1LTSC

Refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1992-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltsC00
1LTTC 1LTGC 1XTCC 1LTBC 1LTIC 1HTLC 1LTSC 1LTAC
chains in the Genus database with same CATH superfamily
2FYNB 3L74G 1JY3P 3H1IG 3U1AA 3L70E 3V2NA 4D6TE 1GTWA 5AW0B 4GODA 1J1DC 2W83C 5CBNA 3CCQP 1DD4A 3RL0D 3V2RA 2HYNA 1J2JB 3GHGC 1ZMEC 3S1KA 3B8EB 1WT6A 2QJPB 4IL6H 3TSIA 5TISH 1EZVG 1OXZA 1YTZI 1OFCX 2QJKC 1LP1B 3L71D 3MTUE 5AVYB 1NO4A 4IOIH 1VQPP 1MFTA 3G71P 1X22A 1RE4A 1DEBA 1SQXE 2WQYC 4ZKPA 3OW2O 1LTJB 3IF4A 4GKGA 3WUUA 4AUWA 5AW8B 2V4HA 3L74J 1RE3A 2FFDC 3HTKA 2Q7CA 2C9NY 2FYNC 5EFWB 1NU1J 1JMBA 5C39A 4ASWA 1NTMK 2BCCE 4RESB 1FAVA 1KYOD 1W5CE 4I6MC 1X8YA 3H32B 2RKLA 4H13D 3WU2E 2AEJA 3AE3C 5KKZC 4NPDA 3CPWO 4PV1B 1W2BO 4IFMA 1L0NK 3HE4B 1WRGA 5GTHH 4ZNCA 3AEGC 4QMAA 1EDLA 4UB8E 1GW3A 1SLQA 4U3FE 1IFJA 3V4WA 1LTBC 1PIXA 2NRGA 2DW3A 1RH5B 1SQPD 1SVFA 2IX7C 2R3CA 2W90A 1RE4C 2D2CB 2JO1A 3HD7B 3RGUA 1M8OB 3VP9A 3KXDA 3EFGA 1KFMA 2R3SA 3IR9A 4PD4D 4XA4A 2ZT9C 1SQQG 1VF5B 1FBMA 5KLVG 1L4AC 1EZVI 1X9VA 1NGMB 1AVYA 1BCCJ 5AW4B 1P84E 2R32A 4N78D 5BU8B 3CCRP 1VQMP 1YQ3C 1KMIZ 1YHQP 2FBWC 4GIFA 1RF1A 3CD6P 2A45H 1LTIC 1L0LJ 1NTMD 3FWLA 2BASA 1Q7YQ 2IZ1A 3L72J 2HFED 1KD1Q 2KIKA 1S72P 1VQLP 2A06E 3GHGB 3GF7A 2AEMA 2O3JA 1LP1A 3B4SA 3EQ2A 3KDPB 2OYHA 1KB9I 2WITA 3C9IA 2YO2A 2ZAEB 1OW6A 1NTZE 2E76D 3AECC 1CI6A 4N78E 1LNQA 2WPVB 3D6ZA 1HBWA 1NKNA 2GM4A 5CCGA 3B5NA 1FZGA 1DH3A 1GL2B 3L75D 3UIAA 1XTGB 1KQSO 2OYIC 3MD0A 1BSHA 1N2DC 2E75C 2KLUA 2W8ZA 4OGQC 1LTGC 3V2PA 3L72E 4PV1D 1URQD 4B86A 2E43A 3L4FA 4H44C 1FZEA 2B89A 3M0DA 1NKZB 2WT7A 1T6AA 2XNDH 1PPJG 3N4XA 3RBZA 1N86A 2N1TC 3M9HA 1ZR2A 3MZWB 3L71G 1LWUA 4MN4C 2M8RA 3A3YB 4HB1A 4U7JA 5KLVJ 1H89A 4A7PA 1LT9A 2N1TD 1Y9BA 4I1LA 4RKUJ 1JY2O 3VN0A 1NTZG 1VQ5P 1GL2C 2J59M 4HKZH 1X0TA 2GA1A 2WSFH 5L8RJ 4DJGA 5CCHC 3AE9C 2FYUD 1PP9J 3M9BA 4XFJA 1QX8A 2GUVA 1OVUA 1VQOP 2J5UA 1Q2NA 2KUBA 2ITAA 2O1JA 4GT1A 1FJPA 4H0LD 1FDIA 4LLHA 5KTBA 4PJ0E 1W2EA 1NTKE 2RN0A 3MP7B 1S5LE 3C8VA 1EZVE 1J1EB 3JC22 3SSUA 1YIJP 1QL2A 1RF0C 3L72G 4O9BA 4BRYA 2FFDB 2NPSB 3H1LD 1EXIA 1GMJA 1SQPG 2FYUK 2NPSA 1BSNA 4JF7A 3TF5A 3D6YA 1BDCA 1QL1A 1JTHB 1LWUC 5APUA 2FYUJ 2BCCJ 5AVTB 2K9YA 3H1IE 2K88A 1NTKD 1KILA 1NYHA 3T97B 3CL3D 2M0BA 1MV8A 4WVZA 2AXCA 1NTKJ 4PD4I 3U59A 2IZ0A 3P8CD 3D71A 1S5LH 3FXEA 4H0LC 2XNXA 2QJYB 4YTPC 5BU5A 1VQNP 1FC2C 3H1LE 1KYOH 3C1LA 3H1JE 4PJ0H 4NPFX 2E75B 1M90Q 2QE7H 1TU3F 3VP8A 4H44B 2W6JH 4Y99C 3RBXA 3CCUP 2R5BA 1LTTC 2XDJA 3BCCG 1EXJA 2B88A 2KS1B 3HD7A 3VYIA 4D6TJ 1KC8Q 2FYZA 3M0DC 5AVRB 3RL0g 5APXA 3W68A 4Y28J 2WTYA 1CZQA 1JY3N 3CCLP 3L75E 3Q5PA 4BWNA 4L75A 2IBZG 2LKMA 1S9KE 1YBKA 1KV4A 2WZ7A 1L0NJ 1NU1E 3HUSB 1RQVA 3QWOC 1G2CA 3S9OA 1QVFO 2IFMA 1S1CX 4R4MA 3IAOA 2JWAA 3FXDA 3L70G 4TT3H 1JY2P 3U1CA 1MUUA 4YPCA 1SQXK 1NTMJ 2UWJE 4BRYB 1NJIQ 3VMAA 2FFDA 1PFIA 1JO5A 1L2PA 4C7RA 1BDDA 2D2CC 3AE1C 3CWBD 3HD7C 3CXHD 5H2FE 2QJPC 3HUSA 1KN7A 3AE2C 1LTAC 1AJYA 2H7HA 1XTCC 3LIDA 2YXRB 1LJ2A 3RK2B 1Z56A 2FYUG 1ZR4A 3N7NA 2QSIA 2Y0EA 2A45G 1SQBD 1AA0A 1EDKA 3TGUJ 3WMM0 2WSSH 3AEAC 1LT1A 3L37A 3TDKA 1GZLA 1L4AD 1QGKB 3CXHE 1K73Q 1EQ7A 1SP4A 2WSEJ 1P84H 5AW5B 1N7SD 3HE5B 1YJNP 3H1HJ 1VQ4P 3M06A 2IDBA 3AEFC 5APSA 4EIJA 5CCGD 1NU1G 2FKWB 1KTMA 2JKVA 1T3UA 5B66E 1GDTA 2G8YA 2E42A 2SPZA 3AE6C 1Q82Q 1IZNB 4AYCA 2ZT9B 3KZIE 2N9YB 3L74D 3FX0A 4I7ZB 1NTZJ 1GW4A 5TJHA 3H1ID 5GTHE 3RK3E 4JQ0D 5KAFE 1HUCA 2ZXXA 1KORA 3O6QB 2JJLA 5DJTB 1PGJA 4C46A 2KZJA 1OWAA 2KB7P 4N6JA 4W80A 1R5LA 1JUNA 4PD4H 3EFFK 1JEKA 3IFMA 3JSVC 3L71J 3WU2H 3PRJA 1FJKA 3HTKB 3GW6A 3OAKA 3G6EP 1GD2E 1IO4A 3B5NC 1G1JA 4K35A 3ITKA 1ZRTE 1HVVA 1L0NG 1NU1K 4PV1C 2WSCJ 3BCCD 5CBOA 1YJ9P 1N7LA 3L75J 1DEEG 3RK3D 5KLIB 1LT9C 1NVOA 1R5SA 3V5BA 2VRSA 5KLVK 4PD4E 4JYBA 2IBZI 1OX3A 4Z1MH 1P84D 5KAFH 2Y9ZA 3CMAP 2ZFCA 1SS1A 2WMMA 1OVRA 1ZRTD 3AEDC 3BCCJ 3KZIH 1MFZA 1G1IA 1IFNA 1NTME 5AVUB 1U7MA 3CC4P 1LTSC 4RO0A 5AW6B 1N7SB 5B66H 1ZP0C 3D70A 2P7JA 1HGZA 1PL5A 1Y8AA 1JY2N 3H1KG 1SQBJ 3L70D 3TGUD 2OYIA 1BCCD 2QRXA 3RL0B 5CCGC 2QVAA 3CCEP 3CXHH 4H13C 1FDOA 1SFCB 1BE3G 1VF5C 1CSBA 1NOHA 2PRRA 1FS0E 2XV5A 2YIUC 3CXHI 1SQQJ 2I1KA 3VMYA 4JPZB 2L91A 3M9QA 2XZRA 1IFMA 2ZYDA 2YXQB 4WY4C 3I5CA 2E74D 3KYQA 1UIIA 1ZLLA 2A06G 1FZAA 2K9JA 5CJ0A 1H8AA 2H8PD 3SFDC 1U57A 3A7OA 5H2FH 5APWA 2FXOA 2QEXP 3FWNA 1M1KQ 1LTJA 3AE5C 3L73G 2Y0DA 3P32A 1S4XA 5AVXB 1KILB 1HJBA 3G3ZA 2B87B 2D2CD 2OGUA 3A2AA 1T3JA 1YITP 1JB0J 1URQA 1P84I 4C7NB 3TNUA 1URQB 4WBAA 5CHXA 1D7MA 2WPQA 4OH8B 3TK1A 2HPCB 1CI6B 1LGHB 1JNMA 1CW5A 2BEQD 2V7QJ 1T8ZA 4IFDK 3L75G 2RMZA 3B5ND 1VL2A 4U3FD 3RK2C 1BGYD 5CMZA 1RF1C 1QLED 2MJZA 2B87A 2WSCH 3L74E 2YIUB 1KILD 4M3LA 1M1JC 3Q2YA 4N3YB 1FZCC 2IBZE 3EWKA 4WY4A 1YI2P 3CX5E 5GTIH 2OTJP 1Q81Q 1RE3C 4EDFA 1DIPA 1PPJD 3MUDA 1OW8A 3H1KJ 1PGPA 1SQPK 2G3AA 2YMYA 4K3AA 1PV3A 1VQ9P 2P67A 1URQC 1YJWP 4YXWH 3H1JG 2WWWA 2BCCD 1VQ6P 3BCCE 1EDIA 3A0BH 3CI9A 1OW7A 1KYOE 3II6A 3LW5H 4U3FJ 1SFCA 3A0HE 4JYCA 1VQ7P 1HJ0A 2IFNA 3CX5D 2J58A 3P8CE 2YKOA 2QIWA 3PJSK 1K9MQ 1NTKK 3I56P 1PPJE 1MKMA 3HRNA 3MHVA 1L0LE 1SQVG 2I8DA 2IYOA 3Q5RA 2Z4EA 4W7YA 2W27A 5K5GB 2LXCB 3VMZA 1N7SA 2M3BA 1T2KC 3CCVP 3P7KA 1SQPE 3T97A 2OTLP 3FGAD 2A45I 1SQXJ 5KLIC 3TGUG 1FOSF 1JM0A 3R2PA 3E7KA 4KHXA 1KB9H 3USSA 1A02F 3L72D 1PP9D 3H6PA 5AW1B 5APYA 3E1IA 2H89C 3MUDC 1L0LD 2E76B 1BE3D 4AQRD 2OYHC 2E76C 1FE6A 1S2EA 4RJTA 1N73A 1IFDA 2IYPA 3GF3A 2YKQA 4UB6H 3CLQA 5KAIH 1NWQA 1NTKG 2XKMA 1KQLA 1YTZT 2O1KA 2C0WA 2QJYC 4DOJA 4I7ZC 1GU5A 4NPEA 3F5HA 3G4SP 1AFOA 1DX7A 2KLVA 2KSEA 2O01N 2A06D 1M1JA 4JBZA 3H1HE 1RF1B 1NAYA 1T2KD 1EDJA 1UIXA 2AEFA 2KNCA 1H0TA 1KZUB 1M57D 3L36A 1RHZB 1L0NE 1JOCA 1G2CB 3H1HG 5AW2B 2V7QH 3SFEC 2JR8A 3VMXA 1SFCD 2FY8A 4HJGH 3HUSC 3WUVA 4EOTA 1H88A 5KKZB 1DD3A 5AVZB 4LC1A 1AV1A 2FXPA 4IFFA 4W7ZA 4WY4B 1N73C 2HODA 2P1JA 2KI7B 2YNYA 1KB9D 2HR3A 1WMKA 1Q90D 1BGYG 4U3FG 1PGQA 5DJUB 4DCKA 3QH9A 1JCDA 2R44A 2OQQA 1FU1A 2FXMA 2JWDA 2C9LY 3BRVB 1BGYE 1IJDB 3I55P 3K5BA 4H0LB 1KQGB 1FZFA 3H32A 1S5LX 2M5AB 1L4AB 3HD7D 3V4QA 2QJKB 2ZVOB 4BXLA 1FOSE 2CPBA 1NTMG 1JCCA 3OJAB 2PAJA 4HYTB 1ZXGA 3L70J 4WWIA 5AVSB 5AW9B 3AE8C 3PTZA 4EI2A 1ZOYC 4OVNF 1USDA 1SQVK 4XE5B 3JCUH 4IL6X 3BASA 5E79H 1SQXG 2FYUE 3H1JD 3RL0C 2K3RA 2BCCG 1E5WA 2KOGA 3H1IJ 3IN6A 3TNUB 2AXTH 3L35A 1AVOA 2ZYGA 1M7LA 2AXTE 3PHLA 1JTHA 1ZV8A 2XU6A 2Z5HA 1SQPJ 3NFQA 1SQVJ 3JCUE 2Q3EA 5E79E 2WSEH 1U7JA 1IFPA 1OMIA 3AEBC 4DZOA 1SQVD 1ZN5A 3CX5I 1VF5D 3O6QA 3VTPC 4KJMA 1GK6A 4KT0J 2CK3H 2E5TA 3MIWA 3P8MC 4L73A 3Q1MA 1IK9A 2WSFJ 2E74C 3S4RA 1GL2D 3LW5J 4UB8H 5CCHD 1JMMA 2JEEA 2Y0CA 1PP9G 3PLNA 1K05A 4Y99B 4WY4D 4HH2A 5KJ7D 1NU1D 1Y47A 4OWFA 1L0LG 1SQVE 1PP9E 3B71A 1X79B 5AVVB 3ABVC 1HH0A 2P58A 1IK7A 2NPSD 1NTZD 2Q1KA 2LR2A 3HE4A 3CMEP 5AW3B 3CWBJ 1FDMA 3V6IA 1M1JB 1LWUB 1J1DB 2W6BA 4H44D 5APQA 2R5DA 1USEA 5AVQB 5APTA 3RK3C 4ZMDA 2ZYAA 5KJ7C 4OGQD 2Q9IA 2N1TB 3RK2D 3H1HD 1K04A 5AVWB 5APVA 1BCCE 3GLMA 1RY3A 3VOPA 1QVGO 3OA7A 2JDIH 4DT0A 1L0ND 3M91A 4IL6E 2YO3A 5TISE 1NTZK 2PP6A 2C0XA 2B9BA 3H1LG 3NXSA 4R4LA 4UB6E 5KAIE 2YMKA 1J1EC 2ZJSE 1IC2A 2O01J 3H1KE 5AW7B 2N1TA 5BVZA 3H25A 1S9KD 2Z5IA 3BVHA 2KXPB 2QG4A 3AE4C 1EC5A 3GG2A 2POHA 3H1JJ 3BATA 4D6TD 1SQBK 1KB9E 1HGVA 1VQKP 1LTJC 2KK7A 2QA4P 5B5EH 1VQ8P 1FZBA 5KJ7A 2KZIA 2NZ2A 2PFXA 2H88C 2K9JB 3E1RA 1HWTC 1OVVA 3SWFA 1JY3O 1GU4A 2H43A 3H1KD 4TLFA 3CCJP 3RK3B 3R4YA 2HG5D 1BCCG 1IFIA 1SFCC 1FZCB 3HE5A 1EZVD 1E79H 1KFNA 1SQXD 1HF9A 2P10A 4EYYQ 4GOFA 2KS1A 3A0HH 3KQGA 1PZQA 1SQBE 2K1AA 2WVRA 3A0BE 4WB4A 2QM8A 3GMAA 2YKPA 3Q3DA 2E75D 2KNCB 3CCMP 1BGYJ 3Q5SA 1A02J 1FZCA 3AEEC 1H0TB 2OYIB 2Q6QA 1KILE 2PGDA 1N7SC 1ZW0A 2O01H 4L74A 3CC7P 4OGQB 3H1LJ 2IBZD 1KQFB 4GDOA 3G9RA 5GTIE 3CX5H 1VDFA 1KILC 3L73J 2KP8A 3NMDA 1RQUA 2QM7A 3O8ZA 3SWYA 1YQ4C 1N73B 1GL2A 2M3EA 3L73D 5CCHA 3B5NB 5KLVE 2L5GB 1KYOI 2JP3A 2K37A 1AQ5A 4LGDE 1MZ9A 2HLOA 2HPCA 4ASVA 4C7NA 2WPRA 1AQTA 3AE7C 3CWBG 1QEXA 4H13B 2W6AA 3W67A 3KPEA 2M5AA 1M56D 3TGUE 1NAFA 2E5YA 1GK4A 1BE3J 1NHLA 1OIPA 2P2UA 2Q3IA 2RH0A 1PGOA 3F89A 4L76A 2WPSA 3LIEA 3L73E 2LXBA 3CCSP 1SQQD 2CPSA 2OYOA 3GHGA 5KLVD 3ZDMA 4CPGA 3MGNA 1R8EA 2OYHB 1NH4A 4YXDC 1K8AQ 2GUSA 1SQBG 1Q86Q 2ZXEB 2BEZF 2OARA 5M1BA 1L4AA 1S3JA 2N9BA 1OZHA 2ZVNB 4I2LC 1N8RQ 2IPPA 4GOEA 3A5TA 2E74B 2MKVA 3NTNA 1HTLC 2KSJA 3BRTB 3KHUA 3V2QA 1RF0A 1BE3E 1SQQE 2I1JA 2NPSC 1SQQK 3WUTA 4ZKUA 3CC2P 1LT9B 3PP5A 1L0LK 3TYYA 2Q5UA 2HODB 3SWKA 2ZT9D 1YYCA 2OTKE 3CWBE 3PH0A 1VPCA 2KYVA 2Y9YA 5CJ4A 5B5EE 2WT7B 3M0AA 4D6TG 3L71E
chains in the Genus database with same CATH topology
1JY3P 3U1AA 1GTWA 3V2NA 5AW0B 1J1DC 3RL0D 3V2RA 2HYNA 1J2JB 3GHGC 3B8EB 1WT6A 3TSIA 1OXZA 1YTZI 3MTUE 5AVYB 1NO4A 1RE4A 1DEBA 4ZKPA 1LTJB 4GKGA 4AUWA 5AW8B 2FFDC 2C9NY 1RE3A 3HTKA 2Q7CA 1NTMK 4RESB 1FAVA 4I6MC 1X8YA 3H32B 4IFMA 1L0NK 3HE4B 1WRGA 1GW3A 1SLQA 1IFJA 3V4WA 1LTBC 2R3CA 4GIFA 1SVFA 2IX7C 3HD7B 4LLHA 3V4QA 3VP9A 1RE4C 3EFGA 1KFMA 3IR9A 4XA4A 1FBMA 1L4AC 1X9VA 5AW4B 2R32A 4N78D 5BU8B 1RF1A 2A45H 1LTIC 2BASA 2HFED 3GHGB 2OYHA 3EQ2A 3KDPB 2WITA 3C9IA 2YO2A 1CI6A 4N78E 1HBWA 1NKNA 2GM4A 5CCGA 3B5NA 1FZGA 1GL2B 3UIAA 1XTGB 2OYIC 3MD0A 1N2DC 2E43A 4B86A 1LTGC 1URQD 3L4FA 1FZEA 3M0DA 1NKZB 2WT7A 3N4XA 1N86A 2N1TC 3M9HA 1ZR2A 1LWUA 2M8RA 3A3YB 1H89A 1LT9A 2N1TD 4I1LA 3VN0A 1JY2O 1GL2C 2J59M 5CCHC 2WSFH 3M9BA 2GUVA 1FJPA 2O1JA 4GT1A 5KTBA 1W2EA 1J1EB 1QL2A 1RF0C 4O9BA 2FFDB 2NPSB 4JF7A 2FYUK 2NPSA 1QL1A 1JTHB 1LWUC 5APUA 5AVTB 1KILA 3CL3D 1MV8A 3U59A 3P8CD 2XNXA 5BU5A 3VP8A 4Y99C 2R5BA 1LTTC 2XDJA 3HD7A 3VYIA 2FYZA 3M0DC 5AVRB 5APXA 2WTYA 1CZQA 1JY3N 2LKMA 1S9KE 2WZ7A 3HUSB 1G2CA 2IFMA 1JY2P 3U1CA 1MUUA 1SQXK 1PFIA 2FFDA 1JO5A 4C7RA 3HD7C 3HUSA 1LTAC 2H7HA 1XTCC 3LIDA 3RK2B 1Z56A 1ZR4A 3N7NA 2A45G 3WMM0 3L37A 1GZLA 1L4AD 1EQ7A 1SP4A 5AW5B 1N7SD 3HE5B 3M06A 5APSA 4EIJA 5CCGD 2FKWB 1T3UA 1GDTA 2E42A 4AYCA 1GW4A 1HUCA 2JJLA 4C46A 4W80A 1OWAA 2KB7P 4N6JA 1JUNA 3IFMA 1FJKA 3HTKB 3OAKA 1GD2E 1IO4A 3B5NC 1G1JA 1HVVA 1NU1K 1N7LA 3RK3D 1LT9C 3V5BA 2VRSA 4JYBA 2ZFCA 5AVUB 1H88A 1MFZA 1G1IA 1IFNA 1LTSC 5AW6B 1N7SB 2P7JA 1HGZA 1JY2N 2OYIA 3RL0B 5CCGC 1SFCB 1CSBA 1NOHA 2XV5A 3VMYA 2I1KA 3M9QA 2XZRA 1IFMA 4WY4C 3I5CA 3KYQA 1ZLLA 5CJ0A 1FZAA 1H8AA 2H8PD 3A7OA 5APWA 1LTJA 3P32A 5AVXB 1KILB 1HJBA 3G3ZA 3A2AA 1T3JA 1URQA 4C7NB 3TNUA 1URQB 4WBAA 5CHXA 3TK1A 2WPQA 4OH8B 2HPCB 1CI6B 1LGHB 1CW5A 1T8ZA 4IFDK 3B5ND 3RK2C 5CMZA 1RF1C 2MJZA 2WSCH 4M3LA 1KILD 1M1JC 4N3YB 1FZCC 4WY4A 1RE3C 3MUDA 1SQPK 2YMYA 2P67A 1URQC 2WWWA 3CI9A 3II6A 3LW5H 1SFCA 4JYCA 2IFNA 2J58A 3P8CE 2YKOA 1NTKK 3HRNA 2Z4EA 4W7YA 2W27A 3VMZA 1N7SA 2M3BA 1T2KC 3P7KA 3T97A 2A45I 1FOSF 3R2PA 4KHXA 1A02F 3H6PA 5AW1B 5APYA 3E1IA 4AQRD 2OYHC 1N73A 1IFDA 1DH3A 2YKQA 1AFOA 3CLQA 1NWQA 2XKMA 4DOJA 1KQLA 1YTZT 2O1KA 2C0WA 1DX7A 1GU5A 2KLVA 1M1JA 1RF1B 1T2KD 1KZUB 3L36A 5AW2B 3VMXA 1JOCA 1G2CB 5KLVK 1SFCD 3HUSC 4EOTA 5AVZB 4LC1A 4IFFA 4W7ZA 4WY4B 2HODA 2P1JA 2YNYA 1JCDA 1FU1A 2FXMA 2C9LY 3BRVB 1IJDB 1FZFA 3H32A 3HD7D 1L4AB 1FOSE 2CPBA 1JCCA 3OJAB 2PAJA 4HYTB 5AVSB 5AW9B 4XE5B 1SQVK 3BASA 3RL0C 1N73C 3TNUB 2KOGA 1E5WA 3L35A 1M7LA 1JTHA 2XU6A 1ZV8A 2Z5HA 3NFQA 4DZOA 2WSEH 1ZN5A 3VTPC 1GK6A 3P8MC 3MIWA 1IK9A 1GL2D 5CCHD 1JMMA 2JEEA 5KJ7D 4Y99B 4WY4D 4HH2A 1X79B 5AVVB 1HH0A 2NPSD 3HE4A 5AW3B 1FDMA 1M1JB 1LWUB 1J1DB 2W6BA 5APQA 5AVQB 2R5DA 3RK3C 5KJ7C 5APTA 1JNMA 2Q9IA 2N1TB 3RK2D 5AVWB 3VOPA 5APVA 1RY3A 3OA7A 3M91A 2YO3A 1NTZK 2PP6A 2C0XA 3NXSA 1J1EC 1IC2A 5BVZA 5AW7B 1S9KD 2N1TA 2Z5IA 3BVHA 2POHA 3BATA 1SQBK 1HGVA 1LTJC 1FZBA 5KJ7A 1HWTC 3SWFA 1JY3O 1GU4A 2H43A 3RK3B 2HG5D 1IFIA 1FZCB 1SFCC 3HE5A 1KFNA 3KQGA 4WB4A 2QM8A 2YKPA 1A02J 1FZCA 2OYIB 1N7SC 2O01H 1VDFA 1KILC 3NMDA 2KP8A 3O8ZA 3SWYA 2QM7A 1N73B 1GL2A 5CCHA 3B5NB 2L5GB 1AQ5A 4LGDE 1MZ9A 2HLOA 2HPCA 4C7NA 2WPRA 2W6AA 3KPEA 1NAFA 1GK4A 1NHLA 3V2PA 2Q3IA 2P2UA 2WPSA 3LIEA 2CPSA 3GHGA 2OYHB 3MGNA 1NH4A 2GUSA 2ZXEB 2OARA 1L4AA 2N9BA 4I2LC 2IPPA 3A5TA 3NTNA 1HTLC 2KSJA 3BRTB 3V2QA 1RF0A 2I1JA 4ZKUA 2NPSC 1SQQK 1LT9B 3PP5A 1L0LK 3TYYA 2Q5UA 2HODB 1YYCA 5CJ4A 2WT7B 1VPCA 2KYVA 3M0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1LTG C;  1XTC C;  1LTB C;  1LTI C;  1HTL C;  1LTS C;  1LTA C; 
#chains in the Genus database with same CATH topology
 2FYN B;  3L74 G;  1JY3 P;  3H1I G;  3U1A A;  3L70 E;  3V2N A;  4D6T E;  1GTW A;  5AW0 B;  4GOD A;  1J1D C;  2W83 C;  5CBN A;  3CCQ P;  1DD4 A;  3RL0 D;  3V2R A;  2HYN A;  1J2J B;  3GHG C;  1ZME C;  3S1K A;  3B8E B;  1WT6 A;  2QJP B;  4IL6 H;  3TSI A;  5TIS H;  1EZV G;  1OXZ A;  1YTZ I;  1OFC X;  2QJK C;  1LP1 B;  3L71 D;  3MTU E;  5AVY B;  1NO4 A;  4IOI H;  1VQP P;  1MFT A;  3G71 P;  1X22 A;  1RE4 A;  1DEB A;  1SQX E;  2WQY C;  4ZKP A;  3OW2 O;  1LTJ B;  3IF4 A;  4GKG A;  3WUU A;  4AUW A;  5AW8 B;  2V4H A;  3L74 J;  1RE3 A;  2FFD C;  3HTK A;  2Q7C A;  2C9N Y;  2FYN C;  5EFW B;  1NU1 J;  1JMB A;  5C39 A;  4ASW A;  1NTM K;  2BCC E;  4RES B;  1FAV A;  1KYO D;  1W5C E;  4I6M C;  1X8Y A;  3H32 B;  2RKL A;  4H13 D;  3WU2 E;  2AEJ A;  3AE3 C;  5KKZ C;  4NPD A;  3CPW O;  4PV1 B;  1W2B O;  4IFM A;  1L0N K;  3HE4 B;  1WRG A;  5GTH H;  4ZNC A;  3AEG C;  4QMA A;  1EDL A;  4UB8 E;  1GW3 A;  1SLQ A;  4U3F E;  1IFJ A;  3V4W A;  1LTB C;  1PIX A;  2NRG A;  2DW3 A;  1RH5 B;  1SQP D;  1SVF A;  2IX7 C;  2R3C A;  2W90 A;  1RE4 C;  2D2C B;  2JO1 A;  3HD7 B;  3RGU A;  1M8O B;  3VP9 A;  3KXD A;  3EFG A;  1KFM A;  2R3S A;  3IR9 A;  4PD4 D;  4XA4 A;  2ZT9 C;  1SQQ G;  1VF5 B;  1FBM A;  5KLV G;  1L4A C;  1EZV I;  1X9V A;  1NGM B;  1AVY A;  1BCC J;  5AW4 B;  1P84 E;  2R32 A;  4N78 D;  5BU8 B;  3CCR P;  1VQM P;  1YQ3 C;  1KMI Z;  1YHQ P;  2FBW C;  4GIF A;  1RF1 A;  3CD6 P;  2A45 H;  1LTI C;  1L0L J;  1NTM D;  3FWL A;  2BAS A;  1Q7Y Q;  2IZ1 A;  3L72 J;  2HFE D;  1KD1 Q;  2KIK A;  1S72 P;  1VQL P;  2A06 E;  3GHG B;  3GF7 A;  2AEM A;  2O3J A;  1LP1 A;  3B4S A;  3EQ2 A;  3KDP B;  2OYH A;  1KB9 I;  2WIT A;  3C9I A;  2YO2 A;  2ZAE B;  1OW6 A;  1NTZ E;  2E76 D;  3AEC C;  1CI6 A;  4N78 E;  1LNQ A;  2WPV B;  3D6Z A;  1HBW A;  1NKN A;  2GM4 A;  5CCG A;  3B5N A;  1FZG A;  1DH3 A;  1GL2 B;  3L75 D;  3UIA A;  1XTG B;  1KQS O;  2OYI C;  3MD0 A;  1BSH A;  1N2D C;  2E75 C;  2KLU A;  2W8Z A;  4OGQ C;  1LTG C;  3V2P A;  3L72 E;  4PV1 D;  1URQ D;  4B86 A;  2E43 A;  3L4F A;  4H44 C;  1FZE A;  2B89 A;  3M0D A;  1NKZ B;  2WT7 A;  1T6A A;  2XND H;  1PPJ G;  3N4X A;  3RBZ A;  1N86 A;  2N1T C;  3M9H A;  1ZR2 A;  3MZW B;  3L71 G;  1LWU A;  4MN4 C;  2M8R A;  3A3Y B;  4HB1 A;  4U7J A;  5KLV J;  1H89 A;  4A7P A;  1LT9 A;  2N1T D;  1Y9B A;  4I1L A;  4RKU J;  1JY2 O;  3VN0 A;  1NTZ G;  1VQ5 P;  1GL2 C;  2J59 M;  4HKZ H;  1X0T A;  2GA1 A;  2WSF H;  5L8R J;  4DJG A;  5CCH C;  3AE9 C;  2FYU D;  1PP9 J;  3M9B A;  4XFJ A;  1QX8 A;  2GUV A;  1OVU A;  1VQO P;  2J5U A;  1Q2N A;  2KUB A;  2ITA A;  2O1J A;  4GT1 A;  1FJP A;  4H0L D;  1FDI A;  4LLH A;  5KTB A;  4PJ0 E;  1W2E A;  1NTK E;  2RN0 A;  3MP7 B;  1S5L E;  3C8V A;  1EZV E;  1J1E B;  3JC2 2;  3SSU A;  1YIJ P;  1QL2 A;  1RF0 C;  3L72 G;  4O9B A;  4BRY A;  2FFD B;  2NPS B;  3H1L D;  1EXI A;  1GMJ A;  1SQP G;  2FYU K;  2NPS A;  1BSN A;  4JF7 A;  3TF5 A;  3D6Y A;  1BDC A;  1QL1 A;  1JTH B;  1LWU C;  5APU A;  2FYU J;  2BCC J;  5AVT B;  2K9Y A;  3H1I E;  2K88 A;  1NTK D;  1KIL A;  1NYH A;  3T97 B;  3CL3 D;  2M0B A;  1MV8 A;  4WVZ A;  2AXC A;  1NTK J;  4PD4 I;  3U59 A;  2IZ0 A;  3P8C D;  3D71 A;  1S5L H;  3FXE A;  4H0L C;  2XNX A;  2QJY B;  4YTP C;  5BU5 A;  1VQN P;  1FC2 C;  3H1L E;  1KYO H;  3C1L A;  3H1J E;  4PJ0 H;  4NPF X;  2E75 B;  1M90 Q;  2QE7 H;  1TU3 F;  3VP8 A;  4H44 B;  2W6J H;  4Y99 C;  3RBX A;  3CCU P;  2R5B A;  1LTT C;  2XDJ A;  3BCC G;  1EXJ A;  2B88 A;  2KS1 B;  3HD7 A;  3VYI A;  4D6T J;  1KC8 Q;  2FYZ A;  3M0D C;  5AVR B;  3RL0 g;  5APX A;  3W68 A;  4Y28 J;  2WTY A;  1CZQ A;  1JY3 N;  3CCL P;  3L75 E;  3Q5P A;  4BWN A;  4L75 A;  2IBZ G;  2LKM A;  1S9K E;  1YBK A;  1KV4 A;  2WZ7 A;  1L0N J;  1NU1 E;  3HUS B;  1RQV A;  3QWO C;  1G2C A;  3S9O A;  1QVF O;  2IFM A;  1S1C X;  4R4M A;  3IAO A;  2JWA A;  3FXD A;  3L70 G;  4TT3 H;  1JY2 P;  3U1C A;  1MUU A;  4YPC A;  1SQX K;  1NTM J;  2UWJ E;  4BRY B;  1NJI Q;  3VMA A;  2FFD A;  1PFI A;  1JO5 A;  1L2P A;  4C7R A;  1BDD A;  2D2C C;  3AE1 C;  3CWB D;  3HD7 C;  3CXH D;  5H2F E;  2QJP C;  3HUS A;  1KN7 A;  3AE2 C;  1LTA C;  1AJY A;  2H7H A;  1XTC C;  3LID A;  2YXR B;  1LJ2 A;  3RK2 B;  1Z56 A;  2FYU G;  1ZR4 A;  3N7N A;  2QSI A;  2Y0E A;  2A45 G;  1SQB D;  1AA0 A;  1EDK A;  3TGU J;  3WMM 0;  2WSS H;  3AEA C;  1LT1 A;  3L37 A;  3TDK A;  1GZL A;  1L4A D;  1QGK B;  3CXH E;  1K73 Q;  1EQ7 A;  1SP4 A;  2WSE J;  1P84 H;  5AW5 B;  1N7S D;  3HE5 B;  1YJN P;  3H1H J;  1VQ4 P;  3M06 A;  2IDB A;  3AEF C;  5APS A;  4EIJ A;  5CCG D;  1NU1 G;  2FKW B;  1KTM A;  2JKV A;  1T3U A;  5B66 E;  1GDT A;  2G8Y A;  2E42 A;  2SPZ A;  3AE6 C;  1Q82 Q;  1IZN B;  4AYC A;  2ZT9 B;  3KZI E;  2N9Y B;  3L74 D;  3FX0 A;  4I7Z B;  1NTZ J;  1GW4 A;  5TJH A;  3H1I D;  5GTH E;  3RK3 E;  4JQ0 D;  5KAF E;  1HUC A;  2ZXX A;  1KOR A;  3O6Q B;  2JJL A;  5DJT B;  1PGJ A;  4C46 A;  2KZJ A;  1OWA A;  2KB7 P;  4N6J A;  4W80 A;  1R5L A;  1JUN A;  4PD4 H;  3EFF K;  1JEK A;  3IFM A;  3JSV C;  3L71 J;  3WU2 H;  3PRJ A;  1FJK A;  3HTK B;  3GW6 A;  3OAK A;  3G6E P;  1GD2 E;  1IO4 A;  3B5N C;  1G1J A;  4K35 A;  3ITK A;  1ZRT E;  1HVV A;  1L0N G;  1NU1 K;  4PV1 C;  2WSC J;  3BCC D;  5CBO A;  1YJ9 P;  1N7L A;  3L75 J;  1DEE G;  3RK3 D;  5KLI B;  1LT9 C;  1NVO A;  1R5S A;  3V5B A;  2VRS A;  5KLV K;  4PD4 E;  4JYB A;  2IBZ I;  1OX3 A;  4Z1M H;  1P84 D;  5KAF H;  2Y9Z A;  3CMA P;  2ZFC A;  1SS1 A;  2WMM A;  1OVR A;  1ZRT D;  3AED C;  3BCC J;  3KZI H;  1MFZ A;  1G1I A;  1IFN A;  1NTM E;  5AVU B;  1U7M A;  3CC4 P;  1LTS C;  4RO0 A;  5AW6 B;  1N7S B;  5B66 H;  1ZP0 C;  3D70 A;  2P7J A;  1HGZ A;  1PL5 A;  1Y8A A;  1JY2 N;  3H1K G;  1SQB J;  3L70 D;  3TGU D;  2OYI A;  1BCC D;  2QRX A;  3RL0 B;  5CCG C;  2QVA A;  3CCE P;  3CXH H;  4H13 C;  1FDO A;  1SFC B;  1BE3 G;  1VF5 C;  1CSB A;  1NOH A;  2PRR A;  1FS0 E;  2XV5 A;  2YIU C;  3CXH I;  1SQQ J;  2I1K A;  3VMY A;  4JPZ B;  2L91 A;  3M9Q A;  2XZR A;  1IFM A;  2ZYD A;  2YXQ B;  4WY4 C;  3I5C A;  2E74 D;  3KYQ A;  1UII A;  1ZLL A;  2A06 G;  1FZA A;  2K9J A;  5CJ0 A;  1H8A A;  2H8P D;  3SFD C;  1U57 A;  3A7O A;  5H2F H;  5APW A;  2FXO A;  2QEX P;  3FWN A;  1M1K Q;  1LTJ A;  3AE5 C;  3L73 G;  2Y0D A;  3P32 A;  1S4X A;  5AVX B;  1KIL B;  1HJB A;  3G3Z A;  2B87 B;  2D2C D;  2OGU A;  3A2A A;  1T3J A;  1YIT P;  1JB0 J;  1URQ A;  1P84 I;  4C7N B;  3TNU A;  1URQ B;  4WBA A;  5CHX A;  1D7M A;  2WPQ A;  4OH8 B;  3TK1 A;  2HPC B;  1CI6 B;  1LGH B;  1JNM A;  1CW5 A;  2BEQ D;  2V7Q J;  1T8Z A;  4IFD K;  3L75 G;  2RMZ A;  3B5N D;  1VL2 A;  4U3F D;  3RK2 C;  1BGY D;  5CMZ A;  1RF1 C;  1QLE D;  2MJZ A;  2B87 A;  2WSC H;  3L74 E;  2YIU B;  1KIL D;  4M3L A;  1M1J C;  3Q2Y A;  4N3Y B;  1FZC C;  2IBZ E;  3EWK A;  4WY4 A;  1YI2 P;  3CX5 E;  5GTI H;  2OTJ P;  1Q81 Q;  1RE3 C;  4EDF A;  1DIP A;  1PPJ D;  3MUD A;  1OW8 A;  3H1K J;  1PGP A;  1SQP K;  2G3A A;  2YMY A;  4K3A A;  1PV3 A;  1VQ9 P;  2P67 A;  1URQ C;  1YJW P;  4YXW H;  3H1J G;  2WWW A;  2BCC D;  1VQ6 P;  3BCC E;  1EDI A;  3A0B H;  3CI9 A;  1OW7 A;  1KYO E;  3II6 A;  3LW5 H;  4U3F J;  1SFC A;  3A0H E;  4JYC A;  1VQ7 P;  1HJ0 A;  2IFN A;  3CX5 D;  2J58 A;  3P8C E;  2YKO A;  2QIW A;  3PJS K;  1K9M Q;  1NTK K;  3I56 P;  1PPJ E;  1MKM A;  3HRN A;  3MHV A;  1L0L E;  1SQV G;  2I8D A;  2IYO A;  3Q5R A;  2Z4E A;  4W7Y A;  2W27 A;  5K5G B;  2LXC B;  3VMZ A;  1N7S A;  2M3B A;  1T2K C;  3CCV P;  3P7K A;  1SQP E;  3T97 A;  2OTL P;  3FGA D;  2A45 I;  1SQX J;  5KLI C;  3TGU G;  1FOS F;  1JM0 A;  3R2P A;  3E7K A;  4KHX A;  1KB9 H;  3USS A;  1A02 F;  3L72 D;  1PP9 D;  3H6P A;  5AW1 B;  5APY A;  3E1I A;  2H89 C;  3MUD C;  1L0L D;  2E76 B;  1BE3 D;  4AQR D;  2OYH C;  2E76 C;  1FE6 A;  1S2E A;  4RJT A;  1N73 A;  1IFD A;  2IYP A;  3GF3 A;  2YKQ A;  4UB6 H;  3CLQ A;  5KAI H;  1NWQ A;  1NTK G;  2XKM A;  1KQL A;  1YTZ T;  2O1K A;  2C0W A;  2QJY C;  4DOJ A;  4I7Z C;  1GU5 A;  4NPE A;  3F5H A;  3G4S P;  1AFO A;  1DX7 A;  2KLV A;  2KSE A;  2O01 N;  2A06 D;  1M1J A;  4JBZ A;  3H1H E;  1RF1 B;  1NAY A;  1T2K D;  1EDJ A;  1UIX A;  2AEF A;  2KNC A;  1H0T A;  1KZU B;  1M57 D;  3L36 A;  1RHZ B;  1L0N E;  1JOC A;  1G2C B;  3H1H G;  5AW2 B;  2V7Q H;  3SFE C;  2JR8 A;  3VMX A;  1SFC D;  2FY8 A;  4HJG H;  3HUS C;  3WUV A;  4EOT A;  1H88 A;  5KKZ B;  1DD3 A;  5AVZ B;  4LC1 A;  1AV1 A;  2FXP A;  4IFF A;  4W7Z A;  4WY4 B;  1N73 C;  2HOD A;  2P1J A;  2KI7 B;  2YNY A;  1KB9 D;  2HR3 A;  1WMK A;  1Q90 D;  1BGY G;  4U3F G;  1PGQ A;  5DJU B;  4DCK A;  3QH9 A;  1JCD A;  2R44 A;  2OQQ A;  1FU1 A;  2FXM A;  2JWD A;  2C9L Y;  3BRV B;  1BGY E;  1IJD B;  3I55 P;  3K5B A;  4H0L B;  1KQG B;  1FZF A;  3H32 A;  1S5L X;  2M5A B;  1L4A B;  3HD7 D;  3V4Q A;  2QJK B;  2ZVO B;  4BXL A;  1FOS E;  2CPB A;  1NTM G;  1JCC A;  3OJA B;  2PAJ A;  4HYT B;  1ZXG A;  3L70 J;  4WWI A;  5AVS B;  5AW9 B;  3AE8 C;  3PTZ A;  4EI2 A;  1ZOY C;  4OVN F;  1USD A;  1SQV K;  4XE5 B;  3JCU H;  4IL6 X;  3BAS A;  5E79 H;  1SQX G;  2FYU E;  3H1J D;  3RL0 C;  2K3R A;  2BCC G;  1E5W A;  2KOG A;  3H1I J;  3IN6 A;  3TNU B;  2AXT H;  3L35 A;  1AVO A;  2ZYG A;  1M7L A;  2AXT E;  3PHL A;  1JTH A;  1ZV8 A;  2XU6 A;  2Z5H A;  1SQP J;  3NFQ A;  1SQV J;  3JCU E;  2Q3E A;  5E79 E;  2WSE H;  1U7J A;  1IFP A;  1OMI A;  3AEB C;  4DZO A;  1SQV D;  1ZN5 A;  3CX5 I;  1VF5 D;  3O6Q A;  3VTP C;  4KJM A;  1GK6 A;  4KT0 J;  2CK3 H;  2E5T A;  3MIW A;  3P8M C;  4L73 A;  3Q1M A;  1IK9 A;  2WSF J;  2E74 C;  3S4R A;  1GL2 D;  3LW5 J;  4UB8 H;  5CCH D;  1JMM A;  2JEE A;  2Y0C A;  1PP9 G;  3PLN A;  1K05 A;  4Y99 B;  4WY4 D;  4HH2 A;  5KJ7 D;  1NU1 D;  1Y47 A;  4OWF A;  1L0L G;  1SQV E;  1PP9 E;  3B71 A;  1X79 B;  5AVV B;  3ABV C;  1HH0 A;  2P58 A;  1IK7 A;  2NPS D;  1NTZ D;  2Q1K A;  2LR2 A;  3HE4 A;  3CME P;  5AW3 B;  3CWB J;  1FDM A;  3V6I A;  1M1J B;  1LWU B;  1J1D B;  2W6B A;  4H44 D;  5APQ A;  2R5D A;  1USE A;  5AVQ B;  5APT A;  3RK3 C;  4ZMD A;  2ZYA A;  5KJ7 C;  4OGQ D;  2Q9I A;  2N1T B;  3RK2 D;  3H1H D;  1K04 A;  5AVW B;  5APV A;  1BCC E;  3GLM A;  1RY3 A;  3VOP A;  1QVG O;  3OA7 A;  2JDI H;  4DT0 A;  1L0N D;  3M91 A;  4IL6 E;  2YO3 A;  5TIS E;  1NTZ K;  2PP6 A;  2C0X A;  2B9B A;  3H1L G;  3NXS A;  4R4L A;  4UB6 E;  5KAI E;  2YMK A;  1J1E C;  2ZJS E;  1IC2 A;  2O01 J;  3H1K E;  5AW7 B;  2N1T A;  5BVZ A;  3H25 A;  1S9K D;  2Z5I A;  3BVH A;  2KXP B;  2QG4 A;  3AE4 C;  1EC5 A;  3GG2 A;  2POH A;  3H1J J;  3BAT A;  4D6T D;  1SQB K;  1KB9 E;  1HGV A;  1VQK P;  1LTJ C;  2KK7 A;  2QA4 P;  5B5E H;  1VQ8 P;  1FZB A;  5KJ7 A;  2KZI A;  2NZ2 A;  2PFX A;  2H88 C;  2K9J B;  3E1R A;  1HWT C;  1OVV A;  3SWF A;  1JY3 O;  1GU4 A;  2H43 A;  3H1K D;  4TLF A;  3CCJ P;  3RK3 B;  3R4Y A;  2HG5 D;  1BCC G;  1IFI A;  1SFC C;  1FZC B;  3HE5 A;  1EZV D;  1E79 H;  1KFN A;  1SQX D;  1HF9 A;  2P10 A;  4EYY Q;  4GOF A;  2KS1 A;  3A0H H;  3KQG A;  1PZQ A;  1SQB E;  2K1A A;  2WVR A;  3A0B E;  4WB4 A;  2QM8 A;  3GMA A;  2YKP A;  3Q3D A;  2E75 D;  2KNC B;  3CCM P;  1BGY J;  3Q5S A;  1A02 J;  1FZC A;  3AEE C;  1H0T B;  2OYI B;  2Q6Q A;  1KIL E;  2PGD A;  1N7S C;  1ZW0 A;  2O01 H;  4L74 A;  3CC7 P;  4OGQ B;  3H1L J;  2IBZ D;  1KQF B;  4GDO A;  3G9R A;  5GTI E;  3CX5 H;  1VDF A;  1KIL C;  3L73 J;  2KP8 A;  3NMD A;  1RQU A;  2QM7 A;  3O8Z A;  3SWY A;  1YQ4 C;  1N73 B;  1GL2 A;  2M3E A;  3L73 D;  5CCH A;  3B5N B;  5KLV E;  2L5G B;  1KYO I;  2JP3 A;  2K37 A;  1AQ5 A;  4LGD E;  1MZ9 A;  2HLO A;  2HPC A;  4ASV A;  4C7N A;  2WPR A;  1AQT A;  3AE7 C;  3CWB G;  1QEX A;  4H13 B;  2W6A A;  3W67 A;  3KPE A;  2M5A A;  1M56 D;  3TGU E;  1NAF A;  2E5Y A;  1GK4 A;  1BE3 J;  1NHL A;  1OIP A;  2P2U A;  2Q3I A;  2RH0 A;  1PGO A;  3F89 A;  4L76 A;  2WPS A;  3LIE A;  3L73 E;  2LXB A;  3CCS P;  1SQQ D;  2CPS A;  2OYO A;  3GHG A;  5KLV D;  3ZDM A;  4CPG A;  3MGN A;  1R8E A;  2OYH B;  1NH4 A;  4YXD C;  1K8A Q;  2GUS A;  1SQB G;  1Q86 Q;  2ZXE B;  2BEZ F;  2OAR A;  5M1B A;  1L4A A;  1S3J A;  2N9B A;  1OZH A;  2ZVN B;  4I2L C;  1N8R Q;  2IPP A;  4GOE A;  3A5T A;  2E74 B;  2MKV A;  3NTN A;  1HTL C;  2KSJ A;  3BRT B;  3KHU A;  3V2Q A;  1RF0 A;  1BE3 E;  1SQQ E;  2I1J A;  2NPS C;  1SQQ K;  3WUT A;  4ZKU A;  3CC2 P;  1LT9 B;  3PP5 A;  1L0L K;  3TYY A;  2Q5U A;  2HOD B;  3SWK A;  2ZT9 D;  1YYC A;  2OTK E;  3CWB E;  3PH0 A;  1VPC A;  2KYV A;  2Y9Y A;  5CJ4 A;  5B5E E;  2WT7 B;  3M0A A;  4D6T G;  3L71 E; 
#chains in the Genus database with same CATH homology
 1JY3 P;  3U1A A;  1GTW A;  3V2N A;  5AW0 B;  1J1D C;  3RL0 D;  3V2R A;  2HYN A;  1J2J B;  3GHG C;  3B8E B;  1WT6 A;  3TSI A;  1OXZ A;  1YTZ I;  3MTU E;  5AVY B;  1NO4 A;  1RE4 A;  1DEB A;  4ZKP A;  1LTJ B;  4GKG A;  4AUW A;  5AW8 B;  2FFD C;  2C9N Y;  1RE3 A;  3HTK A;  2Q7C A;  1NTM K;  4RES B;  1FAV A;  4I6M C;  1X8Y A;  3H32 B;  4IFM A;  1L0N K;  3HE4 B;  1WRG A;  1GW3 A;  1SLQ A;  1IFJ A;  3V4W A;  1LTB C;  2R3C A;  4GIF A;  1SVF A;  2IX7 C;  3HD7 B;  4LLH A;  3V4Q A;  3VP9 A;  1RE4 C;  3EFG A;  1KFM A;  3IR9 A;  4XA4 A;  1FBM A;  1L4A C;  1X9V A;  5AW4 B;  2R32 A;  4N78 D;  5BU8 B;  1RF1 A;  2A45 H;  1LTI C;  2BAS A;  2HFE D;  3GHG B;  2OYH A;  3EQ2 A;  3KDP B;  2WIT A;  3C9I A;  2YO2 A;  1CI6 A;  4N78 E;  1HBW A;  1NKN A;  2GM4 A;  5CCG A;  3B5N A;  1FZG A;  1GL2 B;  3UIA A;  1XTG B;  2OYI C;  3MD0 A;  1N2D C;  2E43 A;  4B86 A;  1LTG C;  1URQ D;  3L4F A;  1FZE A;  3M0D A;  1NKZ B;  2WT7 A;  3N4X A;  1N86 A;  2N1T C;  3M9H A;  1ZR2 A;  1LWU A;  2M8R A;  3A3Y B;  1H89 A;  1LT9 A;  2N1T D;  4I1L A;  3VN0 A;  1JY2 O;  1GL2 C;  2J59 M;  5CCH C;  2WSF H;  3M9B A;  2GUV A;  1FJP A;  2O1J A;  4GT1 A;  5KTB A;  1W2E A;  1J1E B;  1QL2 A;  1RF0 C;  4O9B A;  2FFD B;  2NPS B;  4JF7 A;  2FYU K;  2NPS A;  1QL1 A;  1JTH B;  1LWU C;  5APU A;  5AVT B;  1KIL A;  3CL3 D;  1MV8 A;  3U59 A;  3P8C D;  2XNX A;  5BU5 A;  3VP8 A;  4Y99 C;  2R5B A;  1LTT C;  2XDJ A;  3HD7 A;  3VYI A;  2FYZ A;  3M0D C;  5AVR B;  5APX A;  2WTY A;  1CZQ A;  1JY3 N;  2LKM A;  1S9K E;  2WZ7 A;  3HUS B;  1G2C A;  2IFM A;  1JY2 P;  3U1C A;  1MUU A;  1SQX K;  1PFI A;  2FFD A;  1JO5 A;  4C7R A;  3HD7 C;  3HUS A;  1LTA C;  2H7H A;  1XTC C;  3LID A;  3RK2 B;  1Z56 A;  1ZR4 A;  3N7N A;  2A45 G;  3WMM 0;  3L37 A;  1GZL A;  1L4A D;  1EQ7 A;  1SP4 A;  5AW5 B;  1N7S D;  3HE5 B;  3M06 A;  5APS A;  4EIJ A;  5CCG D;  2FKW B;  1T3U A;  1GDT A;  2E42 A;  4AYC A;  1GW4 A;  1HUC A;  2JJL A;  4C46 A;  4W80 A;  1OWA A;  2KB7 P;  4N6J A;  1JUN A;  3IFM A;  1FJK A;  3HTK B;  3OAK A;  1GD2 E;  1IO4 A;  3B5N C;  1G1J A;  1HVV A;  1NU1 K;  1N7L A;  3RK3 D;  1LT9 C;  3V5B A;  2VRS A;  4JYB A;  2ZFC A;  5AVU B;  1H88 A;  1MFZ A;  1G1I A;  1IFN A;  1LTS C;  5AW6 B;  1N7S B;  2P7J A;  1HGZ A;  1JY2 N;  2OYI A;  3RL0 B;  5CCG C;  1SFC B;  1CSB A;  1NOH A;  2XV5 A;  3VMY A;  2I1K A;  3M9Q A;  2XZR A;  1IFM A;  4WY4 C;  3I5C A;  3KYQ A;  1ZLL A;  5CJ0 A;  1FZA A;  1H8A A;  2H8P D;  3A7O A;  5APW A;  1LTJ A;  3P32 A;  5AVX B;  1KIL B;  1HJB A;  3G3Z A;  3A2A A;  1T3J A;  1URQ A;  4C7N B;  3TNU A;  1URQ B;  4WBA A;  5CHX A;  3TK1 A;  2WPQ A;  4OH8 B;  2HPC B;  1CI6 B;  1LGH B;  1CW5 A;  1T8Z A;  4IFD K;  3B5N D;  3RK2 C;  5CMZ A;  1RF1 C;  2MJZ A;  2WSC H;  4M3L A;  1KIL D;  1M1J C;  4N3Y B;  1FZC C;  4WY4 A;  1RE3 C;  3MUD A;  1SQP K;  2YMY A;  2P67 A;  1URQ C;  2WWW A;  3CI9 A;  3II6 A;  3LW5 H;  1SFC A;  4JYC A;  2IFN A;  2J58 A;  3P8C E;  2YKO A;  1NTK K;  3HRN A;  2Z4E A;  4W7Y A;  2W27 A;  3VMZ A;  1N7S A;  2M3B A;  1T2K C;  3P7K A;  3T97 A;  2A45 I;  1FOS F;  3R2P A;  4KHX A;  1A02 F;  3H6P A;  5AW1 B;  5APY A;  3E1I A;  4AQR D;  2OYH C;  1N73 A;  1IFD A;  1DH3 A;  2YKQ A;  1AFO A;  3CLQ A;  1NWQ A;  2XKM A;  4DOJ A;  1KQL A;  1YTZ T;  2O1K A;  2C0W A;  1DX7 A;  1GU5 A;  2KLV A;  1M1J A;  1RF1 B;  1T2K D;  1KZU B;  3L36 A;  5AW2 B;  3VMX A;  1JOC A;  1G2C B;  5KLV K;  1SFC D;  3HUS C;  4EOT A;  5AVZ B;  4LC1 A;  4IFF A;  4W7Z A;  4WY4 B;  2HOD A;  2P1J A;  2YNY A;  1JCD A;  1FU1 A;  2FXM A;  2C9L Y;  3BRV B;  1IJD B;  1FZF A;  3H32 A;  3HD7 D;  1L4A B;  1FOS E;  2CPB A;  1JCC A;  3OJA B;  2PAJ A;  4HYT B;  5AVS B;  5AW9 B;  4XE5 B;  1SQV K;  3BAS A;  3RL0 C;  1N73 C;  3TNU B;  2KOG A;  1E5W A;  3L35 A;  1M7L A;  1JTH A;  2XU6 A;  1ZV8 A;  2Z5H A;  3NFQ A;  4DZO A;  2WSE H;  1ZN5 A;  3VTP C;  1GK6 A;  3P8M C;  3MIW A;  1IK9 A;  1GL2 D;  5CCH D;  1JMM A;  2JEE A;  5KJ7 D;  4Y99 B;  4WY4 D;  4HH2 A;  1X79 B;  5AVV B;  1HH0 A;  2NPS D;  3HE4 A;  5AW3 B;  1FDM A;  1M1J B;  1LWU B;  1J1D B;  2W6B A;  5APQ A;  5AVQ B;  2R5D A;  3RK3 C;  5KJ7 C;  5APT A;  1JNM A;  2Q9I A;  2N1T B;  3RK2 D;  5AVW B;  3VOP A;  5APV A;  1RY3 A;  3OA7 A;  3M91 A;  2YO3 A;  1NTZ K;  2PP6 A;  2C0X A;  3NXS A;  1J1E C;  1IC2 A;  5BVZ A;  5AW7 B;  1S9K D;  2N1T A;  2Z5I A;  3BVH A;  2POH A;  3BAT A;  1SQB K;  1HGV A;  1LTJ C;  1FZB A;  5KJ7 A;  1HWT C;  3SWF A;  1JY3 O;  1GU4 A;  2H43 A;  3RK3 B;  2HG5 D;  1IFI A;  1FZC B;  1SFC C;  3HE5 A;  1KFN A;  3KQG A;  4WB4 A;  2QM8 A;  2YKP A;  1A02 J;  1FZC A;  2OYI B;  1N7S C;  2O01 H;  1VDF A;  1KIL C;  3NMD A;  2KP8 A;  3O8Z A;  3SWY A;  2QM7 A;  1N73 B;  1GL2 A;  5CCH A;  3B5N B;  2L5G B;  1AQ5 A;  4LGD E;  1MZ9 A;  2HLO A;  2HPC A;  4C7N A;  2WPR A;  2W6A A;  3KPE A;  1NAF A;  1GK4 A;  1NHL A;  3V2P A;  2Q3I A;  2P2U A;  2WPS A;  3LIE A;  2CPS A;  3GHG A;  2OYH B;  3MGN A;  1NH4 A;  2GUS A;  2ZXE B;  2OAR A;  1L4A A;  2N9B A;  4I2L C;  2IPP A;  3A5T A;  3NTN A;  1HTL C;  2KSJ A;  3BRT B;  3V2Q A;  1RF0 A;  2I1J A;  4ZKU A;  2NPS C;  1SQQ K;  1LT9 B;  3PP5 A;  1L0L K;  3TYY A;  2Q5U A;  2HOD B;  1YYC A;  5CJ4 A;  2WT7 B;  1VPC A;  2KYV A;  3M0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...