF5Q 1EOTA 5IODA 1QG7A 2F0PA 4A3FG 5CV4A 3D0FA 4GNXC 2A69C 3CXCA 1YJWA 4C3IG 3S1RH 2QEXA 2PQEA 3GTPB 1VF7A 2JA9A 4ALPA 1F2ZA 3KLSX 3IAYA 4YHHQ 5I4DA 4AYBE 1GHJA 4JI0L 4GLXA 2NVYB 5JOBA 3J81E 2Z6KC 4PG3A 3D31A 3C1FA 2JQOA 1EFWA 4NXNQ 1LT6D 4X3KA 2Q2TA 4TVAB 1PHJA 3W1BA 4DR2L 4LF4Q 2ZXOA 1VS0A 2JXMB 2RHQB 1VQOA 4RHSA 1IBKQ 4U68A 2KUMA 5E4XA 5IGEA 4LK1C 1RD9D 1X9NA 3JC66 3EIVA 4JOIA 2YTVA 2YTYA 2ES2A 4BY7H 2B63H 3S2DB 4OX9Q 1LT5D 4RGOS 5JVH3 2Z9HA 3PUZA 3PIOA 1SJED 5BN3A 1VF5C 3EVQA 4A93B 2ZTCA 3HOVG 3LWUA 3J81i 1A3VA 3I4MB 3A56A 1I3QH 3CAMA 4H44C 1L2FA 2K32A 5CV9A 2E2IH 3J7AV 2YU9B 1I4PA 3KDFA 1FGBD 3OTOQ 4B3TL 1Y1WG 4B3RQ 5C5MA 2JA6G 1SNMA 2JA5B 4XIGS 3HOXG 5COYA 5KEEA 5M3FG 1WTOA 4QGUA 2RVLA 4J8QA 1UE5A 1S40A 1J5EL 1V43A 4HIOA 3E6ZX 1MIUA 2VL6A 1IBLQ 1CZGA 4JBMA 4KKUA 2DNEA 1CKNB 4OONA 4DR7Q 1CA6A 3S2HB 1SNQA 4K6LA 4P74A 1YI2A 4QJFA 4GNXB 3MHBA 4LMQD 4XYQA 4MN3A 4CDDC 1OXSC 3NHHA 3SGIA 4A3KH 5JPMC 3RLFA 4R8NA 1EWHA 3P1HA 1BUVT 3KOJA 3VR6A 2K75A 1IBML 4AYBB 1QVFA 2ZXPA 2KHSA 2R7ZB 1GD7A 2B39A 5I9OA 2K28A 3N6RA 3RNUA 4KKSA 1CZWA 4DV1Q 3D3RA 4DAYA 3U4ZA 4KJOA 4A3DG 2KBNA 3U58A 2EYMA 2HIVA 3AU7A 1Z9FA 4LUVA 5IP7H 4A3JB 5E3FA 2DGYA 3BVZA 4JI2L 3PSIA 4X66L 4FF3A 1UE6A 2Q2IA 1VCIA 4JI8Q 2FXQA 3K5OA 4DU9A 2O2LD 4FXKC 3PUYA 3P7JA 3R2IA 1U4LA 1VQ8A 4QCLA 4DPGA 3W1GA 1ASYA 2A6ED 2WIIB 4HR7B 3CC7A 1AH9A 3CPWA 4DV0Q 1B2TA 1CQVA 3PUVA 4IJHA 1B70B 3MAQA 3Q6SA 5T1IA 3TP5A 5C4XH 1I6HH 3E9IA 3I4NB 1ML0D 3TS2A 2Z1CA 1KD1C 3DWAA 4A3BH 2R7FA 4UP7A 2EPBA 3QJYA 2OXPA 3MEFA 4A3GG 4A3MG 2BE5D 1XPUA 3GTJH 3CRKC 2E5LL 4R4IA 2EYLA 3P75A 1BR9A 1S5ED 3BZKA 1UNSA 4EQNA 4UPAA 2OT2A 1LTGD 2PNHA 4IUTA 3UDIA 1NR2A 4A3LG 5EGTA 3K7UC 3NBIA 2AWNA 4ILWA 1E0BA 3I55A 1K3RA 2JA7G 3H3VH 3TBIB 1S5DD 4N9TA 1JB7A 3R93A 4JBKA 1LTRD 1YJNA 4Y52H 2O4XA 3K8AA 4J6HA 2PCFB 1XWEA 2VB3X 4R9WA 1YNXA 1CHQD 2PZWA 3KFUA 1DGSA 1XX8A 1EIFA 3OWFA 4GOPC 1E24A 2KCTA 4DV7Q 1WVLA 2L55A 2B2TC 5DLQE 1U4MA 5IIFA 1HZCA 1X3GA 1KAWA 1FVIA 4AIMA 1CKMA 3K7AH 4GN3B 1QILA 2FHTA 1SYCA 4IUPA 4IPHA 1EU3A 1EY4A 1NSNS 3DM1A 4HSPA 2UUBL 1V1OA 1I4XA 2JA8H 1DOMA 3TRZA 4DUYQ 4BY7B 2B63B 3GTLH 1TWGH 3A55A 2ZTEA 4FXDA 2OTJA 1K0RA 1QZGA 1S5BD 5LMNW 1HNXQ 2XIWA 2EYFA 1SMYC 4K8IA 1MBYA 1XMQL 2F4IA 1I3QB 2PW7A 5JEAG 1XNRL 4KTAA 2F3VA 5C3EH 1Q3LA 2WINB 2O5JC 1QE6A 2E2IB 3Q22A 1U4PA 2PQAA 1LV9A 4R4OA 1VQAA 1X32A 2G9HD 1WCMG 5FK9C 5KNBA 5DAUA 5GROA 2Q8IB 1U4RA 1NNXA 1D6EC 4JOIC 1YHBA 4X65L 1SYBA 3S1MB 2UXDL 2A6HC 2TMPA 5C3XA 1KDCA 3HOUB 2EDGA 2KHJA 3CQZH 4N8FA 5G3LF 2CCZA 3GV6A 3H09A 3DXJC 4OEMB 2JEBI 4FF1A 3K81C 1ET6A 3PCOB 4UHVA 1JWSD 1Q1BA 4P2CB 1KL9A 4PZ8A 1VQBA 4DV3L 2E74C 3WWVA 3KBXA 2Z6BA 2EY2A 4A3KB 2EYPA 4WJWA 4RAUC 3OW2A 2K1BA 3M4QA 4HJ8A 5EKKA 1BVSA 3H3VC 1IZ6A 4GOPB 5C5LA 1GO3E 3OOCA 1CHPD 1EL0A 4MTKA 1K8GA 3QO2A 1ENCA 2OF1A 3QG1A 4H7BA 1PV4A 1PH3A 4JI4Q 1AZPA 3H3VI 2MFIA 3VYTA 4Z9CB 3BS1A 1IW7D 3ER0A 3KYHC 4E6IA 2NVXB 1DONA 1GHKA 5F2DA 5ELOA 3A8KE 1EQRA 1P16A 2SNSA 3MXUA 1PH5A 2QDLA 3MWYW 1DOLA 1EY5A 1EYDA 3CC2A 1K73C 3NWSA 5IT9c 2VB2X 3DWPA 1YHAA 4JVZA 1O80A 1RF2D 4GKJL 1PFNA 4YCWA 4ZKCB 2NN6H 2E8GA 5C0XH 2NZHA 4B08A 1FNVA 3VA5A 4UDUC 3I7FA 4JC0A 4JCVE 5GAGC 4JV5Q 4A3EB 4BBSG 1BBXC 4C3JG 4UP8A 1VQKA 5M9OA 3S14B 3VYSA 3H0GH 5C4XB 2ZJPA 1I6HB 5LMNQ 1J9OA 2Y0SE 4C3HG 2PI2A 2UUCQ 4X62L 2V1CC 3WDNA 1B7YB 2LMCB 2VY3A 2HHHL 4XYOA 3T1YQ 2WB1E 3IL8A 2UXCQ 3SE0A 4A76A 1KHIA 2Z4IA 3NENA 2ASBA 2KCNA 4DXFA 4DR4L 3TSSA 4OIJA 3MEHA 3KDFB 3C46A 1WFQA 4UY8C 4HJ5A 5I9PA 5KRUA 1HQMC 1N9WA 2L0CA 5LL6X 2D9UA 4QUCA 2H5XA 4FO2A 2DUDA 3G48A 3G71A 2F3IA 4LF7Q 4U673 2DNCA 4HTHA 2F0IA 3AMUA 1YZ6A 2P5ZX 1RHPA 1K8AC 2K5DA 3Q0AA 2MUYA 3R8BA 2K14A 2V4DA 3DWQA 4LFCQ 3BG3A 1BQQT 5ELCA 3AB9A 2AQ3B 5M3MG 2WV6D 1PH7A 3J81c 4FF2A 1Z7TA 1HUMA 5IGDA 2VQEQ 2NZ1D 3QR8A 1QVGA 4QMGA 3MXNA 1RCVD 4IPCA 2IW3A 2RSNA 4GN4B 1DZ1A 3UI2A 1XJVA 3K7AB 3RN2A 1GUGA 2EYJA 3NUCA 4A3FH 5IWAQ 1SSOA 1VQEA 2TSSA 4FP5D 5D3IB 4C1NI 1TWGB 1VQGA 4H0LC 1G6PA 3OHXC 3FKIG 1MJCA 5CBEE 4ZAIA 1RTOA 5AJ3Q 4FF4A 2EIFA 2Y0SB 4KD3A 2PZTA 4B9WA 2K5VA 4A3IG 3QIAA 1R4PB 5C3EB 3VDYA 1PH8A 2WB1B 1SNOA 2NN6I 5C0XI 1PFSA 3I2ZA 4PMBA 1SN8A 1AFPA 1N32Q 1PDQA 3CCEA 4L63B 2A74C 3LGJA 1K28A 3K59A 1EYCA 3HG9A 4IFDH 2K4KA 5D65A 2MQHA 2RKSA 3NE5B 3G6JB 3HOZB 5C44H 4Q5VA 2PMZE 2F0HA 2Z8LA 5C6AA 1PZKD 4RH6A 3DUZA 3M7GA 5EPJA 3CP0A 1DJRD 4ZLTF 5T1GA 2O5IC 4B3MQ 1LT4D 2R3ZA 5HGQA 4OXPA 1ONLA 1DCZA 2JA6H 4ID6A 4YCUA 1QCBD 2A73B 1T5EA 1GOZA 1EY9A 3HOXH 3S16H 5M3FH 2B8FA 1Y8OB 2IPKD 1WTPA 1CI3M 1HRJA 3X3MA 4GKKL 3PF5A 1MGSA 2E76C 4RA8A 4LWCA 1UEBA 2EJMA 5LMNL 1Q12A 4DV5L 1FR3A 3NQTA 4WORA 4DN4M 5J3BA 3RZOB 3PIPA 3L7ZC 2XN9C 2UXCL 2KEEA 1YJ9A 2IWHA 5AFWA 1LTSD 2LXJA 2G5DA 3D4WA 4JPBW 3TQYA 2DN8A 3HGBA 4BA2I 1OO9B 1NE3A 3J80L 1N34Q 3CCUA 3CD6A 1EWCA 3J7ZC 1UWVA 4ULLA 3LWEA 3RMHA 1WTHA 2EOTA 5C4ZA 1JE5A 4F88A 2K5HA 1O7ZA 4ZUJA 3TZUA 5EKIA 3WOEA 1IKLA 1BCPC 1GUTA 4KHPQ 4RMFA 3H0GB 1B9MA 4J15A 2N78A 4X64L 2KJXA 4DK3C 1SAPA 4DV2L 2UXBL 1HCZA 3CCSA 4BY1B 1ESRA 2KENA 2BOSA 1C48A 1M8AA 1E7ZA 1Y14B 4LJZC 1M4VA 2KOLA 1X54A 1A6XA 3AYHB 5IGCA 4RGTA 2PMZB 4DR3L 4AQYL 5C0XJ 3EBEA 1ZKOA 1JE4A 2LKVA 4G4KA 3C3LA 2F0LA 3F2CA 4RCNA 2PQAB 1EIGA 1TWFH 3GTOH 2F0QA 5CR3A 1XMOL 2UU9Q 2JSOA 5IYCG 1N36L 3TMEA 4EQOA 1TQOA 2N55A 3HOWB 2F0UA 5IYBH 5D14A 4JYAL 4RGNA 3STBC 3ONAB 1XYIA 1HR0W 3CMAA 4QL5A 4IFDI 4A3GH 3I4MG 4X3SA 1JC7A 1HJPA 2R6GA 4A4IA 2F0MA 2EYOA 5C4JH 1TWHB 1V9PA 1QNUA 3NPPA 2DJGC 2JA5G 4A3LH 3HKZE 3A0JA 2JJQA 2PNRC 1D1IA 3H15A 2RDFA 1JQYD 3P20A 5FO8B 5DNFA 1Q1EA 4TKOB 3VA7A 1RTNA 3MXPA 4LF8Q 3KF6A 5FKAC 2F0KA 5IOCA 1FL0A 1BF4A 3HKSA 4YY3Q 1C7YA 3JAML 4IZ8A 4FNFA 1I4QA 3OSOA 5E4WC 1K83H 3NELA 2H1EA 1S5CD 3J80E 1IXRA 4DNIA 2IJ0A 2F52A 3S9WA 4QQBX 1BCPB 3URYA 2K01A 2XWBB 4XXEA 2WAQE 3D6CA 3F1ZA 1K8OA 1PMRA 2XVSA 1ENAA 4YIJA 2E2HH 4DR1L 4AYBG 3HRZC 2H4OA 1WTWA 2Q2HA 1E22A 2PPBC 3SK8A 3E0EA 1HNZQ 3U4VA 2FJ2A 4DKAC 1VMCA 3NBHB 1HA5A 4EQPA 1WTRA 2R93H 3ERSX 5FOBB 4A3JG 1MD2D 2N88A 2EY1A 4RG1A 1HXYD 4N8X1 1GKHA 1PXUA 1PH1A 5LL6S 3NK9A 1RIPA 1Y1VH 1STAA 1SYEA 1TY0A 2ZM6L 1RL2A 3J7YW 5C44B 1VQHA 4UAIA 2DJFC 3GD7A 3IKJA 3ND9A 1JJ2A 2K6AA 3FDTA 1Z47A 4KMUC 2CW0D 2K50A 3PIO3 1CUKA 1BOSA 1KNAA 4OWTB 3OMCA 1PH6A 2IT1A 1KDAA 4CJ0B 4DAVA 3HOXB 3S16B 5M3FB 4HJ7A 3HKZB 3I4NG 1RDPD 1HR0Q 2A68D 1NUCA 1IYVA 1MHWC 4CDEC 4JBJA 1YIJA 4IFDJ 3VR2A 5LMUQ 4BBRB 4YWMA 3EROA 3I8ZA 2HDLA 3PO3B 3T56B 1B4OA 2EJFC 2UUAQ 2Q8RE 3VYUA 2OWOA 3ZYYX 1Q82C 4RWSC 1PYBA 1QJOA 5H1SE 3SK5A 4L6TB 1BO0A 4X3UA 4K5WA 4LF5L 3I3CA 3NQIA 2VQFQ 1TVXA 1Q81C 5EBCA 3E0JA 4ZK9B 3JAME 1SNCA 1SXTA 5KIXA 4RKBA 1YHQA 3GTQH 1YITA 2WAQB 4HMIA 4JI5Q 3OPOA 3KLSA 1A8VA 1Q8IA 2M9VA 4K0KQ 2RF4A 4LF9Q 4TSSA 1TU2B 4I65A 4YHHL 3MXNB 1C0AA 2F03A 1FJGQ 4HCEA 1N33Q 4HJAA 2A8VA 4B9XA 1PTOD 1JORA 2MPMA 3D4RA 4NXNL 1DM0B 2L11A 3PO2G 2D2CC 4LF4L 3M4YA 1IBKL 3Q8DA 5IP9G 1K9MC 4KV6A 5IYDG 2RSOA 1J8IA 2RCFA 3KUPA 2QDBA 5CV5A 4OX9L 3V96A 2Q2UA 3S17H 2VS1A 1QUQA 3EQLC 5D3DA 4KN7C 3PMFA 3OIPA 1TWCH 3E5SA 4X3TA 3S1RB 3NTKA 1ICFB 3W3AA 4KD4A 3HEJA 4HSVA 4B3SQ 3D8GA 4ODGA 1TWFB 3A5UA 2NVQH 3GTOB 2B63G 4BY7G 4R4TA 4NXMQ 1EZ8A 3R3OA 2ZJQA 4IJLA 4QIWE 2IY5B 3I4LA 3OTOL 5JJLA 4B3RL 3L9AX 3QOJA 2FINB 3M4OH 1I6VC 2F1MA 2BE5C 2RDGA 3U9SA 4A3GB 2CH4A 4EGVA 1HFNA 2I5MX 3DEPA 2HIXA 1S4ZA 2N3SA 1TS2A 1JJCB 4HIDA 1EIYB 4PMWA 1CSQA 3M4PA 1HZAA 1BCPF 2WFWA 2GN5A 1SFOH 4XTCS 3W2DA 4HN7A 1EEFD 1MSHA 5C4JB 1HNZL 1IBLL 2F0FA 5ELNA 4DR7L 1HQRD 1KNEA 3A7LA 4P73A 1HA6A 3G7LA 3HOUG 1BKBA 3F2DA 1HNWQ 4K8JA 4GLAC 2EJGC 4DK6C 4V0BA 5HGTA 1FNUA 4DAMA 1XXGA 4KN4C 4A3CH 5M5WH 4DV6Q 2BH2A 1PFMA 4L5TA 4RFBA 1K83B 3KF8A 2YYZA 3A54A 3TS0A 4DR6Q 1PRTD 4J1MA 4O42A 3RR5A 3T51B 5IGGA 1I94Q 1S72A 2AMCB 3Q24A 3GTGH 4A3KG 1HH2P 4RGMA 4DV1L 1P8LA 2HD3A 2K52A 4HMJA 3D6WA 2X6LA 2E2HB 2Z0SA 3DM3A 1SYGA 2EXDA 4GZYC 4BA1I 1IYJB 5I2XA 1KTKA 5J22A 1L0WA 1T9HA 4GN5A 4JI8L 4JI3Q 4GLVB 1MKHA 2GA4B 2PO4A 1VQPA 3HP3A 4ZUIA 3SVMA 5KGUA 4ZYSA 1I5FA 2R93B 3I73A 5IP7G 3BDOA 1HHVA 4KHZA 3HS0C 5JJKA 3QOLA 2MO0A 4IUQA 4OHJA 4YWKA 4DV0L 1ESFA 1Y1VB 5HY6A 3D4DA 2BDOA 1ILPA 4QIWB 2C5CA 4CGYB 5ELEA 5CV6A 3QB3A 4LUZA 4LAAA 5JAVA 3LX0A 2I07B 1G291 2GVBA 4A3EG 1FNWA 1TT2A 2A5HA 4HAEA 4YCVA 4NP5A 4XQQA 3U50C 4CJ1B 1HFGA 3FPPA 3MTSA 2KA7A 1X56A 5C4XG 5ELBA 1H9RA 1RJTA 5EKLA 1CM9A 4EVOA 2F4VQ 4OELB 3M3YH 4IPGA 4JI6Q 2LSSA 4OO1H 2XRSD 3ERQA 1JB3A 3GTKH 1STBA 1ZYRC 3BU2A 2OTLA 1OXXK 1VQ9A 4CKCA 3AFPA 2AUKA 1W2BA 2B2YA 1EY6A 4IURA 2PW5A 1GUOA 3RUZA 2L12A 3CCRA 4B3SL 1PH9A 1DD2A 4KY6A 2NZOA 1SYFA 4F7XA 1VDZA 1EWIA 5ISRA 4ZQ3A 3NTIA 1CKNA 4A3BB 2KQ3A 2C35B 2CHBD 1LUZA 2MP1A 2K7VA 3UE0A 1IW7C 4GNXA 4DV7L 3GTJB 3V05A 1RKNA 2IX1A 4YWLA 1G2TA 1EY0A 4MIUA 2VZAA 2IX0A 4M1UB 1G2SA 1YNJD 1TXYA 1V1QA 1WI5A 2BDNA 1PH4A 4BS9A 3F8TA 1JWMD 3VYRA 2Z6KA 2QKIC 3C2PA 4LFBQ 4DUYL 2VXWA 2RHSB 3BVGA 4DUZQ 4XQNA 3KLRA 4LF6Q 1NMGA 3S17B 1HNWL 1B9NA 2K5NA 1X3QA 1HNXL 3HFZB 4MNOA 2KEDA 2YTXA 4P75A 2VUMG 2FFKB 2HDMA 2K05A 1I4HA 3A7AB 2AQ2B 4IN3A 2R92G 2NVYH 4GS3A 4EX5A 5IE8A 3M4OB 4NMZA 2Y0SG 2L5TA 2E2JH 2KCMA 2R7DA 4Y7NH 3KJPA 2WB1G 5BR8Q 1BNZA 4CJ2C 1D5XC 4PMCA 1NCVA 3TZDA 1PVOA 1EZ6A 1HTPA 3BYTB 1YVCA 2KHIA 1SFOB 1XNQQ 2F0VA 1Q90A 3I56A 4WJ3M 4C3IH 1LYLA 4DV4Q 2JA8B 3S1NH 4DAYB 5CC4A 3GTLB 2I5LX 5ELFA 1B53A 3EN2A 2B2VA 4BXXG 1I4RA 5FO7B 1V8QA 2SNMA 3HOZG 2RDHA 2MNAA 5M5WB 1EQQA 1S5FD 2JE6I 3HOYG 3I4MH 2MJ8A 1AEXA 1E2VA 1GXDC 3FPUB 1HTLD 2PYKA 2ENBA 2E2DC 1SNDA 4OO1I 1DOKA 3DMUA 3H91A 3T13A 4CBVA 2YU9H 4JI0Q 1A63A 2F0SA 3K5LA 1UEAB 2JK8A 4H13C 3GTGB 4DNTB 4JI4L 3KK7A 1QVCA 1JCKB 1AE2A 4DR2Q 5EPKA 3GQBA 4TRDA 1YNND 1TR5A 3CQZB 5L37A 1FYCA 2LFNA 2MGSA 2BA1A 4XT1B 5K5PA 3CF5A 3HOVH 2IL8A 2LY7A 3GDEA 1VQCA 2EY6A 1E1OA 1X3FA 3S2HH 1TIID 1SE2A 1Y1WH 1SYDA 1WTXA 1F9RA 1L1OA 4JV5L 1A0IA 2EXZA 2A19A 1BBWA 1E1TA 3K5NA 3PGZA 3TN2A 2M00A 3BYYB 5IY0A 5C0XG 2NTSA 4DK1A 1SEBD 1E3PA 1V1PA 4L5RC 3S1QH 3K0YA 3MFGA 3K5MA 1A2UA 1CK1A 2UUCL 1WTQA 3T1YL 5FLMG 2CQAA 4DNRB 2MO1A 1A3UA 2CVRA 1J5EQ 4JI7Q 2OCEA 1PZID 1CA5A 1ASZA 1AW7A 4KJNA 3CCQA 1YEZA 4BY1G 1JR0D 3Q23A 2WACA 4ME3A 2MHVA 3NXWA 3M3YB 3FEWX 2AUJD 2E75C 3TP6A 1SE3A 3GTKB 2ID0A 4N9PA 1G91A 1EEID 2J0TD 2B8GA 3CCMA 4P71A 2NBFA 3T16A 4LF7L 4LFAQ 4A3DH 2A69D 1X3EA 2QF7A 1EU4A 5FLXL 5CORA 2J7ZA 1SR3A 4O0AA 4QUFA 3O13A 2KVMA 4G57A 1NJIC 1SE4A 3HOWG 4LFCL 4MTNA 1PLFA 4OIKA 3K80C 1C8CA 5E1FA 4IQZA 2NVTH 4JW0A 1Y8PB 3I70A 5ELDA 5IGFA 5G3LD 2QGQA 1K3BC 3J81j 2VQEL 4P72A 1GM5A 4JI2Q 4X66Q 3MZ5A 1T5XD 3KF8B 4EQ5A 1AE3A 5TSSA 5IWAL 2NB0A 4HJ9A 5JVG3 1D7QA 2B2YC 1VQNA 1EY8A 1BBUA 3EFXD 4ABNA 2PI2E 3UDXA 2HQEA 3T1HQ 4A93G 3FRPB 5LHY1 3E3XA 4A75A 3I90A 1LABA 4A3MH 1LTLA 2XWJB 3IFDA 2N8NA 4RKLA 5AJ3L 2NYZD 4POGA 3PO2H 2CQOA 1WTVA 3MXGA 2RQXA 4JG2A 3BZCA 4NKLA 5K36G 1F9SA 1LO5D 5IP9H 3RZDH 3M9BA 1N32L 1A3TA 2E5LQ 5IYDH 5NUCA 1CTMA 5CV7A 1F2MA 4JBWA 2E2JB 2JA7H 5KYIA 1EFID 1WJJA 2AKWB 4Y7NB 4KY5A 1X6OA 2ZTDA 4XQJA 2EQSA 4XDXA 3I91A 4A3FB 3NTHA 2HQLA 3PUXA 4WFN3 4C3IB 1ILQA 1L0XB 3S1NB 4IUVA 3MVVA 5JJZA 3A5ZB 1TWAH 2JP1A 1F2YA 4B3ML 1C9OA 3TP8A 4IFDG 2WP8J 1TKWB 2YV5A 3SK4A 3S24A 2DY8A 3I72A 1B8AA 5C44G 1KRTA 1Q46A 2R7ZG 1KXLA 3FVQA 3CHBD 5FLXE 3M85A 1KRSA 4CDCC 1DYQA
chains in the Genus database with same CATH topology
1VMPA 1W6KA 1AN8A 1TS4A 3CRLC 5J39A 2D5DA 1D5MC 4FXGC 2F0NA 2B2VC 1ICWA 5I6YA 2L1BA 4RHRA 2HCIA 3HOVB 3T53B 2OEOA 5JEAH 1EQTA 1PTOH 1Y1WB 1K8MA 3A8JE 2JA6B 4G7HC 2LS01 2SOBA 3X3NA 1E2ZA 2K5WA 2L9HA 1H9SA 3SK6A 3S1QB 5EJWA 3WOFA 1X3PA 4PV1C 1UUPA 4DA2A 4F8MA 2QILA 3M7NA 1E2WA 1LT3D 2I46A 2JYOA 1CQFA 3KBGA 1JOKA 3GO5A 1QNKA 1I4GA 4HCSA 5CV8A 2CW0C 2DY7A 4KHVA 1EY7A 5BN4A 4A3DB 3MFYA 2SEBD 1CFMA 2FMCA 5EQ0A 2A68C 5EBDA 2SDFA 1TY2A 1EQVA 4K6DA 2NVTB 2A6EC 5HURA 1JICA 2NWGA 1GUSA 1PZJD 5DEHA 3IFTA 5BN5A 4G7ZC 1AZQA 1SNPA 1WD1A 3BVMA 5FO9B 3TDQA 1Z6HA 2F3WA 4WRDA 4A3MB 1PTOC 1SMYD 4FVMA 1XTCD 1STHA 4KKTA 3PO2B 3MC0B 4KI0A 2BCOA 1JWUD 4L8JA 3VR5A 1PYWD 1KABA 3RZDB 1ZXTA 2A6HD 3DEOA 2JA7B 1FD7D 2F0OA 2FMMA 1O7YA 4K5VA 2EE1A 4BWGB 4PQXA 1LTID 1V1PB 2F0WA 1LTTD 4IALA 3BZDB 4XT3B 1GJXA 3NWTA 4JK1C 2B2UA 5KYLA 2X69A 2ICEC 2XNAC 2IX3A 1EYAA 3N52A 4NDXA 1LLRD 1TWAB 2HUGA 4R8IA 2F0JA 4ZRZA 3LNNA 3SHLA 1SDFA 1R4QB 5I6WA 2B2WA 4I7ZC 4RCOA 3OWEB 5I2YA 1OXVA 1STYA 4MHEA 4K14A 4OGQC 4O1NA 2K33A 4HEDA 5JPNC 4C56C 1STNA 1W6JA 2Q8TA 3C1EA 1GUNA 1H9MA 2RBMA 4CHTB 1PRTC 1PTOB 1L0YB 1NAPA 1ZYRD 3FMCA 1WCMB 1LACA 4G7OC 2ZXRA 2J4XA 4K2KA 1D2BA 1O7LA 1GUWA 2PZUA 4DAPA 3VR4A 1KLUD 2QEJC 3OMGA 2F0TA 4DFAA 3DHQA 5JEAJ 2HCCA 1QB5D 1BDOA 1IL8A 1RODA 1G8ZD 1HUNA 2AWOA 3GTQB 3OIQA 2EVBA 2L4NA 3R2TA 5A2QL 1HPCA 3ITPA 2WKCA 3S15B 3NBHA 4K2LA 1A2TA 4Q0FA 5M5YB 3VR3A 2F0DA 2EY5A 1IHZA 2F0EA 2M2LA 1ET9A 1DXMA 5M5XB 5KNDA 1CT1D 1SBBB 1F9QA 1LTAD 2F0GA 4ME5A 1B50A 3MA2B 3K6OA 1TS5A 1D1KA 1PRTB 5IGBA 4BBSB 1TWCB 4V190 4C3JB 1BXTA 4QB4A 1H9JA 3SXHA 2WKDA 2NVQB 2D62A 3ND8A 5DM63 1LTBD 4C3HB 1G6ZA 2K03A 4C1NK 4OL7A 3J7AF 5IT9L 3H94A 3OW7A 1YNJC 1F2LA 1O78A 1KLGD 3TP7A 4S3SA 1R9TB 4C2MB 1OXUA 2Z4HA 3CKIB 3T4AC 4FYDA 4NW2A 1C4QA 3GP7A 4IUNA 3U9OA 1H9SB 4CKEA 2ICIA 3L3OC 2QCPX 2VUMB 5A2QE 5K36H 2R92B 5M3MB 1F9PA 1KAAA 3PUWA 1JOOA 1WD0A 4DGZA 4F87A 3V2TA 2ZT9C 1PTOF 1TS3A 3EA6A 2R61A 4QF4A 5DM73 5CMDA 3PV0A 1D5ZC 1OXTA 1IYUA 2B2UC 4IUUA 3K57A 4DF7A 1F77A 3NSWA 1JOQA 1MI2A 3FKIB 1B1ZA 2NTTA 2XRQD 2NUCA 3BDCA 3K58A 3SEBA 4OO1G 5CYUA 3HOYB 2NN6G 1PFBA 4A3IB 2B2WC 3GTMB 4KY7A 3BDLA 4CKBA 3J81L 1SJHD 4KK7A 5J1ZA 1STEA 2KECA 1ENFA 5KNCA 1BCPD 1YNNC 3NP8A 1A15A 2C9OA 1MSGA 2KCCA 1H9KA 2AQ1B 4M8AA 2K04A 1IKMA 5IT9E 4PNYA 4TQUS 1U9RA 2BA0A 1QWYA 1UAPA 5CGKA 1AP0A 3QWNA 4DK0A 1Y8NB 5C3WA 1I50B 2JEAI 1EIHA 2XSCA 2RA4A 3A8IE 1NR4A 2G9DA 1KDBA 3GV3A 2K5QA 3H6MA 2EZVA 2EYHA 5C4HA 3HZXA 3SDZA 1B44D 1PRTF 3F2UA 3EJIA 2X6GA 3SR1A 1Y69U 5A35A 5EPLA 1B3AA 3RD4A 4K5XA 3PIP3 1II3A 4ZKBB 1STGA 3CU7A 1QOHA 2B2TA 1ZEQX 5CBAE 2VNUD 4DXGA 1EOTA 5IODA 1QG7A 2F0PA 5CV4A 2A69C 4C3IG 2PQEA 3GTPB 1VF7A 1F2ZA 3KLSX 3IAYA 5I4DA 1GHJA 2NVYB 5JOBA 3J81E 3D31A 3C1FA 1LT6D 4X3KA 2ZXOA 2JXMB 4RHSA 4U68A 2KUMA 5E4XA 5IGEA 4LK1C 1RD9D 3S2DB 1LT5D 4RGOS 5JVH3 3PUZA 1SJED 5BN3A 1VF5C 3EVQA 4A93B 3LWUA 1A3VA 3I4MB 3A56A 4H44C 2K32A 5CV9A 3J7AV 2YU9B 1I4PA 1FGBD 5C5MA 1SNMA 2JA5B 4XIGS 5COYA 5KEEA 1WTOA 2RVLA 4J8QA 1V43A 3E6ZX 1CZGA 4KKUA 2DNEA 1CA6A 3S2HB 1SNQA 4K6LA 3MHBA 4LMQD 4XYQA 4MN3A 1OXSC 3NHHA 5JPMC 3RLFA 4R8NA 1EWHA 3P1HA 1BUVT 3VR6A 4AYBB 2ZXPA 2KHSA 2R7ZB 2B39A 5I9OA 2K28A 3N6RA 4KKSA 1CZWA 3D3RA 4DAYA 4KJOA 2EYMA 3AU7A 4A3JB 5E3FA 3BVZA 4FF3A 1VCIA 3K5OA 4DU9A 2O2LD 4FXKC 3PUYA 3P7JA 3R2IA 1U4LA 4QCLA 2A6ED 2WIIB 4HR7B 1B2TA 1CQVA 3PUVA 3MAQA 3Q6SA 5T1IA 3TP5A 3I4NB 1ML0D 2Z1CA 3DWAA 2EPBA 3QJYA 2OXPA 2BE5D 3CRKC 2EYLA 3P75A 1BR9A 1S5ED 1UNSA 4EQNA 2OT2A 1LTGD 4IUTA 1NR2A 5EGTA 3NBIA 2AWNA 4ILWA 1E0BA 3TBIB 1S5DD 4N9TA 3R93A 1LTRD 2O4XA 4J6HA 2PCFB 1XWEA 2VB3X 4R9WA 1CHQD 2PZWA 1XX8A 3OWFA 1WVLA 2L55A 2B2TC 1U4MA 5IIFA 1QILA 2FHTA 1SYCA 4IUPA 1EU3A 1EY4A 1NSNS 4HSPA 3DM1A 1V1OA 1I4XA 1DOMA 4BY7B 2B63B 3A55A 4FXDA 1S5BD 2XIWA 2EYFA 1SMYC 4K8IA 1MBYA 2F4IA 1I3QB 2PW7A 5JEAG 4KTAA 2F3VA 1Q3LA 2WINB 2O5JC 1QE6A 2E2IB 3Q22A 1U4PA 1LV9A 1X32A 2G9HD 5FK9C 5KNBA 5DAUA 2Q8IB 1U4RA 1D6EC 1SYBA 3S1MB 2A6HC 2TMPA 5C3XA 1KDCA 3HOUB 2EDGA 5G3LF 3GV6A 3H09A 3DXJC 2JEBI 4FF1A 1ET6A 1JWSD 1Q1BA 4P2CB 2E74C 3KBXA 2EY2A 4A3KB 2EYPA 4WJWA 4RAUC 2K1BA 5EKKA 3H3VC 5C5LA 3OOCA 1CHPD 1EL0A 3QO2A 1ENCA 2OF1A 3QG1A 4H7BA 1AZPA 3VYTA 4Z9CB 3BS1A 1IW7D 1DONA 4E6IA 2NVXB 1GHKA 5F2DA 3A8KE 2SNSA 3MXUA 3MWYW 1DOLA 1EY5A 1EYDA 3NWSA 2VB2X 3DWPA 1O80A 1RF2D 1PFNA 4ZKCB 2NN6H 5C0XH 4B08A 1FNVA 3VA5A 4UDUC 4A3EB 1BBXC 4C3JG 5M9OA 3S14B 3VYSA 5C4XB 1I6HB 1J9OA 4C3HG 3WDNA 2LMCB 4XYOA 3IL8A 3SE0A 2Z4IA 2KCNA 4DXFA 3TSSA 4OIJA 3MEHA 3C46A 5I9PA 5KRUA 1HQMC 2L0CA 5LL6X 2D9UA 4QUCA 4FO2A 4U673 2DNCA 4HTHA 2F0IA 3AMUA 1RHPA 2K5DA 3Q0AA 2MUYA 3R8BA 2V4DA 3DWQA 3BG3A 1BQQT 5ELCA 3AB9A 2AQ3B 2WV6D 4FF2A 1Z7TA 1HUMA 5IGDA 2NZ1D 4QMGA 3MXNA 1RCVD 2IW3A 2RSNA 1DZ1A 3UI2A 3K7AB 1GUGA 2EYJA 3NUCA 1SSOA 2TSSA 4FP5D 5D3IB 4C1NI 1TWGB 4H0LC 3OHXC 5CBEE 4ZAIA 1RTOA 4FF4A 2Y0SB 4KD3A 2PZTA 4B9WA 3QIAA 1R4PB 5C3EB 2WB1B 1SNOA 2NN6I 5C0XI 4PMBA 1AFPA 1PDQA 4L63B 2A74C 3K59A 1EYCA 3HG9A 4IFDH 5D65A 2RKSA 3NE5B 3G6JB 3HOZB 4Q5VA 2F0HA 2Z8LA 5C6AA 1PZKD 4RH6A 3DUZA 3M7GA 5EPJA 1DJRD 4ZLTF 5T1GA 2O5IC 1LT4D 2R3ZA 1ONLA 1DCZA 4ID6A 1QCBD 2A73B 1T5EA 1GOZA 1EY9A 2B8FA 1Y8OB 2IPKD 1WTPA 1CI3M 1HRJA 3X3MA 1MGSA 2E76C 4RA8A 2EJMA 1Q12A 1FR3A 3NQTA 4WORA 4DN4M 3RZOB 3L7ZC 2XN9C 2KEEA 2IWHA 5AFWA 1LTSD 3D4WA 2DN8A 3HGBA 4BA2I 1OO9B 3J80L 1EWCA 4ULLA 3LWEA 3RMHA 2EOTA 5C4ZA 4F88A 1O7ZA 4ZUJA 3TZUA 5EKIA 3WOEA 1IKLA 1BCPC 1GUTA 3H0GB 1B9MA 2KJXA 1SAPA 1HCZA 4BY1B 1ESRA 2BOSA 1C48A 1M8AA 4LJZC 1M4VA 2KOLA 1A6XA 5IGCA 4RGTA 2PMZB 5C0XJ 1ZKOA 1JE4A 2LKVA 4G4KA 3C3LA 2F0LA 4RCNA 1EIGA 2F0QA 5CR3A 2JSOA 3TMEA 4EQOA 1TQOA 2N55A 3HOWB 2F0UA 5D14A 4RGNA 3ONAB 1XYIA 4IFDI 4X3SA 1JC7A 2R6GA 2F0MA 2EYOA 1TWHB 1QNUA 3NPPA 2PNRC 1D1IA 2RDFA 1JQYD 3P20A 5FO8B 5DNFA 1Q1EA 4TKOB 3VA7A 1RTNA 3MXPA 5FKAC 2F0KA 5IOCA 1BF4A 3JAML 4IZ8A 4FNFA 1I4QA 3OSOA 5E4WC 2H1EA 1S5CD 3J80E 2IJ0A 3S9WA 1BCPB 3URYA 2K01A 2XWBB 4XXEA 3D6CA 1K8OA 1PMRA 2XVSA 1ENAA 4YIJA 3HRZC 2H4OA 1WTWA 2PPBC 3SK8A 2FJ2A 1VMCA 1HA5A 4EQPA 1WTRA 5FOBB 1MD2D 2N88A 2EY1A 1HXYD 1PXUA 5LL6S 3NK9A 1STAA 1SYEA 1TY0A 3J7YW 5C44B 4UAIA 3GD7A 3IKJA 3ND9A 2K6AA 3FDTA 1Z47A 4KMUC 2CW0D 3PIO3 1BOSA 1KNAA 3OMCA 2IT1A 1KDAA 4CJ0B 4DAVA 3HOXB 3S16B 5M3FB 3HKZB 1RDPD 2A68D 1NUCA 1IYVA 4IFDJ 3VR2A 4BBRB 3EROA 3I8ZA 2HDLA 3PO3B 3T56B 1B4OA 2EJFC 2Q8RE 3VYUA 3ZYYX 4RWSC 1QJOA 3SK5A 4L6TB 1BO0A 4X3UA 4K5WA 3I3CA 3NQIA 1TVXA 5EBCA 3E0JA 4ZK9B 3JAME 1SNCA 1SXTA 5KIXA 4RKBA 2WAQB 4HMIA 3OPOA 3KLSA 1Q8IA 2M9VA 4TSSA 1TU2B 4I65A 2F03A 4HCEA 4B9XA 1PTOD 1JORA 2MPMA 3D4RA 1DM0B 2L11A 2D2CC 3M4YA 4KV6A 2RSOA 1J8IA 3KUPA 2QDBA 5CV5A 3V96A 3EQLC 5D3DA 4KN7C 3PMFA 3OIPA 3E5SA 4X3TA 3S1RB 3NTKA 3W3AA 4KD4A 3HEJA 4HSVA 3D8GA 4ODGA 1TWFB 3GTOB 1EZ8A 3R3OA 3I4LA 3L9AX 3QOJA 2FINB 1I6VC 2F1MA 2BE5C 2RDGA 3U9SA 4A3GB 1HFNA 4EGVA 3DEPA 1S4ZA 1TS2A 4PMWA 1BCPF 4XTCS 3W2DA 4HN7A 1EEFD 1MSHA 5C4JB 2F0FA 1HQRD 1KNEA 3A7LA 1HA6A 3G7LA 4K8JA 2EJGC 4V0BA 5HGTA 1FNUA 1XXGA 4KN4C 1PFMA 4RFBA 1K83B 3KF8A 2YYZA 3A54A 1PRTD 4J1MA 4O42A 3T51B 5IGGA 3Q24A 4RGMA 4HMJA 3D6WA 2X6LA 2E2HB 1SYGA 4GZYC 4BA1I 5I2XA 5J22A 1KTKA 2GA4B 2PO4A 3HP3A 4ZUIA 3SVMA 5KGUA 4ZYSA 2R93B 3I73A 3BDOA 1HHVA 4KHZA 3HS0C 3QOLA 4IUQA 4OHJA 1ESFA 1Y1VB 3D4DA 2BDOA 1ILPA 4QIWB 2C5CA 4CGYB 5ELEA 5CV6A 3QB3A 4LAAA 5JAVA 3LX0A 2I07B 1G291 1FNWA 1TT2A 2A5HA 4HAEA 4NP5A 4XQQA 4CJ1B 1HFGA 3FPPA 3MTSA 2KA7A 5ELBA 1H9RA 1RJTA 5EKLA 1CM9A 4EVOA 4OO1H 2XRSD 3ERQA 1JB3A 1STBA 1ZYRC 1OXXK 4CKCA 2AUKA 2B2YA 1EY6A 4IURA 2PW5A 1GUOA 3RUZA 2L12A 1DD2A 4KY6A 1SYFA 4F7XA 1VDZA 5ISRA 4ZQ3A 3NTIA 4A3BB 2KQ3A 2CHBD 2MP1A 2K7VA 1IW7C 3GTJB 3V05A 1RKNA 2IX1A 1G2TA 1EY0A 4MIUA 2IX0A 4M1UB 1G2SA 1YNJD 2BDNA 4BS9A 1JWMD 3VYRA 2QKIC 3C2PA 2VXWA 3BVGA 4XQNA 3KLRA 3S17B 1B9NA 1X3QA 2KEDA 2FFKB 2HDMA 2K05A 1I4HA 3A7AB 2AQ2B 4IN3A 3M4OB 4NMZA 2L5TA 1BNZA 4CJ2C 1D5XC 4PMCA 1NCVA 3TZDA 1EZ6A 1HTPA 3BYTB 1SFOB 2F0VA 1Q90A 2JA8B 5CC4A 3GTLB 5ELFA 1B53A 2B2VA 1I4RA 5FO7B 1V8QA 2SNMA 2RDHA 5M5WB 1S5FD 2JE6I 2MJ8A 1AEXA 1E2VA 1GXDC 3FPUB 1HTLD 2PYKA 2ENBA 2E2DC 1SNDA 4OO1I 1DOKA 3DMUA 3H91A 3T13A 4CBVA 2F0SA 3K5LA 1UEAB 4H13C 3GTGB 4DNTB 3KK7A 1JCKB 5EPKA 3GQBA 4TRDA 1YNND 1TR5A 3CQZB 1FYCA 2LFNA 2MGSA 2BA1A 4XT1B 5K5PA 2IL8A 2LY7A 2EY6A 1TIID 1SE2A 1SYDA 1WTXA 1F9RA 2EXZA 3K5NA 3TN2A 2M00A 3BYYB 5C0XG 2NTSA 4DK1A 1SEBD 1V1PA 3K0YA 3MFGA 3K5MA 1A2UA 1CK1A 1WTQA 2CQAA 4DNRB 1A3UA 2CVRA 1PZID 1CA5A 1AW7A 4KJNA 1JR0D 3Q23A 2WACA 2MHVA 3NXWA 3M3YB 3FEWX 2AUJD 2E75C 3TP6A 1SE3A 3GTKB 2ID0A 4N9PA 1G91A 1EEID 2J0TD 2B8GA 2NBFA 3T16A 2A69D 2QF7A 1EU4A 5FLXL 5CORA 2J7ZA 4QUFA 3O13A 2KVMA 4G57A 1SE4A 1PLFA 4OIKA 1C8CA 5E1FA 4IQZA 1Y8PB 3I70A 5ELDA 5IGFA 5G3LD 3MZ5A 1T5XD 5TSSA 2NB0A 5JVG3 2B2YC 1EY8A 3EFXD 4ABNA 2HQEA 3FRPB 5LHY1 3I90A 1LABA 2XWJB 3IFDA 4RKLA 2NYZD 1WTVA 3MXGA 2RQXA 4NKLA 5K36G 1F9SA 1LO5D 1A3TA 5NUCA 1CTMA 5CV7A 1F2MA 4JBWA 2E2JB 5KYIA 1EFID 4Y7NB 4KY5A 4XQJA 4XDXA 3I91A 4A3FB 3NTHA 3PUXA 4WFN3 4C3IB 1ILQA 1L0XB 3S1NB 4IUVA 3MVVA 5JJZA 2JP1A 1F2YA 3TP8A 4IFDG 2WP8J 1TKWB 3SK4A 2DY8A 3I72A 3FVQA 3CHBD 5FLXE 3M85A 1DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDG A;  1ENF A;  1LTB D;  1EU4 A;  5ELF A;  1AN8 A;  1BCP D;  1RD9 D;  1I4R A;  1TS4 A;  2XRS D;  3O13 A;  1TS2 A;  1CQV A;  1PRT C;  1BCP F;  2RDH A;  1D5M C;  1PZJ D;  1SE4 A;  2AQ1 B;  1PTO B;  1S5F D;  1L0Y B;  3W2D A;  1LT5 D;  4RGO S;  1EEF D;  2G9H D;  2Z8L A;  5FK9 C;  1PZK D;  4RGN A;  4RH6 A;  1SJE D;  4DXF A;  1HTL D;  1RDP D;  1HQR D;  4RHR A;  1DJR D;  1D6E C;  5ELD A;  3TSS A;  2J4X A;  1LT4 D;  3DWA A;  1KLG D;  3BVM A;  1FNU A;  1T5X D;  1XXG A;  1JCK B;  1I4P A;  1PTO H;  1PTO C;  1FGB D;  1GOZ A;  5TSS A;  2IPK D;  1S5E D;  4RFB A;  1ET6 A;  4L6T B;  1KLU D;  1UNS A;  2CHB D;  1JWS D;  1JQY D;  1XTC D;  2QEJ C;  1PRT D;  3MC0 B;  1LTG D;  3EFX D;  3GP7 A;  1JWU D;  3V05 A;  1PYW D;  5FKA C;  1B44 D;  1SXT A;  1PRT F;  2ICI A;  4RGM A;  3R8B A;  1I4Q A;  3DWQ A;  1G8Z D;  2XN9 C;  1SE2 A;  4TSS A;  1S5D D;  5ELC A;  1FD7 D;  2AQ3 B;  1LTS D;  1JWM D;  2WV6 D;  1LTR D;  1CHP D;  1UUP A;  1S5C D;  1KTK A;  4K6L A;  2QIL A;  3R2T A;  1LT3 D;  1PTO D;  4BWG B;  3BVG A;  2IJ0 A;  1LTI D;  1BCP B;  1V1P B;  3URY A;  1LTT D;  1RCV D;  1LO5 D;  3BZD B;  3BYY B;  1EWC A;  1PTO F;  4Z9C B;  4ZYS A;  2NTS A;  1TS3 A;  2XNA C;  3EA6 A;  2R61 A;  1CHQ D;  1LLR D;  1SEB D;  1V1P A;  4DXG A;  2TSS A;  1EFI D;  3MFG A;  5D3I B;  1I4G A;  1CK1 A;  4OHJ A;  1D5Z C;  1ESF A;  1ET9 A;  1I4H A;  1F77 A;  2AQ2 B;  1BCP C;  1CT1 D;  3DWP A;  1L0X B;  1SBB B;  1PZI D;  5ELE A;  1RF2 D;  1B1Z A;  1HA5 A;  3OWE B;  4RCO A;  1QIL A;  1AW7 A;  1LTA D;  5D3D A;  2NTT A;  2XRQ D;  3KLS X;  1MD2 D;  2SEB D;  4O1N A;  1FNV A;  1JR0 D;  4UDU C;  3SEB A;  5I4D A;  1EU3 A;  4C56 C;  3BVZ A;  1HXY D;  1V1O A;  1I4X A;  1FNW A;  1TS5 A;  1PRT B;  1D5X C;  1M4V A;  1LT6 D;  1SE3 A;  1TY0 A;  3BYT B;  2O2L D;  4RGT A;  1BXT A;  1EEI D;  1SJH D;  1TY2 A;  3R2I A;  5ELB A;  1S5B D;  3CHB D;  4L63 B;  1STE A;  1DYQ A;  4RHS A; 
#chains in the Genus database with same CATH topology
 1VMP A;  1W6K A;  1AN8 A;  2CH4 W;  1TS4 A;  3CRL C;  5E7N A;  5J39 A;  2D5D A;  3S1M H;  1D5M C;  4FXG C;  3J80 i;  2F0N A;  3HOU H;  3HKZ G;  2B2V C;  1ICW A;  5I6Y A;  2JN4 A;  2L1B A;  4RHR A;  4JI7 L;  4BBR G;  2UUB Q;  2HCI A;  2QW7 A;  3PO3 G;  3HOV B;  4L5Q A;  3T53 B;  2OEO A;  4I7A A;  5JEA H;  1N34 L;  3E9H A;  2B29 A;  1EQT A;  4L5S A;  1PTO H;  1Y1W B;  1VQI A;  1WCM H;  1IL2 A;  1K8M A;  3A8J E;  2JA6 B;  1HZ9 A;  4G7H C;  2LS0 1;  4POF A;  2SOB A;  1XMQ Q;  3X3N A;  1XNR Q;  1E2Z A;  4LFA L;  1UE1 A;  3G6E A;  2WAQ G;  3CCL A;  4KHP L;  2K5W A;  2L9H A;  1H9S A;  3NEM A;  5FJ8 G;  3SK6 A;  1A62 A;  3S1Q B;  5EJW A;  4NPS A;  3WOF A;  1O7I A;  1X3P A;  4X65 Q;  2UXD Q;  4PV1 C;  1UUP A;  4DA2 A;  4F8M A;  2QIL A;  3M7N A;  1E2W A;  1LT3 D;  2CWP A;  2I46 A;  2NVX H;  3RLO A;  2JYO A;  2IHE A;  1CQF A;  3KBG A;  1JOK A;  3RLN A;  1L1O C;  3GO5 A;  1QNK A;  1I4G A;  4KLK A;  4HCS A;  4DV3 Q;  5CV8 A;  2UU9 L;  2CW0 C;  2DY7 A;  4CDF C;  4KHV A;  3CME A;  3S15 H;  1YBY A;  2IHF A;  1VQ4 A;  1X55 A;  4A3E H;  5M5Y H;  3T1H L;  2L15 A;  1EY7 A;  1SRU A;  5BN4 A;  1JMC A;  4A3D B;  3MFY A;  2SEB D;  3A74 A;  3UDF A;  1CFM A;  2QA4 A;  3F2B A;  2FMC A;  3S14 H;  5EQ0 A;  1U5K A;  2A68 C;  5M5X H;  5IYB G;  5EBD A;  2SDF A;  1TY2 A;  1EQV A;  4K6D A;  1EUJ A;  3JAM i;  2NVT B;  1JJG A;  1SLJ A;  2A6E C;  1H95 A;  5HUR A;  4LF8 L;  3CW2 C;  1JIC A;  1VQL A;  2NWG A;  1VQM A;  1GUS A;  4BBS H;  1PZJ D;  1W3S A;  3OYY A;  4YY3 L;  4C3J H;  1NY4 A;  4R4Q A;  3B6Y A;  4GKJ Q;  5DEH A;  1EOV A;  3IFT A;  5BN5 A;  4G7Z C;  4C3H H;  1AZQ A;  1SNP A;  1WD1 A;  3BVM A;  1NTG A;  5FO9 B;  2CKZ B;  3TDQ A;  1Z6H A;  3KLW A;  2F3W A;  2D0O A;  4WRD A;  4A3M B;  1PTO C;  5GAD C;  1SMY D;  4FVM A;  1VQ5 A;  1XTC D;  1STH A;  4KKT A;  3PO2 B;  3MC0 B;  4KI0 A;  4X62 Q;  2BCO A;  1JWU D;  4L8J A;  3VR5 A;  2HHH Q;  4LUO A;  1PYW D;  1NBW A;  1KAB A;  3RZD B;  4C2M H;  1R9T H;  1VQ6 A;  1L1O B;  1ZXT A;  2A6H D;  4DR4 Q;  3DEO A;  2JA7 B;  1FD7 D;  3KJO A;  2F0O A;  2FMM A;  1O7Y A;  4K5V A;  5GAE C;  1MJE A;  1PA6 A;  2EE1 A;  1U0L A;  4BWG B;  4PQX A;  1LTI D;  1V1P B;  2F0W A;  1LTT D;  4IAL A;  3BZD B;  3TEH B;  4XT3 B;  1GJX A;  3CPF A;  3NWT A;  2B2U A;  4JK1 C;  5KYL A;  5EAY A;  2X69 A;  3AEV A;  2R93 G;  2ICE C;  2XNA C;  2IX3 A;  1EYA A;  3N52 A;  2VUM H;  4NDX A;  1LLR D;  1TWA B;  2HUG A;  4R8I A;  2F0J A;  4ZRZ A;  3LNN A;  3SHL A;  1FGU A;  2R92 H;  5M3M H;  1SDF A;  1Y1V G;  4OWW B;  1R4Q B;  3L2P A;  4O2D A;  5I6W A;  2ZJR A;  2B2W A;  4DR5 Q;  4I7Z C;  4RCO A;  3OWE B;  5I2Y A;  3ULJ A;  1OXV A;  1STY A;  3ULP A;  4MHE A;  1HR0 L;  4K14 A;  4OGQ C;  4O1N A;  3W5O A;  2K33 A;  2VW9 A;  4HED A;  5JPN C;  4C56 C;  1STN A;  5LMU L;  2XGT A;  1W6J A;  2Q8T A;  4LW1 A;  2UUA L;  3C1E A;  1S3O A;  1VQ7 A;  1GUN A;  1B3Q A;  2LXK A;  3FKI H;  4BXX H;  1H9M A;  1HZB A;  2RBM A;  4CHT B;  3HOZ H;  2VQF L;  2BH8 A;  2N49 A;  2OQK A;  3HOY H;  3DLL A;  4A3I H;  1M1K C;  3GTM H;  1PRT C;  4JI5 L;  1PTO B;  1L0Y B;  1NAP A;  4K0K L;  1VQD A;  1ZYR D;  4LF9 L;  3I4O A;  3FMC A;  1WCM B;  1LAC A;  4G7O C;  2ZXR A;  1FJG L;  2J4X A;  1N33 L;  4K2K A;  1D2B A;  1D8L A;  4LNQ A;  1O7L A;  1JT8 A;  1GUW A;  2PZU A;  1PH2 A;  4DAP A;  4A3B G;  1XPR A;  4AH6 A;  3VR4 A;  1KLU D;  3L0O A;  2QEJ C;  3RZO H;  3OMG A;  3FHW A;  2F0T A;  2CWA A;  4DFA A;  3DHQ A;  5JEA J;  1I50 H;  4IOA A;  2HCC A;  1QB5 D;  3J7A 5;  5JJI A;  1BDO A;  1IL8 A;  1ROD A;  1G8Z D;  1HUN A;  4IPD A;  2AWO A;  1CSP A;  4JI1 Q;  3GTQ B;  3AQQ A;  3OIQ A;  3PQI A;  2EVB A;  2L4N A;  3R2T A;  5A2Q L;  1HPC A;  3ITP A;  4NXM L;  2WKC A;  3S15 B;  3KF6 B;  3NBH A;  1CKO A;  4K2L A;  1A2T A;  4Q0F A;  5M5Y B;  3VR3 A;  1Q86 C;  5FLM H;  2F0D A;  2EY5 A;  4GKK Q;  1IHZ A;  2F0E A;  2M2L A;  1GVP A;  1ET9 A;  1VQF A;  3CCJ A;  4DV5 Q;  1DXM A;  5M5X B;  5KND A;  1CT1 D;  4BY1 H;  2HT1 A;  1SBB B;  1F9Q A;  1LTA D;  2F0G A;  2OQ0 A;  4ME5 A;  1UE7 A;  1B50 A;  3MA2 B;  3K6O A;  1TS5 A;  1D1K A;  1PRT B;  1Q7Y C;  5IGB A;  4BBS B;  1TWC B;  1KQS A;  4V19 0;  4QY7 A;  4C3J B;  1BXT A;  4DV6 L;  2JA8 G;  4QB4 A;  3GTP H;  1H9J A;  3TRE A;  3AFQ A;  3SXH A;  2WKD A;  2NVQ B;  1KC8 C;  4DR6 L;  2D62 A;  3ND8 A;  5DM6 3;  1LTB D;  1M90 C;  4C3H B;  3HOW H;  1I94 L;  1G6Z A;  2K03 A;  2XTI A;  4MZ9 A;  4A3C G;  1OTC A;  4C1N K;  2D0P A;  5C3E G;  4OL7 A;  3J7A F;  4X64 Q;  1WOC A;  4DV2 Q;  2UXB Q;  5IT9 L;  4DR5 L;  3H94 A;  3OW7 A;  1QZH A;  4X6A H;  1TWH H;  1YNJ C;  1F2L A;  1O78 A;  4JI3 L;  1KLG D;  3TP7 A;  4S3S A;  1R9T B;  4C2M B;  3ULL A;  1OXU A;  2Z4H A;  4PZ7 A;  3S2D H;  1SRO A;  4DR3 Q;  5IYC H;  4AQY Q;  4PZ6 A;  4H02 A;  3G4S A;  3CKI B;  3T4A C;  4FYD A;  4HIM A;  4NW2 A;  4A93 H;  2AHO B;  4ZCK A;  1SMX A;  1C4Q A;  3GP7 A;  4IUN A;  3U9O A;  1H9S B;  4CKE A;  2I0Q A;  3ICE A;  2A1A A;  2ICI A;  1XMO Q;  3L3O C;  3J80 c;  1N36 Q;  1K0S A;  2QCP X;  3UE1 A;  1X65 A;  2VUM B;  4JYA Q;  3K0X A;  5A2Q E;  2JA5 H;  5K36 H;  2R92 B;  5M3M B;  1F9P A;  1KAA A;  4WJ4 A;  3PUW A;  1JOO A;  3RN5 A;  1WD0 A;  4DGZ A;  3UDG A;  4F87 A;  3V2T A;  2ZT9 C;  5FLX c;  1PTO F;  3ZJY C;  1J6Q A;  1TS3 A;  2I5H A;  3EA6 A;  2R61 A;  4QF4 A;  4FDB A;  5DM7 3;  2F4V L;  5CMD A;  3PV0 A;  4JI6 L;  1D5Z C;  1OXT A;  1IYU A;  2B2U C;  4IUU A;  3K57 A;  3PF4 A;  4DF7 A;  1F77 A;  3NSW A;  1JOQ A;  1MI2 A;  1VQJ A;  1KIX A;  3FKI B;  1B1Z A;  2NTT A;  2XRQ D;  2NUC A;  3BDC A;  3K58 A;  3SEB A;  1EYG A;  1LM0 A;  5CYU A;  3BJU A;  4OO1 G;  3HOY B;  2NN6 G;  1PFB A;  4A3I B;  2B2W C;  2R7Z H;  3GTM B;  4B3T Q;  4IOC A;  4JI1 L;  1SE8 A;  4KY7 A;  3BDL A;  4CKB A;  4IO9 A;  3J81 L;  1SJH D;  4KK7 A;  1QUQ B;  5J1Z A;  1STE A;  4DR1 Q;  2KEC A;  1ENF A;  4A3J H;  3H0G G;  1BCP D;  1YNN C;  3NP8 A;  5KNC A;  2RCN A;  1A15 A;  2C9O A;  1MSG A;  1N8R C;  3FP9 A;  4HIK A;  2KCC A;  2B3G A;  4OWX B;  1H9K A;  2AQ1 B;  4M8A A;  2K04 A;  1IKM A;  5IT9 E;  2CFM A;  4APV A;  4BBR H;  4PNY A;  4TQU S;  3PO3 H;  1U9R A;  3IRB A;  2BA0 A;  1QWY A;  1UAP A;  4R1J A;  5CGK A;  1AP0 A;  3QWN A;  4DK0 A;  4LFB L;  1Q8K A;  1Y8N B;  3CC4 A;  5C3W A;  1I50 B;  4DUZ L;  2JEA I;  1EIH A;  4LF6 L;  2XSC A;  2RA4 A;  1PYS B;  2ZM6 Q;  1IBM Q;  3A8I E;  3JAM c;  2ATW A;  5GQO A;  1NR4 A;  2G9D A;  1KDB A;  3GV3 A;  2K5Q A;  3H6M A;  2EZV A;  2EYH A;  3I4N H;  5C4H A;  3CCV A;  3HZX A;  3SDZ A;  4NB3 A;  5FJ8 H;  1B44 D;  1PRT F;  3STB D;  1NMF A;  3F2U A;  3EJI A;  2X6G A;  3SR1 A;  1Y69 U;  5A35 A;  5EPL A;  1B3A A;  1XTD A;  5BR8 L;  2ALY B;  5GAH C;  1WYD A;  3RD4 A;  1G51 A;  4K5X A;  4GOP A;  3PIP 3;  1II3 A;  4ZKB B;  1XNQ L;  1STG A;  4UP9 A;  3CU7 A;  4DV4 L;  1QOH A;  2B2T A;  1ZEQ X;  5CBA E;  2VNU D;  4DXG A;  2GVA A;  1XPO A;  4R4C A;  4LF5 Q;  1EOT A;  5IOD A;  1QG7 A;  2F0P A;  4A3F G;  5CV4 A;  3D0F A;  4GNX C;  2A69 C;  3CXC A;  1YJW A;  4C3I G;  3S1R H;  2QEX A;  2PQE A;  3GTP B;  1VF7 A;  2JA9 A;  4ALP A;  1F2Z A;  3KLS X;  3IAY A;  4YHH Q;  5I4D A;  4AYB E;  1GHJ A;  4JI0 L;  4GLX A;  2NVY B;  5JOB A;  3J81 E;  2Z6K C;  4PG3 A;  3D31 A;  3C1F A;  2JQO A;  1EFW A;  4NXN Q;  1LT6 D;  4X3K A;  2Q2T A;  4TVA B;  1PHJ A;  3W1B A;  4DR2 L;  4LF4 Q;  2ZXO A;  1VS0 A;  2JXM B;  2RHQ B;  1VQO A;  4RHS A;  1IBK Q;  4U68 A;  2KUM A;  5E4X A;  5IGE A;  4LK1 C;  1RD9 D;  1X9N A;  3JC6 6;  3EIV A;  4JOI A;  2YTV A;  2YTY A;  2ES2 A;  4BY7 H;  2B63 H;  3S2D B;  4OX9 Q;  1LT5 D;  4RGO S;  5JVH 3;  2Z9H A;  3PUZ A;  3PIO A;  1SJE D;  5BN3 A;  1VF5 C;  3EVQ A;  4A93 B;  2ZTC A;  3HOV G;  3LWU A;  3J81 i;  1A3V A;  3I4M B;  3A56 A;  1I3Q H;  3CAM A;  4H44 C;  1L2F A;  2K32 A;  5CV9 A;  2E2I H;  3J7A V;  2YU9 B;  1I4P A;  3KDF A;  1FGB D;  3OTO Q;  4B3T L;  1Y1W G;  4B3R Q;  5C5M A;  2JA6 G;  1SNM A;  2JA5 B;  4XIG S;  3HOX G;  5COY A;  5KEE A;  5M3F G;  1WTO A;  4QGU A;  2RVL A;  4J8Q A;  1UE5 A;  1S40 A;  1J5E L;  1V43 A;  4HIO A;  3E6Z X;  1MIU A;  2VL6 A;  1IBL Q;  1CZG A;  4JBM A;  4KKU A;  2DNE A;  1CKN B;  4OON A;  4DR7 Q;  1CA6 A;  3S2H B;  1SNQ A;  4K6L A;  4P74 A;  1YI2 A;  4QJF A;  4GNX B;  3MHB A;  4LMQ D;  4XYQ A;  4MN3 A;  4CDD C;  1OXS C;  3NHH A;  3SGI A;  4A3K H;  5JPM C;  3RLF A;  4R8N A;  1EWH A;  3P1H A;  1BUV T;  3KOJ A;  3VR6 A;  2K75 A;  1IBM L;  4AYB B;  1QVF A;  2ZXP A;  2KHS A;  2R7Z B;  1GD7 A;  2B39 A;  5I9O A;  2K28 A;  3N6R A;  3RNU A;  4KKS A;  1CZW A;  4DV1 Q;  3D3R A;  4DAY A;  3U4Z A;  4KJO A;  4A3D G;  2KBN A;  3U58 A;  2EYM A;  2HIV A;  3AU7 A;  1Z9F A;  4LUV A;  5IP7 H;  4A3J B;  5E3F A;  2DGY A;  3BVZ A;  4JI2 L;  3PSI A;  4X66 L;  4FF3 A;  1UE6 A;  2Q2I A;  1VCI A;  4JI8 Q;  2FXQ A;  3K5O A;  4DU9 A;  2O2L D;  4FXK C;  3PUY A;  3P7J A;  3R2I A;  1U4L A;  1VQ8 A;  4QCL A;  4DPG A;  3W1G A;  1ASY A;  2A6E D;  2WII B;  4HR7 B;  3CC7 A;  1AH9 A;  3CPW A;  4DV0 Q;  1B2T A;  1CQV A;  3PUV A;  4IJH A;  1B70 B;  3MAQ A;  3Q6S A;  5T1I A;  3TP5 A;  5C4X H;  1I6H H;  3E9I A;  3I4N B;  1ML0 D;  3TS2 A;  2Z1C A;  1KD1 C;  3DWA A;  4A3B H;  2R7F A;  4UP7 A;  2EPB A;  3QJY A;  2OXP A;  3MEF A;  4A3G G;  4A3M G;  2BE5 D;  1XPU A;  3GTJ H;  3CRK C;  2E5L L;  4R4I A;  2EYL A;  3P75 A;  1BR9 A;  1S5E D;  3BZK A;  1UNS A;  4EQN A;  4UPA A;  2OT2 A;  1LTG D;  2PNH A;  4IUT A;  3UDI A;  1NR2 A;  4A3L G;  5EGT A;  3K7U C;  3NBI A;  2AWN A;  4ILW A;  1E0B A;  3I55 A;  1K3R A;  2JA7 G;  3H3V H;  3TBI B;  1S5D D;  4N9T A;  1JB7 A;  3R93 A;  4JBK A;  1LTR D;  1YJN A;  4Y52 H;  2O4X A;  3K8A A;  4J6H A;  2PCF B;  1XWE A;  2VB3 X;  4R9W A;  1YNX A;  1CHQ D;  2PZW A;  3KFU A;  1DGS A;  1XX8 A;  1EIF A;  3OWF A;  4GOP C;  1E24 A;  2KCT A;  4DV7 Q;  1WVL A;  2L55 A;  2B2T C;  5DLQ E;  1U4M A;  5IIF A;  1HZC A;  1X3G A;  1KAW A;  1FVI A;  4AIM A;  1CKM A;  3K7A H;  4GN3 B;  1QIL A;  2FHT A;  1SYC A;  4IUP A;  4IPH A;  1EU3 A;  1EY4 A;  1NSN S;  3DM1 A;  4HSP A;  2UUB L;  1V1O A;  1I4X A;  2JA8 H;  1DOM A;  3TRZ A;  4DUY Q;  4BY7 B;  2B63 B;  3GTL H;  1TWG H;  3A55 A;  2ZTE A;  4FXD A;  2OTJ A;  1K0R A;  1QZG A;  1S5B D;  5LMN W;  1HNX Q;  2XIW A;  2EYF A;  1SMY C;  4K8I A;  1MBY A;  1XMQ L;  2F4I A;  1I3Q B;  2PW7 A;  5JEA G;  1XNR L;  4KTA A;  2F3V A;  5C3E H;  1Q3L A;  2WIN B;  2O5J C;  1QE6 A;  2E2I B;  3Q22 A;  1U4P A;  2PQA A;  1LV9 A;  4R4O A;  1VQA A;  1X32 A;  2G9H D;  1WCM G;  5FK9 C;  5KNB A;  5DAU A;  5GRO A;  2Q8I B;  1U4R A;  1NNX A;  1D6E C;  4JOI C;  1YHB A;  4X65 L;  1SYB A;  3S1M B;  2UXD L;  2A6H C;  2TMP A;  5C3X A;  1KDC A;  3HOU B;  2EDG A;  2KHJ A;  3CQZ H;  4N8F A;  5G3L F;  2CCZ A;  3GV6 A;  3H09 A;  3DXJ C;  4OEM B;  2JEB I;  4FF1 A;  3K81 C;  1ET6 A;  3PCO B;  4UHV A;  1JWS D;  1Q1B A;  4P2C B;  1KL9 A;  4PZ8 A;  1VQB A;  4DV3 L;  2E74 C;  3WWV A;  3KBX A;  2Z6B A;  2EY2 A;  4A3K B;  2EYP A;  4WJW A;  4RAU C;  3OW2 A;  2K1B A;  3M4Q A;  4HJ8 A;  5EKK A;  1BVS A;  3H3V C;  1IZ6 A;  4GOP B;  5C5L A;  1GO3 E;  3OOC A;  1CHP D;  1EL0 A;  4MTK A;  1K8G A;  3QO2 A;  1ENC A;  2OF1 A;  3QG1 A;  4H7B A;  1PV4 A;  1PH3 A;  4JI4 Q;  1AZP A;  3H3V I;  2MFI A;  3VYT A;  4Z9C B;  3BS1 A;  1IW7 D;  3ER0 A;  3KYH C;  4E6I A;  2NVX B;  1DON A;  1GHK A;  5F2D A;  5ELO A;  3A8K E;  1EQR A;  1P16 A;  2SNS A;  3MXU A;  1PH5 A;  2QDL A;  3MWY W;  1DOL A;  1EY5 A;  1EYD A;  3CC2 A;  1K73 C;  3NWS A;  5IT9 c;  2VB2 X;  3DWP A;  1YHA A;  4JVZ A;  1O80 A;  1RF2 D;  4GKJ L;  1PFN A;  4YCW A;  4ZKC B;  2NN6 H;  2E8G A;  5C0X H;  2NZH A;  4B08 A;  1FNV A;  3VA5 A;  4UDU C;  3I7F A;  4JC0 A;  4JCV E;  5GAG C;  4JV5 Q;  4A3E B;  4BBS G;  1BBX C;  4C3J G;  4UP8 A;  1VQK A;  5M9O A;  3S14 B;  3VYS A;  3H0G H;  5C4X B;  2ZJP A;  1I6H B;  5LMN Q;  1J9O A;  2Y0S E;  4C3H G;  2PI2 A;  2UUC Q;  4X62 L;  2V1C C;  3WDN A;  1B7Y B;  2LMC B;  2VY3 A;  2HHH L;  4XYO A;  3T1Y Q;  2WB1 E;  3IL8 A;  2UXC Q;  3SE0 A;  4A76 A;  1KHI A;  2Z4I A;  3NEN A;  2ASB A;  2KCN A;  4DXF A;  4DR4 L;  3TSS A;  4OIJ A;  3MEH A;  3KDF B;  3C46 A;  1WFQ A;  4UY8 C;  4HJ5 A;  5I9P A;  5KRU A;  1HQM C;  1N9W A;  2L0C A;  5LL6 X;  2D9U A;  4QUC A;  2H5X A;  4FO2 A;  2DUD A;  3G48 A;  3G71 A;  2F3I A;  4LF7 Q;  4U67 3;  2DNC A;  4HTH A;  2F0I A;  3AMU A;  1YZ6 A;  2P5Z X;  1RHP A;  1K8A C;  2K5D A;  3Q0A A;  2MUY A;  3R8B A;  2K14 A;  2V4D A;  3DWQ A;  4LFC Q;  3BG3 A;  1BQQ T;  5ELC A;  3AB9 A;  2AQ3 B;  5M3M G;  2WV6 D;  1PH7 A;  3J81 c;  4FF2 A;  1Z7T A;  1HUM A;  5IGD A;  2VQE Q;  2NZ1 D;  3QR8 A;  1QVG A;  4QMG A;  3MXN A;  1RCV D;  4IPC A;  2IW3 A;  2RSN A;  4GN4 B;  1DZ1 A;  3UI2 A;  1XJV A;  3K7A B;  3RN2 A;  1GUG A;  2EYJ A;  3NUC A;  4A3F H;  5IWA Q;  1SSO A;  1VQE A;  2TSS A;  4FP5 D;  5D3I B;  4C1N I;  1TWG B;  1VQG A;  4H0L C;  1G6P A;  3OHX C;  3FKI G;  1MJC A;  5CBE E;  4ZAI A;  1RTO A;  5AJ3 Q;  4FF4 A;  2EIF A;  2Y0S B;  4KD3 A;  2PZT A;  4B9W A;  2K5V A;  4A3I G;  3QIA A;  1R4P B;  5C3E B;  3VDY A;  1PH8 A;  2WB1 B;  1SNO A;  2NN6 I;  5C0X I;  1PFS A;  3I2Z A;  4PMB A;  1SN8 A;  1AFP A;  1N32 Q;  1PDQ A;  3CCE A;  4L63 B;  2A74 C;  3LGJ A;  1K28 A;  3K59 A;  1EYC A;  3HG9 A;  4IFD H;  2K4K A;  5D65 A;  2MQH A;  2RKS A;  3NE5 B;  3G6J B;  3HOZ B;  5C44 H;  4Q5V A;  2PMZ E;  2F0H A;  2Z8L A;  5C6A A;  1PZK D;  4RH6 A;  3DUZ A;  3M7G A;  5EPJ A;  3CP0 A;  1DJR D;  4ZLT F;  5T1G A;  2O5I C;  4B3M Q;  1LT4 D;  2R3Z A;  5HGQ A;  4OXP A;  1ONL A;  1DCZ A;  2JA6 H;  4ID6 A;  4YCU A;  1QCB D;  2A73 B;  1T5E A;  1GOZ A;  1EY9 A;  3HOX H;  3S16 H;  5M3F H;  2B8F A;  1Y8O B;  2IPK D;  1WTP A;  1CI3 M;  1HRJ A;  3X3M A;  4GKK L;  3PF5 A;  1MGS A;  2E76 C;  4RA8 A;  4LWC A;  1UEB A;  2EJM A;  5LMN L;  1Q12 A;  4DV5 L;  1FR3 A;  3NQT A;  4WOR A;  4DN4 M;  5J3B A;  3RZO B;  3PIP A;  3L7Z C;  2XN9 C;  2UXC L;  2KEE A;  1YJ9 A;  2IWH A;  5AFW A;  1LTS D;  2LXJ A;  2G5D A;  3D4W A;  4JPB W;  3TQY A;  2DN8 A;  3HGB A;  4BA2 I;  1OO9 B;  1NE3 A;  3J80 L;  1N34 Q;  3CCU A;  3CD6 A;  1EWC A;  3J7Z C;  1UWV A;  4ULL A;  3LWE A;  3RMH A;  1WTH A;  2EOT A;  5C4Z A;  1JE5 A;  4F88 A;  2K5H A;  1O7Z A;  4ZUJ A;  3TZU A;  5EKI A;  3WOE A;  1IKL A;  1BCP C;  1GUT A;  4KHP Q;  4RMF A;  3H0G B;  1B9M A;  4J15 A;  2N78 A;  4X64 L;  2KJX A;  4DK3 C;  1SAP A;  4DV2 L;  2UXB L;  1HCZ A;  3CCS A;  4BY1 B;  1ESR A;  2KEN A;  2BOS A;  1C48 A;  1M8A A;  1E7Z A;  1Y14 B;  4LJZ C;  1M4V A;  2KOL A;  1X54 A;  1A6X A;  3AYH B;  5IGC A;  4RGT A;  2PMZ B;  4DR3 L;  4AQY L;  5C0X J;  3EBE A;  1ZKO A;  1JE4 A;  2LKV A;  4G4K A;  3C3L A;  2F0L A;  3F2C A;  4RCN A;  2PQA B;  1EIG A;  1TWF H;  3GTO H;  2F0Q A;  5CR3 A;  1XMO L;  2UU9 Q;  2JSO A;  5IYC G;  1N36 L;  3TME A;  4EQO A;  1TQO A;  2N55 A;  3HOW B;  2F0U A;  5IYB H;  5D14 A;  4JYA L;  4RGN A;  3STB C;  3ONA B;  1XYI A;  1HR0 W;  3CMA A;  4QL5 A;  4IFD I;  4A3G H;  3I4M G;  4X3S A;  1JC7 A;  1HJP A;  2R6G A;  4A4I A;  2F0M A;  2EYO A;  5C4J H;  1TWH B;  1V9P A;  1QNU A;  3NPP A;  2DJG C;  2JA5 G;  4A3L H;  3HKZ E;  3A0J A;  2JJQ A;  2PNR C;  1D1I A;  3H15 A;  2RDF A;  1JQY D;  3P20 A;  5FO8 B;  5DNF A;  1Q1E A;  4TKO B;  3VA7 A;  1RTN A;  3MXP A;  4LF8 Q;  3KF6 A;  5FKA C;  2F0K A;  5IOC A;  1FL0 A;  1BF4 A;  3HKS A;  4YY3 Q;  1C7Y A;  3JAM L;  4IZ8 A;  4FNF A;  1I4Q A;  3OSO A;  5E4W C;  1K83 H;  3NEL A;  2H1E A;  1S5C D;  3J80 E;  1IXR A;  4DNI A;  2IJ0 A;  2F52 A;  3S9W A;  4QQB X;  1BCP B;  3URY A;  2K01 A;  2XWB B;  4XXE A;  2WAQ E;  3D6C A;  3F1Z A;  1K8O A;  1PMR A;  2XVS A;  1ENA A;  4YIJ A;  2E2H H;  4DR1 L;  4AYB G;  3HRZ C;  2H4O A;  1WTW A;  2Q2H A;  1E22 A;  2PPB C;  3SK8 A;  3E0E A;  1HNZ Q;  3U4V A;  2FJ2 A;  4DKA C;  1VMC A;  3NBH B;  1HA5 A;  4EQP A;  1WTR A;  2R93 H;  3ERS X;  5FOB B;  4A3J G;  1MD2 D;  2N88 A;  2EY1 A;  4RG1 A;  1HXY D;  4N8X 1;  1GKH A;  1PXU A;  1PH1 A;  5LL6 S;  3NK9 A;  1RIP A;  1Y1V H;  1STA A;  1SYE A;  1TY0 A;  2ZM6 L;  1RL2 A;  3J7Y W;  5C44 B;  1VQH A;  4UAI A;  2DJF C;  3GD7 A;  3IKJ A;  3ND9 A;  1JJ2 A;  2K6A A;  3FDT A;  1Z47 A;  4KMU C;  2CW0 D;  2K50 A;  3PIO 3;  1CUK A;  1BOS A;  1KNA A;  4OWT B;  3OMC A;  1PH6 A;  2IT1 A;  1KDA A;  4CJ0 B;  4DAV A;  3HOX B;  3S16 B;  5M3F B;  4HJ7 A;  3HKZ B;  3I4N G;  1RDP D;  1HR0 Q;  2A68 D;  1NUC A;  1IYV A;  1MHW C;  4CDE C;  4JBJ A;  1YIJ A;  4IFD J;  3VR2 A;  5LMU Q;  4BBR B;  4YWM A;  3ERO A;  3I8Z A;  2HDL A;  3PO3 B;  3T56 B;  1B4O A;  2EJF C;  2UUA Q;  2Q8R E;  3VYU A;  2OWO A;  3ZYY X;  1Q82 C;  4RWS C;  1PYB A;  1QJO A;  5H1S E;  3SK5 A;  4L6T B;  1BO0 A;  4X3U A;  4K5W A;  4LF5 L;  3I3C A;  3NQI A;  2VQF Q;  1TVX A;  1Q81 C;  5EBC A;  3E0J A;  4ZK9 B;  3JAM E;  1SNC A;  1SXT A;  5KIX A;  4RKB A;  1YHQ A;  3GTQ H;  1YIT A;  2WAQ B;  4HMI A;  4JI5 Q;  3OPO A;  3KLS A;  1A8V A;  1Q8I A;  2M9V A;  4K0K Q;  2RF4 A;  4LF9 Q;  4TSS A;  1TU2 B;  4I65 A;  4YHH L;  3MXN B;  1C0A A;  2F03 A;  1FJG Q;  4HCE A;  1N33 Q;  4HJA A;  2A8V A;  4B9X A;  1PTO D;  1JOR A;  2MPM A;  3D4R A;  4NXN L;  1DM0 B;  2L11 A;  3PO2 G;  2D2C C;  4LF4 L;  3M4Y A;  1IBK L;  3Q8D A;  5IP9 G;  1K9M C;  4KV6 A;  5IYD G;  2RSO A;  1J8I A;  2RCF A;  3KUP A;  2QDB A;  5CV5 A;  4OX9 L;  3V96 A;  2Q2U A;  3S17 H;  2VS1 A;  1QUQ A;  3EQL C;  5D3D A;  4KN7 C;  3PMF A;  3OIP A;  1TWC H;  3E5S A;  4X3T A;  3S1R B;  3NTK A;  1ICF B;  3W3A A;  4KD4 A;  3HEJ A;  4HSV A;  4B3S Q;  3D8G A;  4ODG A;  1TWF B;  3A5U A;  2NVQ H;  3GTO B;  2B63 G;  4BY7 G;  4R4T A;  4NXM Q;  1EZ8 A;  3R3O A;  2ZJQ A;  4IJL A;  4QIW E;  2IY5 B;  3I4L A;  3OTO L;  5JJL A;  4B3R L;  3L9A X;  3QOJ A;  2FIN B;  3M4O H;  1I6V C;  2F1M A;  2BE5 C;  2RDG A;  3U9S A;  4A3G B;  2CH4 A;  4EGV A;  1HFN A;  2I5M X;  3DEP A;  2HIX A;  1S4Z A;  2N3S A;  1TS2 A;  1JJC B;  4HID A;  1EIY B;  4PMW A;  1CSQ A;  3M4P A;  1HZA A;  1BCP F;  2WFW A;  2GN5 A;  1SFO H;  4XTC S;  3W2D A;  4HN7 A;  1EEF D;  1MSH A;  5C4J B;  1HNZ L;  1IBL L;  2F0F A;  5ELN A;  4DR7 L;  1HQR D;  1KNE A;  3A7L A;  4P73 A;  1HA6 A;  3G7L A;  3HOU G;  1BKB A;  3F2D A;  1HNW Q;  4K8J A;  4GLA C;  2EJG C;  4DK6 C;  4V0B A;  5HGT A;  1FNU A;  4DAM A;  1XXG A;  4KN4 C;  4A3C H;  5M5W H;  4DV6 Q;  2BH2 A;  1PFM A;  4L5T A;  4RFB A;  1K83 B;  3KF8 A;  2YYZ A;  3A54 A;  3TS0 A;  4DR6 Q;  1PRT D;  4J1M A;  4O42 A;  3RR5 A;  3T51 B;  5IGG A;  1I94 Q;  1S72 A;  2AMC B;  3Q24 A;  3GTG H;  4A3K G;  1HH2 P;  4RGM A;  4DV1 L;  1P8L A;  2HD3 A;  2K52 A;  4HMJ A;  3D6W A;  2X6L A;  2E2H B;  2Z0S A;  3DM3 A;  1SYG A;  2EXD A;  4GZY C;  4BA1 I;  1IYJ B;  5I2X A;  1KTK A;  5J22 A;  1L0W A;  1T9H A;  4GN5 A;  4JI8 L;  4JI3 Q;  4GLV B;  1MKH A;  2GA4 B;  2PO4 A;  1VQP A;  3HP3 A;  4ZUI A;  3SVM A;  5KGU A;  4ZYS A;  1I5F A;  2R93 B;  3I73 A;  5IP7 G;  3BDO A;  1HHV A;  4KHZ A;  3HS0 C;  5JJK A;  3QOL A;  2MO0 A;  4IUQ A;  4OHJ A;  4YWK A;  4DV0 L;  1ESF A;  1Y1V B;  5HY6 A;  3D4D A;  2BDO A;  1ILP A;  4QIW B;  2C5C A;  4CGY B;  5ELE A;  5CV6 A;  3QB3 A;  4LUZ A;  4LAA A;  5JAV A;  3LX0 A;  2I07 B;  1G29 1;  2GVB A;  4A3E G;  1FNW A;  1TT2 A;  2A5H A;  4HAE A;  4YCV A;  4NP5 A;  4XQQ A;  3U50 C;  4CJ1 B;  1HFG A;  3FPP A;  3MTS A;  2KA7 A;  1X56 A;  5C4X G;  5ELB A;  1H9R A;  1RJT A;  5EKL A;  1CM9 A;  4EVO A;  2F4V Q;  4OEL B;  3M3Y H;  4IPG A;  4JI6 Q;  2LSS A;  4OO1 H;  2XRS D;  3ERQ A;  1JB3 A;  3GTK H;  1STB A;  1ZYR C;  3BU2 A;  2OTL A;  1OXX K;  1VQ9 A;  4CKC A;  3AFP A;  2AUK A;  1W2B A;  2B2Y A;  1EY6 A;  4IUR A;  2PW5 A;  1GUO A;  3RUZ A;  2L12 A;  3CCR A;  4B3S L;  1PH9 A;  1DD2 A;  4KY6 A;  2NZO A;  1SYF A;  4F7X A;  1VDZ A;  1EWI A;  5ISR A;  4ZQ3 A;  3NTI A;  1CKN A;  4A3B B;  2KQ3 A;  2C35 B;  2CHB D;  1LUZ A;  2MP1 A;  2K7V A;  3UE0 A;  1IW7 C;  4GNX A;  4DV7 L;  3GTJ B;  3V05 A;  1RKN A;  2IX1 A;  4YWL A;  1G2T A;  1EY0 A;  4MIU A;  2VZA A;  2IX0 A;  4M1U B;  1G2S A;  1YNJ D;  1TXY A;  1V1Q A;  1WI5 A;  2BDN A;  1PH4 A;  4BS9 A;  3F8T A;  1JWM D;  3VYR A;  2Z6K A;  2QKI C;  3C2P A;  4LFB Q;  4DUY L;  2VXW A;  2RHS B;  3BVG A;  4DUZ Q;  4XQN A;  3KLR A;  4LF6 Q;  1NMG A;  3S17 B;  1HNW L;  1B9N A;  2K5N A;  1X3Q A;  1HNX L;  3HFZ B;  4MNO A;  2KED A;  2YTX A;  4P75 A;  2VUM G;  2FFK B;  2HDM A;  2K05 A;  1I4H A;  3A7A B;  2AQ2 B;  4IN3 A;  2R92 G;  2NVY H;  4GS3 A;  4EX5 A;  5IE8 A;  3M4O B;  4NMZ A;  2Y0S G;  2L5T A;  2E2J H;  2KCM A;  2R7D A;  4Y7N H;  3KJP A;  2WB1 G;  5BR8 Q;  1BNZ A;  4CJ2 C;  1D5X C;  4PMC A;  1NCV A;  3TZD A;  1PVO A;  1EZ6 A;  1HTP A;  3BYT B;  1YVC A;  2KHI A;  1SFO B;  1XNQ Q;  2F0V A;  1Q90 A;  3I56 A;  4WJ3 M;  4C3I H;  1LYL A;  4DV4 Q;  2JA8 B;  3S1N H;  4DAY B;  5CC4 A;  3GTL B;  2I5L X;  5ELF A;  1B53 A;  3EN2 A;  2B2V A;  4BXX G;  1I4R A;  5FO7 B;  1V8Q A;  2SNM A;  3HOZ G;  2RDH A;  2MNA A;  5M5W B;  1EQQ A;  1S5F D;  2JE6 I;  3HOY G;  3I4M H;  2MJ8 A;  1AEX A;  1E2V A;  1GXD C;  3FPU B;  1HTL D;  2PYK A;  2ENB A;  2E2D C;  1SND A;  4OO1 I;  1DOK A;  3DMU A;  3H91 A;  3T13 A;  4CBV A;  2YU9 H;  4JI0 Q;  1A63 A;  2F0S A;  3K5L A;  1UEA B;  2JK8 A;  4H13 C;  3GTG B;  4DNT B;  4JI4 L;  3KK7 A;  1QVC A;  1JCK B;  1AE2 A;  4DR2 Q;  5EPK A;  3GQB A;  4TRD A;  1YNN D;  1TR5 A;  3CQZ B;  5L37 A;  1FYC A;  2LFN A;  2MGS A;  2BA1 A;  4XT1 B;  5K5P A;  3CF5 A;  3HOV H;  2IL8 A;  2LY7 A;  3GDE A;  1VQC A;  2EY6 A;  1E1O A;  1X3F A;  3S2H H;  1TII D;  1SE2 A;  1Y1W H;  1SYD A;  1WTX A;  1F9R A;  1L1O A;  4JV5 L;  1A0I A;  2EXZ A;  2A19 A;  1BBW A;  1E1T A;  3K5N A;  3PGZ A;  3TN2 A;  2M00 A;  3BYY B;  5IY0 A;  5C0X G;  2NTS A;  4DK1 A;  1SEB D;  1E3P A;  1V1P A;  4L5R C;  3S1Q H;  3K0Y A;  3MFG A;  3K5M A;  1A2U A;  1CK1 A;  2UUC L;  1WTQ A;  3T1Y L;  5FLM G;  2CQA A;  4DNR B;  2MO1 A;  1A3U A;  2CVR A;  1J5E Q;  4JI7 Q;  2OCE A;  1PZI D;  1CA5 A;  1ASZ A;  1AW7 A;  4KJN A;  3CCQ A;  1YEZ A;  4BY1 G;  1JR0 D;  3Q23 A;  2WAC A;  4ME3 A;  2MHV A;  3NXW A;  3M3Y B;  3FEW X;  2AUJ D;  2E75 C;  3TP6 A;  1SE3 A;  3GTK B;  2ID0 A;  4N9P A;  1G91 A;  1EEI D;  2J0T D;  2B8G A;  3CCM A;  4P71 A;  2NBF A;  3T16 A;  4LF7 L;  4LFA Q;  4A3D H;  2A69 D;  1X3E A;  2QF7 A;  1EU4 A;  5FLX L;  5COR A;  2J7Z A;  1SR3 A;  4O0A A;  4QUF A;  3O13 A;  2KVM A;  4G57 A;  1NJI C;  1SE4 A;  3HOW G;  4LFC L;  4MTN A;  1PLF A;  4OIK A;  3K80 C;  1C8C A;  5E1F A;  4IQZ A;  2NVT H;  4JW0 A;  1Y8P B;  3I70 A;  5ELD A;  5IGF A;  5G3L D;  2QGQ A;  1K3B C;  3J81 j;  2VQE L;  4P72 A;  1GM5 A;  4JI2 Q;  4X66 Q;  3MZ5 A;  1T5X D;  3KF8 B;  4EQ5 A;  1AE3 A;  5TSS A;  5IWA L;  2NB0 A;  4HJ9 A;  5JVG 3;  1D7Q A;  2B2Y C;  1VQN A;  1EY8 A;  1BBU A;  3EFX D;  4ABN A;  2PI2 E;  3UDX A;  2HQE A;  3T1H Q;  4A93 G;  3FRP B;  5LHY 1;  3E3X A;  4A75 A;  3I90 A;  1LAB A;  4A3M H;  1LTL A;  2XWJ B;  3IFD A;  2N8N A;  4RKL A;  5AJ3 L;  2NYZ D;  4POG A;  3PO2 H;  2CQO A;  1WTV A;  3MXG A;  2RQX A;  4JG2 A;  3BZC A;  4NKL A;  5K36 G;  1F9S A;  1LO5 D;  5IP9 H;  3RZD H;  3M9B A;  1N32 L;  1A3T A;  2E5L Q;  5IYD H;  5NUC A;  1CTM A;  5CV7 A;  1F2M A;  4JBW A;  2E2J B;  2JA7 H;  5KYI A;  1EFI D;  1WJJ A;  2AKW B;  4Y7N B;  4KY5 A;  1X6O A;  2ZTD A;  4XQJ A;  2EQS A;  4XDX A;  3I91 A;  4A3F B;  3NTH A;  2HQL A;  3PUX A;  4WFN 3;  4C3I B;  1ILQ A;  1L0X B;  3S1N B;  4IUV A;  3MVV A;  5JJZ A;  3A5Z B;  1TWA H;  2JP1 A;  1F2Y A;  4B3M L;  1C9O A;  3TP8 A;  4IFD G;  2WP8 J;  1TKW B;  2YV5 A;  3SK4 A;  3S24 A;  2DY8 A;  3I72 A;  1B8A A;  5C44 G;  1KRT A;  1Q46 A;  2R7Z G;  1KXL A;  3FVQ A;  3CHB D;  5FLX E;  3M85 A;  1KRS A;  4CDC C;  1DYQ A; 
#chains in the Genus database with same CATH homology
 1VMP A;  1W6K A;  1AN8 A;  1TS4 A;  3CRL C;  5J39 A;  2D5D A;  1D5M C;  4FXG C;  2F0N A;  2B2V C;  1ICW A;  5I6Y A;  2L1B A;  4RHR A;  2HCI A;  3HOV B;  3T53 B;  2OEO A;  5JEA H;  1EQT A;  1PTO H;  1Y1W B;  1K8M A;  3A8J E;  2JA6 B;  4G7H C;  2LS0 1;  2SOB A;  3X3N A;  1E2Z A;  2K5W A;  2L9H A;  1H9S A;  3SK6 A;  3S1Q B;  5EJW A;  3WOF A;  1X3P A;  4PV1 C;  1UUP A;  4DA2 A;  4F8M A;  2QIL A;  3M7N A;  1E2W A;  1LT3 D;  2I46 A;  2JYO A;  1CQF A;  3KBG A;  1JOK A;  3GO5 A;  1QNK A;  1I4G A;  4HCS A;  5CV8 A;  2CW0 C;  2DY7 A;  4KHV A;  1EY7 A;  5BN4 A;  4A3D B;  3MFY A;  2SEB D;  1CFM A;  2FMC A;  5EQ0 A;  2A68 C;  5EBD A;  2SDF A;  1TY2 A;  1EQV A;  4K6D A;  2NVT B;  2A6E C;  5HUR A;  1JIC A;  2NWG A;  1GUS A;  1PZJ D;  5DEH A;  3IFT A;  5BN5 A;  4G7Z C;  1AZQ A;  1SNP A;  1WD1 A;  3BVM A;  5FO9 B;  3TDQ A;  1Z6H A;  2F3W A;  4WRD A;  4A3M B;  1PTO C;  1SMY D;  4FVM A;  1XTC D;  1STH A;  4KKT A;  3PO2 B;  3MC0 B;  4KI0 A;  2BCO A;  1JWU D;  4L8J A;  3VR5 A;  1PYW D;  1KAB A;  3RZD B;  1ZXT A;  2A6H D;  3DEO A;  2JA7 B;  1FD7 D;  2F0O A;  2FMM A;  1O7Y A;  4K5V A;  2EE1 A;  4BWG B;  4PQX A;  1LTI D;  1V1P B;  2F0W A;  1LTT D;  4IAL A;  3BZD B;  4XT3 B;  1GJX A;  3NWT A;  4JK1 C;  2B2U A;  5KYL A;  2X69 A;  2ICE C;  2XNA C;  2IX3 A;  1EYA A;  3N52 A;  4NDX A;  1LLR D;  1TWA B;  2HUG A;  4R8I A;  2F0J A;  4ZRZ A;  3LNN A;  3SHL A;  1SDF A;  1R4Q B;  5I6W A;  2B2W A;  4I7Z C;  4RCO A;  3OWE B;  5I2Y A;  1OXV A;  1STY A;  4MHE A;  4K14 A;  4OGQ C;  4O1N A;  2K33 A;  4HED A;  5JPN C;  4C56 C;  1STN A;  1W6J A;  2Q8T A;  3C1E A;  1GUN A;  1H9M A;  2RBM A;  4CHT B;  1PRT C;  1PTO B;  1L0Y B;  1NAP A;  1ZYR D;  3FMC A;  1WCM B;  1LAC A;  4G7O C;  2ZXR A;  2J4X A;  4K2K A;  1D2B A;  1O7L A;  1GUW A;  2PZU A;  4DAP A;  3VR4 A;  1KLU D;  2QEJ C;  3OMG A;  2F0T A;  4DFA A;  3DHQ A;  5JEA J;  2HCC A;  1QB5 D;  1BDO A;  1IL8 A;  1ROD A;  1G8Z D;  1HUN A;  2AWO A;  3GTQ B;  3OIQ A;  2EVB A;  2L4N A;  3R2T A;  5A2Q L;  1HPC A;  3ITP A;  2WKC A;  3S15 B;  3NBH A;  4K2L A;  1A2T A;  4Q0F A;  5M5Y B;  3VR3 A;  2F0D A;  2EY5 A;  1IHZ A;  2F0E A;  2M2L A;  1ET9 A;  1DXM A;  5M5X B;  5KND A;  1CT1 D;  1SBB B;  1F9Q A;  1LTA D;  2F0G A;  4ME5 A;  1B50 A;  3MA2 B;  3K6O A;  1TS5 A;  1D1K A;  1PRT B;  5IGB A;  4BBS B;  1TWC B;  4V19 0;  4C3J B;  1BXT A;  4QB4 A;  1H9J A;  3SXH A;  2WKD A;  2NVQ B;  2D62 A;  3ND8 A;  5DM6 3;  1LTB D;  4C3H B;  1G6Z A;  2K03 A;  4C1N K;  4OL7 A;  3J7A F;  5IT9 L;  3H94 A;  3OW7 A;  1YNJ C;  1F2L A;  1O78 A;  1KLG D;  3TP7 A;  4S3S A;  1R9T B;  4C2M B;  1OXU A;  2Z4H A;  3CKI B;  3T4A C;  4FYD A;  4NW2 A;  1C4Q A;  3GP7 A;  4IUN A;  3U9O A;  1H9S B;  4CKE A;  2ICI A;  3L3O C;  2QCP X;  2VUM B;  5A2Q E;  5K36 H;  2R92 B;  5M3M B;  1F9P A;  1KAA A;  3PUW A;  1JOO A;  1WD0 A;  4DGZ A;  4F87 A;  3V2T A;  2ZT9 C;  1PTO F;  1TS3 A;  3EA6 A;  2R61 A;  4QF4 A;  5DM7 3;  5CMD A;  3PV0 A;  1D5Z C;  1OXT A;  1IYU A;  2B2U C;  4IUU A;  3K57 A;  4DF7 A;  1F77 A;  3NSW A;  1JOQ A;  1MI2 A;  3FKI B;  1B1Z A;  2NTT A;  2XRQ D;  2NUC A;  3BDC A;  3K58 A;  3SEB A;  4OO1 G;  5CYU A;  3HOY B;  2NN6 G;  1PFB A;  4A3I B;  2B2W C;  3GTM B;  4KY7 A;  3BDL A;  4CKB A;  3J81 L;  1SJH D;  4KK7 A;  5J1Z A;  1STE A;  2KEC A;  1ENF A;  5KNC A;  1BCP D;  1YNN C;  3NP8 A;  1A15 A;  2C9O A;  1MSG A;  2KCC A;  1H9K A;  2AQ1 B;  4M8A A;  2K04 A;  1IKM A;  5IT9 E;  4PNY A;  4TQU S;  1U9R A;  2BA0 A;  1QWY A;  1UAP A;  5CGK A;  1AP0 A;  3QWN A;  4DK0 A;  1Y8N B;  5C3W A;  1I50 B;  2JEA I;  1EIH A;  2XSC A;  2RA4 A;  3A8I E;  1NR4 A;  2G9D A;  1KDB A;  3GV3 A;  2K5Q A;  3H6M A;  2EZV A;  2EYH A;  5C4H A;  3HZX A;  3SDZ A;  1B44 D;  1PRT F;  3F2U A;  3EJI A;  2X6G A;  3SR1 A;  1Y69 U;  5A35 A;  5EPL A;  1B3A A;  3RD4 A;  4K5X A;  3PIP 3;  1II3 A;  4ZKB B;  1STG A;  3CU7 A;  1QOH A;  2B2T A;  1ZEQ X;  5CBA E;  2VNU D;  4DXG A;  1EOT A;  5IOD A;  1QG7 A;  2F0P A;  5CV4 A;  2A69 C;  4C3I G;  2PQE A;  3GTP B;  1VF7 A;  1F2Z A;  3KLS X;  3IAY A;  5I4D A;  1GHJ A;  2NVY B;  5JOB A;  3J81 E;  3D31 A;  3C1F A;  1LT6 D;  4X3K A;  2ZXO A;  2JXM B;  4RHS A;  4U68 A;  2KUM A;  5E4X A;  5IGE A;  4LK1 C;  1RD9 D;  3S2D B;  1LT5 D;  4RGO S;  5JVH 3;  3PUZ A;  1SJE D;  5BN3 A;  1VF5 C;  3EVQ A;  4A93 B;  3LWU A;  1A3V A;  3I4M B;  3A56 A;  4H44 C;  2K32 A;  5CV9 A;  3J7A V;  2YU9 B;  1I4P A;  1FGB D;  5C5M A;  1SNM A;  2JA5 B;  4XIG S;  5COY A;  5KEE A;  1WTO A;  2RVL A;  4J8Q A;  1V43 A;  3E6Z X;  1CZG A;  4KKU A;  2DNE A;  1CA6 A;  3S2H B;  1SNQ A;  4K6L A;  3MHB A;  4LMQ D;  4XYQ A;  4MN3 A;  1OXS C;  3NHH A;  5JPM C;  3RLF A;  4R8N A;  1EWH A;  3P1H A;  1BUV T;  3VR6 A;  4AYB B;  2ZXP A;  2KHS A;  2R7Z B;  2B39 A;  5I9O A;  2K28 A;  3N6R A;  4KKS A;  1CZW A;  3D3R A;  4DAY A;  4KJO A;  2EYM A;  3AU7 A;  4A3J B;  5E3F A;  3BVZ A;  4FF3 A;  1VCI A;  3K5O A;  4DU9 A;  2O2L D;  4FXK C;  3PUY A;  3P7J A;  3R2I A;  1U4L A;  4QCL A;  2A6E D;  2WII B;  4HR7 B;  1B2T A;  1CQV A;  3PUV A;  3MAQ A;  3Q6S A;  5T1I A;  3TP5 A;  3I4N B;  1ML0 D;  2Z1C A;  3DWA A;  2EPB A;  3QJY A;  2OXP A;  2BE5 D;  3CRK C;  2EYL A;  3P75 A;  1BR9 A;  1S5E D;  1UNS A;  4EQN A;  2OT2 A;  1LTG D;  4IUT A;  1NR2 A;  5EGT A;  3NBI A;  2AWN A;  4ILW A;  1E0B A;  3TBI B;  1S5D D;  4N9T A;  3R93 A;  1LTR D;  2O4X A;  4J6H A;  2PCF B;  1XWE A;  2VB3 X;  4R9W A;  1CHQ D;  2PZW A;  1XX8 A;  3OWF A;  1WVL A;  2L55 A;  2B2T C;  1U4M A;  5IIF A;  1QIL A;  2FHT A;  1SYC A;  4IUP A;  1EU3 A;  1EY4 A;  1NSN S;  4HSP A;  3DM1 A;  1V1O A;  1I4X A;  1DOM A;  4BY7 B;  2B63 B;  3A55 A;  4FXD A;  1S5B D;  2XIW A;  2EYF A;  1SMY C;  4K8I A;  1MBY A;  2F4I A;  1I3Q B;  2PW7 A;  5JEA G;  4KTA A;  2F3V A;  1Q3L A;  2WIN B;  2O5J C;  1QE6 A;  2E2I B;  3Q22 A;  1U4P A;  1LV9 A;  1X32 A;  2G9H D;  5FK9 C;  5KNB A;  5DAU A;  2Q8I B;  1U4R A;  1D6E C;  1SYB A;  3S1M B;  2A6H C;  2TMP A;  5C3X A;  1KDC A;  3HOU B;  2EDG A;  5G3L F;  3GV6 A;  3H09 A;  3DXJ C;  2JEB I;  4FF1 A;  1ET6 A;  1JWS D;  1Q1B A;  4P2C B;  2E74 C;  3KBX A;  2EY2 A;  4A3K B;  2EYP A;  4WJW A;  4RAU C;  2K1B A;  5EKK A;  3H3V C;  5C5L A;  3OOC A;  1CHP D;  1EL0 A;  3QO2 A;  1ENC A;  2OF1 A;  3QG1 A;  4H7B A;  1AZP A;  3VYT A;  4Z9C B;  3BS1 A;  1IW7 D;  1DON A;  4E6I A;  2NVX B;  1GHK A;  5F2D A;  3A8K E;  2SNS A;  3MXU A;  3MWY W;  1DOL A;  1EY5 A;  1EYD A;  3NWS A;  2VB2 X;  3DWP A;  1O80 A;  1RF2 D;  1PFN A;  4ZKC B;  2NN6 H;  5C0X H;  4B08 A;  1FNV A;  3VA5 A;  4UDU C;  4A3E B;  1BBX C;  4C3J G;  5M9O A;  3S14 B;  3VYS A;  5C4X B;  1I6H B;  1J9O A;  4C3H G;  3WDN A;  2LMC B;  4XYO A;  3IL8 A;  3SE0 A;  2Z4I A;  2KCN A;  4DXF A;  3TSS A;  4OIJ A;  3MEH A;  3C46 A;  5I9P A;  5KRU A;  1HQM C;  2L0C A;  5LL6 X;  2D9U A;  4QUC A;  4FO2 A;  4U67 3;  2DNC A;  4HTH A;  2F0I A;  3AMU A;  1RHP A;  2K5D A;  3Q0A A;  2MUY A;  3R8B A;  2V4D A;  3DWQ A;  3BG3 A;  1BQQ T;  5ELC A;  3AB9 A;  2AQ3 B;  2WV6 D;  4FF2 A;  1Z7T A;  1HUM A;  5IGD A;  2NZ1 D;  4QMG A;  3MXN A;  1RCV D;  2IW3 A;  2RSN A;  1DZ1 A;  3UI2 A;  3K7A B;  1GUG A;  2EYJ A;  3NUC A;  1SSO A;  2TSS A;  4FP5 D;  5D3I B;  4C1N I;  1TWG B;  4H0L C;  3OHX C;  5CBE E;  4ZAI A;  1RTO A;  4FF4 A;  2Y0S B;  4KD3 A;  2PZT A;  4B9W A;  3QIA A;  1R4P B;  5C3E B;  2WB1 B;  1SNO A;  2NN6 I;  5C0X I;  4PMB A;  1AFP A;  1PDQ A;  4L63 B;  2A74 C;  3K59 A;  1EYC A;  3HG9 A;  4IFD H;  5D65 A;  2RKS A;  3NE5 B;  3G6J B;  3HOZ B;  4Q5V A;  2F0H A;  2Z8L A;  5C6A A;  1PZK D;  4RH6 A;  3DUZ A;  3M7G A;  5EPJ A;  1DJR D;  4ZLT F;  5T1G A;  2O5I C;  1LT4 D;  2R3Z A;  1ONL A;  1DCZ A;  4ID6 A;  1QCB D;  2A73 B;  1T5E A;  1GOZ A;  1EY9 A;  2B8F A;  1Y8O B;  2IPK D;  1WTP A;  1CI3 M;  1HRJ A;  3X3M A;  1MGS A;  2E76 C;  4RA8 A;  2EJM A;  1Q12 A;  1FR3 A;  3NQT A;  4WOR A;  4DN4 M;  3RZO B;  3L7Z C;  2XN9 C;  2KEE A;  2IWH A;  5AFW A;  1LTS D;  3D4W A;  2DN8 A;  3HGB A;  4BA2 I;  1OO9 B;  3J80 L;  1EWC A;  4ULL A;  3LWE A;  3RMH A;  2EOT A;  5C4Z A;  4F88 A;  1O7Z A;  4ZUJ A;  3TZU A;  5EKI A;  3WOE A;  1IKL A;  1BCP C;  1GUT A;  3H0G B;  1B9M A;  2KJX A;  1SAP A;  1HCZ A;  4BY1 B;  1ESR A;  2BOS A;  1C48 A;  1M8A A;  4LJZ C;  1M4V A;  2KOL A;  1A6X A;  5IGC A;  4RGT A;  2PMZ B;  5C0X J;  1ZKO A;  1JE4 A;  2LKV A;  4G4K A;  3C3L A;  2F0L A;  4RCN A;  1EIG A;  2F0Q A;  5CR3 A;  2JSO A;  3TME A;  4EQO A;  1TQO A;  2N55 A;  3HOW B;  2F0U A;  5D14 A;  4RGN A;  3ONA B;  1XYI A;  4IFD I;  4X3S A;  1JC7 A;  2R6G A;  2F0M A;  2EYO A;  1TWH B;  1QNU A;  3NPP A;  2PNR C;  1D1I A;  2RDF A;  1JQY D;  3P20 A;  5FO8 B;  5DNF A;  1Q1E A;  4TKO B;  3VA7 A;  1RTN A;  3MXP A;  5FKA C;  2F0K A;  5IOC A;  1BF4 A;  3JAM L;  4IZ8 A;  4FNF A;  1I4Q A;  3OSO A;  5E4W C;  2H1E A;  1S5C D;  3J80 E;  2IJ0 A;  3S9W A;  1BCP B;  3URY A;  2K01 A;  2XWB B;  4XXE A;  3D6C A;  1K8O A;  1PMR A;  2XVS A;  1ENA A;  4YIJ A;  3HRZ C;  2H4O A;  1WTW A;  2PPB C;  3SK8 A;  2FJ2 A;  1VMC A;  1HA5 A;  4EQP A;  1WTR A;  5FOB B;  1MD2 D;  2N88 A;  2EY1 A;  1HXY D;  1PXU A;  5LL6 S;  3NK9 A;  1STA A;  1SYE A;  1TY0 A;  3J7Y W;  5C44 B;  4UAI A;  3GD7 A;  3IKJ A;  3ND9 A;  2K6A A;  3FDT A;  1Z47 A;  4KMU C;  2CW0 D;  3PIO 3;  1BOS A;  1KNA A;  3OMC A;  2IT1 A;  1KDA A;  4CJ0 B;  4DAV A;  3HOX B;  3S16 B;  5M3F B;  3HKZ B;  1RDP D;  2A68 D;  1NUC A;  1IYV A;  4IFD J;  3VR2 A;  4BBR B;  3ERO A;  3I8Z A;  2HDL A;  3PO3 B;  3T56 B;  1B4O A;  2EJF C;  2Q8R E;  3VYU A;  3ZYY X;  4RWS C;  1QJO A;  3SK5 A;  4L6T B;  1BO0 A;  4X3U A;  4K5W A;  3I3C A;  3NQI A;  1TVX A;  5EBC A;  3E0J A;  4ZK9 B;  3JAM E;  1SNC A;  1SXT A;  5KIX A;  4RKB A;  2WAQ B;  4HMI A;  3OPO A;  3KLS A;  1Q8I A;  2M9V A;  4TSS A;  1TU2 B;  4I65 A;  2F03 A;  4HCE A;  4B9X A;  1PTO D;  1JOR A;  2MPM A;  3D4R A;  1DM0 B;  2L11 A;  2D2C C;  3M4Y A;  4KV6 A;  2RSO A;  1J8I A;  3KUP A;  2QDB A;  5CV5 A;  3V96 A;  3EQL C;  5D3D A;  4KN7 C;  3PMF A;  3OIP A;  3E5S A;  4X3T A;  3S1R B;  3NTK A;  3W3A A;  4KD4 A;  3HEJ A;  4HSV A;  3D8G A;  4ODG A;  1TWF B;  3GTO B;  1EZ8 A;  3R3O A;  3I4L A;  3L9A X;  3QOJ A;  2FIN B;  1I6V C;  2F1M A;  2BE5 C;  2RDG A;  3U9S A;  4A3G B;  1HFN A;  4EGV A;  3DEP A;  1S4Z A;  1TS2 A;  4PMW A;  1BCP F;  4XTC S;  3W2D A;  4HN7 A;  1EEF D;  1MSH A;  5C4J B;  2F0F A;  1HQR D;  1KNE A;  3A7L A;  1HA6 A;  3G7L A;  4K8J A;  2EJG C;  4V0B A;  5HGT A;  1FNU A;  1XXG A;  4KN4 C;  1PFM A;  4RFB A;  1K83 B;  3KF8 A;  2YYZ A;  3A54 A;  1PRT D;  4J1M A;  4O42 A;  3T51 B;  5IGG A;  3Q24 A;  4RGM A;  4HMJ A;  3D6W A;  2X6L A;  2E2H B;  1SYG A;  4GZY C;  4BA1 I;  5I2X A;  5J22 A;  1KTK A;  2GA4 B;  2PO4 A;  3HP3 A;  4ZUI A;  3SVM A;  5KGU A;  4ZYS A;  2R93 B;  3I73 A;  3BDO A;  1HHV A;  4KHZ A;  3HS0 C;  3QOL A;  4IUQ A;  4OHJ A;  1ESF A;  1Y1V B;  3D4D A;  2BDO A;  1ILP A;  4QIW B;  2C5C A;  4CGY B;  5ELE A;  5CV6 A;  3QB3 A;  4LAA A;  5JAV A;  3LX0 A;  2I07 B;  1G29 1;  1FNW A;  1TT2 A;  2A5H A;  4HAE A;  4NP5 A;  4XQQ A;  4CJ1 B;  1HFG A;  3FPP A;  3MTS A;  2KA7 A;  5ELB A;  1H9R A;  1RJT A;  5EKL A;  1CM9 A;  4EVO A;  4OO1 H;  2XRS D;  3ERQ A;  1JB3 A;  1STB A;  1ZYR C;  1OXX K;  4CKC A;  2AUK A;  2B2Y A;  1EY6 A;  4IUR A;  2PW5 A;  1GUO A;  3RUZ A;  2L12 A;  1DD2 A;  4KY6 A;  1SYF A;  4F7X A;  1VDZ A;  5ISR A;  4ZQ3 A;  3NTI A;  4A3B B;  2KQ3 A;  2CHB D;  2MP1 A;  2K7V A;  1IW7 C;  3GTJ B;  3V05 A;  1RKN A;  2IX1 A;  1G2T A;  1EY0 A;  4MIU A;  2IX0 A;  4M1U B;  1G2S A;  1YNJ D;  2BDN A;  4BS9 A;  1JWM D;  3VYR A;  2QKI C;  3C2P A;  2VXW A;  3BVG A;  4XQN A;  3KLR A;  3S17 B;  1B9N A;  1X3Q A;  2KED A;  2FFK B;  2HDM A;  2K05 A;  1I4H A;  3A7A B;  2AQ2 B;  4IN3 A;  3M4O B;  4NMZ A;  2L5T A;  1BNZ A;  4CJ2 C;  1D5X C;  4PMC A;  1NCV A;  3TZD A;  1EZ6 A;  1HTP A;  3BYT B;  1SFO B;  2F0V A;  1Q90 A;  2JA8 B;  5CC4 A;  3GTL B;  5ELF A;  1B53 A;  2B2V A;  1I4R A;  5FO7 B;  1V8Q A;  2SNM A;  2RDH A;  5M5W B;  1S5F D;  2JE6 I;  2MJ8 A;  1AEX A;  1E2V A;  1GXD C;  3FPU B;  1HTL D;  2PYK A;  2ENB A;  2E2D C;  1SND A;  4OO1 I;  1DOK A;  3DMU A;  3H91 A;  3T13 A;  4CBV A;  2F0S A;  3K5L A;  1UEA B;  4H13 C;  3GTG B;  4DNT B;  3KK7 A;  1JCK B;  5EPK A;  3GQB A;  4TRD A;  1YNN D;  1TR5 A;  3CQZ B;  1FYC A;  2LFN A;  2MGS A;  2BA1 A;  4XT1 B;  5K5P A;  2IL8 A;  2LY7 A;  2EY6 A;  1TII D;  1SE2 A;  1SYD A;  1WTX A;  1F9R A;  2EXZ A;  3K5N A;  3TN2 A;  2M00 A;  3BYY B;  5C0X G;  2NTS A;  4DK1 A;  1SEB D;  1V1P A;  3K0Y A;  3MFG A;  3K5M A;  1A2U A;  1CK1 A;  1WTQ A;  2CQA A;  4DNR B;  1A3U A;  2CVR A;  1PZI D;  1CA5 A;  1AW7 A;  4KJN A;  1JR0 D;  3Q23 A;  2WAC A;  2MHV A;  3NXW A;  3M3Y B;  3FEW X;  2AUJ D;  2E75 C;  3TP6 A;  1SE3 A;  3GTK B;  2ID0 A;  4N9P A;  1G91 A;  1EEI D;  2J0T D;  2B8G A;  2NBF A;  3T16 A;  2A69 D;  2QF7 A;  1EU4 A;  5FLX L;  5COR A;  2J7Z A;  4QUF A;  3O13 A;  2KVM A;  4G57 A;  1SE4 A;  1PLF A;  4OIK A;  1C8C A;  5E1F A;  4IQZ A;  1Y8P B;  3I70 A;  5ELD A;  5IGF A;  5G3L D;  3MZ5 A;  1T5X D;  5TSS A;  2NB0 A;  5JVG 3;  2B2Y C;  1EY8 A;  3EFX D;  4ABN A;  2HQE A;  3FRP B;  5LHY 1;  3I90 A;  1LAB A;  2XWJ B;  3IFD A;  4RKL A;  2NYZ D;  1WTV A;  3MXG A;  2RQX A;  4NKL A;  5K36 G;  1F9S A;  1LO5 D;  1A3T A;  5NUC A;  1CTM A;  5CV7 A;  1F2M A;  4JBW A;  2E2J B;  5KYI A;  1EFI D;  4Y7N B;  4KY5 A;  4XQJ A;  4XDX A;  3I91 A;  4A3F B;  3NTH A;  3PUX A;  4WFN 3;  4C3I B;  1ILQ A;  1L0X B;  3S1N B;  4IUV A;  3MVV A;  5JJZ A;  2JP1 A;  1F2Y A;  3TP8 A;  4IFD G;  2WP8 J;  1TKW B;  3SK4 A;  2DY8 A;  3I72 A;  3FVQ A;  3CHB D;  5FLX E;  3M85 A;  1DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...