1LTSC

Refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1992-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltsC00
1LTTC 1LTAC 1XTCC 1LTGC 1LTIC 1HTLC 1LTBC 1LTSC
chains in the Genus database with same CATH superfamily
2G8YA 2Q7CA 4H0LB 2K9YA 1BDCA 1JY2P 3L70J 2AXCA 1X0TA 2FYNB 3AEEC 4I7ZB 3N4XA 2O01J 2YKOA 3F89A 3L4FA 4UB6E 4GOEA 1N86A 3H1KE 2QJKC 3R2PA 1NTMD 2Q5UA 4JQ0D 3FXDA 3AEGC 3SFEC 4DZOA 3B5NB 2BCCJ 4TT3H 1RF0A 4PJ0E 3CCVP 2O1JA 2AEJA 5AVRB 1RF0C 2QSIA 1VQLP 4IL6E 2H43A 3PJSK 5KAFH 2K1AA 3L75J 2KS1A 2YIUB 1SQVJ 3K5BA 1OFCX 3OAKA 1YTZT 1RE4A 3II6A 1SQXD 2POHA 3L36A 1HWTC 1P84H 1RE4C 1ZOYC 1NTKK 3L70D 1VQOP 2CPSA 1HH0A 4GIFA 1GW4A 1L4AB 4ZNCA 4WVZA 2W83C 2OTLP 2JWAA 2P10A 1NJIQ 3GHGB 1GK4A 2LXCB 2HLOA 4H13B 1J1EC 1JY2O 2Z5HA 2JKVA 1G1IA 1BSNA 2FXPA 2OTKE 3L75D 2FY8A 2K9JB 2LKMA 1X8YA 4W7YA 1SQVD 3G4SP 2YMKA 3RK2C 2ZT9D 2OYIB 3RBZA 2YKPA 1KC8Q 4EYYQ 1J1DC 1OW7A 1NU1J 2AEFA 2OYOA 2R5BA 5KKZB 1JTHB 2L91A 1IC2A 1X9VA 1VQPP 4W7ZA 1NTMK 1GMJA 2O1KA 1EXJA 1N7SB 2P1JA 5KLVJ 2FYUD 1PGOA 1Y9BA 4D6TJ 1H0TB 5M1BA 3L72E 1FS0E 1OZHA 2PP6A 2YKQA 3AE5C 1URQA 1LTJA 1VDFA 1KB9E 3BCCE 3NTNA 1SQPD 1LTJC 1SQQJ 5CJ0A 2M3EA 3V2RA 3KQGA 1VF5B 1ZRTE 2DW3A 3CC7P 4WBAA 2KUBA 1LWUC 1SFCB 1YBKA 1H89A 1M56D 1LTBC 1JUNA 3B4SA 1MUUA 1RH5B 1YIJP 4ZKUA 1RF1C 2HG5D 2KK7A 3L74G 2CK3H 3L71J 1N7LA 3L37A 1VQ5P 5CBOA 3A7OA 3M9QA 3E1IA 5KLVD 1AVOA 1KV4A 1OVVA 1OVRA 1M1JC 1HTLC 3H1ID 2VRSA 3OA7A 3CC2P 3CCLP 4JPZB 3MHVA 1FOSE 2RN0A 3H32A 2ZVOB 4C7RA 1SQQD 1SQVK 4OGQD 1OW6A 3QH9A 3CXHI 1BE3J 2ZYGA 1IK7A 5B5EH 1VQ8P 1T2KC 5L8RJ 4L73A 1IFJA 1NTMG 3TNUB 1S5LH 2KOGA 3L71D 1YTZI 2WSEH 5GTHE 1JMBA 4B86A 3FGAD 1FZAA 5AW7B 1OVUA 5H2FE 1VPCA 3WMM0 1M8OB 4BRYA 1FZFA 2XV5A 3CXHD 3V4QA 2IYPA 1FC2C 1SQXG 1MV8A 2AXTH 2HODA 3SSUA 1EDKA 1YITP 3W67A 2K37A 1AQ5A 3TGUG 1PP9G 1BE3D 4W80A 2OQQA 2KLVA 2WT7B 3U1AA 1NU1K 1U7MA 1UIIA 1PGPA 1PFIA 1FDOA 2NPSB 2W6BA 1KMIZ 1P84I 1M7LA 2FYNC 4I7ZC 1LT9C 5KLVK 3O6QB 1K73Q 1GTWA 3IR9A 2JO1A 4GOFA 2O01H 3B5NA 2XZRA 2RKLA 3RBXA 1LJ2A 1SQQK 2UWJE 3B5NC 1DH3A 1KQLA 1J1EB 3P32A 3VP8A 3AEAC 3G6EP 1RHZB 1RE3C 2YIUC 2M3BA 1T6AA 2FKWB 3RK2B 1P84D 2B89A 3IFMA 2QM8A 2E75D 1YJNP 2FYUG 5APSA 3L74E 3CWBJ 2O3JA 3D71A 1L4AA 1BGYJ 4A7PA 3ABVC 1L4AC 1QVGO 1SQPG 3HD7A 3CMEP 3H25A 3GHGA 3JC22 1NTZJ 3CCEP 1LNQA 1CSBA 1LP1B 1GL2B 4WY4D 5APUA 2ZXXA 2QIWA 4H13C 5GTIH 1JMMA 1JNMA 1KORA 2K9JA 2Y0EA 3D70A 2O01N 2QM7A 4XFJA 3RK3C 2OYIA 2C0WA 2KZIA 2QJYB 3AEDC 2OYIC 1LWUB 1MFZA 4YTPC 1HUCA 4PV1B 3AE8C 4HH2A 5KLVG 1NTME 3RK3E 3E7KA 1BCCG 4L74A 3H1IG 1JTHA 3CWBD 3LIDA 3UIAA 1NGMB 1RF1B 3HE5B 4HYTB 5KKZC 3B71A 3KXDA 3P8CD 2WSCJ 2PGDA 4JYCA 4UB6H 1N7SA 1SQQG 1Y8AA 1RY3A 1NTZD 3C8VA 1N7SC 1H0TA 3VMYA 1KYOI 2BEQD 1SQXE 1JCCA 1SVFA 5APYA 3M9BA 1NOHA 3H1LJ 3TGUE 2FFDC 5AVUB 1PP9E 3L71G 1GZLA 3RL0g 1VQMP 1SFCA 4RESB 2A45H 1NHLA 2W6AA 1SFCC 3A0BH 1LGHB 3HE4B 2WSEJ 3V2PA 2JP3A 1HJBA 4Z1MH 2GUSA 1Q90D 2QG4A 2D2CB 3H1JJ 2NRGA 2QJPB 2Y9YA 4OH8B 1UIXA 1KYOD 3L73D 3I56P 1DD4A 1NTKD 1YHQP 3CCRP 5AW1B 1KILD 1NWQA 2P2UA 1NYHA 2RH0A 1OW8A 1EC5A 2E76B 2GUVA 1ZV8A 3EWKA 1K05A 4RKUJ 1NH4A 3H1LD 1L0LJ 4LGDE 2N1TD 1R5LA 3USSA 1ZR4A 1SP4A 4IFMA 1JCDA 4AQRD 3GLMA 3TNUA 1SQBJ 2FYUE 1OIPA 2IBZI 1L0NJ 2KIKA 2HR3A 1M1KQ 3H1JD 1WT6A 2E74D 2I1KA 1NTZK 1LT9B 1SQPE 4BXLA 1SS1A 1XTCC 2QVAA 2JEEA 5KTBA 2LR2A 3RL0B 4PD4H 3Q5PA 2ZYAA 3HD7D 3RGUA 3S4RA 3GF3A 3LW5J 3KZIH 4U3FD 5AVXB 2H7HA 4Y28J 5KJ7A 1QL2A 2B87B 4L76A 2Z5IA 2IBZD 5KJ7C 1DD3A 2WT7A 2E5YA 3KYQA 1LTAC 1SQBD 1BCCE 2NPSA 3H1IE 4NPDA 5AW9B 2NPSC 3SFDC 2N9BA 3O6QA 3CCJP 2Y9ZA 5KLIB 4O9BA 1SQQE 2PRRA 4DT0A 1VQ6P 2N9YB 4L75A 3WUUA 1YJ9P 3H1HJ 4JF7A 2OGUA 1G2CB 5CCHA 1GU4A 3CMAP 2BCCD 5CCHC 3GG2A 2FXOA 1N2DC 1NVOA 4DOJA 1FZEA 3CLQA 4WB4A 2HPCB 3RK3B 1CW5A 1PPJD 2KNCB 2A06G 2FXMA 1QEXA 1ZMEC 1HGVA 5B66E 1EDLA 1NTZG 3CXHE 5KAIE 1G1JA 2WSSH 3V6IA 1YI2P 3N7NA 3KPEA 3TF5A 3Q5RA 5BVZA 1LP1A 1GL2A 3BVHA 3H1HD 4ZKPA 2KSEA 3O8ZA 3AE6C 1NAFA 5C39A 1L0LK 1GL2C 3AE3C 1JY3N 2Y0CA 2QA4P 2I1JA 3VP9A 4K3AA 3AE1C 3S9OA 3TSIA 2FFDB 1IZNB 1KFMA 1SQBK 3CX5H 3PP5A 1LTSC 1LWUA 2QJYC 2IFNA 3AE4C 3L73G 1NTKG 1L0NK 4UB8H 2Q3EA 5AW5B 1R5SA 4PV1C 3OW2O 2A45I 1RF1A 4N78D 1U7JA 3HE5A 1NU1D 5AVWB 3M06A 1FJPA 1E5WA 5KAFE 3H1LG 5DJTB 2ZT9B 1ZXGA 4HJGH 3PH0A 1M1JA 1KYOH 2WSCH 2KYVA 5TISE 1S2EA 5AVQB 3SWFA 1A02J 4D6TD 1EZVI 1S4XA 3Q1MA 2XNDH 2KP8A 3H1JG 1ZLLA 1DX7A 1LT1A 2QE7H 3EFGA 3HE4A 1JM0A 2JR8A 1OMIA 1KQFB 2D2CC 4U3FG 1IFIA 2QJPC 5APTA 2XU6A 1EZVD 2WVRA 3ZDMA 2K3RA 2MKVA 2IBZG 3L72J 3MP7B 2E76C 2M5AB 2CPBA 3C9IA 1USEA 3BCCJ 4PD4I 1EDJA 1DEEG 3PRJA 3HTKB 1FOSF 2Q6QA 3TDKA 3L70G 3G9RA 2A06E 2NZ2A 3MD0A 3G71P 3MTUE 1X22A 1W2BO 1PGQA 3AEBC 2HYNA 1WRGA 3V5BA 4AUWA 3H6PA 1OWAA 4OGQB 5CCGA 1LT9A 3T97B 2BCCG 1FZCB 2XDJA 5CCGC 4GT1A 4PD4D 2I8DA 2KS1B 5E79E 3U59A 2SPZA 3RL0C 3L75G 2P67A 3QWOC 1H8AA 1SQVG 1PPJG 3MIWA 1BDDA 3P8MC 1USDA 1JOCA 1R8EA 3VMXA 3LW5H 2B87A 1U57A 1ZRTD 2IFMA 2G3AA 4N3YB 4OWFA 1URQD 1E79H 1RE3A 3SWYA 1D7MA 5AVVB 3L73E 1NTKE 1KILE 3MZWB 3GMAA 3H1HG 2OTJP 3NFQA 1KD1Q 5KLIC 3CCMP 1K9MQ 1PV3A 3HRNA 3VMZA 3WU2H 2Y0DA 1G2CA 1PIXA 2YXQB 4GDOA 3A0HH 3HUSC 1QX8A 4R4LA 4TLFA 2ITAA 2YNYA 2L5GB 3GF7A 1WMKA 3KHUA 5TJHA 3H1JE 2HPCA 1NU1G 2KNCA 4XA4A 1HBWA 3F5HA 2IDBA 1HJ0A 2ZYDA 1Q81Q 4MN4C 2OYHC 2W6JH 1FE6A 3CX5I 3PTZA 5CJ4A 1T2KD 2Z4EA 5AVYB 1LTIC 4H44D 4U3FE 3AE2C 2M0BA 4D6TG 1YYCA 1BGYD 1BSHA 3TYYA 2R3SA 4NPEA 1QLED 2IBZE 5BU8B 3IF4A 2E75B 1JO5A 2YO3A 4PJ0H 2WPVB 1S1CX 4EDFA 1M57D 2FFDA 3CX5D 2XNXA 4IL6H 1XTGB 3L70E 3M0DA 1S3JA 4ZMDA 1AQTA 2ZJSE 1T8ZA 3M0DC 1DEBA 3V4WA 1JY3O 4WY4B 1EQ7A 1EZVG 1FDIA 3L74J 2HFED 1IFNA 1QL1A 3BRVB 4H0LD 1KFNA 2BCCE 2XKMA 1W5CE 1KQGB 2ZT9C 4N6JA 2WSFJ 1KTMA 2WPRA 1Y47A 1S9KD 2V7QJ 1AVYA 3A2AA 3L75E 2H89C 2BEZF 1SQVE 1PPJE 1BE3G 3D6ZA 2OARA 4Y99B 3B5ND 3D6YA 4YPCA 4DCKA 2JJLA 1ZR2A 1VQNP 3P7KA 3CL3D 1NTMJ 4C46A 5AW4B 5B66H 5CBNA 2C9LY 1GD2E 1CZQA 1LTTC 5KAIH 3ITKA 3VTPC 1OXZA 1AJYA 3OJAB 3BATA 1EDIA 1L4AD 2M5AA 3M0AA 1K04A 1SQXJ 3U1CA 4RJTA 1FAVA 4CPGA 1KZUB 4ASWA 2WTYA 3TGUJ 1YQ3C 3HTKA 4H13D 1PP9J 1L0LD 1KB9H 4N78E 4WWIA 1NU1E 1FZBA 1KILB 3JCUE 2ZVNB 1H88A 1AA0A 1X79B 2LXBA 1FBMA 3TK1A 3RK3D 5AW3B 4QMAA 3M91A 5K5GB 1VQ7P 5KLVE 3I5CA 2WITA 2IYOA 1L0ND 4D6TE 3T97A 1FZCA 4OGQC 4EI2A 2N1TB 1PGJA 1FZCC 3AE9C 3KDPB 3FXEA 5EFWB 2BASA 5AW2B 3A0BE 1N7SD 5TISH 3TGUD 3HUSB 1PP9D 3V2QA 5APQA 2E74B 1VQKP 4K35A 4GKGA 2IX7C 4HKZH 3L71E 1S5LX 3CWBG 1FU1A 3SWKA 2IZ1A 1BGYG 1NKNA 1VF5D 1EZVE 2FYUJ 3HD7B 1Q2NA 1SFCD 2OYHB 3CD6P 3C1LA 3L35A 2Q1KA 1SQPJ 4IFDK 5GTHH 4IFFA 2R44A 1CI6B 3H1KJ 2ZFCA 2ZAEB 2MJZA 1VQ4P 5H2FH 3S1KA 5CHXA 3VOPA 1BE3E 4YXWH 1DIPA 3IN6A 4M3LA 1SLQA 1KQSO 4R4MA 4U7JA 2WWWA 4C7NB 1EXIA 5DJUB 1A02F 1N73B 1BCCJ 4PD4E 3H1IJ 3LIEA 3G3ZA 2C0XA 3NMDA 3KZIE 2WQYC 1AV1A 4IOIH 5AW6B 1URQC 2WZ7A 2JDIH 3H1KD 1YJWP 1SQXK 3JSVC 5E79H 3AE7C 5CMZA 1GU5A 1QGKB 2E75C 3FX0A 1P84E 5APWA 2JWDA 5AW8B 2B88A 1J2JB 2WMMA 2P58A 2C9NY 1VL2A 3MUDA 2ZXEB 3AEFC 4WY4A 5KJ7D 1BCCD 3MUDC 1FDMA 4WY4C 4XE5B 1Q7YQ 1MFTA 4ASVA 1JB0J 1IK9A 1Q86Q 3CCSP 2NPSD 4KJMA 1L0LG 1NKZB 1GDTA 4JBZA 2B9BA 2IPPA 4GODA 5AVZB 3IAOA 2WSFH 2V7QH 2J59M 4H44C 3CPWO 3VN0A 4LLHA 4Y99C 4DJGA 1MZ9A 4YXDC 1SQBG 5CCHD 3VYIA 3MGNA 1L0NG 1OX3A 4HB1A 5AVSB 2FYUK 3CWBE 3EFFK 1KB9I 1BGYE 3P8CE 2QJKB 2YO2A 3E1RA 1QVFO 1Q82Q 3RK2D 1SQPK 5BU5A 1NTZE 3W68A 4EOTA 2W27A 3VMAA 3M9HA 5APXA 1HVVA 3CX5E 4LC1A 4IL6X 4UB8E 4EIJA 3L72D 4H0LC 2J5UA 1GL2D 1KB9D 2M8RA 2R5DA 1VQ9P 1T3JA 3BCCD 2H8PD 1HGZA 2E42A 1KILA 1GK6A 3PHLA 1KILC 1IO4A 1JY2N 1KN7A 1ZP0C 3FWNA 1KYOE 1S9KE 4I2LC 1MKMA 1RQVA 1AFOA 4PV1D 2R3CA 2N1TA 4BWNA 1IFMA 3BASA 1N8RQ 2N1TC 3Q3DA 3H1LE 2RMZA 1JEKA 2PFXA 1GW3A 3WUTA 1S72P 1JY3P 4NPFX 2GM4A 1IFPA 5B5EE 1J1DB 3HUSA 1T3UA 1RQUA 2R32A 3BRTB 4I1LA 1S5LE 2FBWC 3CI9A 2E74C 3CCUP 2PAJA 4I6MC 2QEXP 2FYZA 1FZGA 2E43A 1Z56A 5APVA 3H1KG 2OYHA 3HD7C 4OVNF 3GHGC 3A5TA 1IJDB 3WUVA 2K88A 2AXTE 1URQB 1LTJB 3A3YB 1PL5A 1PZQA 1CI6A 2D2CD 2WPSA 1L0LE 4AYCA 2KI7B 2P7JA 1IFDA 1M90Q 2V4HA 1K8AQ 2A45G 4RO0A 2E76D 2GA1A 5AVTB 1LTGC 3I55P 1SQBE 1ZN5A 1ZW0A 2A06D 1L0NE 3JCUH 3L73J 4C7NA 1NTKJ 1N73A 2QRXA 1N73C 1M1JB 2KLUA 4KT0J 1NO4A 2H88C 2WPQA 3H32B 2W90A 3CC4P 2AEMA 1VF5C 2Q9IA 5CCGD 2W8ZA 3NXSA 2YXRB 5AW0B 1W2EA 3EQ2A 3GW6A 3Q5SA 3RL0D 3Q2YA 4H44B 2KSJA 2KB7P 3AECC 3R4YA 3FWLA 3CCQP 1FJKA 4KHXA 3V2NA 2J58A 3WU2E 2KZJA 1NAYA 3B8EB 4JYBA 3A0HE 2IZ0A 3L74D 4U3FJ 4BRYB 3H1HE 3L72G 3PLNA 1L2PA 3CXHH 1TU3F 2HODB 5GTIE 3BCCG 2YMYA 2E5TA 1YQ4C 2KXPB 2Q3IA 1HF9A
chains in the Genus database with same CATH topology
3RK3C 2OYIA 2C0WA 3HTKB 1FOSF 2Q7CA 2OYIC 4M3LA 1SLQA 1LWUB 1MFZA 1JY2P 1HUCA 3MD0A 3MTUE 4HH2A 2WWWA 4C7NB 3N4XA 1JTHA 2HYNA 1WRGA 3LIDA 3UIAA 1RF1B 1N73B 3HE5B 3V5BA 1A02F 4HYTB 4AUWA 3LIEA 3G3ZA 2YKOA 3L4FA 3H6PA 1OWAA 3P8CD 1N86A 2C0XA 3NMDA 3R2PA 4JYCA 5CCGA 1N7SA 1LT9A 2Q5UA 5AW6B 1FZCB 2XDJA 1RY3A 1URQC 5CCGC 4GT1A 1N7SC 4DZOA 3B5NB 2WZ7A 1RF0A 3U59A 3VMYA 1SQXK 3RL0C 2O1JA 5AVRB 1RF0C 1JCCA 1SVFA 5APYA 2P67A 1H8AA 2H43A 3M9BA 3MIWA 1NOHA 5CMZA 3P8MC 1GU5A 1JOCA 2FFDC 5AVUB 3VMXA 3LW5H 3OAKA 1YTZT 1RE4A 1GZLA 2IFMA 3II6A 5APWA 1SFCA 2POHA 3L36A 1HWTC 4RESB 4N3YB 2A45H 1NHLA 1URQD 2W6AA 1RE3A 1RE4C 1SFCC 3SWYA 5AVVB 5AW8B 1NTKK 1J2JB 1LGHB 2C9NY 2CPSA 3MUDA 1HH0A 3HE4B 4GIFA 2ZXEB 3V2PA 1GW4A 4WY4A 5KJ7D 1HJBA 2GUSA 1L4AB 1FDMA 4WY4C 4XE5B 4OH8B 3NFQA 5AW1B 1KILD 1NWQA 2P2UA 3GHGB 1GK4A 2HLOA 1IK9A 2NPSD 1J1EC 3HRNA 2GUVA 1ZV8A 3VMZA 1JY2O 2Z5HA 1G1IA 1G2CA 1NKZB 1NH4A 2LKMA 1X8YA 4W7YA 1GDTA 3HUSC 2IPPA 4LGDE 5AVZB 3RK2C 2WSFH 2OYIB 2YNYA 2N1TD 2L5GB 2J59M 2YKPA 3VN0A 4LLHA 1ZR4A 1SP4A 4Y99C 4IFMA 2HPCA 1MZ9A 1JCDA 4AQRD 1J1DC 5CCHD 4XA4A 1HBWA 3VYIA 3MGNA 3TNUA 5AVSB 2FYUK 2R5BA 1JTHB 1IC2A 2OYHC 1X9VA 3P8CE 2YO2A 5CJ4A 1T2KD 4W7ZA 1NTMK 2Z4EA 2O1KA 3RK2D 1WT6A 5AVYB 1LTIC 1SQPK 2I1KA 1N7SB 1NTZK 1LT9B 2P1JA 5BU5A 4EOTA 1XTCC 1YYCA 2JEEA 5KTBA 2W27A 3RL0B 3TYYA 3M9HA 2PP6A 2YKQA 5APXA 1URQA 1LTJA 3HD7D 1VDFA 5BU8B 1HVVA 3NTNA 1LTJC 5CJ0A 5AVXB 4LC1A 2H7HA 3V2RA 4EIJA 3KQGA 1JO5A 2YO3A 5KJ7A 1QL2A 2Z5IA 4WBAA 1LWUC 1SFCB 1GL2D 2M8RA 5KJ7C 1LTBC 1H89A 2R5DA 1JUNA 1T3JA 2FFDA 2H8PD 1MUUA 2WT7A 2XNXA 1HGZA 4ZKUA 1XTGB 2E42A 3M0DA 1KILA 3KYQA 1GK6A 1LTAC 1RF1C 1T8ZA 3M0DC 1KILC 2HG5D 1IO4A 1DEBA 3V4WA 1JY3O 2NPSA 4WY4B 1EQ7A 5AW9B 1JY2N 1N7LA 3L37A 2NPSC 2HFED 3A7OA 1IFNA 2N9BA 1QL1A 3BRVB 1S9KE 3M9QA 4I2LC 3E1IA 4O9BA 1KFNA 1AFOA 2XKMA 1M1JC 1HTLC 2R3CA 2VRSA 3OA7A 2N1TA 1FOSE 1IFMA 3BASA 3H32A 4N6JA 2N1TC 2WPRA 1S9KD 4JF7A 1G2CB 5CCHA 3A2AA 4C7RA 1SQVK 1GU4A 1GW3A 5CCHC 1JY3P 2GM4A 1N2DC 2OARA 4DOJA 4Y99B 1FZEA 3CLQA 4WB4A 3B5ND 1J1DB 3HUSA 1T3UA 2HPCB 2R32A 1T2KC 3BRTB 3RK3B 1CW5A 2JJLA 4I1LA 1IFJA 2FXMA 3CI9A 3TNUB 1ZR2A 2PAJA 3P7KA 4I6MC 1HGVA 2FYZA 2KOGA 3CL3D 4C46A 1YTZI 2WSEH 5AW4B 1FZGA 2E43A 4B86A 1Z56A 5APVA 1FZAA 5AW7B 1G1JA 2OYHA 2C9LY 3HD7C 1GD2E 3GHGC 1CZQA 1LTTC 1VPCA 3A5TA 3N7NA 3KPEA 1IJDB 3WMM0 3VTPC 1FZFA 1OXZA 2XV5A 3V4QA 5BVZA 1GL2A 3BVHA 4ZKPA 1URQB 1LTJB 3A3YB 3OJAB 1CI6A 3O8ZA 3BATA 1L4AD 1NAFA 1L0LK 1GL2C 1MV8A 2HODA 2WPSA 4AYCA 2P7JA 3M0AA 1IFDA 1JY3N 3U1CA 1AQ5A 2I1JA 1FAVA 2A45G 3VP9A 4W80A 1KZUB 2WTYA 3HTKA 3TSIA 2FFDB 4N78E 2KLVA 5AVTB 1LTGC 2WT7B 3U1AA 1NU1K 1KFMA 1FZBA 1SQBK 1KILB 3PP5A 1LTSC 1LWUA 2IFNA 1H88A 1ZN5A 1X79B 1L0NK 1PFIA 1FBMA 2NPSB 5AW5B 3TK1A 3RK3D 2W6BA 4C7NA 5AW3B 2A45I 1M7LA 1RF1A 4N78D 1N73A 3HE5A 3M91A 1LT9C 5KLVK 5AVWB 1N73C 3M06A 1M1JB 1GTWA 1FJPA 3I5CA 2WITA 1E5WA 3IR9A 3T97A 1FZCA 2N1TB 1NO4A 2O01H 3B5NA 2XZRA 1FZCC 2WPQA 3H32B 1M1JA 2WSCH 1SQQK 3B5NC 2KYVA 1DH3A 1KQLA 3KDPB 1J1EB 3P32A 5AVQB 3SWFA 1A02J 2BASA 5AW2B 2Q9IA 5CCGD 1N7SD 3VP8A 3NXSA 5AW0B 1W2EA 3EQ2A 1RE3C 3HUSB 2KP8A 2M3BA 3RL0D 2FKWB 3RK2B 3V2QA 5APQA 1ZLLA 1DX7A 2KSJA 2KB7P 2IX7C 4GKGA 3IFMA 2QM8A 3EFGA 5APSA 1FU1A 3HE4A 1NKNA 1FJKA 4KHXA 3V2NA 2J58A 3HD7B 1L4AA 1SFCD 2OYHB 1L4AC 3L35A 3B8EB 1IFIA 4JYBA 5APTA 2XU6A 3HD7A 3GHGA 4IFDK 1CSBA 1GL2B 4IFFA 4WY4D 5APUA 1CI6B 2ZFCA 2HODB 2MJZA 2CPBA 2YMYA 3C9IA 5CHXA 3VOPA 1JNMA 1JMMA 2QM7A 2Q3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1LTA C;  1XTC C;  1LTG C;  1LTI C;  1HTL C;  1LTB C;  1LTS C; 
#chains in the Genus database with same CATH topology
 2G8Y A;  2Q7C A;  4H0L B;  2K9Y A;  1BDC A;  1JY2 P;  3L70 J;  2AXC A;  1X0T A;  2FYN B;  3AEE C;  4I7Z B;  3N4X A;  2O01 J;  2YKO A;  3F89 A;  3L4F A;  4UB6 E;  4GOE A;  1N86 A;  3H1K E;  2QJK C;  3R2P A;  1NTM D;  2Q5U A;  4JQ0 D;  3FXD A;  3AEG C;  3SFE C;  4DZO A;  3B5N B;  2BCC J;  4TT3 H;  1RF0 A;  4PJ0 E;  3CCV P;  2O1J A;  2AEJ A;  5AVR B;  1RF0 C;  2QSI A;  1VQL P;  4IL6 E;  2H43 A;  3PJS K;  5KAF H;  2K1A A;  3L75 J;  2KS1 A;  2YIU B;  1SQV J;  3K5B A;  1OFC X;  3OAK A;  1YTZ T;  1RE4 A;  3II6 A;  1SQX D;  2POH A;  3L36 A;  1HWT C;  1P84 H;  1RE4 C;  1ZOY C;  1NTK K;  3L70 D;  1VQO P;  2CPS A;  1HH0 A;  4GIF A;  1GW4 A;  1L4A B;  4ZNC A;  4WVZ A;  2W83 C;  2OTL P;  2JWA A;  2P10 A;  1NJI Q;  3GHG B;  1GK4 A;  2LXC B;  2HLO A;  4H13 B;  1J1E C;  1JY2 O;  2Z5H A;  2JKV A;  1G1I A;  1BSN A;  2FXP A;  2OTK E;  3L75 D;  2FY8 A;  2K9J B;  2LKM A;  1X8Y A;  4W7Y A;  1SQV D;  3G4S P;  2YMK A;  3RK2 C;  2ZT9 D;  2OYI B;  3RBZ A;  2YKP A;  1KC8 Q;  4EYY Q;  1J1D C;  1OW7 A;  1NU1 J;  2AEF A;  2OYO A;  2R5B A;  5KKZ B;  1JTH B;  2L91 A;  1IC2 A;  1X9V A;  1VQP P;  4W7Z A;  1NTM K;  1GMJ A;  2O1K A;  1EXJ A;  1N7S B;  2P1J A;  5KLV J;  2FYU D;  1PGO A;  1Y9B A;  4D6T J;  1H0T B;  5M1B A;  3L72 E;  1FS0 E;  1OZH A;  2PP6 A;  2YKQ A;  3AE5 C;  1URQ A;  1LTJ A;  1VDF A;  1KB9 E;  3BCC E;  3NTN A;  1SQP D;  1LTJ C;  1SQQ J;  5CJ0 A;  2M3E A;  3V2R A;  3KQG A;  1VF5 B;  1ZRT E;  2DW3 A;  3CC7 P;  4WBA A;  2KUB A;  1LWU C;  1SFC B;  1YBK A;  1H89 A;  1M56 D;  1LTB C;  1JUN A;  3B4S A;  1MUU A;  1RH5 B;  1YIJ P;  4ZKU A;  1RF1 C;  2HG5 D;  2KK7 A;  3L74 G;  2CK3 H;  3L71 J;  1N7L A;  3L37 A;  1VQ5 P;  5CBO A;  3A7O A;  3M9Q A;  3E1I A;  5KLV D;  1AVO A;  1KV4 A;  1OVV A;  1OVR A;  1M1J C;  1HTL C;  3H1I D;  2VRS A;  3OA7 A;  3CC2 P;  3CCL P;  4JPZ B;  3MHV A;  1FOS E;  2RN0 A;  3H32 A;  2ZVO B;  4C7R A;  1SQQ D;  1SQV K;  4OGQ D;  1OW6 A;  3QH9 A;  3CXH I;  1BE3 J;  2ZYG A;  1IK7 A;  5B5E H;  1VQ8 P;  1T2K C;  5L8R J;  4L73 A;  1IFJ A;  1NTM G;  3TNU B;  1S5L H;  2KOG A;  3L71 D;  1YTZ I;  2WSE H;  5GTH E;  1JMB A;  4B86 A;  3FGA D;  1FZA A;  5AW7 B;  1OVU A;  5H2F E;  1VPC A;  3WMM 0;  1M8O B;  4BRY A;  1FZF A;  2XV5 A;  3CXH D;  3V4Q A;  2IYP A;  1FC2 C;  1SQX G;  1MV8 A;  2AXT H;  2HOD A;  3SSU A;  1EDK A;  1YIT P;  3W67 A;  2K37 A;  1AQ5 A;  3TGU G;  1PP9 G;  1BE3 D;  4W80 A;  2OQQ A;  2KLV A;  2WT7 B;  3U1A A;  1NU1 K;  1U7M A;  1UII A;  1PGP A;  1PFI A;  1FDO A;  2NPS B;  2W6B A;  1KMI Z;  1P84 I;  1M7L A;  2FYN C;  4I7Z C;  1LT9 C;  5KLV K;  3O6Q B;  1K73 Q;  1GTW A;  3IR9 A;  2JO1 A;  4GOF A;  2O01 H;  3B5N A;  2XZR A;  2RKL A;  3RBX A;  1LJ2 A;  1SQQ K;  2UWJ E;  3B5N C;  1DH3 A;  1KQL A;  1J1E B;  3P32 A;  3VP8 A;  3AEA C;  3G6E P;  1RHZ B;  1RE3 C;  2YIU C;  2M3B A;  1T6A A;  2FKW B;  3RK2 B;  1P84 D;  2B89 A;  3IFM A;  2QM8 A;  2E75 D;  1YJN P;  2FYU G;  5APS A;  3L74 E;  3CWB J;  2O3J A;  3D71 A;  1L4A A;  1BGY J;  4A7P A;  3ABV C;  1L4A C;  1QVG O;  1SQP G;  3HD7 A;  3CME P;  3H25 A;  3GHG A;  3JC2 2;  1NTZ J;  3CCE P;  1LNQ A;  1CSB A;  1LP1 B;  1GL2 B;  4WY4 D;  5APU A;  2ZXX A;  2QIW A;  4H13 C;  5GTI H;  1JMM A;  1JNM A;  1KOR A;  2K9J A;  2Y0E A;  3D70 A;  2O01 N;  2QM7 A;  4XFJ A;  3RK3 C;  2OYI A;  2C0W A;  2KZI A;  2QJY B;  3AED C;  2OYI C;  1LWU B;  1MFZ A;  4YTP C;  1HUC A;  4PV1 B;  3AE8 C;  4HH2 A;  5KLV G;  1NTM E;  3RK3 E;  3E7K A;  1BCC G;  4L74 A;  3H1I G;  1JTH A;  3CWB D;  3LID A;  3UIA A;  1NGM B;  1RF1 B;  3HE5 B;  4HYT B;  5KKZ C;  3B71 A;  3KXD A;  3P8C D;  2WSC J;  2PGD A;  4JYC A;  4UB6 H;  1N7S A;  1SQQ G;  1Y8A A;  1RY3 A;  1NTZ D;  3C8V A;  1N7S C;  1H0T A;  3VMY A;  1KYO I;  2BEQ D;  1SQX E;  1JCC A;  1SVF A;  5APY A;  3M9B A;  1NOH A;  3H1L J;  3TGU E;  2FFD C;  5AVU B;  1PP9 E;  3L71 G;  1GZL A;  3RL0 g;  1VQM P;  1SFC A;  4RES B;  2A45 H;  1NHL A;  2W6A A;  1SFC C;  3A0B H;  1LGH B;  3HE4 B;  2WSE J;  3V2P A;  2JP3 A;  1HJB A;  4Z1M H;  2GUS A;  1Q90 D;  2QG4 A;  2D2C B;  3H1J J;  2NRG A;  2QJP B;  2Y9Y A;  4OH8 B;  1UIX A;  1KYO D;  3L73 D;  3I56 P;  1DD4 A;  1NTK D;  1YHQ P;  3CCR P;  5AW1 B;  1KIL D;  1NWQ A;  2P2U A;  1NYH A;  2RH0 A;  1OW8 A;  1EC5 A;  2E76 B;  2GUV A;  1ZV8 A;  3EWK A;  1K05 A;  4RKU J;  1NH4 A;  3H1L D;  1L0L J;  4LGD E;  2N1T D;  1R5L A;  3USS A;  1ZR4 A;  1SP4 A;  4IFM A;  1JCD A;  4AQR D;  3GLM A;  3TNU A;  1SQB J;  2FYU E;  1OIP A;  2IBZ I;  1L0N J;  2KIK A;  2HR3 A;  1M1K Q;  3H1J D;  1WT6 A;  2E74 D;  2I1K A;  1NTZ K;  1LT9 B;  1SQP E;  4BXL A;  1SS1 A;  1XTC C;  2QVA A;  2JEE A;  5KTB A;  2LR2 A;  3RL0 B;  4PD4 H;  3Q5P A;  2ZYA A;  3HD7 D;  3RGU A;  3S4R A;  3GF3 A;  3LW5 J;  3KZI H;  4U3F D;  5AVX B;  2H7H A;  4Y28 J;  5KJ7 A;  1QL2 A;  2B87 B;  4L76 A;  2Z5I A;  2IBZ D;  5KJ7 C;  1DD3 A;  2WT7 A;  2E5Y A;  3KYQ A;  1LTA C;  1SQB D;  1BCC E;  2NPS A;  3H1I E;  4NPD A;  5AW9 B;  2NPS C;  3SFD C;  2N9B A;  3O6Q A;  3CCJ P;  2Y9Z A;  5KLI B;  4O9B A;  1SQQ E;  2PRR A;  4DT0 A;  1VQ6 P;  2N9Y B;  4L75 A;  3WUU A;  1YJ9 P;  3H1H J;  4JF7 A;  2OGU A;  1G2C B;  5CCH A;  1GU4 A;  3CMA P;  2BCC D;  5CCH C;  3GG2 A;  2FXO A;  1N2D C;  1NVO A;  4DOJ A;  1FZE A;  3CLQ A;  4WB4 A;  2HPC B;  3RK3 B;  1CW5 A;  1PPJ D;  2KNC B;  2A06 G;  2FXM A;  1QEX A;  1ZME C;  1HGV A;  5B66 E;  1EDL A;  1NTZ G;  3CXH E;  5KAI E;  1G1J A;  2WSS H;  3V6I A;  1YI2 P;  3N7N A;  3KPE A;  3TF5 A;  3Q5R A;  5BVZ A;  1LP1 A;  1GL2 A;  3BVH A;  3H1H D;  4ZKP A;  2KSE A;  3O8Z A;  3AE6 C;  1NAF A;  5C39 A;  1L0L K;  1GL2 C;  3AE3 C;  1JY3 N;  2Y0C A;  2QA4 P;  2I1J A;  3VP9 A;  4K3A A;  3AE1 C;  3S9O A;  3TSI A;  2FFD B;  1IZN B;  1KFM A;  1SQB K;  3CX5 H;  3PP5 A;  1LTS C;  1LWU A;  2QJY C;  2IFN A;  3AE4 C;  3L73 G;  1NTK G;  1L0N K;  4UB8 H;  2Q3E A;  5AW5 B;  1R5S A;  4PV1 C;  3OW2 O;  2A45 I;  1RF1 A;  4N78 D;  1U7J A;  3HE5 A;  1NU1 D;  5AVW B;  3M06 A;  1FJP A;  1E5W A;  5KAF E;  3H1L G;  5DJT B;  2ZT9 B;  1ZXG A;  4HJG H;  3PH0 A;  1M1J A;  1KYO H;  2WSC H;  2KYV A;  5TIS E;  1S2E A;  5AVQ B;  3SWF A;  1A02 J;  4D6T D;  1EZV I;  1S4X A;  3Q1M A;  2XND H;  2KP8 A;  3H1J G;  1ZLL A;  1DX7 A;  1LT1 A;  2QE7 H;  3EFG A;  3HE4 A;  1JM0 A;  2JR8 A;  1OMI A;  1KQF B;  2D2C C;  4U3F G;  1IFI A;  2QJP C;  5APT A;  2XU6 A;  1EZV D;  2WVR A;  3ZDM A;  2K3R A;  2MKV A;  2IBZ G;  3L72 J;  3MP7 B;  2E76 C;  2M5A B;  2CPB A;  3C9I A;  1USE A;  3BCC J;  4PD4 I;  1EDJ A;  1DEE G;  3PRJ A;  3HTK B;  1FOS F;  2Q6Q A;  3TDK A;  3L70 G;  3G9R A;  2A06 E;  2NZ2 A;  3MD0 A;  3G71 P;  3MTU E;  1X22 A;  1W2B O;  1PGQ A;  3AEB C;  2HYN A;  1WRG A;  3V5B A;  4AUW A;  3H6P A;  1OWA A;  4OGQ B;  5CCG A;  1LT9 A;  3T97 B;  2BCC G;  1FZC B;  2XDJ A;  5CCG C;  4GT1 A;  4PD4 D;  2I8D A;  2KS1 B;  5E79 E;  3U59 A;  2SPZ A;  3RL0 C;  3L75 G;  2P67 A;  3QWO C;  1H8A A;  1SQV G;  1PPJ G;  3MIW A;  1BDD A;  3P8M C;  1USD A;  1JOC A;  1R8E A;  3VMX A;  3LW5 H;  2B87 A;  1U57 A;  1ZRT D;  2IFM A;  2G3A A;  4N3Y B;  4OWF A;  1URQ D;  1E79 H;  1RE3 A;  3SWY A;  1D7M A;  5AVV B;  3L73 E;  1NTK E;  1KIL E;  3MZW B;  3GMA A;  3H1H G;  2OTJ P;  3NFQ A;  1KD1 Q;  5KLI C;  3CCM P;  1K9M Q;  1PV3 A;  3HRN A;  3VMZ A;  3WU2 H;  2Y0D A;  1G2C A;  1PIX A;  2YXQ B;  4GDO A;  3A0H H;  3HUS C;  1QX8 A;  4R4L A;  4TLF A;  2ITA A;  2YNY A;  2L5G B;  3GF7 A;  1WMK A;  3KHU A;  5TJH A;  3H1J E;  2HPC A;  1NU1 G;  2KNC A;  4XA4 A;  1HBW A;  3F5H A;  2IDB A;  1HJ0 A;  2ZYD A;  1Q81 Q;  4MN4 C;  2OYH C;  2W6J H;  1FE6 A;  3CX5 I;  3PTZ A;  5CJ4 A;  1T2K D;  2Z4E A;  5AVY B;  1LTI C;  4H44 D;  4U3F E;  3AE2 C;  2M0B A;  4D6T G;  1YYC A;  1BGY D;  1BSH A;  3TYY A;  2R3S A;  4NPE A;  1QLE D;  2IBZ E;  5BU8 B;  3IF4 A;  2E75 B;  1JO5 A;  2YO3 A;  4PJ0 H;  2WPV B;  1S1C X;  4EDF A;  1M57 D;  2FFD A;  3CX5 D;  2XNX A;  4IL6 H;  1XTG B;  3L70 E;  3M0D A;  1S3J A;  4ZMD A;  1AQT A;  2ZJS E;  1T8Z A;  3M0D C;  1DEB A;  3V4W A;  1JY3 O;  4WY4 B;  1EQ7 A;  1EZV G;  1FDI A;  3L74 J;  2HFE D;  1IFN A;  1QL1 A;  3BRV B;  4H0L D;  1KFN A;  2BCC E;  2XKM A;  1W5C E;  1KQG B;  2ZT9 C;  4N6J A;  2WSF J;  1KTM A;  2WPR A;  1Y47 A;  1S9K D;  2V7Q J;  1AVY A;  3A2A A;  3L75 E;  2H89 C;  2BEZ F;  1SQV E;  1PPJ E;  1BE3 G;  3D6Z A;  2OAR A;  4Y99 B;  3B5N D;  3D6Y A;  4YPC A;  4DCK A;  2JJL A;  1ZR2 A;  1VQN P;  3P7K A;  3CL3 D;  1NTM J;  4C46 A;  5AW4 B;  5B66 H;  5CBN A;  2C9L Y;  1GD2 E;  1CZQ A;  1LTT C;  5KAI H;  3ITK A;  3VTP C;  1OXZ A;  1AJY A;  3OJA B;  3BAT A;  1EDI A;  1L4A D;  2M5A A;  3M0A A;  1K04 A;  1SQX J;  3U1C A;  4RJT A;  1FAV A;  4CPG A;  1KZU B;  4ASW A;  2WTY A;  3TGU J;  1YQ3 C;  3HTK A;  4H13 D;  1PP9 J;  1L0L D;  1KB9 H;  4N78 E;  4WWI A;  1NU1 E;  1FZB A;  1KIL B;  3JCU E;  2ZVN B;  1H88 A;  1AA0 A;  1X79 B;  2LXB A;  1FBM A;  3TK1 A;  3RK3 D;  5AW3 B;  4QMA A;  3M91 A;  5K5G B;  1VQ7 P;  5KLV E;  3I5C A;  2WIT A;  2IYO A;  1L0N D;  4D6T E;  3T97 A;  1FZC A;  4OGQ C;  4EI2 A;  2N1T B;  1PGJ A;  1FZC C;  3AE9 C;  3KDP B;  3FXE A;  5EFW B;  2BAS A;  5AW2 B;  3A0B E;  1N7S D;  5TIS H;  3TGU D;  3HUS B;  1PP9 D;  3V2Q A;  5APQ A;  2E74 B;  1VQK P;  4K35 A;  4GKG A;  2IX7 C;  4HKZ H;  3L71 E;  1S5L X;  3CWB G;  1FU1 A;  3SWK A;  2IZ1 A;  1BGY G;  1NKN A;  1VF5 D;  1EZV E;  2FYU J;  3HD7 B;  1Q2N A;  1SFC D;  2OYH B;  3CD6 P;  3C1L A;  3L35 A;  2Q1K A;  1SQP J;  4IFD K;  5GTH H;  4IFF A;  2R44 A;  1CI6 B;  3H1K J;  2ZFC A;  2ZAE B;  2MJZ A;  1VQ4 P;  5H2F H;  3S1K A;  5CHX A;  3VOP A;  1BE3 E;  4YXW H;  1DIP A;  3IN6 A;  4M3L A;  1SLQ A;  1KQS O;  4R4M A;  4U7J A;  2WWW A;  4C7N B;  1EXI A;  5DJU B;  1A02 F;  1N73 B;  1BCC J;  4PD4 E;  3H1I J;  3LIE A;  3G3Z A;  2C0X A;  3NMD A;  3KZI E;  2WQY C;  1AV1 A;  4IOI H;  5AW6 B;  1URQ C;  2WZ7 A;  2JDI H;  3H1K D;  1YJW P;  1SQX K;  3JSV C;  5E79 H;  3AE7 C;  5CMZ A;  1GU5 A;  1QGK B;  2E75 C;  3FX0 A;  1P84 E;  5APW A;  2JWD A;  5AW8 B;  2B88 A;  1J2J B;  2WMM A;  2P58 A;  2C9N Y;  1VL2 A;  3MUD A;  2ZXE B;  3AEF C;  4WY4 A;  5KJ7 D;  1BCC D;  3MUD C;  1FDM A;  4WY4 C;  4XE5 B;  1Q7Y Q;  1MFT A;  4ASV A;  1JB0 J;  1IK9 A;  1Q86 Q;  3CCS P;  2NPS D;  4KJM A;  1L0L G;  1NKZ B;  1GDT A;  4JBZ A;  2B9B A;  2IPP A;  4GOD A;  5AVZ B;  3IAO A;  2WSF H;  2V7Q H;  2J59 M;  4H44 C;  3CPW O;  3VN0 A;  4LLH A;  4Y99 C;  4DJG A;  1MZ9 A;  4YXD C;  1SQB G;  5CCH D;  3VYI A;  3MGN A;  1L0N G;  1OX3 A;  4HB1 A;  5AVS B;  2FYU K;  3CWB E;  3EFF K;  1KB9 I;  1BGY E;  3P8C E;  2QJK B;  2YO2 A;  3E1R A;  1QVF O;  1Q82 Q;  3RK2 D;  1SQP K;  5BU5 A;  1NTZ E;  3W68 A;  4EOT A;  2W27 A;  3VMA A;  3M9H A;  5APX A;  1HVV A;  3CX5 E;  4LC1 A;  4IL6 X;  4UB8 E;  4EIJ A;  3L72 D;  4H0L C;  2J5U A;  1GL2 D;  1KB9 D;  2M8R A;  2R5D A;  1VQ9 P;  1T3J A;  3BCC D;  2H8P D;  1HGZ A;  2E42 A;  1KIL A;  1GK6 A;  3PHL A;  1KIL C;  1IO4 A;  1JY2 N;  1KN7 A;  1ZP0 C;  3FWN A;  1KYO E;  1S9K E;  4I2L C;  1MKM A;  1RQV A;  1AFO A;  4PV1 D;  2R3C A;  2N1T A;  4BWN A;  1IFM A;  3BAS A;  1N8R Q;  2N1T C;  3Q3D A;  3H1L E;  2RMZ A;  1JEK A;  2PFX A;  1GW3 A;  3WUT A;  1S72 P;  1JY3 P;  4NPF X;  2GM4 A;  1IFP A;  5B5E E;  1J1D B;  3HUS A;  1T3U A;  1RQU A;  2R32 A;  3BRT B;  4I1L A;  1S5L E;  2FBW C;  3CI9 A;  2E74 C;  3CCU P;  2PAJ A;  4I6M C;  2QEX P;  2FYZ A;  1FZG A;  2E43 A;  1Z56 A;  5APV A;  3H1K G;  2OYH A;  3HD7 C;  4OVN F;  3GHG C;  3A5T A;  1IJD B;  3WUV A;  2K88 A;  2AXT E;  1URQ B;  1LTJ B;  3A3Y B;  1PL5 A;  1PZQ A;  1CI6 A;  2D2C D;  2WPS A;  1L0L E;  4AYC A;  2KI7 B;  2P7J A;  1IFD A;  1M90 Q;  2V4H A;  1K8A Q;  2A45 G;  4RO0 A;  2E76 D;  2GA1 A;  5AVT B;  1LTG C;  3I55 P;  1SQB E;  1ZN5 A;  1ZW0 A;  2A06 D;  1L0N E;  3JCU H;  3L73 J;  4C7N A;  1NTK J;  1N73 A;  2QRX A;  1N73 C;  1M1J B;  2KLU A;  4KT0 J;  1NO4 A;  2H88 C;  2WPQ A;  3H32 B;  2W90 A;  3CC4 P;  2AEM A;  1VF5 C;  2Q9I A;  5CCG D;  2W8Z A;  3NXS A;  2YXR B;  5AW0 B;  1W2E A;  3EQ2 A;  3GW6 A;  3Q5S A;  3RL0 D;  3Q2Y A;  4H44 B;  2KSJ A;  2KB7 P;  3AEC C;  3R4Y A;  3FWL A;  3CCQ P;  1FJK A;  4KHX A;  3V2N A;  2J58 A;  3WU2 E;  2KZJ A;  1NAY A;  3B8E B;  4JYB A;  3A0H E;  2IZ0 A;  3L74 D;  4U3F J;  4BRY B;  3H1H E;  3L72 G;  3PLN A;  1L2P A;  3CXH H;  1TU3 F;  2HOD B;  5GTI E;  3BCC G;  2YMY A;  2E5T A;  1YQ4 C;  2KXP B;  2Q3I A;  1HF9 A; 
#chains in the Genus database with same CATH homology
 3RK3 C;  2OYI A;  2C0W A;  3HTK B;  1FOS F;  2Q7C A;  2OYI C;  4M3L A;  1SLQ A;  1LWU B;  1MFZ A;  1JY2 P;  1HUC A;  3MD0 A;  3MTU E;  4HH2 A;  2WWW A;  4C7N B;  3N4X A;  1JTH A;  2HYN A;  1WRG A;  3LID A;  3UIA A;  1RF1 B;  1N73 B;  3HE5 B;  3V5B A;  1A02 F;  4HYT B;  4AUW A;  3LIE A;  3G3Z A;  2YKO A;  3L4F A;  3H6P A;  1OWA A;  3P8C D;  1N86 A;  2C0X A;  3NMD A;  3R2P A;  4JYC A;  5CCG A;  1N7S A;  1LT9 A;  2Q5U A;  5AW6 B;  1FZC B;  2XDJ A;  1RY3 A;  1URQ C;  5CCG C;  4GT1 A;  1N7S C;  4DZO A;  3B5N B;  2WZ7 A;  1RF0 A;  3U59 A;  3VMY A;  1SQX K;  3RL0 C;  2O1J A;  5AVR B;  1RF0 C;  1JCC A;  1SVF A;  5APY A;  2P67 A;  1H8A A;  2H43 A;  3M9B A;  3MIW A;  1NOH A;  5CMZ A;  3P8M C;  1GU5 A;  1JOC A;  2FFD C;  5AVU B;  3VMX A;  3LW5 H;  3OAK A;  1YTZ T;  1RE4 A;  1GZL A;  2IFM A;  3II6 A;  5APW A;  1SFC A;  2POH A;  3L36 A;  1HWT C;  4RES B;  4N3Y B;  2A45 H;  1NHL A;  1URQ D;  2W6A A;  1RE3 A;  1RE4 C;  1SFC C;  3SWY A;  5AVV B;  5AW8 B;  1NTK K;  1J2J B;  1LGH B;  2C9N Y;  2CPS A;  3MUD A;  1HH0 A;  3HE4 B;  4GIF A;  2ZXE B;  3V2P A;  1GW4 A;  4WY4 A;  5KJ7 D;  1HJB A;  2GUS A;  1L4A B;  1FDM A;  4WY4 C;  4XE5 B;  4OH8 B;  3NFQ A;  5AW1 B;  1KIL D;  1NWQ A;  2P2U A;  3GHG B;  1GK4 A;  2HLO A;  1IK9 A;  2NPS D;  1J1E C;  3HRN A;  2GUV A;  1ZV8 A;  3VMZ A;  1JY2 O;  2Z5H A;  1G1I A;  1G2C A;  1NKZ B;  1NH4 A;  2LKM A;  1X8Y A;  4W7Y A;  1GDT A;  3HUS C;  2IPP A;  4LGD E;  5AVZ B;  3RK2 C;  2WSF H;  2OYI B;  2YNY A;  2N1T D;  2L5G B;  2J59 M;  2YKP A;  3VN0 A;  4LLH A;  1ZR4 A;  1SP4 A;  4Y99 C;  4IFM A;  2HPC A;  1MZ9 A;  1JCD A;  4AQR D;  1J1D C;  5CCH D;  4XA4 A;  1HBW A;  3VYI A;  3MGN A;  3TNU A;  5AVS B;  2FYU K;  2R5B A;  1JTH B;  1IC2 A;  2OYH C;  1X9V A;  3P8C E;  2YO2 A;  5CJ4 A;  1T2K D;  4W7Z A;  1NTM K;  2Z4E A;  2O1K A;  3RK2 D;  1WT6 A;  5AVY B;  1LTI C;  1SQP K;  2I1K A;  1N7S B;  1NTZ K;  1LT9 B;  2P1J A;  5BU5 A;  4EOT A;  1XTC C;  1YYC A;  2JEE A;  5KTB A;  2W27 A;  3RL0 B;  3TYY A;  3M9H A;  2PP6 A;  2YKQ A;  5APX A;  1URQ A;  1LTJ A;  3HD7 D;  1VDF A;  5BU8 B;  1HVV A;  3NTN A;  1LTJ C;  5CJ0 A;  5AVX B;  4LC1 A;  2H7H A;  3V2R A;  4EIJ A;  3KQG A;  1JO5 A;  2YO3 A;  5KJ7 A;  1QL2 A;  2Z5I A;  4WBA A;  1LWU C;  1SFC B;  1GL2 D;  2M8R A;  5KJ7 C;  1LTB C;  1H89 A;  2R5D A;  1JUN A;  1T3J A;  2FFD A;  2H8P D;  1MUU A;  2WT7 A;  2XNX A;  1HGZ A;  4ZKU A;  1XTG B;  2E42 A;  3M0D A;  1KIL A;  3KYQ A;  1GK6 A;  1LTA C;  1RF1 C;  1T8Z A;  3M0D C;  1KIL C;  2HG5 D;  1IO4 A;  1DEB A;  3V4W A;  1JY3 O;  2NPS A;  4WY4 B;  1EQ7 A;  5AW9 B;  1JY2 N;  1N7L A;  3L37 A;  2NPS C;  2HFE D;  3A7O A;  1IFN A;  2N9B A;  1QL1 A;  3BRV B;  1S9K E;  3M9Q A;  4I2L C;  3E1I A;  4O9B A;  1KFN A;  1AFO A;  2XKM A;  1M1J C;  1HTL C;  2R3C A;  2VRS A;  3OA7 A;  2N1T A;  1FOS E;  1IFM A;  3BAS A;  3H32 A;  4N6J A;  2N1T C;  2WPR A;  1S9K D;  4JF7 A;  1G2C B;  5CCH A;  3A2A A;  4C7R A;  1SQV K;  1GU4 A;  1GW3 A;  5CCH C;  1JY3 P;  2GM4 A;  1N2D C;  2OAR A;  4DOJ A;  4Y99 B;  1FZE A;  3CLQ A;  4WB4 A;  3B5N D;  1J1D B;  3HUS A;  1T3U A;  2HPC B;  2R32 A;  1T2K C;  3BRT B;  3RK3 B;  1CW5 A;  2JJL A;  4I1L A;  1IFJ A;  2FXM A;  3CI9 A;  3TNU B;  1ZR2 A;  2PAJ A;  3P7K A;  4I6M C;  1HGV A;  2FYZ A;  2KOG A;  3CL3 D;  4C46 A;  1YTZ I;  2WSE H;  5AW4 B;  1FZG A;  2E43 A;  4B86 A;  1Z56 A;  5APV A;  1FZA A;  5AW7 B;  1G1J A;  2OYH A;  2C9L Y;  3HD7 C;  1GD2 E;  3GHG C;  1CZQ A;  1LTT C;  1VPC A;  3A5T A;  3N7N A;  3KPE A;  1IJD B;  3WMM 0;  3VTP C;  1FZF A;  1OXZ A;  2XV5 A;  3V4Q A;  5BVZ A;  1GL2 A;  3BVH A;  4ZKP A;  1URQ B;  1LTJ B;  3A3Y B;  3OJA B;  1CI6 A;  3O8Z A;  3BAT A;  1L4A D;  1NAF A;  1L0L K;  1GL2 C;  1MV8 A;  2HOD A;  2WPS A;  4AYC A;  2P7J A;  3M0A A;  1IFD A;  1JY3 N;  3U1C A;  1AQ5 A;  2I1J A;  1FAV A;  2A45 G;  3VP9 A;  4W80 A;  1KZU B;  2WTY A;  3HTK A;  3TSI A;  2FFD B;  4N78 E;  2KLV A;  5AVT B;  1LTG C;  2WT7 B;  3U1A A;  1NU1 K;  1KFM A;  1FZB A;  1SQB K;  1KIL B;  3PP5 A;  1LTS C;  1LWU A;  2IFN A;  1H88 A;  1ZN5 A;  1X79 B;  1L0N K;  1PFI A;  1FBM A;  2NPS B;  5AW5 B;  3TK1 A;  3RK3 D;  2W6B A;  4C7N A;  5AW3 B;  2A45 I;  1M7L A;  1RF1 A;  4N78 D;  1N73 A;  3HE5 A;  3M91 A;  1LT9 C;  5KLV K;  5AVW B;  1N73 C;  3M06 A;  1M1J B;  1GTW A;  1FJP A;  3I5C A;  2WIT A;  1E5W A;  3IR9 A;  3T97 A;  1FZC A;  2N1T B;  1NO4 A;  2O01 H;  3B5N A;  2XZR A;  1FZC C;  2WPQ A;  3H32 B;  1M1J A;  2WSC H;  1SQQ K;  3B5N C;  2KYV A;  1DH3 A;  1KQL A;  3KDP B;  1J1E B;  3P32 A;  5AVQ B;  3SWF A;  1A02 J;  2BAS A;  5AW2 B;  2Q9I A;  5CCG D;  1N7S D;  3VP8 A;  3NXS A;  5AW0 B;  1W2E A;  3EQ2 A;  1RE3 C;  3HUS B;  2KP8 A;  2M3B A;  3RL0 D;  2FKW B;  3RK2 B;  3V2Q A;  5APQ A;  1ZLL A;  1DX7 A;  2KSJ A;  2KB7 P;  2IX7 C;  4GKG A;  3IFM A;  2QM8 A;  3EFG A;  5APS A;  1FU1 A;  3HE4 A;  1NKN A;  1FJK A;  4KHX A;  3V2N A;  2J58 A;  3HD7 B;  1L4A A;  1SFC D;  2OYH B;  1L4A C;  3L35 A;  3B8E B;  1IFI A;  4JYB A;  5APT A;  2XU6 A;  3HD7 A;  3GHG A;  4IFD K;  1CSB A;  1GL2 B;  4IFF A;  4WY4 D;  5APU A;  1CI6 B;  2ZFC A;  2HOD B;  2MJZ A;  2CPB A;  2YMY A;  3C9I A;  5CHX A;  3VOP A;  1JNM A;  1JMM A;  2QM7 A;  2Q3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...