1LTRD

Crystal structure of the b subunit of human heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
b'APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLYAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 27
structure length 108
sequence length 108
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1998-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltrD00
3TSSA 1QILA 2AQ3B 4RFBA 1D6EC 1HQRD 1SE4A 1B1ZA 5FK9C 1S5CD 1PTOC 4BWGB 3V05A 1CT1D 1D5MC 4TSSA 3SEBA 1SBBB 1PZJD 1ENFA 1JR0D 2AQ1B 4UDUC 1S5ED 3CHBD 1M4VA 2RDGA 3R8BA 1PRTC 1LTSD 1MD2D 2IJ0A 1EWCA 1I4QA 1HA5A 3GP7A 5D3DA 1L0YB 1TY2A 2CHBD 3BVZA 4K6LA 5ELCA 4DXFA 4L63B 1SE3A 2TSSA 1FNUA 1HXYD 1CHQD 2Z8LA 1JCKB 5ELEA 1EEFD 1LT6D 5D3IB 1T5XD 5I4DA 3BYYB 1I4XA 3DWPA 4OHJA 1F77A 1PZID 4RH6A 1XTCD 1EU4A 1FD7D 1LTBD 1B44D 4DXGA 1FNVA 2XN9C 1V1PA 2QEJC 1CHPD 3EA6A 2IPKD 3R2TA 1LTID 4RGTA 2ICIA 2NTTA 4RGNA 4Z9CB 2J4XA 1JWUD 3W2DA 3BYTB 2RDHA 1TS3A 1D5ZC 1UNSA 3BZDB 3DWQA 1ESFA 1LTTD 1JQYD 1FGBD 1KTKA 1KLGD 1S5DD 1STEA 1KLUD 4RGOS 1JWMD 3MFGA 1V1PB 5ELDA 1TY0A 1G8ZD 1RDPD 1LT4D 1LTGD 4RCOA 1BCPD 3OWEB 3MC0B 1AN8A 1JWSD 1RD9D 1I4GA 1S5FD 1TS2A 1RF2D 2AQ2B 1AW7A 1HTLD 3URYA 1UUPA 1SJHD 2O2LD 1PRTD 1D5XC 1XXGA 4C56C 4RHSA 1CK1A 1PYWD 1DYQA 1TS4A 1S5BD 1CQVA 1I4HA 1LTRD 5ELFA 3BVGA 1BCPF 1DJRD 1L0XB 2SEBD 1PTOB 5TSSA 1RCVD 1BCPB 1EFID 1EU3A 1LO5D 1LT3D 1PRTF 1PTOD 2XNAC 1TS5A 5FKAC 1LLRD 1BXTA 2XRQD 4RHRA 2QILA 1I4RA 4ZYSA 1PRTB 3KLSX 1PTOH 1BCPC 2NTSA 3DWAA 3O13A 3EFXD 4RGMA 1ET9A 1SJED 4O1NA 1EEID 1I4PA 1LT5D 2R61A 3BVMA 1SEBD 1SXTA 1FNWA 1GOZA 2XRSD 2WV6D 1V1OA 3R2IA 1PZKD 4L6TB 1PTOF 1SE2A 1ET6A 1LTAD 2G9HD 5ELBA
chains in the Genus database with same CATH superfamily
4C1NK 3TSSA 3OSOA 1PDQA 4CKBA 5IP9G 1QZGA 5BN3A 2Q2UA 4L5RC 4IFDG 5FK9C 3MWYW 2UUBL 3Q23A 1GM5A 1B9NA 2PW7A 4K2LA 4C3HH 1CT1D 1LUZA 3C1EA 3PF4A 4L5QA 1S5ED 5IYDG 1XPOA 1A15A 1S4ZA 4OX9Q 4DFAA 3PGZA 1BUVT 1WTRA 4KLKA 1CHQD 1TIID 4BY7H 3CMAA 1QZHA 5ELEA 5D3IB 4IO9A 2B2VA 5C3EB 4OHJA 2I5MX 4LF4Q 4OWTB 1EWHA 3GTPB 1E2WA 1LTBD 2K5DA 2GVAA 3G6JB 1SNOA 5BN5A 3E9IA 3MXGA 1OO9B 2DY7A 3H0GH 4MN3A 4PZ6A 1NUCA 3SE0A 2D2CC 4TKOB 2MFIA 1J8IA 2ZTEA 4P71A 1ESFA 3NQTA 2IX0A 1X3PA 4RGOS 1HQMC 1TY0A 4RCOA 3QWNA 4WJ4A 1A2UA 1V8QA 4BA2I 4ZLTF 5EPJA 1XMOL 5E7NA 1S5FD 1P8LA 1B2TA 1SROA 3EQLC 3KYHC 2KECA 2O2LD 3NUCA 4C56C 2N78A 2UU9Q 2PZTA 1CK1A 1PH2A 4GZYC 1TS4A 1Y8NB 5IP7G 2UUBQ 2F0MA 1GUSA 1IKMA 5D65A 1N34L 1CSPA 2LMCB 1LM0A 4DK0A 1Y1VH 4CJ2C 5TSSA 2QCPX 2Z4IA 1LO5D 3Q22A 5AFWA 1TS5A 2YU9B 4LAAA 3SK4A 5M3FG 2IX3A 3SR1A 2CQAA 2NN6I 4JI2L 5KGUA 4DAYB 1NJIC 4H02A 1BBUA 4L6TB 5FLMH 1ET6A 3PO3H 4JI7L 3AB9A 3C46A 1SMXA 1BVSA 2MHVA 1NMFA 2JA5H 3J7A5 2YTYA 3WOEA 1MJCA 4YCWA 2R3ZA 1N32L 2P5ZX 3NSWA 3H3VI 4UY8C 2J7ZA 1TU2B 1LYLA 4A3LG 4DR6Q 5KNCA 3SK5A 4YIJA 4C3IG 5ISRA 3BJUA 1XMOQ 1YJWA 5D3DA 2MJ8A 3FRPB 3E0JA 3F2BA 3HOZH 4A93G 2QDBA 3N52A 5EPKA 3J80L 3A8KE 2EVBA 1N34Q 2F3IA 2L11A 1KRTA 2VUMG 2LY7A 2XWBB 4HJ5A 1VQKA 3PUVA 4R8IA 3M7GA 1K8OA 5IT9E 4DV4L 4EVOA 2RBMA 2EYPA 2F3VA 2EZVA 3HEJA 1HZAA 1M1KC 1IBLQ 4JI2Q 3PMFA 3LGJA 5L37A 1TWAB 1D1KA 3TDQA 3ITPA 2ES2A 3AEVA 1PVOA 5IP9H 1AN8A 2O5JC 1JWSD 4JPBW 4IFDH 5C4XG 1EY5A 1YBYA 1AW7A 4G7HC 4JI7Q 4ABNA 1PRTD 2WB1B 5J22A 2F0SA 5C3XA 4JI3L 1EY6A 1TR5A 3P20A 3BDOA 3OW2A 1PH6A 5C0XG 1I50B 4X62L 1IZ6A 3G7LA 1Q82C 2K50A 4DR4Q 2E2IB 2K28A 4FF2A 1VQAA 1QNUA 4A3BB 2XNAC 3ND8A 2NVXB 1KDCA 2A6ED 4TVAB 1I4RA 4XQQA 1VQPA 1PTOH 4NW2A 3GV3A 3HFZB 3U58A 4BS9A 2Y0SG 1M8AA 5LMNW 1ENAA 5IGCA 1B8AA 1X56A 5HY6A 2NN6H 2E2JH 5NUCA 3KFUA 1LTAD 3D4DA 4HSVA 4UAIA 3TRZA 1DONA 1KL9A 1PH4A 2DN8A 3Q6SA 5CV5A 1F2ZA 2BA1A 1R4PB 1HCZA 1YJ9A 3K5OA 2ZJRA 4I7AA 5JOBA 1NR2A 4FXGC 3CCLA 2E76C 2RA4A 4KHZA 1AE3A 1I94L 1DOMA 1J5EL 1WTVA 1PRTC 5IP7H 5I2YA 3CCJA 5M3MB 1RHPA 2WAQE 4DNIA 5GADC 4JI3Q 2NZHA 4DAPA 2JYOA 1TXYA 5IGGA 2K01A 2F0OA 4X62Q 1ILPA 5I4DA 1WTOA 3TBIB 4RH6A 3K8AA 4PMBA 1S3OA 1HFGA 2DY8A 5M3FH 4KV6A 2MO0A 2WP8J 1PH8A 2NWGA 4IPDA 5M5YB 3I4NB 4B9WA 2OCEA 5DM73 1BKBA 4DV2L 1RJTA 2E2HH 2F0WA 3I7FA 4FNFA 1W2BA 2OQKA 1VCIA 5JEAH 1MKHA 1RDPD 3B6YA 4HCEA 4OL7A 5HGTA 4KI0A 4KKTA 2EIFA 2F52A 3JAMc 3K80C 3D31A 1M90C 2JA7B 2OT2A 2DUDA 4BY1B 4A3GB 1EL0A 2MUYA 1SJHD 2Z6KA 4A3LH 1MBYA 4XTCS 3PUXA 4C3IH 4V190 1TQOA 2X69A 1R9TH 1TWGB 4CKCA 4PQXA 4U68A 5LL6X 3OW7A 3RN2A 4A93H 1C8CA 4WORA 2K5QA 3VR3A 1J5EQ 1A3TA 2HCIA 1CZWA 1DOKA 3S2HH 1QUQA 2PW5A 2XRQD 3E9HA 4CHTB 5IWAL 3PQIA 1EOTA 5M5XH 5COYA 2K7VA 3MXNA 4IJLA 4EQNA 1FYCA 2VUMH 3S24A 5CR3A 1SYCA 1VF7A 2MP1A 1SXTA 3C2PA 1FNWA 1GOZA 2B39A 4Q5VA 4KD3A 4HIMA 3ND9A 1IW7D 2F0HA 2E75C 2RCNA 1A3UA 2K5NA 1JJCB 2QA4A 5EQ0A 2IY5B 3T4AC 2BOSA 2LKVA 2YTVA 4DV2Q 4B9XA 2R7FA 3T1YL 4X3KA 1EYAA 3A8JE 2EXDA 1D6EC 1SE4A 1NMGA 2EE1A 1B1ZA 3S2DH 5CYUA 1UE5A 1HTPA 2VS1A 1BDOA 1GVPA 3FPPA 5I9OA 2J0TD 1HNZL 4ULLA 1KIXA 2AQ1B 5CV6A 1XNRQ 2CWAA 3NWTA 3UDGA 2UUAQ 2VNUD 4X66L 4FYDA 4ALPA 5C0XH 3G71A 3GP7A 2NYZD 1ILQA 2ZTCA 1Q12A 4A3IG 4YWLA 3MXNB 3NE5B 2G5DA 1JCKB 1ICFB 2D5DA 1GD7A 2RVLA 1EY0A 1FD7D 1CUKA 1VQFA 1J6QA 5GAEC 1XYIA 3R2TA 4PZ7A 1LTID 2NTTA 5IWAQ 1SNCA 1Q81C 1JWUD 4O0AA 2I46A 1LTTD 2NZOA 3FKIB 3J81c 2K14A 5LL6S 1IW7C 1PH7A 2QKIC 1WD1A 2B2YA 4R4CA 4U673 5C6AA 1N36L 2F1MA 1WFQA 3V2TA 3OOCA 1HTLD 1DXMA 2B2TC 2A19A 4A3KB 4BBRB 1GUNA 4DKAC 1XPUA 4KY5A 4XT3B 1VDZA 3BVGA 4MHEA 1HNZQ 1XNQL 4IALA 3J80i 2N88A 1SFOB 1GUWA 2A1AA 2HQLA 2PZUA 1TWHB 3MHBA 4LFCL 4QQBX 1VQ4A 3OMCA 2A6HC 4DGZA 1X54A 2WAQG 1EY8A 4FO2A 3DHQA 1NCVA 1F2MA 2Z9HA 3NK9A 5FLXc 3E3XA 3VR6A 2PPBC 2WV6D 3HOYB 1JJGA 1EYDA 2WB1G 3AFPA 1UAPA 1EQQA 3FVQA 4JW0A 3A55A 3S15H 4DV5L 1CA6A 2N3SA 1HZ9A 5FO8B 1EQRA 2SDFA 5EKKA 2JE6I 1D5MC 4ZCKA 4YWMA 5K5PA 1PZJD 3KK7A 2KJXA 4YCUA 2K52A 1ENCA 1K3RA 3MTSA 1S72A 3NXWA 1VQ9A 1JOKA 2EY5A 4OO1G 3EN2A 4K6LA 1STNA 5ELCA 3H6MA 3IFDA 4ZAIA 4JI1L 5IYCG 3L2PA 3PCOB 1Z6HA 4NP5A 1WCMB 3CC7A 2JSOA 3M4QA 1B50A 1EEFD 3OIQA 1T5XD 1CZGA 1XNQQ 2K5HA 1HFNA 2KCTA 1MJEA 2HDMA 1IYVA 2K1BA 5C4JB 4EGVA 2KVMA 5HURA 4B3RL 3ZYYX 4HAEA 3PSIA 1SE8A 1VQHA 1YNNC 4B3TQ 4IURA 5EKLA 1KLGD 5A35A 1QCBD 2JXMB 1AZQA 1V1PB 3DLLA 4GNXA 3CAMA 1X3FA 3CC4A 2K05A 1SYEA 1MHWC 3KLSA 5KEEA 4DV5Q 4NPSA 2UUCQ 3NTKA 3QO2A 2IHFA 1E2VA 2F4VL 2KBNA 2YU9H 2KHIA 2R92B 4AYBE 2F0VA 2F0NA 1KRSA 4Y7NB 4IUTA 1E22A 4DK1A 1LTLA 5DM63 2F0IA 2JEAI 3I4NG 2I07B 4H44C 4A3IH 1D1IA 3VYTA 1N33Q 2AWOA 2I5HA 1K73C 3RZOB 4NXNQ 1L1OC 2JA9A 3N6RA 1PRTB 5GQOA 5JJIA 1DOLA 4ME5A 3RD4A 4C3JB 1LT5D 2NVYB 3CQZH 1FVIA 4P74A 2JA7G 3KBXA 3MEFA 5E3FA 2N8NA 4C2MH 2UXCQ 3BDLA 1YJNA 2RHSB 3VYUA 1Y1WB 4R4QA 4IJHA 4GN4B 4RWSC 4DV0L 1E24A 5IODA 2ASBA 5C5MA 1BF4A 1U4MA 3M9BA 4QIWB 2HT1A 1U4PA 3F2UA 3HOWB 1IHZA 4L5SA 2F0UA 1SSOA 4CDDC 1F9PA 2X6LA 5I2XA 4ZKCB 2E2DC 3Q24A 1EIHA 1N8RC 1V43A 3I90A 2F4VQ 3HOVG 1C48A 1F2YA 1AP0A 4JI5L 4K6DA 1FNUA 2C9OA 2VQEL 2Z8LA 4OXPA 2EOTA 4MTNA 2HHHL 4S3SA 2N49A 1STHA 1F77A 2ZM6L 4QB4A 1HZCA 2HD3A 4DUYL 4GKJL 4JI4Q 1TWAH 5JJKA 3RLNA 3HOUB 2K32A 3SHLA 3EROA 2CH4W 2PNRC 3NENA 3BU2A 4RGTA 1CKOA 5LMUL 1X9NA 3OMGA 3IFTA 2PMZB 3T1HL 3KF8B 1PFBA 4R4IA 3JAML 2OEOA 1Z9FA 4QJFA 1FGBD 2Y0SE 1L0WA 4X65Q 3ZJYC 2JEBI 3GTJB 3RZDH 5C4ZA 1LTGD 1I50H 1WTWA 2F0JA 2E2IH 2L9HA 1I4GA 4WRDA 4DV0Q 3D8GA 2XSCA 1LV9A 3WOFA 1GO3E 1PH5A 4FF4A 4A3DG 3L7ZC 1VMCA 1D5XC 2JA8B 2R93B 1IYUA 2IHEA 2ZJPA 4TRDA 1KAAA 4YCVA 2MQHA 1OTCA 3MA2B 5ELFA 3HOXG 4OO1H 2JK8A 5IYCH 3MVVA 5DNFA 4DAYA 4IFDI 1NBWA 2B2UC 1H9MA 3VYSA 1AFPA 5FKAC 1Q1EA 1LLRD 1XTDA 1YHBA 2ENBA 3IAYA 4JI5Q 1BCPC 1SJED 4O1NA 2HHHQ 1HNWQ 1EEID 3J7AV 2ID0A 4BA1I 4RKLA 5ELOA 1G6PA 3CXCA 3G48A 3TP5A 2UXBL 3Q0AA 3W5OA 4BBSB 5IY0A 4BBRG 3DEPA 4POGA 5ELBA 5LMUQ 2K5VA 2AQ3B 2KCNA 3QJYA 4APVA 3NWSA 1PTOC 5E4WC 4X64L 3WWVA 2KUMA 2PMZE 1X3EA 1WYDA 2EYFA 1YHQA 1OXSC 3GTQB 3T51B 4A3EG 4J6HA 3E5SA 1WI5A 4JG2A 3HGBA 1LTSD 2B3GA 2I5LX 1I4QA 3C1FA 3CRLC 2BA0A 1BNZA 2TSSA 3ER0A 4A3JB 4XQJA 1SYGA 3EIVA 4HTHA 2WKCA 5CV4A 1A63A 4AYBG 1E1OA 3MXPA 1PZID 1EYGA 2E8GA 4DF7A 4IPGA 1B44D 4X3TA 3STBC 3OWFA 4CJ0B 3S1NH 1MI2A 4HIOA 2D0PA 3J81L 1HH2P 2JA7H 3H3VC 1CM9A 4AQYL 4IPCA 4G57A 4PMCA 3BYTB 4LFBL 3FDTA 4GLVB 1HJPA 4P75A 3AU7A 1TWGH 3OWEB 2B2WC 2JA6B 1RD9D 3CCUA 4RA8A 2MGSA 1WCMG 4GOPC 1PHJA 1I6HB 1IYJB 3PO2B 4LF6L 1W3SA 1UWVA 1DJRD 1L0XB 4KN7C 1FJGL 3HOVH 2QDLA 1Z7TA 2R7ZB 2PQEA 4LF7L 2AHOB 3KDFA 5FLXL 4MIUA 1RTNA 4DU9A 1SYDA 1O80A 1U9RA 2N55A 3HKSA 4JV5L 4JYAL 3BZCA 3BVMA 3U4VA 3S1MB 5IGBA 1N32Q 2KEEA 2VQFL 1ONLA 3U9OA 2XRSD 5IYDH 1SNQA 1BR9A 2HUGA 1U4LA 2V4DA 4POFA 4QUCA 1VQLA 5GROA 2R92G 4DR1L 4C3HB 1EIFA 1E1TA 3A5UA 3IL8A 1NTGA 4LMQD 2AUKA 1SN8A 2JJQA 2X6GA 1SNDA 3AQQA 4ILWA 2I0QA 3JAME 1IL8A 1SBBB 3PIPA 4A3DH 5C44G 3TN2A 3F2DA 3UE1A 1EIGA 2Q8RE 5IE8A 4GLXA 1K3BC 3S1RB 4BY7B 2L55A 3L3OC 4MTKA 3KDFB 4X3UA 1EWCA 1K0RA 1Y14B 3BVZA 3CRKC 4DXFA 3HOXH 1B70B 1SE3A 1UEAB 2L0CA 4DV4Q 2ZXOA 3S1QH 1V1QA 3H0GB 3BYYB 1I4XA 5JVG3 4XT1B 3A7AB 1GHKA 1FJGQ 3ERQA 2QGQA 1ICWA 2EYLA 2XN9C 4JI0L 4LF7Q 4MZ9A 5C0XI 3EA6A 4R1JA 3NPPA 3M3YH 1NAPA 3I91A 3HOWG 1L1OB 3KBGA 2A5HA 4LK1C 1BO0A 4JV5Q 4JYAQ 3J7YW 1S5DD 2LXKA 4BBRH 3UDIA 3TEHB 2M9VA 4P2CB 2F0DA 4FF3A 1K9MC 2K75A 1KXLA 2WB1E 3EJIA 5EAYA 1AH9A 4FXKC 4DNTB 3TP6A 4A75A 1KDBA 2ALYB 4NXML 3U50C 1TWHH 2CFMA 4QUFA 1GXDC 1Q90A 1NE3A 3X3NA 1Q1BA 3CF5A 3K5LA 1PYWD 4A3EH 1S5BD 3HOUG 1I4HA 1BCPF 3ERSX 5HGQA 1RIPA 3I4MB 1I5FA 2QF7A 3D0FA 4P72A 1GUOA 1LT3D 1PFMA 4UP9A 1BXTA 1A8VA 1F9RA 4N8X1 1A3VA 1CQFA 2EYJA 2Z0SA 3NBHB 4EX5A 5J39A 5C3EG 1UE6A 3PO3B 3M7NA 3NEMA 1X55A 3MFYA 3JAMi 3M4OB 3QIAA 1HUMA 5KRUA 2JA5B 3QOJA 2JA8G 3SGIA 3S16H 2GVBA 1PTOF 1C7YA 4L5TA 4JI0Q 4RMFA 1VQ8A 3MXUA 3R93A 2FMCA 1I94Q 5I6WA 2A74C 2B2UA 1HR0L 5C4HA 2VB3X 5K36G 3J81j 4OEMB 3GTOH 4LJZC 5FO7B 1I3QB 5CC4A 1WCMH 4TSSA 5H1SE 3SEBA 1O7LA 3K58A 4A76A 4Y52H 5IYBG 3VDYA 1Q7YC 1TVXA 1CKNA 1O7IA 3K7AH 5C4JH 4G4KA 3J80E 4KTAA 1G291 5CGKA 1L0YB 2CHBD 3W3AA 3J7ZC 3TP8A 4K14A 3RR5A 5JVH3 3KLRA 5JEAJ 2IX1A 5CBAE 1PH3A 2Z6BA 5C4XH 4DR3L 2FXQA 3CCRA 1KQSA 1X32A 2B63B 4RGNA 4Z9CB 1WTPA 2A68C 4I65A 1ZKOA 1WJJA 5FLXE 2BE5D 1UE7A 1KTKA 2R92H 1B4OA 3W1GA 1ASYA 2NVQH 5DAUA 1UE1A 2A6HD 5J3BA 4CGYB 5FO9B 3VR4A 1K83B 2CWPA 3L0OA 4OONA 4IN3A 4A3JG 1CKNB 1TS2A 2AQ2B 1U0LA 2VXWA 4K5WA 2PZWA 5C44H 2KHJA 3I55A 4HMJA 1P16A 4DR7L 2PNHA 3TQYA 1VQDA 5M5WB 2KOLA 2NVYH 4X3SA 3RUZA 4DV6L 1H95A 4N8FA 1PTOB 1E0BA 1EZ6A 3AYHB 1XX8A 5IIFA 1A62A 2EY1A 2B2VC 4QL5A 2PI2A 2HCCA 4N9TA 2AKWB 4EQPA 2NTSA 3J81i 2HQEA 2EY2A 1S40A 3F2CA 4PMWA 3UI2A 2ZJQA 1Q8KA 2JA6G 3CC2A 4OIJA 2R61A 3T1YQ 3IKJA 1SEBD 1YVCA 4G7OC 1JE5A 4RKBA 3HG9A 1STYA 2EJMA 1SDFA 3HOWH 2WKDA 3NP8A 4OGQC 1PYBA 1SE2A 1SMYC 4H0LC 4XDXA 4M1UB 3GTKH 3C3LA 2LS01 2GN5A 2BE5C 4X66Q 1WVLA 4QGUA 1WTQA 2Q8TA 2QEXA 1EUJA 1O7ZA 2R7ZG 5JAVA 1MSHA 1VQJA 1YNND 3P1HA 2MO1A 3KLWA 2F0PA 3CHBD 3HOUH 4DN4M 1B3QA 2KENA 1KABA 1JC7A 2D9UA 4LWCA 4GOPB 5M3FB 1QNKA 3ULLA 4YHHL 1GUGA 2CVRA 4XYOA 5IGFA 1V9PA 1U5KA 4K5XA 3DWPA 2KEDA 4DV6Q 1EU4A 4LNQA 1YI2A 2E2HB 4A3BG 1V1PA 3S14B 5BR8L 5C3EH 4DR5L 3D4RA 3BDCA 2ICIA 1XPRA 4FVMA 3GTPH 1N36Q 1A6XA 2Q8IB 1VQCA 2RDHA 1TS3A 4DV7L 5FJ8G 1QWYA 3X3MA 4ZRZA 2Z1CA 1ML0D 4J8QA 4A3MB 3FPUB 3DEOA 2F0QA 3KOJA 4QY7A 1JMCA 1AEXA 3HS0C 3HZXA 3UDXA 1YITA 3VA5A 2K33A 1PV4A 3CD6A 4LFCQ 1F9SA 1EY4A 1B9MA 4RCNA 5IYBH 1LTRD 2L4NA 4F7XA 4R4TA 4A3CG 1VQ7A 2C35B 1VMPA 5M5XB 4WJWA 1RCVD 4LUOA 1ZYRD 1AZPA 3U4ZA 5C5LA 5M3MG 3U9SA 1FGUA 4PNYA 5KYIA 1STBA 2FMMA 3RNUA 4ME3A 1QVFA 1CA5A 1A0IA 2ZTDA 4TQUS 4HIDA 3VA7A 1VQ6A 4OO1I 1V1OA 3LWUA 4IPHA 3S2DB 3SXHA 3GTQH 1D2BA 5BR8Q 3L9AX 1GJXA 3H09A 4B3SL 3FHWA 4DV7Q 4KJOA 4A3FB 2A8VA 3I4MG 2EQSA 4FDBA 3I2ZA 1NSNS 4A3JH 4JOIC 4IUPA 4FXDA 4JI1Q 1SYBA 4HCSA 1HNXL 4YY3L 4NKLA 4BY1G 4A3GG 2V1CC 1PFSA 1MD2D 1G2TA 5KNDA 2IJ0A 2EJGC 1HA5A 3GV6A 5J1ZA 3PO3G 4B3RQ 4DNRB 3TS2A 5G3LF 1GHJA 1HXYD 4DAMA 4DR2L 1ASZA 1G91A 1QOHA 4FF1A 3KF8A 4R9WA 2E74C 2FFKB 2HIVA 1XTCD 2NZ1D 4KMUC 2VY3A 1ZYRC 1IL2A 2CQOA 2RSNA 4B08A 5EJWA 2JA6H 4ZKBB 3GTLB 2TMPA 1EOVA 3T56B 1VQBA 3GTGB 4XIGS 2XVSA 3I70A 4DA2A 4IZ8A 3CP0A 1HRJA 4JBWA 5ELDA 2NVTB 2KHSA 2WACA 5T1GA 3PIP3 4NMZA 5JJZA 1BCPD 1VF5C 4ZK9B 4KN4C 5JPMC 2OQ0A 3URYA 2R7ZH 1K28A 1UUPA 4B3SQ 1XXGA 2IWHA 2PCFB 1LABA 3MAQA 2EPBA 3PUWA 1HPCA 2Q2HA 1CQVA 1NNXA 1VQGA 3A5ZB 2B63G 4YY3Q 3ULPA 3CCQA 2UU9L 1PLFA 5E1FA 1XWEA 1PTOD 5LMNL 3A56A 1TWFB 3BG3A 2QILA 4ZYSA 2RCFA 4CJ1B 1HUNA 1TT2A 4JBKA 1W6KA 4RGMA 3SDZA 4A3BH 4DR2Q 4I7ZC 4CDCC 3S15B 4CDEC 2NVXH 1XJVA 4OWXB 3K57A 4IUNA 3G6EA 2CW0D 1IBKL 2VL6A 3AFQA 1WD0A 3D3RA 2F0LA 3M4YA 4JC0A 2G9HD 5FJ8H 2KQ3A 4QIWE 3S1RH 3LNNA 2E5LL 3LX0A 3T53B 1NY4A 3OTOL 3STBD 3FKIG 1HQRD 3BZKA 4EQOA 1B53A 1STGA 3V05A 1E7ZA 3S17B 1WTHA 2KCMA 2Z6KC 1QB5D 2PYKA 3KUPA 3D4WA 2VQEQ 1RKNA 2L5TA 1Y69U 1JR0D 2B2TA 1YNXA 1YZ6A 2RQXA 5IOCA 2EY6A 1M4VA 1QG7A 2AMCB 2RDGA 4M8AA 2NN6G 3NTHA 4R4OA 5CBEE 2ZM6Q 4DUYQ 4GKJQ 5DLQE 1TKWB 4DUZL 4A3KG 4UP7A 4A3CH 3SK6A 1YIJA 3P75A 5EBDA 5AJ3L 1K0SA 3M85A 4DR6L 1BOSA 4NDXA 3TZUA 3T1HQ 1D8LA 5M3MH 2EYOA 3ONAB 2DJGC 3FMCA 5CMDA 1OXUA 2L12A 4HN7A 2F4IA 2QEJC 1STAA 2RKSA 4IQZA 1CHPD 5LMNQ 1O7YA 2QW7A 2IPKD 4DK3C 1OXTA 4RAUC 5M9OA 5JJLA 4B3ML 4OELB 1VQ5A 2BCOA 2C5CA 3DWQA 2H1EA 2R6GA 4Q0FA 2F3WA 4KHVA 5M5YH 1EY7A 2D62A 3HKZB 3I4NH 2CW0C 1KD1C 1HA6A 1KHIA 3HOYG 2FINB 1IBKQ 1E3PA 1YHAA 2K4KA 4HJAA 1X6OA 2EJFC 3I4MH 2R7DA 4IOAA 3NELA 1KNAA 1JORA 1IBLL 4AIMA 2E5LQ 4HJ7A 5E4XA 3OTOQ 4RHSA 3JC66 2OF1A 4A3IB 1QE6A 4BY1H 4A3GH 3W1BA 1TWCB 5JEAG 1O78A 3M4OH 2UXDL 3ULJA 3K5NA 1EU3A 3OHXC 3CQZB 2UXBQ 1B7YB 1DGSA 1JOOA 4K2KA 4DUZQ 4C2MB 4K8IA 3RMHA 3D6CA 1DD2A 3DWAA 4A3MG 3Q8DA 4DR4L 5AJ3Q 1SR3A 2L1BA 3VR2A 1I4PA 1VQNA 3J7AF 3VR5A 3D6WA 1I3QH 1NR4A 4HR7B 1MSGA 2F0EA 4X64Q 2LFNA 2Q2IA 3RLFA 3F1ZA 3BS1A 1DM0B 4B3MQ 2DNEA 1RTOA 2B2YC 5LHY1 4EQ5A 4G7ZC 3CCMA 4OIKA 2D0OA 4HJ8A 2EYMA 3CPFA 2DGYA 2O4XA 3SK8A 4BWGB 1K8GA 4JVZA 1OXXK 4N9PA 1SNPA 3RN5A 2LSSA 4UDUC 3T16A 5FOBB 1T5EA 3HKZE 3GTMB 4KHPL 1G6ZA 1IXRA 3A8IE 1IBML 1PXUA 3NBIA 2B63H 3CCSA 1KNEA 2WAQB 4AQYQ 3K5MA 2ZXRA 4FP5D 4KJNA 3I73A 1L1OA 4LFBQ 2WINB 2UXDQ 1Q46A 4JOIA 3K7UC 1EWIA 2F0GA 2IW3A 4A3FG 5KYLA 3R3OA 1K83H 3IRBA 4L8JA 5C3WA 1WTXA 5CORA 2J4XA 5EKIA 2F0TA 4K8JA 3RZDB 3W2DA 2FJ2A 4C3JG 4OWWB 2AUJD 4CKEA 1JQYD 4O42A 1JWMD 3CCVA 1LT4D 2Z4HA 1Y1WG 4LF6Q 1VQOA 5M5WH 3FKIH 3PV0A 1K8AC 3G4SA 1X65A 3S9WA 1Q86C 2M2LA 3CW2C 4LF5L 2AWNA 4XYQA 1KAWA 4IFDJ 1JICA 1ESRA 2B8FA 4JI6L 3K59A 4IOCA 3NBHA 4X6AH 4QCLA 4A3KH 4JI8L 3A0JA 1XMQL 3A54A 4J15A 4A4IA 5I9PA 2VQFQ 2SNSA 2DNCA 4KHPQ 2A69D 3RLOA 1EFWA 4RHRA 1Z47A 1IBMQ 2M00A 4JBMA 1SFOH 5IT9c 4UPAA 5T1IA 4DR1Q 3K6OA 1ET9A 3I56A 3FP9A 3H3VH 2B29A 1W6JA 1Y1VB 1QVCA 2F0KA 3H91A 4HIKA 5EBCA 2FHTA 4H13C 3R2IA 3GQBA 1HNWL 3NTIA 2H5XA 2ATWA 4GNXC 3AMUA 1H9RA 3HOYH 3PUZA 1PFNA 4RG1A 4HEDA 1K8MA 1S5CD 2ZXPA 5G3LD 1VQIA 2NBFA 2IT1A 2A68D 2YTXA 2A6EC 1C0AA 5KIXA 1WOCA 3K0XA 5CV9A 2SOBA 2XGTA 4MNOA 5EGTA 2R93G 3HP3A 3GO5A 3K81C 1SYFA 2HDLA 5D14A 3S14H 4DK6C 1VS0A 5CV7A 4K0KL 4LF5Q 4LF9L 4L63B 4F87A 4P73A 1C4QA 3S1NB 1XNRL 1RODA 4JI6Q 2UUAL 4PG3A 1HHVA 3J81E 3CU7A 3H94A 4JI8Q 2KA7A 1XMQQ 4UP8A 4A3MH 3TMEA 2A69C 2H4OA 3I3CA 4JK1C 5CV8A 3ICEA 3HOZB 1GKHA 4DAVA 1HZBA 3I4OA 3EBEA 3QG1A 2EYHA 4NXMQ 3DUZA 3TZDA 1CKMA 1RL2A 3CCEA 4HMIA 4BBSG 1PYSB 3MC0B 4DV1L 1R4QB 1T9HA 4CBVA 3KJPA 4LUVA 4KY7A 2G9DA 3I4LA 3HOVB 3CPWA 1C9OA 1SMYD 4E6IA 1F2LA 1JJ2A 1X3GA 1J9OA 2SEBD 1EZ8A 1LACA 4KD4A 4R8NA 2YYZA 1BCPB 2XTIA 1EFID 4ODGA 4Y7NH 4PV1C 2K6AA 2GA4B 3A7LA 1ZXTA 3KJOA 3HKZG 1H9JA 2NB0A 4K0KQ 4LF9Q 3I72A 3DM3A 4GLAC 3EFXD 2PO4A 3OIPA 1CFMA 4A3FH 3RZOH 1KC8C 1HR0Q 3DM1A 4UHVA 1QUQB 5A2QL 1PZKD 2OWOA 4C3JH 3NHHA 1Y8PB 4LUZA 1MGSA 1JE4A 1OXVA 1SNMA 2RF4A 2BDOA 3I8ZA 4A3DB 1QILA 3A74A 5I6YA 4RFBA 3PIO3 1Y1WH 5BN4A 1GUTA 1QVGA 2B2WA 1VQMA 5ELNA 3H15A 3QB3A 4GOPA 1Q8IA 4F8MA 2E2JB 2CCZA 1ENFA 3HOXB 4KKSA 4DV1Q 3R8BA 3M4PA 2BDNA 1SLJA 3S1QB 4LFAL 2EDGA 4DR3Q 1EIYB 3GTLH 1U4RA 3PO2G 3GTGH 5IGEA 1LT6D 5C0XJ 2RHQB 4IUUA 2XWJB 5F2DA 4WFN3 2MNAA 4F88A 3M3YB 1IKLA 1I6VC 2NVTH 1BBWA 4DXGA 4IUVA 1FNVA 1DZ1A 2CKZB 2HIXA 3LWEA 2JP1A 3J80c 4BXXG 2EXZA 1G51A 1JB7A 4GN3B 3KF6A 1UNSA 3BZDB 1F9QA 2BH8A 3PF5A 5DEHA 1G8ZD 3OPOA 1YNJD 2K5WA 4DR7Q 4WJ3M 4A3EB 4B3TL 4C3HG 1RF2D 1QJOA 4ZUIA 4GS3A 3GTJH 1AE2A 1TWFH 3E6ZX 4KKUA 1N9WA 1X3QA 5JPNC 2YV5A 2R93H 4LF8L 2JA8H 1II3A 4AYBB 2K04A 2F03A 2UUCL 1EY9A 3PUYA 4BY7G 3DXJC 3K0YA 1PRTF 4GN5A 4LFAQ 3WDNA 1ZEQX 3TREA 5K36H 3KF6B 2NUCA 4C3IB 3S16B 2OXPA 2CH4A 1Y8OB 1R9TB 2DJFC 3H0GG 2IL8A 1N33L 4A93B 2LXJA 4NXNL 3S17H 2JN4A 3S2HB 4JBJA 3GTOB 2RSOA 1YEZA 4YWKA 1FL0A 4GKKL 1Q3LA 2VUMB 3MZ5A 1CI3M 1MIUA 4HSPA 1SRUA 4BBSH 1BQQT 1CTMA 2UXCL 1DCZA 1PMRA 5KNBA 1YNJC 3K7AB 4K5VA 2WFWA 1HR0W 4XXEA 1H9SA 4YHHQ 1SAPA 1PH1A 1E2ZA 2OTJA 2PI2E 3SVMA 4J1MA 5GAGC 1EQTA 3UDFA 1Y1VG 1TY2A 4QMGA 3TP7A 4ID6A 4DV3L 4DR5Q 5C4XB 4ZUJA 1H9KA 1JT8A 1VQEA 1BBXC 4LF8Q 3QOLA 4IUQA 3GD7A 2RDFA 3NQIA 1B3AA 3OYYA 1FR3A 2NVQB 4PZ8A 4XQNA 4AH6A 5FLMG 1D5ZC 3MEHA 1A2TA 1STEA 1PH9A 4JI4L 3GDEA 1KLUD 1JOQA 3MFGA 2JA5G 2O5IC 2K03A 3FEWX 1H9SB 2VW9A 5IGDA 2Y0SB 5C44B 1TWCH 4KY6A 2Q2TA 2A73B 2PQAA 5GAHC 2OTLA 5A2QE 4CDFC 4OX9L 3T13A 2VZAA 4GKKQ 1D7QA 4NB3A 3E0EA 4X65L 1CSQA 2L15A 4GNXB 1DYQA 4ZQ3A 1PA6A 3TS0A 1EYCA 2WIIB 3HOZG 2SNMA 4LF4L 1I6HH 1EQVA 4LW1A 4V0BA 3DMUA 5IT9L 4H7BA 2MPMA 2F0FA 3PO2H 3HRZC 4O2DA 3F8TA 3EVQA 2ZT9C 4KK7A 4C1NI 3KLSX 4QF4A 3VYRA 2ICEC 4DV3Q 3O13A 3QR8A 1JB3A 1L2FA 2B8GA 2VB2X 4BXXH 1KDAA 3GTKB 3PIOA 3UE0A 1G2SA 2JQOA 5EPLA 3CKIB 2XIWA 4HJ9A 2PQAB 4JCVE 2BH2A 3S1MH 1HNXQ 1UEBA 2KCCA 3V96A 4DPGA 3CMEA 3GTMH 3P7JA
chains in the Genus database with same CATH topology
4C1NK 3TSSA 3OSOA 1PDQA 4CKBA 5BN3A 4IFDG 5FK9C 3MWYW 3Q23A 1B9NA 2PW7A 4K2LA 1CT1D 3C1EA 1S5ED 1A15A 1S4ZA 4DFAA 1BUVT 1WTRA 1CHQD 1TIID 5ELEA 5D3IB 2B2VA 5C3EB 4OHJA 1EWHA 3GTPB 1E2WA 1LTBD 2K5DA 3G6JB 1SNOA 5BN5A 3MXGA 1OO9B 2DY7A 4MN3A 1NUCA 3SE0A 2D2CC 4TKOB 1J8IA 1ESFA 3NQTA 2IX0A 1X3PA 4RGOS 1HQMC 1TY0A 4RCOA 3QWNA 1A2UA 1V8QA 4BA2I 4ZLTF 5EPJA 1S5FD 1B2TA 3EQLC 2KECA 2O2LD 3NUCA 4C56C 2PZTA 1CK1A 4GZYC 1TS4A 1Y8NB 2F0MA 1GUSA 1IKMA 5D65A 2LMCB 4DK0A 4CJ2C 5TSSA 2QCPX 2Z4IA 1LO5D 3Q22A 5AFWA 1TS5A 2YU9B 4LAAA 3SK4A 2IX3A 3SR1A 2CQAA 2NN6I 5KGUA 4L6TB 1ET6A 3AB9A 3C46A 2MHVA 3WOEA 2R3ZA 3NSWA 2J7ZA 1TU2B 5KNCA 3SK5A 4YIJA 4C3IG 5ISRA 5D3DA 2MJ8A 3FRPB 3E0JA 2QDBA 3N52A 5EPKA 3J80L 3A8KE 2EVBA 2L11A 2LY7A 2XWBB 3PUVA 4R8IA 3M7GA 1K8OA 5IT9E 4EVOA 2RBMA 2EYPA 2F3VA 2EZVA 3HEJA 3PMFA 1TWAB 1D1KA 3TDQA 3ITPA 1AN8A 2O5JC 1JWSD 4IFDH 1EY5A 1AW7A 4G7HC 4ABNA 1PRTD 2WB1B 5J22A 2F0SA 5C3XA 1EY6A 1TR5A 3P20A 3BDOA 5C0XG 1I50B 3G7LA 2E2IB 2K28A 4FF2A 1QNUA 4A3BB 2XNAC 3ND8A 2NVXB 1KDCA 2A6ED 4XQQA 1I4RA 1PTOH 4NW2A 3GV3A 4BS9A 1M8AA 1ENAA 5IGCA 2NN6H 5NUCA 1LTAD 3D4DA 4HSVA 4UAIA 1DONA 2DN8A 3Q6SA 5CV5A 1F2ZA 2BA1A 1R4PB 1HCZA 3K5OA 5JOBA 1NR2A 4FXGC 2E76C 2RA4A 4KHZA 1DOMA 1WTVA 1PRTC 5I2YA 5M3MB 1RHPA 4DAPA 2JYOA 5IGGA 2K01A 2F0OA 1ILPA 5I4DA 1WTOA 3TBIB 4RH6A 4PMBA 1HFGA 2DY8A 4KV6A 2WP8J 2NWGA 5M5YB 3I4NB 4B9WA 5DM73 1RJTA 2F0WA 4FNFA 1VCIA 5JEAH 1RDPD 4HCEA 4OL7A 5HGTA 4KI0A 4KKTA 3D31A 2JA7B 2OT2A 4BY1B 4A3GB 1EL0A 2MUYA 1SJHD 1MBYA 4XTCS 3PUXA 4V190 1TQOA 2X69A 1TWGB 4CKCA 4PQXA 4U68A 5LL6X 3OW7A 1C8CA 4WORA 2K5QA 3VR3A 1A3TA 2HCIA 1CZWA 1DOKA 2PW5A 2XRQD 4CHTB 1EOTA 5COYA 2K7VA 3MXNA 4EQNA 1FYCA 5CR3A 1SYCA 1VF7A 2MP1A 1SXTA 3C2PA 1FNWA 1GOZA 2B39A 4Q5VA 4KD3A 3ND9A 1IW7D 2F0HA 2E75C 1A3UA 5EQ0A 3T4AC 2BOSA 2LKVA 4B9XA 4X3KA 1EYAA 3A8JE 1D6EC 1SE4A 2EE1A 1B1ZA 5CYUA 1HTPA 1BDOA 3FPPA 5I9OA 2J0TD 4ULLA 2AQ1B 5CV6A 3NWTA 2VNUD 4FYDA 5C0XH 3GP7A 2NYZD 1ILQA 1Q12A 3NE5B 1JCKB 2D5DA 2RVLA 1EY0A 1FD7D 1XYIA 3R2TA 1LTID 2NTTA 1SNCA 1JWUD 2I46A 1LTTD 3FKIB 5LL6S 1IW7C 2QKIC 1WD1A 2B2YA 4U673 5C6AA 2F1MA 3V2TA 3OOCA 1HTLD 1DXMA 2B2TC 4A3KB 4BBRB 1GUNA 4KY5A 4XT3B 1VDZA 3BVGA 4MHEA 4IALA 2N88A 1SFOB 1GUWA 2PZUA 1TWHB 3MHBA 3OMCA 2A6HC 4DGZA 1EY8A 4FO2A 3DHQA 1NCVA 1F2MA 3NK9A 3VR6A 2PPBC 2WV6D 3HOYB 1EYDA 1UAPA 3FVQA 3A55A 1CA6A 5FO8B 2SDFA 5EKKA 2JE6I 1D5MC 5K5PA 1PZJD 3KK7A 2KJXA 1ENCA 3MTSA 3NXWA 1JOKA 2EY5A 4OO1G 4K6LA 1STNA 5ELCA 3H6MA 3IFDA 4ZAIA 1Z6HA 4NP5A 1WCMB 2JSOA 1B50A 1EEFD 3OIQA 1T5XD 1CZGA 1HFNA 2HDMA 1IYVA 2K1BA 5C4JB 4EGVA 2KVMA 5HURA 3ZYYX 4HAEA 1YNNC 4IURA 5EKLA 1KLGD 5A35A 1QCBD 2JXMB 1AZQA 1V1PB 2K05A 1SYEA 3KLSA 5KEEA 3NTKA 3QO2A 1E2VA 2R92B 2F0VA 2F0NA 4Y7NB 4IUTA 4DK1A 5DM63 2F0IA 2JEAI 2I07B 4H44C 1D1IA 3VYTA 2AWOA 3RZOB 3N6RA 1PRTB 1DOLA 4ME5A 3RD4A 4C3JB 1LT5D 2NVYB 3KBXA 5E3FA 3BDLA 3VYUA 1Y1WB 4RWSC 5IODA 5C5MA 1BF4A 1U4MA 4QIWB 1U4PA 3F2UA 3HOWB 1IHZA 2F0UA 1SSOA 1F9PA 2X6LA 5I2XA 4ZKCB 2E2DC 3Q24A 1EIHA 1V43A 3I90A 1C48A 1F2YA 1AP0A 4K6DA 1FNUA 2C9OA 2Z8LA 2EOTA 4S3SA 1STHA 1F77A 4QB4A 3HOUB 2K32A 3SHLA 3EROA 2PNRC 4RGTA 3OMGA 3IFTA 2PMZB 1PFBA 3JAML 2OEOA 1FGBD 2JEBI 3GTJB 5C4ZA 1LTGD 1WTWA 2F0JA 2L9HA 1I4GA 4WRDA 3D8GA 2XSCA 1LV9A 3WOFA 4FF4A 2R93B 3L7ZC 1VMCA 1D5XC 2JA8B 1IYUA 4TRDA 1KAAA 3MA2B 5ELFA 4OO1H 3MVVA 5DNFA 4DAYA 4IFDI 2B2UC 1H9MA 3VYSA 1AFPA 5FKAC 1Q1EA 1LLRD 2ENBA 3IAYA 1BCPC 1SJED 4O1NA 1EEID 3J7AV 2ID0A 4BA1I 4RKLA 3TP5A 3Q0AA 4BBSB 3DEPA 5ELBA 2AQ3B 2KCNA 3QJYA 3NWSA 1PTOC 5E4WC 2KUMA 2EYFA 1OXSC 3GTQB 3T51B 4J6HA 3E5SA 3HGBA 1LTSD 3C1FA 1I4QA 3CRLC 2BA0A 1BNZA 2TSSA 4A3JB 4XQJA 1SYGA 4HTHA 5CV4A 2WKCA 3MXPA 1PZID 4DF7A 1B44D 4X3TA 3OWFA 4CJ0B 1MI2A 3J81L 3H3VC 1CM9A 4G57A 4PMCA 3BYTB 3FDTA 3AU7A 3OWEB 2B2WC 2JA6B 1RD9D 4RA8A 2MGSA 1I6HB 3PO2B 1DJRD 1L0XB 4KN7C 1Z7TA 2R7ZB 2PQEA 5FLXL 4MIUA 1RTNA 4DU9A 1SYDA 1O80A 1U9RA 2N55A 3BVMA 3S1MB 5IGBA 2KEEA 1ONLA 3U9OA 2XRSD 1SNQA 1BR9A 2HUGA 1U4LA 2V4DA 4QUCA 4C3HB 3IL8A 4LMQD 2AUKA 2X6GA 1SNDA 4ILWA 3JAME 1IL8A 1SBBB 3TN2A 1EIGA 2Q8RE 4BY7B 3S1RB 2L55A 3L3OC 4X3UA 1EWCA 3CRKC 3BVZA 4DXFA 1SE3A 1UEAB 2L0CA 2ZXOA 3H0GB 3BYYB 1I4XA 5JVG3 4XT1B 3A7AB 1GHKA 3ERQA 1ICWA 2EYLA 2XN9C 5C0XI 3EA6A 3NPPA 1NAPA 3I91A 3KBGA 2A5HA 4LK1C 1BO0A 3J7YW 1S5DD 2M9VA 4P2CB 2F0DA 4FF3A 3EJIA 4FXKC 4DNTB 3TP6A 1KDBA 4QUFA 1GXDC 1Q90A 3X3NA 1Q1BA 3K5LA 1PYWD 1S5BD 1I4HA 1BCPF 3I4MB 2QF7A 1GUOA 1LT3D 1PFMA 1BXTA 1F9RA 1A3VA 1CQFA 2EYJA 5J39A 3PO3B 3M7NA 3M4OB 3MFYA 3QIAA 1HUMA 5KRUA 2JA5B 3QOJA 1PTOF 3MXUA 3R93A 2FMCA 5I6WA 2A74C 2B2UA 5C4HA 2VB3X 5K36G 4LJZC 5FO7B 1I3QB 5CC4A 4TSSA 3SEBA 1O7LA 3K58A 1TVXA 4G4KA 3J80E 4KTAA 1G291 5CGKA 1L0YB 2CHBD 3W3AA 3TP8A 4K14A 5JVH3 3KLRA 5JEAJ 2IX1A 5CBAE 1X32A 2B63B 4RGNA 4Z9CB 1WTPA 2A68C 4I65A 1ZKOA 5FLXE 2BE5D 1KTKA 1B4OA 5DAUA 2A6HD 4CGYB 5FO9B 3VR4A 1K83B 4IN3A 1TS2A 2AQ2B 2VXWA 4K5WA 2PZWA 4HMJA 5M5WB 2KOLA 4X3SA 3RUZA 1PTOB 1E0BA 1EZ6A 1XX8A 5IIFA 2EY1A 2B2VC 2HCCA 4N9TA 4EQPA 2NTSA 2HQEA 2EY2A 4PMWA 3UI2A 4OIJA 2R61A 3IKJA 1SEBD 4G7OC 4RKBA 3HG9A 1STYA 2EJMA 1SDFA 2WKDA 3NP8A 4OGQC 1SE2A 4XDXA 1SMYC 4H0LC 4M1UB 3C3LA 2LS01 2BE5C 1WVLA 1WTQA 2Q8TA 1O7ZA 5JAVA 1MSHA 1YNND 3P1HA 2F0PA 3CHBD 4DN4M 1KABA 1JC7A 2D9UA 5M3FB 1QNKA 1GUGA 2CVRA 4XYOA 5IGFA 4K5XA 3DWPA 2KEDA 1EU4A 2E2HB 1V1PA 3S14B 3D4RA 3BDCA 2ICIA 4FVMA 1A6XA 2Q8IB 2RDHA 1TS3A 1QWYA 3X3MA 4ZRZA 2Z1CA 1ML0D 4J8QA 4A3MB 3FPUB 3DEOA 2F0QA 1AEXA 3HS0C 3HZXA 3VA5A 2K33A 1F9SA 1EY4A 1B9MA 4RCNA 1LTRD 2L4NA 4F7XA 1VMPA 5M5XB 4WJWA 1RCVD 1ZYRD 1AZPA 5C5LA 3U9SA 4PNYA 5KYIA 1STBA 2FMMA 1CA5A 4TQUS 3VA7A 4OO1I 1V1OA 3LWUA 3S2DB 3SXHA 1D2BA 3L9AX 1GJXA 3H09A 4KJOA 4A3FB 1NSNS 4IUPA 4FXDA 1SYBA 4HCSA 4NKLA 1MD2D 1G2TA 5KNDA 2IJ0A 2EJGC 1HA5A 3GV6A 5J1ZA 4DNRB 5G3LF 1GHJA 1HXYD 1G91A 1QOHA 4FF1A 3KF8A 4R9WA 2E74C 2FFKB 2NZ1D 1XTCD 4KMUC 1ZYRC 2RSNA 4B08A 5EJWA 4ZKBB 3GTLB 2TMPA 3T56B 3GTGB 4XIGS 2XVSA 3I70A 4DA2A 4IZ8A 1HRJA 4JBWA 5ELDA 2NVTB 2KHSA 2WACA 5T1GA 3PIP3 4NMZA 5JJZA 1BCPD 1VF5C 4ZK9B 4KN4C 5JPMC 3URYA 1UUPA 1XXGA 2IWHA 2PCFB 1LABA 3MAQA 2EPBA 3PUWA 1HPCA 1CQVA 1PLFA 5E1FA 1XWEA 1PTOD 3A56A 1TWFB 3BG3A 2QILA 4ZYSA 4CJ1B 1HUNA 1TT2A 1W6KA 4RGMA 3SDZA 4I7ZC 3S15B 3K57A 4IUNA 2CW0D 1WD0A 3D3RA 2F0LA 3M4YA 2G9HD 2KQ3A 3LNNA 3LX0A 3T53B 1HQRD 4EQOA 1B53A 1STGA 3V05A 3S17B 3D4WA 1QB5D 2PYKA 3KUPA 1Y69U 1RKNA 2L5TA 1JR0D 2B2TA 2RQXA 5IOCA 2EY6A 1M4VA 1QG7A 2RDGA 4M8AA 2NN6G 3NTHA 5CBEE 1TKWB 3SK6A 3P75A 5EBDA 3M85A 1BOSA 4NDXA 3TZUA 2EYOA 3ONAB 3FMCA 5CMDA 1OXUA 2L12A 4HN7A 2F4IA 2QEJC 1STAA 2RKSA 4IQZA 1CHPD 1O7YA 2IPKD 1OXTA 4RAUC 5M9OA 2BCOA 2C5CA 3DWQA 2H1EA 2R6GA 4Q0FA 2F3WA 4KHVA 1HA6A 1EY7A 2D62A 3HKZB 2CW0C 2FINB 2EJFC 1KNAA 1JORA 5E4XA 4RHSA 2OF1A 4A3IB 1QE6A 1TWCB 5JEAG 1O78A 3K5NA 1EU3A 3OHXC 3CQZB 4K2KA 1JOOA 4C2MB 4K8IA 3RMHA 3D6CA 1DD2A 3DWAA 2L1BA 3VR2A 1I4PA 3J7AF 3VR5A 3D6WA 1NR4A 4HR7B 1MSGA 2F0EA 2LFNA 3RLFA 3BS1A 1DM0B 2DNEA 1RTOA 2B2YC 5LHY1 4G7ZC 4OIKA 2EYMA 3SK8A 2O4XA 4BWGB 1OXXK 4N9PA 1SNPA 4UDUC 3T16A 5FOBB 1T5EA 3GTMB 1G6ZA 3A8IE 1PXUA 3NBIA 1KNEA 2WAQB 3K5MA 2ZXRA 4FP5D 4KJNA 3I73A 2WINB 2F0GA 2IW3A 5KYLA 3R3OA 4L8JA 5C3WA 1WTXA 5CORA 2J4XA 5EKIA 2F0TA 4K8JA 3RZDB 3W2DA 2FJ2A 4C3JG 2AUJD 4CKEA 1JQYD 4O42A 1JWMD 1LT4D 2Z4HA 3PV0A 3S9WA 2M2LA 2AWNA 4XYQA 4IFDJ 1JICA 1ESRA 2B8FA 3K59A 3NBHA 4QCLA 3A54A 5I9PA 2SNSA 2DNCA 2A69D 4RHRA 1Z47A 2M00A 5T1IA 3K6OA 1ET9A 1W6JA 1Y1VB 2F0KA 3H91A 5EBCA 2FHTA 4H13C 3R2IA 3GQBA 3NTIA 3AMUA 1H9RA 3PUZA 1PFNA 4HEDA 1K8MA 1S5CD 2ZXPA 5G3LD 2NBFA 2IT1A 2A68D 2A6EC 5KIXA 5CV9A 2SOBA 5EGTA 3HP3A 3GO5A 1SYFA 2HDLA 5D14A 5CV7A 4L63B 4F87A 1C4QA 3S1NB 1RODA 1HHVA 3J81E 3CU7A 3H94A 2KA7A 3TMEA 2A69C 2H4OA 3I3CA 4JK1C 5CV8A 3HOZB 4DAVA 3QG1A 2EYHA 3DUZA 3TZDA 4HMIA 3MC0B 1R4QB 4CBVA 4KY7A 2G9DA 3I4LA 3HOVB 1SMYD 4E6IA 1F2LA 1J9OA 2SEBD 1EZ8A 1LACA 4KD4A 4R8NA 2YYZA 1BCPB 1EFID 4ODGA 4PV1C 2K6AA 2GA4B 3A7LA 1ZXTA 1H9JA 2NB0A 3I72A 3EFXD 2PO4A 3OIPA 1CFMA 3DM1A 5A2QL 1PZKD 3NHHA 1Y8PB 1MGSA 1JE4A 1OXVA 1SNMA 2BDOA 3I8ZA 4A3DB 1QILA 5I6YA 4RFBA 3PIO3 5BN4A 1GUTA 2B2WA 3QB3A 1Q8IA 4F8MA 2E2JB 1ENFA 3HOXB 4KKSA 3R8BA 2BDNA 3S1QB 2EDGA 1U4RA 5IGEA 1LT6D 5C0XJ 4IUUA 2XWJB 5F2DA 4WFN3 4F88A 3M3YB 1IKLA 1I6VC 4DXGA 4IUVA 1FNVA 1DZ1A 3LWEA 2JP1A 2EXZA 1UNSA 3BZDB 1F9QA 5DEHA 1G8ZD 3OPOA 1YNJD 2K5WA 4A3EB 4C3HG 1RF2D 1QJOA 4ZUIA 3E6ZX 4KKUA 1X3QA 5JPNC 1II3A 4AYBB 2K04A 2F03A 1EY9A 3PUYA 3DXJC 3K0YA 1PRTF 3WDNA 1ZEQX 5K36H 2NUCA 4C3IB 3S16B 2OXPA 1Y8OB 1R9TB 2IL8A 4A93B 3S2HB 3GTOB 2RSOA 1Q3LA 2VUMB 3MZ5A 1CI3M 4HSPA 1BQQT 1CTMA 1DCZA 1PMRA 5KNBA 1YNJC 3K7AB 4K5VA 4XXEA 1H9SA 1SAPA 1E2ZA 3SVMA 4J1MA 1EQTA 1TY2A 4QMGA 3TP7A 4ID6A 5C4XB 4ZUJA 1H9KA 1BBXC 3QOLA 4IUQA 3GD7A 2RDFA 3NQIA 1B3AA 1FR3A 2NVQB 4XQNA 1D5ZC 3MEHA 1A2TA 1STEA 1KLUD 1JOQA 3MFGA 2O5IC 2K03A 3FEWX 1H9SB 5IGDA 2Y0SB 5C44B 4KY6A 2A73B 5A2QE 3T13A 1DYQA 4ZQ3A 1EYCA 2WIIB 2SNMA 1EQVA 4V0BA 3DMUA 5IT9L 4H7BA 2MPMA 2F0FA 3HRZC 3EVQA 2ZT9C 4KK7A 4C1NI 3KLSX 4QF4A 3VYRA 2ICEC 3O13A 1JB3A 2B8GA 2VB2X 1KDAA 3GTKB 1G2SA 5EPLA 3CKIB 2XIWA 2KCCA 3V96A 3P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSS A;  1QIL A;  2AQ3 B;  4RFB A;  1D6E C;  1HQR D;  1SE4 A;  1B1Z A;  5FK9 C;  1S5C D;  1PTO C;  4BWG B;  3V05 A;  1CT1 D;  1D5M C;  4TSS A;  3SEB A;  1SBB B;  1PZJ D;  1ENF A;  1JR0 D;  2AQ1 B;  4UDU C;  1S5E D;  3CHB D;  1M4V A;  2RDG A;  3R8B A;  1PRT C;  1LTS D;  1MD2 D;  2IJ0 A;  1EWC A;  1I4Q A;  1HA5 A;  3GP7 A;  5D3D A;  1L0Y B;  1TY2 A;  2CHB D;  3BVZ A;  4K6L A;  5ELC A;  4DXF A;  4L63 B;  1SE3 A;  2TSS A;  1FNU A;  1HXY D;  1CHQ D;  2Z8L A;  1JCK B;  5ELE A;  1EEF D;  1LT6 D;  5D3I B;  1T5X D;  5I4D A;  3BYY B;  1I4X A;  3DWP A;  4OHJ A;  1F77 A;  1PZI D;  4RH6 A;  1XTC D;  1EU4 A;  1FD7 D;  1LTB D;  1B44 D;  4DXG A;  1FNV A;  2XN9 C;  1V1P A;  2QEJ C;  1CHP D;  3EA6 A;  2IPK D;  3R2T A;  1LTI D;  4RGT A;  2ICI A;  2NTT A;  4RGN A;  4Z9C B;  2J4X A;  1JWU D;  3W2D A;  3BYT B;  2RDH A;  1TS3 A;  1D5Z C;  1UNS A;  3BZD B;  3DWQ A;  1ESF A;  1LTT D;  1JQY D;  1FGB D;  1KTK A;  1KLG D;  1S5D D;  1STE A;  1KLU D;  4RGO S;  1JWM D;  3MFG A;  1V1P B;  5ELD A;  1TY0 A;  1G8Z D;  1RDP D;  1LT4 D;  1LTG D;  4RCO A;  1BCP D;  3OWE B;  3MC0 B;  1AN8 A;  1JWS D;  1RD9 D;  1I4G A;  1S5F D;  1TS2 A;  1RF2 D;  2AQ2 B;  1AW7 A;  1HTL D;  3URY A;  1UUP A;  1SJH D;  2O2L D;  1PRT D;  1D5X C;  1XXG A;  4C56 C;  4RHS A;  1CK1 A;  1PYW D;  1DYQ A;  1TS4 A;  1S5B D;  1CQV A;  1I4H A;  1LTR D;  5ELF A;  3BVG A;  1BCP F;  1DJR D;  1L0X B;  2SEB D;  1PTO B;  5TSS A;  1RCV D;  1BCP B;  1EFI D;  1EU3 A;  1LO5 D;  1LT3 D;  1PRT F;  1PTO D;  2XNA C;  1TS5 A;  5FKA C;  1LLR D;  1BXT A;  2XRQ D;  4RHR A;  2QIL A;  1I4R A;  4ZYS A;  1PRT B;  3KLS X;  1PTO H;  1BCP C;  2NTS A;  3DWA A;  3O13 A;  3EFX D;  4RGM A;  1ET9 A;  1SJE D;  4O1N A;  1EEI D;  1I4P A;  1LT5 D;  2R61 A;  3BVM A;  1SEB D;  1SXT A;  1FNW A;  1GOZ A;  2XRS D;  2WV6 D;  1V1O A;  3R2I A;  1PZK D;  4L6T B;  1PTO F;  1SE2 A;  1ET6 A;  1LTA D;  2G9H D;  5ELB A; 
#chains in the Genus database with same CATH topology
 4C1N K;  3TSS A;  3OSO A;  1PDQ A;  4CKB A;  5IP9 G;  1QZG A;  5BN3 A;  2Q2U A;  4L5R C;  4IFD G;  5FK9 C;  3MWY W;  2UUB L;  3Q23 A;  1GM5 A;  1B9N A;  2PW7 A;  4K2L A;  4C3H H;  1CT1 D;  1LUZ A;  3C1E A;  3PF4 A;  4L5Q A;  1S5E D;  5IYD G;  1XPO A;  1A15 A;  1S4Z A;  4OX9 Q;  4DFA A;  3PGZ A;  1BUV T;  1WTR A;  4KLK A;  1CHQ D;  1TII D;  4BY7 H;  3CMA A;  1QZH A;  5ELE A;  5D3I B;  4IO9 A;  2B2V A;  5C3E B;  4OHJ A;  2I5M X;  4LF4 Q;  4OWT B;  1EWH A;  3GTP B;  1E2W A;  1LTB D;  2K5D A;  2GVA A;  3G6J B;  1SNO A;  5BN5 A;  3E9I A;  3MXG A;  1OO9 B;  2DY7 A;  3H0G H;  4MN3 A;  4PZ6 A;  1NUC A;  3SE0 A;  2D2C C;  4TKO B;  2MFI A;  1J8I A;  2ZTE A;  4P71 A;  1ESF A;  3NQT A;  2IX0 A;  1X3P A;  4RGO S;  1HQM C;  1TY0 A;  4RCO A;  3QWN A;  4WJ4 A;  1A2U A;  1V8Q A;  4BA2 I;  4ZLT F;  5EPJ A;  1XMO L;  5E7N A;  1S5F D;  1P8L A;  1B2T A;  1SRO A;  3EQL C;  3KYH C;  2KEC A;  2O2L D;  3NUC A;  4C56 C;  2N78 A;  2UU9 Q;  2PZT A;  1CK1 A;  1PH2 A;  4GZY C;  1TS4 A;  1Y8N B;  5IP7 G;  2UUB Q;  2F0M A;  1GUS A;  1IKM A;  5D65 A;  1N34 L;  1CSP A;  2LMC B;  1LM0 A;  4DK0 A;  1Y1V H;  4CJ2 C;  5TSS A;  2QCP X;  2Z4I A;  1LO5 D;  3Q22 A;  5AFW A;  1TS5 A;  2YU9 B;  4LAA A;  3SK4 A;  5M3F G;  2IX3 A;  3SR1 A;  2CQA A;  2NN6 I;  4JI2 L;  5KGU A;  4DAY B;  1NJI C;  4H02 A;  1BBU A;  4L6T B;  5FLM H;  1ET6 A;  3PO3 H;  4JI7 L;  3AB9 A;  3C46 A;  1SMX A;  1BVS A;  2MHV A;  1NMF A;  2JA5 H;  3J7A 5;  2YTY A;  3WOE A;  1MJC A;  4YCW A;  2R3Z A;  1N32 L;  2P5Z X;  3NSW A;  3H3V I;  4UY8 C;  2J7Z A;  1TU2 B;  1LYL A;  4A3L G;  4DR6 Q;  5KNC A;  3SK5 A;  4YIJ A;  4C3I G;  5ISR A;  3BJU A;  1XMO Q;  1YJW A;  5D3D A;  2MJ8 A;  3FRP B;  3E0J A;  3F2B A;  3HOZ H;  4A93 G;  2QDB A;  3N52 A;  5EPK A;  3J80 L;  3A8K E;  2EVB A;  1N34 Q;  2F3I A;  2L11 A;  1KRT A;  2VUM G;  2LY7 A;  2XWB B;  4HJ5 A;  1VQK A;  3PUV A;  4R8I A;  3M7G A;  1K8O A;  5IT9 E;  4DV4 L;  4EVO A;  2RBM A;  2EYP A;  2F3V A;  2EZV A;  3HEJ A;  1HZA A;  1M1K C;  1IBL Q;  4JI2 Q;  3PMF A;  3LGJ A;  5L37 A;  1TWA B;  1D1K A;  3TDQ A;  3ITP A;  2ES2 A;  3AEV A;  1PVO A;  5IP9 H;  1AN8 A;  2O5J C;  1JWS D;  4JPB W;  4IFD H;  5C4X G;  1EY5 A;  1YBY A;  1AW7 A;  4G7H C;  4JI7 Q;  4ABN A;  1PRT D;  2WB1 B;  5J22 A;  2F0S A;  5C3X A;  4JI3 L;  1EY6 A;  1TR5 A;  3P20 A;  3BDO A;  3OW2 A;  1PH6 A;  5C0X G;  1I50 B;  4X62 L;  1IZ6 A;  3G7L A;  1Q82 C;  2K50 A;  4DR4 Q;  2E2I B;  2K28 A;  4FF2 A;  1VQA A;  1QNU A;  4A3B B;  2XNA C;  3ND8 A;  2NVX B;  1KDC A;  2A6E D;  4TVA B;  1I4R A;  4XQQ A;  1VQP A;  1PTO H;  4NW2 A;  3GV3 A;  3HFZ B;  3U58 A;  4BS9 A;  2Y0S G;  1M8A A;  5LMN W;  1ENA A;  5IGC A;  1B8A A;  1X56 A;  5HY6 A;  2NN6 H;  2E2J H;  5NUC A;  3KFU A;  1LTA D;  3D4D A;  4HSV A;  4UAI A;  3TRZ A;  1DON A;  1KL9 A;  1PH4 A;  2DN8 A;  3Q6S A;  5CV5 A;  1F2Z A;  2BA1 A;  1R4P B;  1HCZ A;  1YJ9 A;  3K5O A;  2ZJR A;  4I7A A;  5JOB A;  1NR2 A;  4FXG C;  3CCL A;  2E76 C;  2RA4 A;  4KHZ A;  1AE3 A;  1I94 L;  1DOM A;  1J5E L;  1WTV A;  1PRT C;  5IP7 H;  5I2Y A;  3CCJ A;  5M3M B;  1RHP A;  2WAQ E;  4DNI A;  5GAD C;  4JI3 Q;  2NZH A;  4DAP A;  2JYO A;  1TXY A;  5IGG A;  2K01 A;  2F0O A;  4X62 Q;  1ILP A;  5I4D A;  1WTO A;  3TBI B;  4RH6 A;  3K8A A;  4PMB A;  1S3O A;  1HFG A;  2DY8 A;  5M3F H;  4KV6 A;  2MO0 A;  2WP8 J;  1PH8 A;  2NWG A;  4IPD A;  5M5Y B;  3I4N B;  4B9W A;  2OCE A;  5DM7 3;  1BKB A;  4DV2 L;  1RJT A;  2E2H H;  2F0W A;  3I7F A;  4FNF A;  1W2B A;  2OQK A;  1VCI A;  5JEA H;  1MKH A;  1RDP D;  3B6Y A;  4HCE A;  4OL7 A;  5HGT A;  4KI0 A;  4KKT A;  2EIF A;  2F52 A;  3JAM c;  3K80 C;  3D31 A;  1M90 C;  2JA7 B;  2OT2 A;  2DUD A;  4BY1 B;  4A3G B;  1EL0 A;  2MUY A;  1SJH D;  2Z6K A;  4A3L H;  1MBY A;  4XTC S;  3PUX A;  4C3I H;  4V19 0;  1TQO A;  2X69 A;  1R9T H;  1TWG B;  4CKC A;  4PQX A;  4U68 A;  5LL6 X;  3OW7 A;  3RN2 A;  4A93 H;  1C8C A;  4WOR A;  2K5Q A;  3VR3 A;  1J5E Q;  1A3T A;  2HCI A;  1CZW A;  1DOK A;  3S2H H;  1QUQ A;  2PW5 A;  2XRQ D;  3E9H A;  4CHT B;  5IWA L;  3PQI A;  1EOT A;  5M5X H;  5COY A;  2K7V A;  3MXN A;  4IJL A;  4EQN A;  1FYC A;  2VUM H;  3S24 A;  5CR3 A;  1SYC A;  1VF7 A;  2MP1 A;  1SXT A;  3C2P A;  1FNW A;  1GOZ A;  2B39 A;  4Q5V A;  4KD3 A;  4HIM A;  3ND9 A;  1IW7 D;  2F0H A;  2E75 C;  2RCN A;  1A3U A;  2K5N A;  1JJC B;  2QA4 A;  5EQ0 A;  2IY5 B;  3T4A C;  2BOS A;  2LKV A;  2YTV A;  4DV2 Q;  4B9X A;  2R7F A;  3T1Y L;  4X3K A;  1EYA A;  3A8J E;  2EXD A;  1D6E C;  1SE4 A;  1NMG A;  2EE1 A;  1B1Z A;  3S2D H;  5CYU A;  1UE5 A;  1HTP A;  2VS1 A;  1BDO A;  1GVP A;  3FPP A;  5I9O A;  2J0T D;  1HNZ L;  4ULL A;  1KIX A;  2AQ1 B;  5CV6 A;  1XNR Q;  2CWA A;  3NWT A;  3UDG A;  2UUA Q;  2VNU D;  4X66 L;  4FYD A;  4ALP A;  5C0X H;  3G71 A;  3GP7 A;  2NYZ D;  1ILQ A;  2ZTC A;  1Q12 A;  4A3I G;  4YWL A;  3MXN B;  3NE5 B;  2G5D A;  1JCK B;  1ICF B;  2D5D A;  1GD7 A;  2RVL A;  1EY0 A;  1FD7 D;  1CUK A;  1VQF A;  1J6Q A;  5GAE C;  1XYI A;  3R2T A;  4PZ7 A;  1LTI D;  2NTT A;  5IWA Q;  1SNC A;  1Q81 C;  1JWU D;  4O0A A;  2I46 A;  1LTT D;  2NZO A;  3FKI B;  3J81 c;  2K14 A;  5LL6 S;  1IW7 C;  1PH7 A;  2QKI C;  1WD1 A;  2B2Y A;  4R4C A;  4U67 3;  5C6A A;  1N36 L;  2F1M A;  1WFQ A;  3V2T A;  3OOC A;  1HTL D;  1DXM A;  2B2T C;  2A19 A;  4A3K B;  4BBR B;  1GUN A;  4DKA C;  1XPU A;  4KY5 A;  4XT3 B;  1VDZ A;  3BVG A;  4MHE A;  1HNZ Q;  1XNQ L;  4IAL A;  3J80 i;  2N88 A;  1SFO B;  1GUW A;  2A1A A;  2HQL A;  2PZU A;  1TWH B;  3MHB A;  4LFC L;  4QQB X;  1VQ4 A;  3OMC A;  2A6H C;  4DGZ A;  1X54 A;  2WAQ G;  1EY8 A;  4FO2 A;  3DHQ A;  1NCV A;  1F2M A;  2Z9H A;  3NK9 A;  5FLX c;  3E3X A;  3VR6 A;  2PPB C;  2WV6 D;  3HOY B;  1JJG A;  1EYD A;  2WB1 G;  3AFP A;  1UAP A;  1EQQ A;  3FVQ A;  4JW0 A;  3A55 A;  3S15 H;  4DV5 L;  1CA6 A;  2N3S A;  1HZ9 A;  5FO8 B;  1EQR A;  2SDF A;  5EKK A;  2JE6 I;  1D5M C;  4ZCK A;  4YWM A;  5K5P A;  1PZJ D;  3KK7 A;  2KJX A;  4YCU A;  2K52 A;  1ENC A;  1K3R A;  3MTS A;  1S72 A;  3NXW A;  1VQ9 A;  1JOK A;  2EY5 A;  4OO1 G;  3EN2 A;  4K6L A;  1STN A;  5ELC A;  3H6M A;  3IFD A;  4ZAI A;  4JI1 L;  5IYC G;  3L2P A;  3PCO B;  1Z6H A;  4NP5 A;  1WCM B;  3CC7 A;  2JSO A;  3M4Q A;  1B50 A;  1EEF D;  3OIQ A;  1T5X D;  1CZG A;  1XNQ Q;  2K5H A;  1HFN A;  2KCT A;  1MJE A;  2HDM A;  1IYV A;  2K1B A;  5C4J B;  4EGV A;  2KVM A;  5HUR A;  4B3R L;  3ZYY X;  4HAE A;  3PSI A;  1SE8 A;  1VQH A;  1YNN C;  4B3T Q;  4IUR A;  5EKL A;  1KLG D;  5A35 A;  1QCB D;  2JXM B;  1AZQ A;  1V1P B;  3DLL A;  4GNX A;  3CAM A;  1X3F A;  3CC4 A;  2K05 A;  1SYE A;  1MHW C;  3KLS A;  5KEE A;  4DV5 Q;  4NPS A;  2UUC Q;  3NTK A;  3QO2 A;  2IHF A;  1E2V A;  2F4V L;  2KBN A;  2YU9 H;  2KHI A;  2R92 B;  4AYB E;  2F0V A;  2F0N A;  1KRS A;  4Y7N B;  4IUT A;  1E22 A;  4DK1 A;  1LTL A;  5DM6 3;  2F0I A;  2JEA I;  3I4N G;  2I07 B;  4H44 C;  4A3I H;  1D1I A;  3VYT A;  1N33 Q;  2AWO A;  2I5H A;  1K73 C;  3RZO B;  4NXN Q;  1L1O C;  2JA9 A;  3N6R A;  1PRT B;  5GQO A;  5JJI A;  1DOL A;  4ME5 A;  3RD4 A;  4C3J B;  1LT5 D;  2NVY B;  3CQZ H;  1FVI A;  4P74 A;  2JA7 G;  3KBX A;  3MEF A;  5E3F A;  2N8N A;  4C2M H;  2UXC Q;  3BDL A;  1YJN A;  2RHS B;  3VYU A;  1Y1W B;  4R4Q A;  4IJH A;  4GN4 B;  4RWS C;  4DV0 L;  1E24 A;  5IOD A;  2ASB A;  5C5M A;  1BF4 A;  1U4M A;  3M9B A;  4QIW B;  2HT1 A;  1U4P A;  3F2U A;  3HOW B;  1IHZ A;  4L5S A;  2F0U A;  1SSO A;  4CDD C;  1F9P A;  2X6L A;  5I2X A;  4ZKC B;  2E2D C;  3Q24 A;  1EIH A;  1N8R C;  1V43 A;  3I90 A;  2F4V Q;  3HOV G;  1C48 A;  1F2Y A;  1AP0 A;  4JI5 L;  4K6D A;  1FNU A;  2C9O A;  2VQE L;  2Z8L A;  4OXP A;  2EOT A;  4MTN A;  2HHH L;  4S3S A;  2N49 A;  1STH A;  1F77 A;  2ZM6 L;  4QB4 A;  1HZC A;  2HD3 A;  4DUY L;  4GKJ L;  4JI4 Q;  1TWA H;  5JJK A;  3RLN A;  3HOU B;  2K32 A;  3SHL A;  3ERO A;  2CH4 W;  2PNR C;  3NEN A;  3BU2 A;  4RGT A;  1CKO A;  5LMU L;  1X9N A;  3OMG A;  3IFT A;  2PMZ B;  3T1H L;  3KF8 B;  1PFB A;  4R4I A;  3JAM L;  2OEO A;  1Z9F A;  4QJF A;  1FGB D;  2Y0S E;  1L0W A;  4X65 Q;  3ZJY C;  2JEB I;  3GTJ B;  3RZD H;  5C4Z A;  1LTG D;  1I50 H;  1WTW A;  2F0J A;  2E2I H;  2L9H A;  1I4G A;  4WRD A;  4DV0 Q;  3D8G A;  2XSC A;  1LV9 A;  3WOF A;  1GO3 E;  1PH5 A;  4FF4 A;  4A3D G;  3L7Z C;  1VMC A;  1D5X C;  2JA8 B;  2R93 B;  1IYU A;  2IHE A;  2ZJP A;  4TRD A;  1KAA A;  4YCV A;  2MQH A;  1OTC A;  3MA2 B;  5ELF A;  3HOX G;  4OO1 H;  2JK8 A;  5IYC H;  3MVV A;  5DNF A;  4DAY A;  4IFD I;  1NBW A;  2B2U C;  1H9M A;  3VYS A;  1AFP A;  5FKA C;  1Q1E A;  1LLR D;  1XTD A;  1YHB A;  2ENB A;  3IAY A;  4JI5 Q;  1BCP C;  1SJE D;  4O1N A;  2HHH Q;  1HNW Q;  1EEI D;  3J7A V;  2ID0 A;  4BA1 I;  4RKL A;  5ELO A;  1G6P A;  3CXC A;  3G48 A;  3TP5 A;  2UXB L;  3Q0A A;  3W5O A;  4BBS B;  5IY0 A;  4BBR G;  3DEP A;  4POG A;  5ELB A;  5LMU Q;  2K5V A;  2AQ3 B;  2KCN A;  3QJY A;  4APV A;  3NWS A;  1PTO C;  5E4W C;  4X64 L;  3WWV A;  2KUM A;  2PMZ E;  1X3E A;  1WYD A;  2EYF A;  1YHQ A;  1OXS C;  3GTQ B;  3T51 B;  4A3E G;  4J6H A;  3E5S A;  1WI5 A;  4JG2 A;  3HGB A;  1LTS D;  2B3G A;  2I5L X;  1I4Q A;  3C1F A;  3CRL C;  2BA0 A;  1BNZ A;  2TSS A;  3ER0 A;  4A3J B;  4XQJ A;  1SYG A;  3EIV A;  4HTH A;  2WKC A;  5CV4 A;  1A63 A;  4AYB G;  1E1O A;  3MXP A;  1PZI D;  1EYG A;  2E8G A;  4DF7 A;  4IPG A;  1B44 D;  4X3T A;  3STB C;  3OWF A;  4CJ0 B;  3S1N H;  1MI2 A;  4HIO A;  2D0P A;  3J81 L;  1HH2 P;  2JA7 H;  3H3V C;  1CM9 A;  4AQY L;  4IPC A;  4G57 A;  4PMC A;  3BYT B;  4LFB L;  3FDT A;  4GLV B;  1HJP A;  4P75 A;  3AU7 A;  1TWG H;  3OWE B;  2B2W C;  2JA6 B;  1RD9 D;  3CCU A;  4RA8 A;  2MGS A;  1WCM G;  4GOP C;  1PHJ A;  1I6H B;  1IYJ B;  3PO2 B;  4LF6 L;  1W3S A;  1UWV A;  1DJR D;  1L0X B;  4KN7 C;  1FJG L;  3HOV H;  2QDL A;  1Z7T A;  2R7Z B;  2PQE A;  4LF7 L;  2AHO B;  3KDF A;  5FLX L;  4MIU A;  1RTN A;  4DU9 A;  1SYD A;  1O80 A;  1U9R A;  2N55 A;  3HKS A;  4JV5 L;  4JYA L;  3BZC A;  3BVM A;  3U4V A;  3S1M B;  5IGB A;  1N32 Q;  2KEE A;  2VQF L;  1ONL A;  3U9O A;  2XRS D;  5IYD H;  1SNQ A;  1BR9 A;  2HUG A;  1U4L A;  2V4D A;  4POF A;  4QUC A;  1VQL A;  5GRO A;  2R92 G;  4DR1 L;  4C3H B;  1EIF A;  1E1T A;  3A5U A;  3IL8 A;  1NTG A;  4LMQ D;  2AUK A;  1SN8 A;  2JJQ A;  2X6G A;  1SND A;  3AQQ A;  4ILW A;  2I0Q A;  3JAM E;  1IL8 A;  1SBB B;  3PIP A;  4A3D H;  5C44 G;  3TN2 A;  3F2D A;  3UE1 A;  1EIG A;  2Q8R E;  5IE8 A;  4GLX A;  1K3B C;  3S1R B;  4BY7 B;  2L55 A;  3L3O C;  4MTK A;  3KDF B;  4X3U A;  1EWC A;  1K0R A;  1Y14 B;  3BVZ A;  3CRK C;  4DXF A;  3HOX H;  1B70 B;  1SE3 A;  1UEA B;  2L0C A;  4DV4 Q;  2ZXO A;  3S1Q H;  1V1Q A;  3H0G B;  3BYY B;  1I4X A;  5JVG 3;  4XT1 B;  3A7A B;  1GHK A;  1FJG Q;  3ERQ A;  2QGQ A;  1ICW A;  2EYL A;  2XN9 C;  4JI0 L;  4LF7 Q;  4MZ9 A;  5C0X I;  3EA6 A;  4R1J A;  3NPP A;  3M3Y H;  1NAP A;  3I91 A;  3HOW G;  1L1O B;  3KBG A;  2A5H A;  4LK1 C;  1BO0 A;  4JV5 Q;  4JYA Q;  3J7Y W;  1S5D D;  2LXK A;  4BBR H;  3UDI A;  3TEH B;  2M9V A;  4P2C B;  2F0D A;  4FF3 A;  1K9M C;  2K75 A;  1KXL A;  2WB1 E;  3EJI A;  5EAY A;  1AH9 A;  4FXK C;  4DNT B;  3TP6 A;  4A75 A;  1KDB A;  2ALY B;  4NXM L;  3U50 C;  1TWH H;  2CFM A;  4QUF A;  1GXD C;  1Q90 A;  1NE3 A;  3X3N A;  1Q1B A;  3CF5 A;  3K5L A;  1PYW D;  4A3E H;  1S5B D;  3HOU G;  1I4H A;  1BCP F;  3ERS X;  5HGQ A;  1RIP A;  3I4M B;  1I5F A;  2QF7 A;  3D0F A;  4P72 A;  1GUO A;  1LT3 D;  1PFM A;  4UP9 A;  1BXT A;  1A8V A;  1F9R A;  4N8X 1;  1A3V A;  1CQF A;  2EYJ A;  2Z0S A;  3NBH B;  4EX5 A;  5J39 A;  5C3E G;  1UE6 A;  3PO3 B;  3M7N A;  3NEM A;  1X55 A;  3MFY A;  3JAM i;  3M4O B;  3QIA A;  1HUM A;  5KRU A;  2JA5 B;  3QOJ A;  2JA8 G;  3SGI A;  3S16 H;  2GVB A;  1PTO F;  1C7Y A;  4L5T A;  4JI0 Q;  4RMF A;  1VQ8 A;  3MXU A;  3R93 A;  2FMC A;  1I94 Q;  5I6W A;  2A74 C;  2B2U A;  1HR0 L;  5C4H A;  2VB3 X;  5K36 G;  3J81 j;  4OEM B;  3GTO H;  4LJZ C;  5FO7 B;  1I3Q B;  5CC4 A;  1WCM H;  4TSS A;  5H1S E;  3SEB A;  1O7L A;  3K58 A;  4A76 A;  4Y52 H;  5IYB G;  3VDY A;  1Q7Y C;  1TVX A;  1CKN A;  1O7I A;  3K7A H;  5C4J H;  4G4K A;  3J80 E;  4KTA A;  1G29 1;  5CGK A;  1L0Y B;  2CHB D;  3W3A A;  3J7Z C;  3TP8 A;  4K14 A;  3RR5 A;  5JVH 3;  3KLR A;  5JEA J;  2IX1 A;  5CBA E;  1PH3 A;  2Z6B A;  5C4X H;  4DR3 L;  2FXQ A;  3CCR A;  1KQS A;  1X32 A;  2B63 B;  4RGN A;  4Z9C B;  1WTP A;  2A68 C;  4I65 A;  1ZKO A;  1WJJ A;  5FLX E;  2BE5 D;  1UE7 A;  1KTK A;  2R92 H;  1B4O A;  3W1G A;  1ASY A;  2NVQ H;  5DAU A;  1UE1 A;  2A6H D;  5J3B A;  4CGY B;  5FO9 B;  3VR4 A;  1K83 B;  2CWP A;  3L0O A;  4OON A;  4IN3 A;  4A3J G;  1CKN B;  1TS2 A;  2AQ2 B;  1U0L A;  2VXW A;  4K5W A;  2PZW A;  5C44 H;  2KHJ A;  3I55 A;  4HMJ A;  1P16 A;  4DR7 L;  2PNH A;  3TQY A;  1VQD A;  5M5W B;  2KOL A;  2NVY H;  4X3S A;  3RUZ A;  4DV6 L;  1H95 A;  4N8F A;  1PTO B;  1E0B A;  1EZ6 A;  3AYH B;  1XX8 A;  5IIF A;  1A62 A;  2EY1 A;  2B2V C;  4QL5 A;  2PI2 A;  2HCC A;  4N9T A;  2AKW B;  4EQP A;  2NTS A;  3J81 i;  2HQE A;  2EY2 A;  1S40 A;  3F2C A;  4PMW A;  3UI2 A;  2ZJQ A;  1Q8K A;  2JA6 G;  3CC2 A;  4OIJ A;  2R61 A;  3T1Y Q;  3IKJ A;  1SEB D;  1YVC A;  4G7O C;  1JE5 A;  4RKB A;  3HG9 A;  1STY A;  2EJM A;  1SDF A;  3HOW H;  2WKD A;  3NP8 A;  4OGQ C;  1PYB A;  1SE2 A;  1SMY C;  4H0L C;  4XDX A;  4M1U B;  3GTK H;  3C3L A;  2LS0 1;  2GN5 A;  2BE5 C;  4X66 Q;  1WVL A;  4QGU A;  1WTQ A;  2Q8T A;  2QEX A;  1EUJ A;  1O7Z A;  2R7Z G;  5JAV A;  1MSH A;  1VQJ A;  1YNN D;  3P1H A;  2MO1 A;  3KLW A;  2F0P A;  3CHB D;  3HOU H;  4DN4 M;  1B3Q A;  2KEN A;  1KAB A;  1JC7 A;  2D9U A;  4LWC A;  4GOP B;  5M3F B;  1QNK A;  3ULL A;  4YHH L;  1GUG A;  2CVR A;  4XYO A;  5IGF A;  1V9P A;  1U5K A;  4K5X A;  3DWP A;  2KED A;  4DV6 Q;  1EU4 A;  4LNQ A;  1YI2 A;  2E2H B;  4A3B G;  1V1P A;  3S14 B;  5BR8 L;  5C3E H;  4DR5 L;  3D4R A;  3BDC A;  2ICI A;  1XPR A;  4FVM A;  3GTP H;  1N36 Q;  1A6X A;  2Q8I B;  1VQC A;  2RDH A;  1TS3 A;  4DV7 L;  5FJ8 G;  1QWY A;  3X3M A;  4ZRZ A;  2Z1C A;  1ML0 D;  4J8Q A;  4A3M B;  3FPU B;  3DEO A;  2F0Q A;  3KOJ A;  4QY7 A;  1JMC A;  1AEX A;  3HS0 C;  3HZX A;  3UDX A;  1YIT A;  3VA5 A;  2K33 A;  1PV4 A;  3CD6 A;  4LFC Q;  1F9S A;  1EY4 A;  1B9M A;  4RCN A;  5IYB H;  1LTR D;  2L4N A;  4F7X A;  4R4T A;  4A3C G;  1VQ7 A;  2C35 B;  1VMP A;  5M5X B;  4WJW A;  1RCV D;  4LUO A;  1ZYR D;  1AZP A;  3U4Z A;  5C5L A;  5M3M G;  3U9S A;  1FGU A;  4PNY A;  5KYI A;  1STB A;  2FMM A;  3RNU A;  4ME3 A;  1QVF A;  1CA5 A;  1A0I A;  2ZTD A;  4TQU S;  4HID A;  3VA7 A;  1VQ6 A;  4OO1 I;  1V1O A;  3LWU A;  4IPH A;  3S2D B;  3SXH A;  3GTQ H;  1D2B A;  5BR8 Q;  3L9A X;  1GJX A;  3H09 A;  4B3S L;  3FHW A;  4DV7 Q;  4KJO A;  4A3F B;  2A8V A;  3I4M G;  2EQS A;  4FDB A;  3I2Z A;  1NSN S;  4A3J H;  4JOI C;  4IUP A;  4FXD A;  4JI1 Q;  1SYB A;  4HCS A;  1HNX L;  4YY3 L;  4NKL A;  4BY1 G;  4A3G G;  2V1C C;  1PFS A;  1MD2 D;  1G2T A;  5KND A;  2IJ0 A;  2EJG C;  1HA5 A;  3GV6 A;  5J1Z A;  3PO3 G;  4B3R Q;  4DNR B;  3TS2 A;  5G3L F;  1GHJ A;  1HXY D;  4DAM A;  4DR2 L;  1ASZ A;  1G91 A;  1QOH A;  4FF1 A;  3KF8 A;  4R9W A;  2E74 C;  2FFK B;  2HIV A;  1XTC D;  2NZ1 D;  4KMU C;  2VY3 A;  1ZYR C;  1IL2 A;  2CQO A;  2RSN A;  4B08 A;  5EJW A;  2JA6 H;  4ZKB B;  3GTL B;  2TMP A;  1EOV A;  3T56 B;  1VQB A;  3GTG B;  4XIG S;  2XVS A;  3I70 A;  4DA2 A;  4IZ8 A;  3CP0 A;  1HRJ A;  4JBW A;  5ELD A;  2NVT B;  2KHS A;  2WAC A;  5T1G A;  3PIP 3;  4NMZ A;  5JJZ A;  1BCP D;  1VF5 C;  4ZK9 B;  4KN4 C;  5JPM C;  2OQ0 A;  3URY A;  2R7Z H;  1K28 A;  1UUP A;  4B3S Q;  1XXG A;  2IWH A;  2PCF B;  1LAB A;  3MAQ A;  2EPB A;  3PUW A;  1HPC A;  2Q2H A;  1CQV A;  1NNX A;  1VQG A;  3A5Z B;  2B63 G;  4YY3 Q;  3ULP A;  3CCQ A;  2UU9 L;  1PLF A;  5E1F A;  1XWE A;  1PTO D;  5LMN L;  3A56 A;  1TWF B;  3BG3 A;  2QIL A;  4ZYS A;  2RCF A;  4CJ1 B;  1HUN A;  1TT2 A;  4JBK A;  1W6K A;  4RGM A;  3SDZ A;  4A3B H;  4DR2 Q;  4I7Z C;  4CDC C;  3S15 B;  4CDE C;  2NVX H;  1XJV A;  4OWX B;  3K57 A;  4IUN A;  3G6E A;  2CW0 D;  1IBK L;  2VL6 A;  3AFQ A;  1WD0 A;  3D3R A;  2F0L A;  3M4Y A;  4JC0 A;  2G9H D;  5FJ8 H;  2KQ3 A;  4QIW E;  3S1R H;  3LNN A;  2E5L L;  3LX0 A;  3T53 B;  1NY4 A;  3OTO L;  3STB D;  3FKI G;  1HQR D;  3BZK A;  4EQO A;  1B53 A;  1STG A;  3V05 A;  1E7Z A;  3S17 B;  1WTH A;  2KCM A;  2Z6K C;  1QB5 D;  2PYK A;  3KUP A;  3D4W A;  2VQE Q;  1RKN A;  2L5T A;  1Y69 U;  1JR0 D;  2B2T A;  1YNX A;  1YZ6 A;  2RQX A;  5IOC A;  2EY6 A;  1M4V A;  1QG7 A;  2AMC B;  2RDG A;  4M8A A;  2NN6 G;  3NTH A;  4R4O A;  5CBE E;  2ZM6 Q;  4DUY Q;  4GKJ Q;  5DLQ E;  1TKW B;  4DUZ L;  4A3K G;  4UP7 A;  4A3C H;  3SK6 A;  1YIJ A;  3P75 A;  5EBD A;  5AJ3 L;  1K0S A;  3M85 A;  4DR6 L;  1BOS A;  4NDX A;  3TZU A;  3T1H Q;  1D8L A;  5M3M H;  2EYO A;  3ONA B;  2DJG C;  3FMC A;  5CMD A;  1OXU A;  2L12 A;  4HN7 A;  2F4I A;  2QEJ C;  1STA A;  2RKS A;  4IQZ A;  1CHP D;  5LMN Q;  1O7Y A;  2QW7 A;  2IPK D;  4DK3 C;  1OXT A;  4RAU C;  5M9O A;  5JJL A;  4B3M L;  4OEL B;  1VQ5 A;  2BCO A;  2C5C A;  3DWQ A;  2H1E A;  2R6G A;  4Q0F A;  2F3W A;  4KHV A;  5M5Y H;  1EY7 A;  2D62 A;  3HKZ B;  3I4N H;  2CW0 C;  1KD1 C;  1HA6 A;  1KHI A;  3HOY G;  2FIN B;  1IBK Q;  1E3P A;  1YHA A;  2K4K A;  4HJA A;  1X6O A;  2EJF C;  3I4M H;  2R7D A;  4IOA A;  3NEL A;  1KNA A;  1JOR A;  1IBL L;  4AIM A;  2E5L Q;  4HJ7 A;  5E4X A;  3OTO Q;  4RHS A;  3JC6 6;  2OF1 A;  4A3I B;  1QE6 A;  4BY1 H;  4A3G H;  3W1B A;  1TWC B;  5JEA G;  1O78 A;  3M4O H;  2UXD L;  3ULJ A;  3K5N A;  1EU3 A;  3OHX C;  3CQZ B;  2UXB Q;  1B7Y B;  1DGS A;  1JOO A;  4K2K A;  4DUZ Q;  4C2M B;  4K8I A;  3RMH A;  3D6C A;  1DD2 A;  3DWA A;  4A3M G;  3Q8D A;  4DR4 L;  5AJ3 Q;  1SR3 A;  2L1B A;  3VR2 A;  1I4P A;  1VQN A;  3J7A F;  3VR5 A;  3D6W A;  1I3Q H;  1NR4 A;  4HR7 B;  1MSG A;  2F0E A;  4X64 Q;  2LFN A;  2Q2I A;  3RLF A;  3F1Z A;  3BS1 A;  1DM0 B;  4B3M Q;  2DNE A;  1RTO A;  2B2Y C;  5LHY 1;  4EQ5 A;  4G7Z C;  3CCM A;  4OIK A;  2D0O A;  4HJ8 A;  2EYM A;  3CPF A;  2DGY A;  2O4X A;  3SK8 A;  4BWG B;  1K8G A;  4JVZ A;  1OXX K;  4N9P A;  1SNP A;  3RN5 A;  2LSS A;  4UDU C;  3T16 A;  5FOB B;  1T5E A;  3HKZ E;  3GTM B;  4KHP L;  1G6Z A;  1IXR A;  3A8I E;  1IBM L;  1PXU A;  3NBI A;  2B63 H;  3CCS A;  1KNE A;  2WAQ B;  4AQY Q;  3K5M A;  2ZXR A;  4FP5 D;  4KJN A;  3I73 A;  1L1O A;  4LFB Q;  2WIN B;  2UXD Q;  1Q46 A;  4JOI A;  3K7U C;  1EWI A;  2F0G A;  2IW3 A;  4A3F G;  5KYL A;  3R3O A;  1K83 H;  3IRB A;  4L8J A;  5C3W A;  1WTX A;  5COR A;  2J4X A;  5EKI A;  2F0T A;  4K8J A;  3RZD B;  3W2D A;  2FJ2 A;  4C3J G;  4OWW B;  2AUJ D;  4CKE A;  1JQY D;  4O42 A;  1JWM D;  3CCV A;  1LT4 D;  2Z4H A;  1Y1W G;  4LF6 Q;  1VQO A;  5M5W H;  3FKI H;  3PV0 A;  1K8A C;  3G4S A;  1X65 A;  3S9W A;  1Q86 C;  2M2L A;  3CW2 C;  4LF5 L;  2AWN A;  4XYQ A;  1KAW A;  4IFD J;  1JIC A;  1ESR A;  2B8F A;  4JI6 L;  3K59 A;  4IOC A;  3NBH A;  4X6A H;  4QCL A;  4A3K H;  4JI8 L;  3A0J A;  1XMQ L;  3A54 A;  4J15 A;  4A4I A;  5I9P A;  2VQF Q;  2SNS A;  2DNC A;  4KHP Q;  2A69 D;  3RLO A;  1EFW A;  4RHR A;  1Z47 A;  1IBM Q;  2M00 A;  4JBM A;  1SFO H;  5IT9 c;  4UPA A;  5T1I A;  4DR1 Q;  3K6O A;  1ET9 A;  3I56 A;  3FP9 A;  3H3V H;  2B29 A;  1W6J A;  1Y1V B;  1QVC A;  2F0K A;  3H91 A;  4HIK A;  5EBC A;  2FHT A;  4H13 C;  3R2I A;  3GQB A;  1HNW L;  3NTI A;  2H5X A;  2ATW A;  4GNX C;  3AMU A;  1H9R A;  3HOY H;  3PUZ A;  1PFN A;  4RG1 A;  4HED A;  1K8M A;  1S5C D;  2ZXP A;  5G3L D;  1VQI A;  2NBF A;  2IT1 A;  2A68 D;  2YTX A;  2A6E C;  1C0A A;  5KIX A;  1WOC A;  3K0X A;  5CV9 A;  2SOB A;  2XGT A;  4MNO A;  5EGT A;  2R93 G;  3HP3 A;  3GO5 A;  3K81 C;  1SYF A;  2HDL A;  5D14 A;  3S14 H;  4DK6 C;  1VS0 A;  5CV7 A;  4K0K L;  4LF5 Q;  4LF9 L;  4L63 B;  4F87 A;  4P73 A;  1C4Q A;  3S1N B;  1XNR L;  1ROD A;  4JI6 Q;  2UUA L;  4PG3 A;  1HHV A;  3J81 E;  3CU7 A;  3H94 A;  4JI8 Q;  2KA7 A;  1XMQ Q;  4UP8 A;  4A3M H;  3TME A;  2A69 C;  2H4O A;  3I3C A;  4JK1 C;  5CV8 A;  3ICE A;  3HOZ B;  1GKH A;  4DAV A;  1HZB A;  3I4O A;  3EBE A;  3QG1 A;  2EYH A;  4NXM Q;  3DUZ A;  3TZD A;  1CKM A;  1RL2 A;  3CCE A;  4HMI A;  4BBS G;  1PYS B;  3MC0 B;  4DV1 L;  1R4Q B;  1T9H A;  4CBV A;  3KJP A;  4LUV A;  4KY7 A;  2G9D A;  3I4L A;  3HOV B;  3CPW A;  1C9O A;  1SMY D;  4E6I A;  1F2L A;  1JJ2 A;  1X3G A;  1J9O A;  2SEB D;  1EZ8 A;  1LAC A;  4KD4 A;  4R8N A;  2YYZ A;  1BCP B;  2XTI A;  1EFI D;  4ODG A;  4Y7N H;  4PV1 C;  2K6A A;  2GA4 B;  3A7L A;  1ZXT A;  3KJO A;  3HKZ G;  1H9J A;  2NB0 A;  4K0K Q;  4LF9 Q;  3I72 A;  3DM3 A;  4GLA C;  3EFX D;  2PO4 A;  3OIP A;  1CFM A;  4A3F H;  3RZO H;  1KC8 C;  1HR0 Q;  3DM1 A;  4UHV A;  1QUQ B;  5A2Q L;  1PZK D;  2OWO A;  4C3J H;  3NHH A;  1Y8P B;  4LUZ A;  1MGS A;  1JE4 A;  1OXV A;  1SNM A;  2RF4 A;  2BDO A;  3I8Z A;  4A3D B;  1QIL A;  3A74 A;  5I6Y A;  4RFB A;  3PIO 3;  1Y1W H;  5BN4 A;  1GUT A;  1QVG A;  2B2W A;  1VQM A;  5ELN A;  3H15 A;  3QB3 A;  4GOP A;  1Q8I A;  4F8M A;  2E2J B;  2CCZ A;  1ENF A;  3HOX B;  4KKS A;  4DV1 Q;  3R8B A;  3M4P A;  2BDN A;  1SLJ A;  3S1Q B;  4LFA L;  2EDG A;  4DR3 Q;  1EIY B;  3GTL H;  1U4R A;  3PO2 G;  3GTG H;  5IGE A;  1LT6 D;  5C0X J;  2RHQ B;  4IUU A;  2XWJ B;  5F2D A;  4WFN 3;  2MNA A;  4F88 A;  3M3Y B;  1IKL A;  1I6V C;  2NVT H;  1BBW A;  4DXG A;  4IUV A;  1FNV A;  1DZ1 A;  2CKZ B;  2HIX A;  3LWE A;  2JP1 A;  3J80 c;  4BXX G;  2EXZ A;  1G51 A;  1JB7 A;  4GN3 B;  3KF6 A;  1UNS A;  3BZD B;  1F9Q A;  2BH8 A;  3PF5 A;  5DEH A;  1G8Z D;  3OPO A;  1YNJ D;  2K5W A;  4DR7 Q;  4WJ3 M;  4A3E B;  4B3T L;  4C3H G;  1RF2 D;  1QJO A;  4ZUI A;  4GS3 A;  3GTJ H;  1AE2 A;  1TWF H;  3E6Z X;  4KKU A;  1N9W A;  1X3Q A;  5JPN C;  2YV5 A;  2R93 H;  4LF8 L;  2JA8 H;  1II3 A;  4AYB B;  2K04 A;  2F03 A;  2UUC L;  1EY9 A;  3PUY A;  4BY7 G;  3DXJ C;  3K0Y A;  1PRT F;  4GN5 A;  4LFA Q;  3WDN A;  1ZEQ X;  3TRE A;  5K36 H;  3KF6 B;  2NUC A;  4C3I B;  3S16 B;  2OXP A;  2CH4 A;  1Y8O B;  1R9T B;  2DJF C;  3H0G G;  2IL8 A;  1N33 L;  4A93 B;  2LXJ A;  4NXN L;  3S17 H;  2JN4 A;  3S2H B;  4JBJ A;  3GTO B;  2RSO A;  1YEZ A;  4YWK A;  1FL0 A;  4GKK L;  1Q3L A;  2VUM B;  3MZ5 A;  1CI3 M;  1MIU A;  4HSP A;  1SRU A;  4BBS H;  1BQQ T;  1CTM A;  2UXC L;  1DCZ A;  1PMR A;  5KNB A;  1YNJ C;  3K7A B;  4K5V A;  2WFW A;  1HR0 W;  4XXE A;  1H9S A;  4YHH Q;  1SAP A;  1PH1 A;  1E2Z A;  2OTJ A;  2PI2 E;  3SVM A;  4J1M A;  5GAG C;  1EQT A;  3UDF A;  1Y1V G;  1TY2 A;  4QMG A;  3TP7 A;  4ID6 A;  4DV3 L;  4DR5 Q;  5C4X B;  4ZUJ A;  1H9K A;  1JT8 A;  1VQE A;  1BBX C;  4LF8 Q;  3QOL A;  4IUQ A;  3GD7 A;  2RDF A;  3NQI A;  1B3A A;  3OYY A;  1FR3 A;  2NVQ B;  4PZ8 A;  4XQN A;  4AH6 A;  5FLM G;  1D5Z C;  3MEH A;  1A2T A;  1STE A;  1PH9 A;  4JI4 L;  3GDE A;  1KLU D;  1JOQ A;  3MFG A;  2JA5 G;  2O5I C;  2K03 A;  3FEW X;  1H9S B;  2VW9 A;  5IGD A;  2Y0S B;  5C44 B;  1TWC H;  4KY6 A;  2Q2T A;  2A73 B;  2PQA A;  5GAH C;  2OTL A;  5A2Q E;  4CDF C;  4OX9 L;  3T13 A;  2VZA A;  4GKK Q;  1D7Q A;  4NB3 A;  3E0E A;  4X65 L;  1CSQ A;  2L15 A;  4GNX B;  1DYQ A;  4ZQ3 A;  1PA6 A;  3TS0 A;  1EYC A;  2WII B;  3HOZ G;  2SNM A;  4LF4 L;  1I6H H;  1EQV A;  4LW1 A;  4V0B A;  3DMU A;  5IT9 L;  4H7B A;  2MPM A;  2F0F A;  3PO2 H;  3HRZ C;  4O2D A;  3F8T A;  3EVQ A;  2ZT9 C;  4KK7 A;  4C1N I;  3KLS X;  4QF4 A;  3VYR A;  2ICE C;  4DV3 Q;  3O13 A;  3QR8 A;  1JB3 A;  1L2F A;  2B8G A;  2VB2 X;  4BXX H;  1KDA A;  3GTK B;  3PIO A;  3UE0 A;  1G2S A;  2JQO A;  5EPL A;  3CKI B;  2XIW A;  4HJ9 A;  2PQA B;  4JCV E;  2BH2 A;  3S1M H;  1HNX Q;  1UEB A;  2KCC A;  3V96 A;  4DPG A;  3CME A;  3GTM H;  3P7J A; 
#chains in the Genus database with same CATH homology
 4C1N K;  3TSS A;  3OSO A;  1PDQ A;  4CKB A;  5BN3 A;  4IFD G;  5FK9 C;  3MWY W;  3Q23 A;  1B9N A;  2PW7 A;  4K2L A;  1CT1 D;  3C1E A;  1S5E D;  1A15 A;  1S4Z A;  4DFA A;  1BUV T;  1WTR A;  1CHQ D;  1TII D;  5ELE A;  5D3I B;  2B2V A;  5C3E B;  4OHJ A;  1EWH A;  3GTP B;  1E2W A;  1LTB D;  2K5D A;  3G6J B;  1SNO A;  5BN5 A;  3MXG A;  1OO9 B;  2DY7 A;  4MN3 A;  1NUC A;  3SE0 A;  2D2C C;  4TKO B;  1J8I A;  1ESF A;  3NQT A;  2IX0 A;  1X3P A;  4RGO S;  1HQM C;  1TY0 A;  4RCO A;  3QWN A;  1A2U A;  1V8Q A;  4BA2 I;  4ZLT F;  5EPJ A;  1S5F D;  1B2T A;  3EQL C;  2KEC A;  2O2L D;  3NUC A;  4C56 C;  2PZT A;  1CK1 A;  4GZY C;  1TS4 A;  1Y8N B;  2F0M A;  1GUS A;  1IKM A;  5D65 A;  2LMC B;  4DK0 A;  4CJ2 C;  5TSS A;  2QCP X;  2Z4I A;  1LO5 D;  3Q22 A;  5AFW A;  1TS5 A;  2YU9 B;  4LAA A;  3SK4 A;  2IX3 A;  3SR1 A;  2CQA A;  2NN6 I;  5KGU A;  4L6T B;  1ET6 A;  3AB9 A;  3C46 A;  2MHV A;  3WOE A;  2R3Z A;  3NSW A;  2J7Z A;  1TU2 B;  5KNC A;  3SK5 A;  4YIJ A;  4C3I G;  5ISR A;  5D3D A;  2MJ8 A;  3FRP B;  3E0J A;  2QDB A;  3N52 A;  5EPK A;  3J80 L;  3A8K E;  2EVB A;  2L11 A;  2LY7 A;  2XWB B;  3PUV A;  4R8I A;  3M7G A;  1K8O A;  5IT9 E;  4EVO A;  2RBM A;  2EYP A;  2F3V A;  2EZV A;  3HEJ A;  3PMF A;  1TWA B;  1D1K A;  3TDQ A;  3ITP A;  1AN8 A;  2O5J C;  1JWS D;  4IFD H;  1EY5 A;  1AW7 A;  4G7H C;  4ABN A;  1PRT D;  2WB1 B;  5J22 A;  2F0S A;  5C3X A;  1EY6 A;  1TR5 A;  3P20 A;  3BDO A;  5C0X G;  1I50 B;  3G7L A;  2E2I B;  2K28 A;  4FF2 A;  1QNU A;  4A3B B;  2XNA C;  3ND8 A;  2NVX B;  1KDC A;  2A6E D;  4XQQ A;  1I4R A;  1PTO H;  4NW2 A;  3GV3 A;  4BS9 A;  1M8A A;  1ENA A;  5IGC A;  2NN6 H;  5NUC A;  1LTA D;  3D4D A;  4HSV A;  4UAI A;  1DON A;  2DN8 A;  3Q6S A;  5CV5 A;  1F2Z A;  2BA1 A;  1R4P B;  1HCZ A;  3K5O A;  5JOB A;  1NR2 A;  4FXG C;  2E76 C;  2RA4 A;  4KHZ A;  1DOM A;  1WTV A;  1PRT C;  5I2Y A;  5M3M B;  1RHP A;  4DAP A;  2JYO A;  5IGG A;  2K01 A;  2F0O A;  1ILP A;  5I4D A;  1WTO A;  3TBI B;  4RH6 A;  4PMB A;  1HFG A;  2DY8 A;  4KV6 A;  2WP8 J;  2NWG A;  5M5Y B;  3I4N B;  4B9W A;  5DM7 3;  1RJT A;  2F0W A;  4FNF A;  1VCI A;  5JEA H;  1RDP D;  4HCE A;  4OL7 A;  5HGT A;  4KI0 A;  4KKT A;  3D31 A;  2JA7 B;  2OT2 A;  4BY1 B;  4A3G B;  1EL0 A;  2MUY A;  1SJH D;  1MBY A;  4XTC S;  3PUX A;  4V19 0;  1TQO A;  2X69 A;  1TWG B;  4CKC A;  4PQX A;  4U68 A;  5LL6 X;  3OW7 A;  1C8C A;  4WOR A;  2K5Q A;  3VR3 A;  1A3T A;  2HCI A;  1CZW A;  1DOK A;  2PW5 A;  2XRQ D;  4CHT B;  1EOT A;  5COY A;  2K7V A;  3MXN A;  4EQN A;  1FYC A;  5CR3 A;  1SYC A;  1VF7 A;  2MP1 A;  1SXT A;  3C2P A;  1FNW A;  1GOZ A;  2B39 A;  4Q5V A;  4KD3 A;  3ND9 A;  1IW7 D;  2F0H A;  2E75 C;  1A3U A;  5EQ0 A;  3T4A C;  2BOS A;  2LKV A;  4B9X A;  4X3K A;  1EYA A;  3A8J E;  1D6E C;  1SE4 A;  2EE1 A;  1B1Z A;  5CYU A;  1HTP A;  1BDO A;  3FPP A;  5I9O A;  2J0T D;  4ULL A;  2AQ1 B;  5CV6 A;  3NWT A;  2VNU D;  4FYD A;  5C0X H;  3GP7 A;  2NYZ D;  1ILQ A;  1Q12 A;  3NE5 B;  1JCK B;  2D5D A;  2RVL A;  1EY0 A;  1FD7 D;  1XYI A;  3R2T A;  1LTI D;  2NTT A;  1SNC A;  1JWU D;  2I46 A;  1LTT D;  3FKI B;  5LL6 S;  1IW7 C;  2QKI C;  1WD1 A;  2B2Y A;  4U67 3;  5C6A A;  2F1M A;  3V2T A;  3OOC A;  1HTL D;  1DXM A;  2B2T C;  4A3K B;  4BBR B;  1GUN A;  4KY5 A;  4XT3 B;  1VDZ A;  3BVG A;  4MHE A;  4IAL A;  2N88 A;  1SFO B;  1GUW A;  2PZU A;  1TWH B;  3MHB A;  3OMC A;  2A6H C;  4DGZ A;  1EY8 A;  4FO2 A;  3DHQ A;  1NCV A;  1F2M A;  3NK9 A;  3VR6 A;  2PPB C;  2WV6 D;  3HOY B;  1EYD A;  1UAP A;  3FVQ A;  3A55 A;  1CA6 A;  5FO8 B;  2SDF A;  5EKK A;  2JE6 I;  1D5M C;  5K5P A;  1PZJ D;  3KK7 A;  2KJX A;  1ENC A;  3MTS A;  3NXW A;  1JOK A;  2EY5 A;  4OO1 G;  4K6L A;  1STN A;  5ELC A;  3H6M A;  3IFD A;  4ZAI A;  1Z6H A;  4NP5 A;  1WCM B;  2JSO A;  1B50 A;  1EEF D;  3OIQ A;  1T5X D;  1CZG A;  1HFN A;  2HDM A;  1IYV A;  2K1B A;  5C4J B;  4EGV A;  2KVM A;  5HUR A;  3ZYY X;  4HAE A;  1YNN C;  4IUR A;  5EKL A;  1KLG D;  5A35 A;  1QCB D;  2JXM B;  1AZQ A;  1V1P B;  2K05 A;  1SYE A;  3KLS A;  5KEE A;  3NTK A;  3QO2 A;  1E2V A;  2R92 B;  2F0V A;  2F0N A;  4Y7N B;  4IUT A;  4DK1 A;  5DM6 3;  2F0I A;  2JEA I;  2I07 B;  4H44 C;  1D1I A;  3VYT A;  2AWO A;  3RZO B;  3N6R A;  1PRT B;  1DOL A;  4ME5 A;  3RD4 A;  4C3J B;  1LT5 D;  2NVY B;  3KBX A;  5E3F A;  3BDL A;  3VYU A;  1Y1W B;  4RWS C;  5IOD A;  5C5M A;  1BF4 A;  1U4M A;  4QIW B;  1U4P A;  3F2U A;  3HOW B;  1IHZ A;  2F0U A;  1SSO A;  1F9P A;  2X6L A;  5I2X A;  4ZKC B;  2E2D C;  3Q24 A;  1EIH A;  1V43 A;  3I90 A;  1C48 A;  1F2Y A;  1AP0 A;  4K6D A;  1FNU A;  2C9O A;  2Z8L A;  2EOT A;  4S3S A;  1STH A;  1F77 A;  4QB4 A;  3HOU B;  2K32 A;  3SHL A;  3ERO A;  2PNR C;  4RGT A;  3OMG A;  3IFT A;  2PMZ B;  1PFB A;  3JAM L;  2OEO A;  1FGB D;  2JEB I;  3GTJ B;  5C4Z A;  1LTG D;  1WTW A;  2F0J A;  2L9H A;  1I4G A;  4WRD A;  3D8G A;  2XSC A;  1LV9 A;  3WOF A;  4FF4 A;  2R93 B;  3L7Z C;  1VMC A;  1D5X C;  2JA8 B;  1IYU A;  4TRD A;  1KAA A;  3MA2 B;  5ELF A;  4OO1 H;  3MVV A;  5DNF A;  4DAY A;  4IFD I;  2B2U C;  1H9M A;  3VYS A;  1AFP A;  5FKA C;  1Q1E A;  1LLR D;  2ENB A;  3IAY A;  1BCP C;  1SJE D;  4O1N A;  1EEI D;  3J7A V;  2ID0 A;  4BA1 I;  4RKL A;  3TP5 A;  3Q0A A;  4BBS B;  3DEP A;  5ELB A;  2AQ3 B;  2KCN A;  3QJY A;  3NWS A;  1PTO C;  5E4W C;  2KUM A;  2EYF A;  1OXS C;  3GTQ B;  3T51 B;  4J6H A;  3E5S A;  3HGB A;  1LTS D;  3C1F A;  1I4Q A;  3CRL C;  2BA0 A;  1BNZ A;  2TSS A;  4A3J B;  4XQJ A;  1SYG A;  4HTH A;  5CV4 A;  2WKC A;  3MXP A;  1PZI D;  4DF7 A;  1B44 D;  4X3T A;  3OWF A;  4CJ0 B;  1MI2 A;  3J81 L;  3H3V C;  1CM9 A;  4G57 A;  4PMC A;  3BYT B;  3FDT A;  3AU7 A;  3OWE B;  2B2W C;  2JA6 B;  1RD9 D;  4RA8 A;  2MGS A;  1I6H B;  3PO2 B;  1DJR D;  1L0X B;  4KN7 C;  1Z7T A;  2R7Z B;  2PQE A;  5FLX L;  4MIU A;  1RTN A;  4DU9 A;  1SYD A;  1O80 A;  1U9R A;  2N55 A;  3BVM A;  3S1M B;  5IGB A;  2KEE A;  1ONL A;  3U9O A;  2XRS D;  1SNQ A;  1BR9 A;  2HUG A;  1U4L A;  2V4D A;  4QUC A;  4C3H B;  3IL8 A;  4LMQ D;  2AUK A;  2X6G A;  1SND A;  4ILW A;  3JAM E;  1IL8 A;  1SBB B;  3TN2 A;  1EIG A;  2Q8R E;  4BY7 B;  3S1R B;  2L55 A;  3L3O C;  4X3U A;  1EWC A;  3CRK C;  3BVZ A;  4DXF A;  1SE3 A;  1UEA B;  2L0C A;  2ZXO A;  3H0G B;  3BYY B;  1I4X A;  5JVG 3;  4XT1 B;  3A7A B;  1GHK A;  3ERQ A;  1ICW A;  2EYL A;  2XN9 C;  5C0X I;  3EA6 A;  3NPP A;  1NAP A;  3I91 A;  3KBG A;  2A5H A;  4LK1 C;  1BO0 A;  3J7Y W;  1S5D D;  2M9V A;  4P2C B;  2F0D A;  4FF3 A;  3EJI A;  4FXK C;  4DNT B;  3TP6 A;  1KDB A;  4QUF A;  1GXD C;  1Q90 A;  3X3N A;  1Q1B A;  3K5L A;  1PYW D;  1S5B D;  1I4H A;  1BCP F;  3I4M B;  2QF7 A;  1GUO A;  1LT3 D;  1PFM A;  1BXT A;  1F9R A;  1A3V A;  1CQF A;  2EYJ A;  5J39 A;  3PO3 B;  3M7N A;  3M4O B;  3MFY A;  3QIA A;  1HUM A;  5KRU A;  2JA5 B;  3QOJ A;  1PTO F;  3MXU A;  3R93 A;  2FMC A;  5I6W A;  2A74 C;  2B2U A;  5C4H A;  2VB3 X;  5K36 G;  4LJZ C;  5FO7 B;  1I3Q B;  5CC4 A;  4TSS A;  3SEB A;  1O7L A;  3K58 A;  1TVX A;  4G4K A;  3J80 E;  4KTA A;  1G29 1;  5CGK A;  1L0Y B;  2CHB D;  3W3A A;  3TP8 A;  4K14 A;  5JVH 3;  3KLR A;  5JEA J;  2IX1 A;  5CBA E;  1X32 A;  2B63 B;  4RGN A;  4Z9C B;  1WTP A;  2A68 C;  4I65 A;  1ZKO A;  5FLX E;  2BE5 D;  1KTK A;  1B4O A;  5DAU A;  2A6H D;  4CGY B;  5FO9 B;  3VR4 A;  1K83 B;  4IN3 A;  1TS2 A;  2AQ2 B;  2VXW A;  4K5W A;  2PZW A;  4HMJ A;  5M5W B;  2KOL A;  4X3S A;  3RUZ A;  1PTO B;  1E0B A;  1EZ6 A;  1XX8 A;  5IIF A;  2EY1 A;  2B2V C;  2HCC A;  4N9T A;  4EQP A;  2NTS A;  2HQE A;  2EY2 A;  4PMW A;  3UI2 A;  4OIJ A;  2R61 A;  3IKJ A;  1SEB D;  4G7O C;  4RKB A;  3HG9 A;  1STY A;  2EJM A;  1SDF A;  2WKD A;  3NP8 A;  4OGQ C;  1SE2 A;  4XDX A;  1SMY C;  4H0L C;  4M1U B;  3C3L A;  2LS0 1;  2BE5 C;  1WVL A;  1WTQ A;  2Q8T A;  1O7Z A;  5JAV A;  1MSH A;  1YNN D;  3P1H A;  2F0P A;  3CHB D;  4DN4 M;  1KAB A;  1JC7 A;  2D9U A;  5M3F B;  1QNK A;  1GUG A;  2CVR A;  4XYO A;  5IGF A;  4K5X A;  3DWP A;  2KED A;  1EU4 A;  2E2H B;  1V1P A;  3S14 B;  3D4R A;  3BDC A;  2ICI A;  4FVM A;  1A6X A;  2Q8I B;  2RDH A;  1TS3 A;  1QWY A;  3X3M A;  4ZRZ A;  2Z1C A;  1ML0 D;  4J8Q A;  4A3M B;  3FPU B;  3DEO A;  2F0Q A;  1AEX A;  3HS0 C;  3HZX A;  3VA5 A;  2K33 A;  1F9S A;  1EY4 A;  1B9M A;  4RCN A;  1LTR D;  2L4N A;  4F7X A;  1VMP A;  5M5X B;  4WJW A;  1RCV D;  1ZYR D;  1AZP A;  5C5L A;  3U9S A;  4PNY A;  5KYI A;  1STB A;  2FMM A;  1CA5 A;  4TQU S;  3VA7 A;  4OO1 I;  1V1O A;  3LWU A;  3S2D B;  3SXH A;  1D2B A;  3L9A X;  1GJX A;  3H09 A;  4KJO A;  4A3F B;  1NSN S;  4IUP A;  4FXD A;  1SYB A;  4HCS A;  4NKL A;  1MD2 D;  1G2T A;  5KND A;  2IJ0 A;  2EJG C;  1HA5 A;  3GV6 A;  5J1Z A;  4DNR B;  5G3L F;  1GHJ A;  1HXY D;  1G91 A;  1QOH A;  4FF1 A;  3KF8 A;  4R9W A;  2E74 C;  2FFK B;  2NZ1 D;  1XTC D;  4KMU C;  1ZYR C;  2RSN A;  4B08 A;  5EJW A;  4ZKB B;  3GTL B;  2TMP A;  3T56 B;  3GTG B;  4XIG S;  2XVS A;  3I70 A;  4DA2 A;  4IZ8 A;  1HRJ A;  4JBW A;  5ELD A;  2NVT B;  2KHS A;  2WAC A;  5T1G A;  3PIP 3;  4NMZ A;  5JJZ A;  1BCP D;  1VF5 C;  4ZK9 B;  4KN4 C;  5JPM C;  3URY A;  1UUP A;  1XXG A;  2IWH A;  2PCF B;  1LAB A;  3MAQ A;  2EPB A;  3PUW A;  1HPC A;  1CQV A;  1PLF A;  5E1F A;  1XWE A;  1PTO D;  3A56 A;  1TWF B;  3BG3 A;  2QIL A;  4ZYS A;  4CJ1 B;  1HUN A;  1TT2 A;  1W6K A;  4RGM A;  3SDZ A;  4I7Z C;  3S15 B;  3K57 A;  4IUN A;  2CW0 D;  1WD0 A;  3D3R A;  2F0L A;  3M4Y A;  2G9H D;  2KQ3 A;  3LNN A;  3LX0 A;  3T53 B;  1HQR D;  4EQO A;  1B53 A;  1STG A;  3V05 A;  3S17 B;  3D4W A;  1QB5 D;  2PYK A;  3KUP A;  1Y69 U;  1RKN A;  2L5T A;  1JR0 D;  2B2T A;  2RQX A;  5IOC A;  2EY6 A;  1M4V A;  1QG7 A;  2RDG A;  4M8A A;  2NN6 G;  3NTH A;  5CBE E;  1TKW B;  3SK6 A;  3P75 A;  5EBD A;  3M85 A;  1BOS A;  4NDX A;  3TZU A;  2EYO A;  3ONA B;  3FMC A;  5CMD A;  1OXU A;  2L12 A;  4HN7 A;  2F4I A;  2QEJ C;  1STA A;  2RKS A;  4IQZ A;  1CHP D;  1O7Y A;  2IPK D;  1OXT A;  4RAU C;  5M9O A;  2BCO A;  2C5C A;  3DWQ A;  2H1E A;  2R6G A;  4Q0F A;  2F3W A;  4KHV A;  1HA6 A;  1EY7 A;  2D62 A;  3HKZ B;  2CW0 C;  2FIN B;  2EJF C;  1KNA A;  1JOR A;  5E4X A;  4RHS A;  2OF1 A;  4A3I B;  1QE6 A;  1TWC B;  5JEA G;  1O78 A;  3K5N A;  1EU3 A;  3OHX C;  3CQZ B;  4K2K A;  1JOO A;  4C2M B;  4K8I A;  3RMH A;  3D6C A;  1DD2 A;  3DWA A;  2L1B A;  3VR2 A;  1I4P A;  3J7A F;  3VR5 A;  3D6W A;  1NR4 A;  4HR7 B;  1MSG A;  2F0E A;  2LFN A;  3RLF A;  3BS1 A;  1DM0 B;  2DNE A;  1RTO A;  2B2Y C;  5LHY 1;  4G7Z C;  4OIK A;  2EYM A;  3SK8 A;  2O4X A;  4BWG B;  1OXX K;  4N9P A;  1SNP A;  4UDU C;  3T16 A;  5FOB B;  1T5E A;  3GTM B;  1G6Z A;  3A8I E;  1PXU A;  3NBI A;  1KNE A;  2WAQ B;  3K5M A;  2ZXR A;  4FP5 D;  4KJN A;  3I73 A;  2WIN B;  2F0G A;  2IW3 A;  5KYL A;  3R3O A;  4L8J A;  5C3W A;  1WTX A;  5COR A;  2J4X A;  5EKI A;  2F0T A;  4K8J A;  3RZD B;  3W2D A;  2FJ2 A;  4C3J G;  2AUJ D;  4CKE A;  1JQY D;  4O42 A;  1JWM D;  1LT4 D;  2Z4H A;  3PV0 A;  3S9W A;  2M2L A;  2AWN A;  4XYQ A;  4IFD J;  1JIC A;  1ESR A;  2B8F A;  3K59 A;  3NBH A;  4QCL A;  3A54 A;  5I9P A;  2SNS A;  2DNC A;  2A69 D;  4RHR A;  1Z47 A;  2M00 A;  5T1I A;  3K6O A;  1ET9 A;  1W6J A;  1Y1V B;  2F0K A;  3H91 A;  5EBC A;  2FHT A;  4H13 C;  3R2I A;  3GQB A;  3NTI A;  3AMU A;  1H9R A;  3PUZ A;  1PFN A;  4HED A;  1K8M A;  1S5C D;  2ZXP A;  5G3L D;  2NBF A;  2IT1 A;  2A68 D;  2A6E C;  5KIX A;  5CV9 A;  2SOB A;  5EGT A;  3HP3 A;  3GO5 A;  1SYF A;  2HDL A;  5D14 A;  5CV7 A;  4L63 B;  4F87 A;  1C4Q A;  3S1N B;  1ROD A;  1HHV A;  3J81 E;  3CU7 A;  3H94 A;  2KA7 A;  3TME A;  2A69 C;  2H4O A;  3I3C A;  4JK1 C;  5CV8 A;  3HOZ B;  4DAV A;  3QG1 A;  2EYH A;  3DUZ A;  3TZD A;  4HMI A;  3MC0 B;  1R4Q B;  4CBV A;  4KY7 A;  2G9D A;  3I4L A;  3HOV B;  1SMY D;  4E6I A;  1F2L A;  1J9O A;  2SEB D;  1EZ8 A;  1LAC A;  4KD4 A;  4R8N A;  2YYZ A;  1BCP B;  1EFI D;  4ODG A;  4PV1 C;  2K6A A;  2GA4 B;  3A7L A;  1ZXT A;  1H9J A;  2NB0 A;  3I72 A;  3EFX D;  2PO4 A;  3OIP A;  1CFM A;  3DM1 A;  5A2Q L;  1PZK D;  3NHH A;  1Y8P B;  1MGS A;  1JE4 A;  1OXV A;  1SNM A;  2BDO A;  3I8Z A;  4A3D B;  1QIL A;  5I6Y A;  4RFB A;  3PIO 3;  5BN4 A;  1GUT A;  2B2W A;  3QB3 A;  1Q8I A;  4F8M A;  2E2J B;  1ENF A;  3HOX B;  4KKS A;  3R8B A;  2BDN A;  3S1Q B;  2EDG A;  1U4R A;  5IGE A;  1LT6 D;  5C0X J;  4IUU A;  2XWJ B;  5F2D A;  4WFN 3;  4F88 A;  3M3Y B;  1IKL A;  1I6V C;  4DXG A;  4IUV A;  1FNV A;  1DZ1 A;  3LWE A;  2JP1 A;  2EXZ A;  1UNS A;  3BZD B;  1F9Q A;  5DEH A;  1G8Z D;  3OPO A;  1YNJ D;  2K5W A;  4A3E B;  4C3H G;  1RF2 D;  1QJO A;  4ZUI A;  3E6Z X;  4KKU A;  1X3Q A;  5JPN C;  1II3 A;  4AYB B;  2K04 A;  2F03 A;  1EY9 A;  3PUY A;  3DXJ C;  3K0Y A;  1PRT F;  3WDN A;  1ZEQ X;  5K36 H;  2NUC A;  4C3I B;  3S16 B;  2OXP A;  1Y8O B;  1R9T B;  2IL8 A;  4A93 B;  3S2H B;  3GTO B;  2RSO A;  1Q3L A;  2VUM B;  3MZ5 A;  1CI3 M;  4HSP A;  1BQQ T;  1CTM A;  1DCZ A;  1PMR A;  5KNB A;  1YNJ C;  3K7A B;  4K5V A;  4XXE A;  1H9S A;  1SAP A;  1E2Z A;  3SVM A;  4J1M A;  1EQT A;  1TY2 A;  4QMG A;  3TP7 A;  4ID6 A;  5C4X B;  4ZUJ A;  1H9K A;  1BBX C;  3QOL A;  4IUQ A;  3GD7 A;  2RDF A;  3NQI A;  1B3A A;  1FR3 A;  2NVQ B;  4XQN A;  1D5Z C;  3MEH A;  1A2T A;  1STE A;  1KLU D;  1JOQ A;  3MFG A;  2O5I C;  2K03 A;  3FEW X;  1H9S B;  5IGD A;  2Y0S B;  5C44 B;  4KY6 A;  2A73 B;  5A2Q E;  3T13 A;  1DYQ A;  4ZQ3 A;  1EYC A;  2WII B;  2SNM A;  1EQV A;  4V0B A;  3DMU A;  5IT9 L;  4H7B A;  2MPM A;  2F0F A;  3HRZ C;  3EVQ A;  2ZT9 C;  4KK7 A;  4C1N I;  3KLS X;  4QF4 A;  3VYR A;  2ICE C;  3O13 A;  1JB3 A;  2B8G A;  2VB2 X;  1KDA A;  3GTK B;  1G2S A;  5EPL A;  3CKI B;  2XIW A;  2KCC A;  3V96 A;  3P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...