1LTSD

Refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1992-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltsD00
1EFID 1DYQA 3BZDB 1XXGA 1EEID 3MC0B 1HTLD 3MFGA 5D3IB 5I4DA 1JR0D 5FK9C 1LTID 3DWPA 1BCPD 1S5DD 1CQVA 1LTBD 1EWCA 1BCPB 4RGOS 2TSSA 1TS4A 1JWSD 1PZID 2AQ2B 4DXGA 1BXTA 1LLRD 1TS2A 1SJED 1FNUA 1ESFA 1LTSD 1EU3A 1PTOF 3R8BA 1JCKB 1L0XB 1KTKA 4RHSA 1EU4A 3KLSX 2XRQD 1CT1D 1FGBD 2NTSA 3BVMA 2RDGA 3R2IA 1UUPA 1SE4A 3GP7A 1BCPC 2XRSD 1KLGD 4RCOA 2O2LD 1PZKD 3DWAA 3O13A 1D5XC 1LTAD 1FNVA 5ELEA 1LO5D 1D6EC 3W2DA 1SBBB 1DJRD 1CHQD 1KLUD 1LT4D 1MD2D 1SJHD 2IPKD 1S5BD 1I4GA 5TSSA 2QILA 1ET6A 1SE3A 5ELFA 2RDHA 1S5CD 1F77A 1RDPD 1I4HA 1I4XA 4K6LA 1AW7A 1PRTF 1LTTD 3URYA 3BYTB 4RGMA 1ENFA 1QILA 1HA5A 3EA6A 1PZJD 3EFXD 1I4PA 3BVGA 4Z9CB 4RGNA 4ZYSA 1I4RA 4RHRA 1B1ZA 1G8ZD 2G9HD 1TY0A 2NTTA 1PTOD 5D3DA 2XN9C 1PTOB 4C56C 1LT3D 1TS3A 1V1PA 1TY2A 1GOZA 1SE2A 1XTCD 3DWQA 4DXFA 2AQ3B 4L6TB 2J4XA 1EEFD 1PRTD 3BYYB 1FNWA 1V1PB 1HQRD 1PRTB 1LT6D 4L63B 1SEBD 1TS5A 1LTRD 1JWUD 1RCVD 3CHBD 1FD7D 1CK1A 2IJ0A 4RFBA 5ELBA 1V1OA 3OWEB 1PTOH 2XNAC 1UNSA 1PYWD 1I4QA 5ELDA 1L0YB 1PTOC 1S5ED 1T5XD 2R61A 1HXYD 1AN8A 1CHPD 5FKAC 1RF2D 1D5MC 1JWMD 2ICIA 2QEJC 3V05A 1PRTC 4O1NA 3TSSA 2WV6D 4TSSA 1RD9D 1S5FD 2SEBD 4RH6A 1BCPF 1B44D 4UDUC 1STEA 1JQYD 2Z8LA 3BVZA 5ELCA 3SEBA 1LTGD 1LT5D 1M4VA 2CHBD 4OHJA 3R2TA 1SXTA 4BWGB 1ET9A 4RGTA 1D5ZC 2AQ1B
chains in the Genus database with same CATH superfamily
3K5LA 1E1TA 2EPBA 2QDBA 2PI2A 4POFA 3OPOA 1SSOA 1D7QA 4C2MH 2D5DA 2ZTDA 3DWPA 4H0LC 1KD1C 4BY1B 1LTBD 2FMMA 2JA8B 1YHQA 3NUCA 1KABA 1QUQA 1B7YB 5GAGC 3KUPA 1YHAA 4A3DB 1A2UA 3VDYA 3FKIH 1JE4A 3L0OA 4JI6L 2WAQE 4CDEC 2NBFA 1SAPA 4FDBA 5CV9A 3ZYYX 5JEAH 1IBKQ 2K4KA 5JEAJ 1X55A 1HZBA 3CCSA 3NK9A 4NW2A 3J7AV 3D8GA 3K81C 1NMFA 1A3UA 1Z7TA 3JAMc 2K5DA 2RHSB 1DCZA 5IODA 4BY7B 1PH1A 1BNZA 1DJRD 2VB2X 1KLUD 5DM73 4ODGA 2F3VA 3NTKA 2MFIA 1ET6A 1EZ8A 4UY8C 2R93B 4MN3A 4WRDA 2UUAQ 1JORA 3I56A 3EQLC 3T1HL 3K5NA 1Q8IA 4DR1L 2RHQB 2EY5A 5M3FG 1NUCA 1VQGA 1HNXQ 2Z1CA 1GHJA 4DAVA 3Q24A 4RGNA 1OXSC 4C3HG 2K1BA 4OL7A 4WJ3M 1QWYA 2GA4B 1VQOA 2YTVA 2GVAA 2XN9C 2ZJPA 1PVOA 1SE2A 4OXPA 4ZLTF 1W3SA 1VQ6A 1DD2A 3TQYA 2A68D 4JPBW 1U9RA 3NEMA 1PH5A 1F9RA 1PRTB 3KYHC 1H9SA 2EDGA 5LL6S 3C2PA 2DY7A 1S4ZA 2ATWA 5G3LF 4LFBL 4RFBA 5J39A 1HFGA 4OGQC 1TWAH 3PSIA 1PTOC 4IFDG 1ENCA 3CU7A 5JJLA 1C48A 3AFQA 4N9TA 2FINB 1B44D 1XYIA 2CCZA 2AUJD 4MIUA 1DM0B 5IGFA 4ZKBB 5CV6A 1Z47A 1K0RA 4A4IA 4BXXH 3D6WA 2AQ1B 1SMXA 1WCMH 1EFID 3NSWA 5CBEE 2M00A 1PH9A 2Y0SE 1EEID 1PFSA 4FF4A 1SFOH 5FK9C 3MXPA 5C4XB 3BDOA 2TSSA 2R6GA 1TS4A 2LSSA 1NBWA 2EJMA 3HOYB 4IFDJ 4DV0L 3TS0A 1CKNA 3FP9A 4JI3L 2K04A 5I9OA 1D1IA 1HJPA 2YU9H 3DEPA 3G6EA 1Y1VH 2K7VA 1EY7A 1JMCA 2ALYB 1KTKA 3NTHA 3HG9A 4DUYQ 2BDOA 1EY5A 1PDQA 4GOPA 2X6GA 3J7A5 2JA5H 2CWPA 3OWFA 5CBAE 1E2VA 1PH7A 3SK8A 3RLNA 1FNVA 1VQAA 2UXDQ 1MSHA 3MEHA 1CHQD 2DGYA 2SNMA 1HZCA 1NSNS 2HHHL 4HJ5A 2F0HA 3VA5A 1C7YA 3S1MB 2A6HC 1GUOA 3HOUH 1S3OA 1YHBA 3RR5A 2CWAA 4AIMA 4R9WA 3FPPA 1SNMA 2VS1A 2F0EA 5M5XH 1SMYC 1V9PA 2Z0SA 4A93B 4GNXC 2G5DA 2PW5A 4Z9CB 1WTWA 4A3IB 2NN6G 1G8ZD 1Z9FA 5EPLA 3KJOA 3PO2H 2F0NA 3S1QB 1L0WA 5D14A 2B2TC 5E3FA 1TXYA 5ELNA 1EEFD 5BR8Q 4F88A 4A75A 2I0QA 3TREA 2OQ0A 3LGJA 4L5TA 4AYBB 3BU2A 1FD7D 3VR5A 5CV7A 1Y1WH 1TWHB 5EGTA 4A3FG 1OTCA 1TR5A 4A3KH 1QNKA 2G9DA 5GQOA 1KDBA 1PYWD 4DV1L 2NVTB 3K6OA 1CHPD 1F9SA 2WKDA 5FKAC 3GV6A 1RF2D 1VMCA 3HOVH 4RKBA 4B3MQ 3D0FA 1B3QA 2JA6H 1JOOA 3SVMA 3M9BA 1SNQA 5IYCH 3CC4A 1EIFA 3HOZB 2NVXH 3A7LA 2K5HA 2BA0A 4FXDA 2F1MA 4C1NI 2A6HD 2C35B 2QDLA 4MZ9A 1VQHA 2XVSA 3M4YA 4BWGB 1QE6A 1AE2A 1VQIA 2EJFC 3H6MA 1H95A 4CDFC 3J7ZC 3GD7A 1DYQA 4EX5A 3PIP3 4EQPA 2XWJB 3G71A 4Y7NB 5C3EH 1WTPA 1QVCA 2EY2A 4KY7A 2XIWA 3KK7A 4BA2I 2B2UA 4QQBX 2C9OA 2EVBA 3HKSA 2XWBB 1PH2A 1AZPA 1JCKB 4LFCQ 2ZTEA 1EY9A 3G6JB 3A56A 4A3GG 4H02A 1VQ5A 4JI7L 3HOWH 3SXHA 4LF7Q 4CDDC 2R7ZG 2K75A 1LTAD 2B2VA 5KNBA 4QF4A 1K83H 1IBMQ 4IUPA 4B3TL 4B08A 4JC0A 3M7NA 4B9WA 2F0DA 4ZQ3A 1XMQQ 3UDIA 4F7XA 1SYCA 4GLAC 1Q90A 1PRTF 1KRSA 1BBWA 2BCOA 2HIXA 1K28A 1VQLA 1VQNA 4XDXA 2A19A 1HA5A 2K03A 1KRTA 3GTPH 4GKJL 4WORA 1FR3A 2PNRC 2XTIA 5FLXc 3EBEA 1TY0A 4A3LG 1BUVT 2F0MA 3J81j 1R9TB 2M2LA 1XMOQ 2B63B 3BYYB 2LS01 5JOBA 1R4PB 5IYDG 5CV5A 5KYIA 1IZ6A 5E1FA 2CFMA 4S3SA 5IWAQ 2L0CA 1F2ZA 1B2TA 3QB3A 2WKCA 2I07B 4QCLA 4KN4C 1FJGQ 1HNZQ 3AMUA 1HNXL 4A3GB 4FVMA 1HQMC 5FO7B 4XTCS 1YZ6A 2B3GA 3RN2A 1J8IA 1WOCA 2DN8A 5C44H 3EIVA 2R7ZB 5IGDA 1STHA 1EQQA 4HTHA 3W1GA 1CKNB 2O5IC 3CC7A 2CQOA 2KCMA 2PQEA 3P20A 5I6WA 2JEBI 1EL0A 1RTOA 4ZK9B 3FMCA 3HOXB 3QOJA 1CQFA 1U4RA 2PCFB 1VQJA 3T53B 1L1OC 1Y14B 4A3BG 2N55A 1CA6A 3RZDB 4QUFA 1JOQA 1CQVA 3A8IE 2RF4A 3J7YW 1VQBA 1YJ9A 4JG2A 2IX3A 1TS2A 2MUYA 2Q8IB 1WVLA 1J5EQ 4AYBE 1SDFA 1ONLA 3GTKH 5BN3A 4R4OA 4J15A 4JI6Q 2NTSA 3GTJH 4JBKA 2VUMH 1E1OA 4IJLA 1NR4A 4QMGA 5I9PA 3AFPA 2O2LD 1GD7A 1E3PA 3M3YH 1EOTA 3S17H 2R7FA 1O7IA 3R3OA 1S72A 4HN7A 4X3KA 3SHLA 5CC4A 2F52A 3CAMA 3I4NH 3A55A 2HCCA 4PMWA 1E22A 2K05A 4LWCA 5EKKA 1I4XA 4DUYL 3T1HQ 4DR1Q 2E2DC 2NUCA 1LTTD 3BYTB 4CGYB 2VW9A 5EBCA 3UI2A 4KKTA 5C4JH 3VYRA 2L4NA 1VS0A 3G48A 3H0GH 4RHRA 2UXDL 3ULPA 1NE3A 5IYBG 1C4QA 4C56C 1O78A 2WAQG 4DXFA 2DJGC 5CYUA 1B70B 2ZXPA 4ME5A 1HHVA 3VA7A 2PZWA 1XNQQ 3N6RA 5LMNQ 3PGZA 5M3MG 4RKLA 3MAQA 3CP0A 2KENA 3DM1A 3CMEA 3OMCA 3MXNB 1IBLL 3H3VI 3PV0A 3KF8B 3W3AA 1SNCA 2XGTA 4XQJA 1K9MC 3BDCA 1LV9A 3PCOB 2CH4W 1V8QA 4LUOA 4DR5L 1QOHA 2PO4A 4JW0A 2JP1A 3HS0C 3WWVA 1WTQA 4KMUC 3FEWX 2K5QA 3K7AB 3T16A 2EYMA 5GAEC 4DK6C 2D2CC 4XYOA 1NJIC 4HEDA 4LUZA 4P71A 4R4CA 3S1NH 4DR7L 3GQBA 1OXUA 2EYLA 2WB1G 1GXDC 4B3ML 4HJ9A 2HT1A 2AQ2B 2JA9A 3GTGH 3GTOB 1BXTA 2PZTA 4I7AA 4DV0Q 2E2JB 1EYDA 3P75A 4KI0A 1EYCA 2KBNA 4C3IH 2MQHA 3OTOQ 3M4OH 4APVA 1EQTA 3MWYW 3HP3A 1GM5A 5EQ0A 3QR8A 2NWGA 1DXMA 1MKHA 4GNXA 3TEHB 4JCVE 4DAPA 2F0UA 3PO3G 4A3JH 2PMZB 3NWSA 1Z6HA 4MHEA 2HHHQ 3AEVA 2B2TA 1I5FA 5IIFA 4A3CH 2Y0SG 4LFCL 2KJXA 3IRBA 4LW1A 5FO9B 2BH2A 4RA8A 3QOLA 1MHWC 1JB3A 4A3EG 4QL5A 2K5NA 2J7ZA 3F1ZA 2B8FA 1NMGA 3S14H 2G9HD 4CJ2C 1IBML 3E3XA 5BN5A 1W6KA 1C0AA 1CI3M 2CW0C 2WB1B 2CH4A 3PF5A 4MTKA 2EYOA 2IJ0A 2P5ZX 1GJXA 4NMZA 1IW7D 2ENBA 4IJHA 1C9OA 1L2FA 2PW7A 4GS3A 4DV1Q 1TT2A 3CC2A 2ICIA 4HR7B 2R92H 4TRDA 4KY5A 3E0EA 5COYA 2E2HH 4BBSH 3CKIB 1M1KC 1V43A 3ND8A 3MXGA 4YY3Q 1LT5D 2BA1A 1FYCA 1I94L 5C0XI 2F0WA 2PNHA 4CBVA 2MNAA 3LNNA 3PUWA 1FGUA 4OWTB 3V2TA 4HIDA 4X64L 3S15H 1I6HB 4OWXB 1HNZL 3GTLH 4GKKQ 1BCPD 4ZUIA 1CKOA 5C3XA 4JI2L 3K0XA 4HMIA 4QUCA 5BN4A 2CQAA 3HKZB 4O42A 1SJED 2K6AA 3RN5A 4M8AA 3NQTA 1UEBA 3FKIG 3VR3A 5KGUA 4QB4A 1EUJA 2YTXA 4FXGC 2K52A 4FO2A 1BKBA 4BY1H 2OQKA 4K5XA 5JEAG 2JA8H 3K5OA 4FNFA 3GV3A 3I4OA 5DNFA 4JI0Q 4L5SA 4NB3A 2OWOA 1VQ9A 4Q5VA 2RQXA 4EQNA 3ERQA 3GDEA 2ASBA 4A3DH 2Q2TA 1SJHD 4B3TQ 1O80A 4LJZC 2UXCL 4A3MB 1J5EL 4JI4Q 1PH6A 4IUUA 1ICFB 2RBMA 1GKHA 4J1MA 4KKSA 3A5UA 1F2MA 5IP7H 1A62A 2ZJRA 3B6YA 4U673 4O2DA 2K5WA 3SK5A 4BBRH 2F0VA 4LF6Q 4GKJQ 5IT9c 4POGA 1EQRA 2A5HA 1FVIA 1MJEA 2Z4IA 3VYSA 3ITPA 4XYQA 1W2BA 5M5YH 2I5LX 3IAYA 1XTCD 3MZ5A 4DKAC 3DWQA 3KF6A 2AQ3B 1SRUA 3CCVA 1O7ZA 1FNWA 1EY6A 3IKJA 4U68A 1I6VC 1BF4A 3CRKC 1RCVD 1JWUD 1STYA 1PH3A 1YBYA 2E75C 2N3SA 3FVQA 4AQYL 4R1JA 3MFYA 1SNOA 1BOSA 3P1HA 5C6AA 5DLQE 2JA7B 1L1OA 4LUVA 2PMZE 1D1KA 2RCFA 1NR2A 2A1AA 3K57A 2NZOA 3PUZA 3KBGA 4DAYB 3I4MB 2K28A 4IQZA 3CD6A 1S5FD 2R7DA 3SK4A 1F9PA 1HUMA 3BVZA 5FOBB 1EY8A 4BXXG 2F0JA 1XNQL 4DV2Q 1WCMG 3C46A 1HA6A 5LMNL 1Q1EA 2AUKA 2V1CC 1M90C 1WYDA 1XXGA 3MC0B 1ICWA 1OXXK 1AP0A 1UE1A 4IN3A 4JI5L 4KTAA 4OO1I 3CCRA 3DXJC 2EQSA 4PG3A 3BJUA 4HMJA 2H5XA 3HZXA 1PZID 1VQEA 2H4OA 2CKZB 2FMCA 4K5VA 2D0OA 2PZUA 3I7FA 1FNUA 4R8IA 1Y1VG 1EU3A 1U4MA 4IPDA 5H1SE 3NBHA 3MA2B 4JVZA 1E24A 2BE5C 5C4XH 3PUYA 2JA5G 3NQIA 3S2HB 3HOYH 2KEEA 3WDNA 3F2DA 1VQCA 1BQQT 1VCIA 2B39A 4K2KA 3EN2A 2JQOA 1STGA 4K8IA 1WTVA 2IHFA 5DAUA 5M3FB 3HOUG 2QILA 1SE3A 4OX9Q 4DV3L 4C3HB 5GAHC 3NWTA 4FP5D 3KDFA 1Q81C 3OTOL 1MI2A 3TP7A 1HFNA 3A8JE 3S9WA 3RNUA 3NP8A 1DOMA 1IL8A 3S1MH 3E6ZX 2EY6A 3HKZE 3U4ZA 4X6AH 1CZWA 3PO2G 1BO0A 3I55A 3MXUA 1PTOD 3E9HA 4UHVA 1SFOB 3VR6A 1V1PA 1GOZA 1QCBD 3J80i 1X3QA 1B3AA 2KUMA 4O0AA 2ZXRA 2A73B 4A93H 2KECA 2PQAB 4K14A 2HCIA 3KLSA 3A8KE 5D65A 5KNDA 4A3IH 1X6OA 5C5MA 1Y1WG 3OHXC 3ICEA 3TRZA 4A3KG 1T5EA 1N8RC 3CMAA 3S1QH 2BE5D 3E5SA 4LNQA 4B9XA 4DA2A 5C4ZA 5AJ3L 1CSPA 2R61A 1IBLQ 1AN8A 5L37A 4QIWB 2QA4A 3HOVG 3HRZC 2EY1A 1PHJA 1CTMA 1JWMD 3S1RB 2JA6G 5HGQA 5IYCG 4P2CB 1D8LA 5EPJA 1PRTC 1BR9A 2IX1A 3VYTA 3QJYA 4ZUJA 2IX0A 1N33Q 1TWHH 4DR5Q 2VB3X 2F0SA 1A3VA 3HEJA 4NP5A 3H3VH 1UE5A 3J80L 2NVTH 4DV5L 1TU2B 1KDCA 2VY3A 3J80E 3HOUB 2AKWB 5J1ZA 3NBIA 3U4VA 5C3EG 4DV6L 5I4DA 5EAYA 3HOZH 4DR7Q 1PH4A 2WIIB 1K8GA 4F8MA 5M5WB 1GUSA 5A2QL 3DHQA 3JC66 3RZOB 1PTOF 1QUQB 1RIPA 2IL8A 3D3RA 4YY3L 2I46A 2RVLA 5A2QE 4Y7NH 3J81i 4UP9A 5T1IA 1DGSA 5FLMH 5E4XA 1CT1D 3HOWG 3BVMA 4LK1C 3R2IA 4JI1L 1HR0L 1WI5A 3TZUA 1N34L 2OCEA 4X66Q 2L12A 4CKBA 2HDMA 4GKKL 1SMYD 5JVH3 4KD3A 1S5BD 2EE1A 1K8AC 3QG1A 3N52A 3RLOA 4ZAIA 1SYGA 5AFWA 5E7NA 4DK0A 1BVSA 4KN7C 3J81L 4JI0L 5EKIA 2OEOA 3OYYA 4K2LA 5IGBA 2F0GA 2L1BA 2UUBQ 3CQZB 3EFXD 3S24A 1XPRA 3J81E 1SE8A 4DR3L 3P7JA 5GROA 4A3FB 1TS3A 4UAIA 4IUQA 1QVFA 2HQLA 1B8AA 2J4XA 1SN8A 4JI4L 1LTLA 4IZ8A 4C3JH 1X3PA 4H7BA 3M4QA 1VQKA 1H9SB 3OWEB 4LF5L 2R3ZA 1R9TH 2VQEL 3UE1A 3CCMA 1XTDA 2E2IB 4OWWB 4LF6L 2ICEC 3CXCA 5JJIA 2QEJC 5C44G 3TSSA 2SEBD 2JE6I 4UDUC 1PLFA 1YNXA 4L5QA 3X3MA 4J8QA 3NHHA 3TBIB 3L3OC 3H3VC 4JBWA 1I94Q 4RGTA 5IY0A 4PMCA 3UE0A 4XT3B 2B8GA 4X64Q 3S16B 3DM3A 1R4QB 5C0XH 2RSOA 5M9OA 4JI2Q 1YIJA 1KNEA 1X3FA 5C0XJ 2UU9Q 3HOXH 3TS2A 1ESFA 2NVQB 3I91A 4PZ6A 3RZDH 3C3LA 2VUMG 1NNXA 4DV2L 2RDGA 4DK3C 1QNUA 3RUZA 2E74C 4H13C 2E5LL 3MHBA 4KHZA 3FRPB 4GOPB 1QZGA 1IYVA 2JYOA 1Y8NB 1VQMA 5KNCA 2SDFA 1SYDA 4IPCA 3ER0A 1SBBB 2OTJA 5KRUA 1X54A 2IT1A 3CCQA 1X9NA 4PZ8A 4FYDA 3I4NG 2UXCQ 4K6DA 4R4QA 2K50A 3A74A 1ZKOA 1K8OA 1JICA 2EYFA 1HUNA 3U58A 4KJOA 2YYZA 2MP1A 4HIMA 1QILA 2CVRA 3H0GG 1K0SA 1ENAA 1ZYRC 4WFN3 4CKCA 4QY7A 4FF2A 2V4DA 2MO1A 2QEXA 4DNRB 3IFDA 2N49A 3NE5B 4OX9L 3OW7A 4IFDI 1GUTA 1TS5A 3ULJA 3CHBD 2N88A 1Q12A 5K5PA 1WJJA 4AQYQ 2FHTA 1V1OA 3HFZB 1STAA 4EQOA 3C1FA 3E0JA 5F2DA 2L55A 3CF5A 2ZT9C 1JJ2A 1IKLA 3AB9A 4OIJA 2NVYB 1XPUA 3ULLA 3SGIA 2L9HA 1UE7A 3M3YB 3S17B 4A3BB 1D2BA 4YWMA 1O7LA 5EKLA 4DR2L 4OHJA 4CKEA 1B53A 3D4DA 4ZKCB 1VQDA 1EZ6A 1N36Q 1CZGA 1X65A 3D4RA 3JAMi 1UE6A 3GTQB 3AYHB 4OONA 4JI5Q 1S5DD 1A6XA 1BCPB 1X3EA 1Y69U 1JWSD 3K7AH 1HCZA 4DXGA 1KL9A 1LLRD 5A35A 1G2SA 1PFNA 3KBXA 4GZYC 4P74A 1N33L 4BA1I 1G291 2F3WA 4C3IG 4OO1H 3BDLA 1F9QA 3U50C 3J81c 3RMHA 3LWEA 2Q2HA 3OMGA 3PMFA 4YCWA 2HUGA 3EROA 4N8FA 2E2JH 3D31A 3ND9A 4JBJA 2VXWA 3FHWA 2NZ1D 2DNCA 4A3JG 3JAML 1JOKA 3S2DB 1G51A 1I4GA 1EYAA 3JAME 4A3CG 1Q1BA 3PIPA 5ELFA 2KCNA 2RDHA 1E2ZA 5KIXA 4DV3Q 1Q7YC 3Q23A 1F77A 3CPFA 2NN6I 2FJ2A 1Q3LA 5KEEA 4DNIA 1PMRA 2F0LA 1IHZA 3NELA 4DV7Q 4DK1A 2WAQB 2AWOA 5IGEA 1PZJD 4X66L 2YTYA 4DFAA 4LF8Q 5M3MB 4JYAL 1IYJB 1VDZA 5D3DA 4EGVA 1I3QB 3K8AA 4YCVA 2MO0A 3IFTA 1GUGA 4DNTB 1HQRD 1TWFB 1KDAA 1JE5A 1AZQA 4YHHQ 4N8X1 4IPHA 2OF1A 2QF7A 1YEZA 4UP8A 5E4WC 1HPCA 1I4QA 2UUBL 2J0TD 5AJ3Q 3WOEA 4DPGA 5JVG3 2R92G 1DOLA 1TWGH 2M9VA 4P72A 4BBSG 2Z6BA 3NPPA 1LUZA 5IP9H 1MJCA 3STBC 2VZAA 1STEA 1PV4A 2FFKB 1G6PA 3SEBA 4DF7A 2DY8A 5K36H 5C4HA 4DV5Q 2EYJA 2F0FA 2AWNA 2YV5A 5C5LA 2A69C 4DV6Q 1XJVA 1TWCB 2WFWA 2VQFQ 1OXTA 4TKOB 2RDFA 5CGKA 1G2TA 1U4LA 3PIOA 3VYUA 3BZCA 4ALPA 3LWUA 2D9UA 2KCCA 4K0KL 1PFMA 2PYKA 1JT8A 1VQFA 3I73A 5HY6A 2F3IA 4BY1G 1I6HH 2JA8G 3PO3B 3BZKA 4RG1A 1MGSA 2F0OA 3W1BA 2C5CA 4J6HA 4JI1Q 2PPBC 5LMUL 1I50H 4G4KA 4F87A 1HR0Q 4IALA 1N34Q 4LAAA 1Q46A 2Y0SB 3DLLA 2A6EC 4A3DG 1B9NA 1KAAA 4KV6A 4OIKA 2IPKD 1EIHA 1GVPA 2UU9L 2RKSA 4A3EB 1PA6A 4JI8Q 3D6CA 4E6IA 2JK8A 2LFNA 3TP8A 5IP7G 3GTMB 1DONA 1N9WA 1H9KA 5HGTA 2CW0D 2K01A 4BBRG 3L2PA 2N8NA 2UXBL 1I4PA 2GVBA 4G57A 4A3MH 4K8JA 3UDFA 4V0BA 4DR3Q 2R93G 1PTOB 5I6YA 1A2TA 5CV8A 4X62Q 4ME3A 1XNRL 5I2XA 3J7AF 2ZTCA 1CUKA 4LF9L 4BY7H 4LF5Q 1K73C 2B2WC 2JSOA 1YJNA 3KOJA 3M4PA 1DZ1A 2VQEQ 4B3SL 2X69A 2WINB 4DU9A 5GADC 2R93H 2A68C 2A6ED 5JPMC 4TSSA 1YVCA 4KK7A 4C2MB 3QWNA 4HSVA 1BCPF 3I72A 4PQXA 5G3LD 1JQYD 4V190 1P8LA 3CRLC 3F8TA 2JA7H 4TVAB 2EIFA 3I4MH 3H94A 2F4VQ 2SNSA 1QJOA 4KJNA 2F03A 4HAEA 3FKIB 5CMDA 1NAPA 4RGOS 1HNWL 3T51B 4TQUS 2N78A 1ESRA 4XT1B 4BBRB 1RL2A 4HJAA 4N9PA 1KAWA 1BBXC 3KFUA 2EYPA 4RHSA 1EU4A 1SNPA 5C4XG 4K5WA 1WTXA 5M5YB 1AH9A 3DEOA 4LF4L 2ZJQA 3F2CA 2L15A 2L5TA 3HOYG 1WFQA 1N36L 4L8JA 2XRSD 1KLGD 2E5LQ 3TP5A 3O13A 3I4LA 1Y8OB 2BH8A 5DM63 2KHSA 5IE8A 3FPUB 4JV5Q 4GNXB 3I70A 2D62A 2WB1E 3S2HH 1XX8A 5CV4A 1AFPA 1EYGA 4HSPA 4HJ7A 1AE3A 4DV4Q 2F0PA 3DUZA 5IGCA 1AW7A 4GN4B 4RGMA 1ENFA 1EY0A 5M3FH 1EQVA 4AH6A 3VR4A 4C3HH 4CJ0B 5FLXL 1TWAB 1SR3A 2XSCA 1X32A 3PQIA 2D0PA 5FLXE 4A93G 1V1QA 1GHKA 2DJFC 4X65L 4A3IG 2NB0A 3L9AX 4PZ7A 1PFBA 1J9OA 4R4IA 4DV7L 2KA7A 2RA4A 1LACA 2XNAC 1AEXA 3SDZA 4I7ZC 1CA5A 3MEFA 4NXML 4DUZL 3RD4A 2IHEA 1MSGA 4YWLA 4LF8L 4AYBG 4IFDH 1WCMB 2A8VA 1A3TA 4IO9A 3DMUA 1K3BC 2ZM6Q 4YWKA 1DOKA 2WV6D 3OW2A 2Q2UA 4WJWA 2MPMA 3Q6SA 1QB5D 4BS9A 5ELCA 2CHBD 4DR2Q 1M4VA 3MTSA 1D5ZC 4YHHL 5J3BA 3S1RH 2YU9B 5EJWA 1Y1VB 3HOZG 1JR0D 4DR6Q 4RMFA 1RTNA 3QIAA 4CDCC 3G7LA 1EWCA 3CCUA 4HJ8A 1WD1A 1GO3E 1A15A 2JA5B 1X56A 1CSQA 1ZEQX 4UP7A 1WTOA 1LTSD 4IUTA 3BG3A 4P75A 3CW2C 3R8BA 1U4PA 1L0XB 4KHPL 3H15A 5FLMG 4G7HC 4JBMA 4XQQA 3NENA 1KHIA 1X3GA 3RLFA 5M5WH 3NTIA 5CORA 1SE4A 3GP7A 4G7OC 1IXRA 3RZOH 2VQFL 4Y52H 2JN4A 3PUXA 2ID0A 3KLRA 5M5XB 4XQNA 1KC8C 5TSSA 4WJ4A 4CHTB 1N32L 3PO2B 4DR4L 5IOCA 2O5JC 5JAVA 1SNDA 4GLVB 2QW7A 1LM0A 4ZYSA 3CCLA 2NN6H 3A7AB 1Y1WB 1KQSA 2K33A 2MGSA 4JYAQ 3K58A 3F2BA 4A3KB 3I3CA 5DEHA 4C3JG 2WACA 2B2YC 4JI8L 1PRTD 2UUCL 3HOVB 1TVXA 3CQZH 3KF6B 4KD4A 2K14A 2JA6B 3T56B 5LMNW 1NY4A 2MHVA 2LXKA 2EXZA 4R4TA 1PYSB 3E9IA 1MBYA 1VMPA 2Z6KC 3MXNA 4XIGS 5ELBA 2NVXB 4NXNQ 3KF8A 4A3FH 3K0YA 1GUNA 1TKWB 2B63G 1T5XD 3F2UA 4RWSC 1L1OB 1NCVA 4LMQD 4O1NA 3OIPA 3FDTA 3I90A 4JOIC 2EJGC 1HZ9A 1E7ZA 5C3EB 3T1YQ 1EWHA 1KXLA 1U0LA 2Z8LA 5LHY1 4X62L 2E8GA 4LFAQ 2E2IH 3OSOA 3AU7A 3H91A 1K8MA 2JJQA 3NXWA 2AHOB 3UDXA 5C0XG 4NKLA 2B63H 1XPOA 3HOWB 2IWHA 5NUCA 3T13A 4EVOA 1ILPA 3HOXG 1RHPA 2KHJA 3EVQA 4K0KQ 1RJTA 1K83B 5HURA 3S16H 4RCNA 4KY6A 2H1EA 4A3GH 2HIVA 4C1NK 1IBKL 3OIQA 5LMUQ 4C3JB 4PV1C 2F0IA 2F4VL 3NBHB 1CFMA 3M7GA 3PUVA 3DWAA 1RKNA 2NVQH 2R7ZH 2ES2A 1LO5D 1D6EC 2VL6A 3MVVA 4KKUA 1LT4D 4Q0FA 3BS1A 1YNJC 5I2YA 2OXPA 3GTPB 2EYHA 3PIO3 3A5ZB 2TMPA 2UUAL 1VF5C 4DGZA 3UDGA 1ASYA 1I4HA 3LX0A 4K6LA 2LKVA 3KDFB 1GUWA 1QZHA 4QIWE 2B2WA 3TMEA 2F0QA 2UXBQ 5JPNC 4B3RQ 1C8CA 2Q8TA 3L7ZC 2AMCB 4JV5L 1LT3D 2LXJA 1TY2A 4A3LH 1QG7A 3WOFA 2F0KA 3CCJA 5CR3A 1EOVA 1YNNC 4FXKC 1V1PB 1XNRQ 3CPWA 1G91A 5C44B 5IYDH 1STBA 4DV4L 1YJWA 4LF9Q 1VF7A 3D4WA 1CK1A 3V96A 4RAUC 5IGGA 2PI2E 3TN2A 3Q22A 1L0YB 1EY4A 4B3SQ 1RODA 4X3UA 2Q8RE 4H44C 1TIID 5LL6X 2QGQA 4NDXA 2E76C 1RD9D 2DNEA 3K7UC 3J80c 1YNJD 2IW3A 1SYEA 4ABNA 1ET9A 1FL0A 1Y8PB 2ZXOA 3R93A 3OOCA 1HR0W 2K5VA 2KCTA 2F0TA 2SOBA 4P73A 2VNUD 2KOLA 2NVYH 5D3IB 2IY5B 3GTKB 1S40A 4A3BH 4DAMA 3GTJB 2VUMB 2GN5A 2NZHA 1CKMA 1HNWQ 2BOSA 1B9MA 3C1EA 3SE0A 1EIYB 2ZM6L 2HDLA 1P16A 2KQ3A 1JJCB 4A76A 4OO1G 3U9OA 2KHIA 2KEDA 2A74C 2HD3A 2I5MX 4MTNA 3GTQH 2EXDA 5FJ8G 1H9MA 1H9RA 1YNND 2XRQD 3KLSX 4HIKA 4GLXA 1FGBD 1M8AA 3X3NA 4LF4Q 2QCPX 5ELOA 3I4NB 5JJKA 1UUPA 4PMBA 4JK1C 1A8VA 4RCOA 4QGUA 2L11A 1ASZA 1Q86C 5FO8B 4DR6L 1UWVA 4YIJA 3SR1A 1MD2D 1SROA 1G6ZA 1ZYRD 1YITA 1EFWA 5C4JB 1SLJA 4IPGA 3H0GB 4G7ZC 4DN4M 3W5OA 3VR2A 1OO9B 1S5CD 1JJGA 1RDPD 2QKIC 1VQ8A 1NTGA 1OXVA 4GOPC 4LFBQ 4R8NA 5FJ8H 2I5HA 1HTPA 3URYA 1O7YA 2DUDA 3S2DH 3GTOH 3EA6A 1WD0A 4IUVA 1I4RA 1B1ZA 4ULLA 1K3RA 2B29A 4XXEA 4ID6A 2F4IA 5IT9L 4X3TA 1JB7A 2EOTA 4M1UB 5J22A 5IYBH 5KYLA 4IUNA 5IT9E 2NYZD 5BR8L 2RCNA 1LT6D 4L63B 4X65Q 1EWIA 1SEBD 4KLKA 5M3MH 3G4SA 4I65A 4ZCKA 1I3QH 4DAYA 3A54A 4OELB 3ERSX 3ZJYC 1HXYD 4NXMQ 4DUZQ 4EQ5A 5T1GA 4MNOA 1D5MC 1HZAA 1T9HA 1JC7A 1STNA 1VQ7A 1TWFH 5IP9G 5EPKA 3KLWA 3V05A 3S1NB 4JI3Q 2LY7A 3EJIA 4RH6A 3IL8A 1F2LA 3K59A 5K36G 3GTGB 1IW7C 5EBDA 2RSNA 4ZRZA 3U9SA 1A0IA 1ZXTA 2LMCB 3I2ZA 1QVGA 3BZDB 3H09A 4NXNL 1HTLD 1Q8KA 3MFGA 4C3IB 1XWEA 1LTID 3M4OB 4IURA 1H9JA 1PH8A 2EZVA 1ML0D 2Z4HA 3T1YL 3K80C 3T4AC 1A63A 1SYBA 4KHPQ 1F2YA 4YCUA 4IOAA 4NPSA 1IYUA 1TWCH 3TDQA 4A3JB 1IKMA 3Q0AA 3Q8DA 4LFAL 3SK6A 2X6LA 3HKZG 1BCPC 4LF7L 1UEAB 2BDNA 2HQEA 2Q2IA 3QO2A 3K5MA 1PZKD 2KVMA 1D5XC 1ILQA 5ELEA 3M85A 3W2DA 4QJFA 1Q82C 1HH2P 2B2UC 2MJ8A 1W6JA 3PO3H 4KHVA 5C3WA 1J6QA 4UPAA 4HCSA 3S14B 2B2YA 1TWGB 1XMQL 1N32Q 1U5KA 1IL2A 2Z9HA 4DR4Q 2OT2A 4L5RC 1VQ4A 1CM9A 1LYLA 2WP8J 4ILWA 2Z6KA 2B2VC 4A3MG 3HGBA 3BVGA 3GO5A 4A3EH 2NTTA 1SYFA 4GN5A 1E0BA 3GTMH 1UAPA 1VQPA 4HIOA 1BDOA 4JOIA 2PQAA 3I8ZA 2OTLA 1XMOL 4IOCA 1WTRA 4L6TB 3ONAB 2UUCQ 1B4OA 3STBD 2R92B 4FF1A 4X3SA 5ISRA 3TZDA 4BY7G 4BBSB 1LTRD 3A0JA 1YI2A 2E2HB 1B50A 3PF4A 5IWAL 3KJPA 1PTOH 4PNYA 1UNSA 5ELDA 2FXQA 1FJGL 4OEMB 1KIXA 1PXUA 1S5ED 1TQOA 2JXMB 1LABA 2A69D 1WTHA 2JEAI 4B3RL 3TP6A 1I50B 5JJZA 4GN3B 4HCEA 1II3A 3S15B 1E2WA 3GTLB 1MIUA 1KNAA 1PYBA 2O4XA 4FF3A 2JA7G 3AQQA 1LTGD 2K32A 3I4MG 1EIGA 1SXTA 3R2TA 4JI7Q 3CCEA 1HRJA 4CJ1B 1BBUA
chains in the Genus database with same CATH topology
3K5LA 2EPBA 2QDBA 3OPOA 1SSOA 2D5DA 3DWPA 4H0LC 4BY1B 1LTBD 2FMMA 2JA8B 3NUCA 1KABA 3KUPA 4A3DB 1A2UA 1JE4A 2NBFA 1SAPA 3ZYYX 5CV9A 5JEAH 5JEAJ 3NK9A 4NW2A 3J7AV 3D8GA 1A3UA 1Z7TA 2K5DA 1DCZA 5IODA 4BY7B 1BNZA 1DJRD 2VB2X 1KLUD 5DM73 4ODGA 2F3VA 3NTKA 1ET6A 1EZ8A 2R93B 4MN3A 4WRDA 1JORA 3EQLC 3K5NA 1Q8IA 2EY5A 1NUCA 2Z1CA 1GHJA 4DAVA 3Q24A 4RGNA 1OXSC 4C3HG 2K1BA 4OL7A 1QWYA 2GA4B 2XN9C 1SE2A 4ZLTF 1DD2A 2A68D 1U9RA 1F9RA 1PRTB 1H9SA 2EDGA 5LL6S 3C2PA 2DY7A 1S4ZA 5G3LF 4RFBA 5J39A 1HFGA 4OGQC 1PTOC 4IFDG 1ENCA 3CU7A 1C48A 4N9TA 2FINB 1B44D 1XYIA 2AUJD 4MIUA 1DM0B 5IGFA 4ZKBB 5CV6A 1Z47A 3D6WA 2AQ1B 1EFID 3NSWA 5CBEE 2M00A 1EEID 4FF4A 5FK9C 3MXPA 5C4XB 3BDOA 2TSSA 2R6GA 1TS4A 2EJMA 3HOYB 4IFDJ 2K04A 5I9OA 1D1IA 3DEPA 2K7VA 1EY7A 1KTKA 3NTHA 3HG9A 2BDOA 1EY5A 1PDQA 2X6GA 3OWFA 5CBAE 1E2VA 3SK8A 1FNVA 1MSHA 3MEHA 1CHQD 2SNMA 1NSNS 2F0HA 3VA5A 3S1MB 2A6HC 1GUOA 4R9WA 3FPPA 1SNMA 2F0EA 4A93B 1SMYC 2PW5A 4Z9CB 1WTWA 4A3IB 2NN6G 1G8ZD 5EPLA 2F0NA 3S1QB 5D14A 2B2TC 5E3FA 1EEFD 4F88A 4AYBB 1FD7D 3VR5A 5CV7A 1TWHB 5EGTA 1TR5A 1QNKA 2G9DA 1KDBA 1PYWD 2NVTB 3K6OA 1CHPD 1F9SA 2WKDA 5FKAC 3GV6A 1RF2D 1VMCA 4RKBA 1JOOA 3SVMA 1SNQA 3HOZB 3A7LA 2BA0A 4FXDA 2F1MA 4C1NI 2A6HD 4BWGB 2XVSA 3M4YA 1QE6A 2EJFC 3H6MA 3GD7A 1DYQA 3PIP3 4EQPA 2XWJB 4Y7NB 1WTPA 2EY2A 4KY7A 2XIWA 3KK7A 4BA2I 2B2UA 2C9OA 2EVBA 2XWBB 1AZPA 1JCKB 1EY9A 3G6JB 3A56A 3SXHA 1LTAD 2B2VA 5KNBA 4QF4A 4IUPA 4B08A 3M7NA 4B9WA 2F0DA 4ZQ3A 4F7XA 1SYCA 1Q90A 1PRTF 2BCOA 4XDXA 1HA5A 2K03A 4WORA 1FR3A 2PNRC 1TY0A 1BUVT 2F0MA 1R9TB 2M2LA 2B63B 3BYYB 2LS01 5JOBA 1R4PB 5CV5A 5KYIA 5E1FA 4S3SA 2L0CA 1F2ZA 1B2TA 3QB3A 2WKCA 2I07B 4QCLA 4KN4C 3AMUA 4A3GB 4FVMA 1HQMC 5FO7B 4XTCS 1J8IA 2DN8A 2R7ZB 5IGDA 1STHA 4HTHA 2O5IC 2PQEA 3P20A 5I6WA 2JEBI 1EL0A 1RTOA 4ZK9B 3FMCA 3HOXB 3QOJA 1CQFA 1U4RA 2PCFB 3T53B 2N55A 1CA6A 3RZDB 4QUFA 1JOQA 1CQVA 3A8IE 3J7YW 2IX3A 1TS2A 2MUYA 2Q8IB 1WVLA 1SDFA 1ONLA 5BN3A 2NTSA 1NR4A 4QMGA 5I9PA 2O2LD 1EOTA 3R3OA 4HN7A 4X3KA 3SHLA 5CC4A 3A55A 2HCCA 4PMWA 2K05A 5EKKA 1I4XA 2E2DC 2NUCA 1LTTD 3BYTB 4CGYB 5EBCA 3UI2A 4KKTA 3VYRA 2L4NA 4RHRA 1C4QA 4C56C 1O78A 4DXFA 5CYUA 2ZXPA 4ME5A 1HHVA 3VA7A 2PZWA 3N6RA 4RKLA 3MAQA 3DM1A 3OMCA 3PV0A 3W3AA 1SNCA 4XQJA 3BDCA 1LV9A 1V8QA 1QOHA 2PO4A 2JP1A 3HS0C 1WTQA 4KMUC 3FEWX 2K5QA 3K7AB 3T16A 2EYMA 2D2CC 4XYOA 4HEDA 3GQBA 1OXUA 2EYLA 1GXDC 2AQ2B 3GTOB 1BXTA 2PZTA 2E2JB 1EYDA 3P75A 4KI0A 1EYCA 1EQTA 3MWYW 3HP3A 5EQ0A 2NWGA 1DXMA 4DAPA 2F0UA 2PMZB 3NWSA 1Z6HA 4MHEA 2B2TA 5IIFA 2KJXA 5FO9B 4RA8A 3QOLA 1JB3A 2J7ZA 2B8FA 2G9HD 4CJ2C 5BN5A 1W6KA 1CI3M 2CW0C 2WB1B 2EYOA 2IJ0A 1GJXA 4NMZA 1IW7D 2ENBA 2PW7A 1TT2A 2ICIA 4HR7B 4TRDA 4KY5A 5COYA 3CKIB 1V43A 3ND8A 3MXGA 1LT5D 2BA1A 1FYCA 5C0XI 2F0WA 4CBVA 3LNNA 3PUWA 3V2TA 1I6HB 1BCPD 4ZUIA 5C3XA 4HMIA 4QUCA 5BN4A 2CQAA 3HKZB 4O42A 1SJED 2K6AA 4M8AA 3NQTA 3VR3A 5KGUA 4QB4A 4FXGC 4FO2A 4K5XA 5JEAG 3K5OA 4FNFA 3GV3A 5DNFA 4Q5VA 2RQXA 4EQNA 3ERQA 1SJHD 1O80A 4LJZC 4A3MB 4IUUA 2RBMA 4J1MA 4KKSA 1F2MA 4U673 2K5WA 3SK5A 2F0VA 2A5HA 2Z4IA 3VYSA 3ITPA 4XYQA 3IAYA 1XTCD 3MZ5A 3DWQA 2AQ3B 1O7ZA 1FNWA 1EY6A 3IKJA 4U68A 1I6VC 1BF4A 3CRKC 1RCVD 1JWUD 1STYA 2E75C 3FVQA 3MFYA 1SNOA 1BOSA 3P1HA 5C6AA 2JA7B 1D1KA 1NR2A 3K57A 3I4MB 3PUZA 3KBGA 2K28A 4IQZA 1S5FD 3SK4A 1F9PA 1HUMA 3BVZA 5FOBB 1EY8A 2F0JA 3C46A 1HA6A 1Q1EA 2AUKA 1XXGA 3MC0B 1ICWA 1OXXK 1AP0A 4IN3A 4KTAA 4OO1I 3DXJC 4HMJA 3HZXA 1PZID 2H4OA 2FMCA 4K5VA 2PZUA 1FNUA 4R8IA 1EU3A 1U4MA 3NBHA 3MA2B 2BE5C 3PUYA 3NQIA 3S2HB 2KEEA 3WDNA 1BQQT 1VCIA 2B39A 4K2KA 1STGA 4K8IA 1WTVA 5DAUA 5M3FB 2QILA 1SE3A 4C3HB 3NWTA 4FP5D 1MI2A 3TP7A 1HFNA 3A8JE 3S9WA 3NP8A 1DOMA 1IL8A 3E6ZX 2EY6A 1CZWA 1BO0A 3MXUA 1PTOD 1SFOB 3VR6A 1V1PA 1GOZA 1QCBD 1X3QA 1B3AA 2KUMA 2ZXRA 2A73B 2KECA 4K14A 2HCIA 3KLSA 3A8KE 5D65A 5KNDA 5C5MA 3OHXC 1T5EA 2BE5D 3E5SA 4B9XA 4DA2A 5C4ZA 2R61A 1AN8A 4QIWB 3HRZC 2EY1A 1CTMA 1JWMD 3S1RB 4P2CB 5EPJA 1PRTC 1BR9A 2IX1A 3VYTA 3QJYA 4ZUJA 2IX0A 2VB3X 2F0SA 1A3VA 3HEJA 4NP5A 3J80L 1TU2B 1KDCA 3J80E 3HOUB 5J1ZA 3NBIA 5I4DA 2WIIB 4F8MA 5M5WB 1GUSA 5A2QL 3DHQA 3RZOB 1PTOF 3D3RA 2IL8A 2I46A 2RVLA 5A2QE 5T1IA 5E4XA 1CT1D 3BVMA 4LK1C 3R2IA 3TZUA 2L12A 4CKBA 2HDMA 1SMYD 5JVH3 4KD3A 1S5BD 2EE1A 3QG1A 3N52A 4ZAIA 1SYGA 5AFWA 4DK0A 4KN7C 3J81L 5EKIA 2OEOA 5IGBA 4K2LA 2F0GA 2L1BA 3CQZB 3EFXD 3J81E 3P7JA 4A3FB 1TS3A 4UAIA 4IUQA 2J4XA 4IZ8A 1X3PA 4H7BA 1H9SB 3OWEB 2R3ZA 2E2IB 2ICEC 2QEJC 3TSSA 2SEBD 2JE6I 4UDUC 1PLFA 3X3MA 4J8QA 3NHHA 3TBIB 3L3OC 3H3VC 4JBWA 4RGTA 4PMCA 4XT3B 2B8GA 3S16B 1R4QB 5C0XH 2RSOA 5M9OA 1KNEA 5C0XJ 2NVQB 1ESFA 3I91A 3C3LA 2RDGA 1QNUA 3RUZA 2E74C 4H13C 3MHBA 4KHZA 3FRPB 1IYVA 2JYOA 1Y8NB 5KNCA 2SDFA 1SYDA 1SBBB 5KRUA 2IT1A 4FYDA 4K6DA 1ZKOA 1K8OA 1JICA 2EYFA 1HUNA 4KJOA 2YYZA 2MP1A 1QILA 2CVRA 1ENAA 1ZYRC 4WFN3 4CKCA 4FF2A 2V4DA 4DNRB 3IFDA 3NE5B 3OW7A 4IFDI 1GUTA 1TS5A 3CHBD 2N88A 1Q12A 5K5PA 2FHTA 1V1OA 1STAA 4EQOA 3C1FA 3E0JA 5F2DA 2L55A 2ZT9C 1IKLA 3AB9A 4OIJA 2NVYB 2L9HA 3M3YB 3S17B 4A3BB 1D2BA 1O7LA 5EKLA 4OHJA 4CKEA 1B53A 3D4DA 4ZKCB 1EZ6A 1CZGA 3D4RA 3GTQB 1S5DD 1A6XA 1BCPB 1Y69U 1JWSD 1HCZA 4DXGA 1LLRD 5A35A 1G2SA 1PFNA 3KBXA 4GZYC 4BA1I 1G291 2F3WA 4C3IG 4OO1H 3BDLA 1F9QA 3RMHA 3LWEA 3OMGA 3PMFA 2HUGA 3EROA 3D31A 3ND9A 2VXWA 2NZ1D 2DNCA 3JAML 1JOKA 3S2DB 1I4GA 1EYAA 3JAME 1Q1BA 5ELFA 2KCNA 2RDHA 1E2ZA 5KIXA 3Q23A 1F77A 2NN6I 2FJ2A 1Q3LA 5KEEA 1PMRA 2F0LA 1IHZA 4DK1A 2WAQB 2AWOA 5IGEA 1PZJD 4DFAA 5M3MB 1VDZA 5D3DA 4EGVA 1I3QB 3IFTA 1GUGA 4DNTB 1HQRD 1TWFB 1KDAA 1AZQA 2OF1A 2QF7A 5E4WC 1HPCA 1I4QA 2J0TD 3WOEA 5JVG3 1DOLA 2M9VA 3NPPA 1STEA 2FFKB 3SEBA 4DF7A 2DY8A 5K36H 5C4HA 2EYJA 2F0FA 2AWNA 5C5LA 2A69C 1TWCB 1OXTA 4TKOB 2RDFA 5CGKA 1G2TA 1U4LA 3VYUA 3LWUA 2D9UA 2KCCA 1PFMA 2PYKA 3I73A 3PO3B 1MGSA 2F0OA 2C5CA 4J6HA 2PPBC 4F87A 4G4KA 4IALA 4LAAA 2Y0SB 2A6EC 1B9NA 1KAAA 4KV6A 4OIKA 2IPKD 1EIHA 2RKSA 4A3EB 3D6CA 4E6IA 2LFNA 3TP8A 3GTMB 1DONA 1H9KA 5HGTA 2CW0D 2K01A 1I4PA 4G57A 4K8JA 4V0BA 1PTOB 5I6YA 1A2TA 5CV8A 5I2XA 3J7AF 2B2WC 2JSOA 1DZ1A 2X69A 2WINB 4DU9A 2A68C 2A6ED 5JPMC 4TSSA 4KK7A 4C2MB 3QWNA 4HSVA 1BCPF 3I72A 4PQXA 5G3LD 1JQYD 4V190 3CRLC 3H94A 2SNSA 1QJOA 4KJNA 2F03A 4HAEA 3FKIB 5CMDA 1NAPA 4RGOS 3T51B 4TQUS 1ESRA 4XT1B 4BBRB 4N9PA 1BBXC 2EYPA 4RHSA 1EU4A 1SNPA 5M5YB 4K5WA 1WTXA 3DEOA 2L5TA 4L8JA 2XRSD 1KLGD 3TP5A 3O13A 3I4LA 1Y8OB 5DM63 2KHSA 3FPUB 3I70A 2D62A 1XX8A 5CV4A 1AFPA 4HSPA 2F0PA 3DUZA 5IGCA 1AW7A 4RGMA 1ENFA 1EY0A 1EQVA 3VR4A 4CJ0B 5FLXL 1TWAB 2XSCA 1X32A 5FLXE 1GHKA 2NB0A 3L9AX 1PFBA 1J9OA 2KA7A 2RA4A 1LACA 2XNAC 1AEXA 3SDZA 4I7ZC 1CA5A 3RD4A 1MSGA 4IFDH 1WCMB 1A3TA 3DMUA 1DOKA 2WV6D 4WJWA 2MPMA 3Q6SA 1QB5D 4BS9A 5ELCA 2CHBD 1M4VA 3MTSA 1D5ZC 2YU9B 5EJWA 1Y1VB 1JR0D 1RTNA 3QIAA 3G7LA 1EWCA 1WD1A 1A15A 2JA5B 1ZEQX 1WTOA 1LTSD 4IUTA 3BG3A 3R8BA 1U4PA 1L0XB 4G7HC 4XQQA 3RLFA 3NTIA 5CORA 1SE4A 3GP7A 4G7OC 3PUXA 2ID0A 3KLRA 5M5XB 4XQNA 5TSSA 4CHTB 3PO2B 5IOCA 2O5JC 5JAVA 1SNDA 4ZYSA 2NN6H 3A7AB 1Y1WB 2K33A 2MGSA 3K58A 4A3KB 3I3CA 5DEHA 4C3JG 2WACA 2B2YC 1PRTD 3HOVB 1TVXA 4KD4A 2JA6B 3T56B 2MHVA 2EXZA 2NVXB 1MBYA 1VMPA 3MXNA 5ELBA 4XIGS 3KF8A 3K0YA 1GUNA 1TKWB 1T5XD 3F2UA 4RWSC 1NCVA 4LMQD 4O1NA 3OIPA 3FDTA 3I90A 2EJGC 5C3EB 1EWHA 2Z8LA 5LHY1 3OSOA 3AU7A 3H91A 1K8MA 3NXWA 5C0XG 4NKLA 3HOWB 2IWHA 5NUCA 3T13A 4EVOA 1ILPA 1RHPA 3EVQA 1RJTA 1K83B 5HURA 4RCNA 4KY6A 2H1EA 4C1NK 3OIQA 4C3JB 4PV1C 2F0IA 1CFMA 3M7GA 3PUVA 3DWAA 1RKNA 1LO5D 1D6EC 3MVVA 4KKUA 1LT4D 4Q0FA 3BS1A 1YNJC 5I2YA 2OXPA 3GTPB 2EYHA 3PIO3 2TMPA 1VF5C 4DGZA 1I4HA 3LX0A 4K6LA 2LKVA 1GUWA 2B2WA 3TMEA 2F0QA 5JPNC 1C8CA 2Q8TA 3L7ZC 1LT3D 1TY2A 1QG7A 3WOFA 2F0KA 5CR3A 1YNNC 4FXKC 1V1PB 1G91A 5C44B 1STBA 1VF7A 3D4WA 1CK1A 3V96A 4RAUC 5IGGA 3TN2A 3Q22A 1L0YB 1EY4A 1RODA 4X3UA 2Q8RE 4H44C 1TIID 5LL6X 4NDXA 2E76C 1RD9D 2DNEA 1YNJD 2IW3A 1SYEA 4ABNA 1ET9A 1Y8PB 2ZXOA 3R93A 3OOCA 2F0TA 2SOBA 2VNUD 2KOLA 5D3IB 3GTKB 3GTJB 2VUMB 2BOSA 1B9MA 3C1EA 3SE0A 2HDLA 2KQ3A 4OO1G 3U9OA 2KEDA 2A74C 1H9MA 1H9RA 1YNND 2XRQD 3KLSX 1FGBD 1M8AA 3X3NA 2QCPX 3I4NB 1UUPA 4PMBA 4JK1C 4RCOA 2L11A 5FO8B 4YIJA 3SR1A 1MD2D 1G6ZA 1ZYRD 5C4JB 3H0GB 4G7ZC 4DN4M 3VR2A 1OO9B 1S5CD 1RDPD 2QKIC 1OXVA 4R8NA 1HTPA 3URYA 1O7YA 3EA6A 1WD0A 4IUVA 1I4RA 1B1ZA 4ULLA 4XXEA 4ID6A 2F4IA 5IT9L 4X3TA 2EOTA 4M1UB 5J22A 5KYLA 4IUNA 5IT9E 2NYZD 1LT6D 4L63B 1SEBD 4I65A 4DAYA 3A54A 1HXYD 5T1GA 1D5MC 1JC7A 1STNA 5EPKA 3V05A 3S1NB 2LY7A 3EJIA 4RH6A 3IL8A 1F2LA 3K59A 5K36G 3GTGB 1IW7C 5EBDA 2RSNA 4ZRZA 3U9SA 1ZXTA 2LMCB 3BZDB 3H09A 1HTLD 3MFGA 4C3IB 1XWEA 1LTID 3M4OB 4IURA 1H9JA 2EZVA 1ML0D 2Z4HA 3T4AC 1SYBA 1F2YA 1IYUA 4A3JB 3TDQA 1IKMA 3Q0AA 3SK6A 2X6LA 1BCPC 1UEAB 2BDNA 2HQEA 3QO2A 3K5MA 1PZKD 2KVMA 1D5XC 1ILQA 5ELEA 3M85A 3W2DA 2B2UC 2MJ8A 1W6JA 4KHVA 5C3WA 4HCSA 3S14B 2B2YA 1TWGB 2OT2A 1CM9A 2WP8J 4ILWA 2B2VC 3HGBA 3BVGA 3GO5A 2NTTA 1SYFA 1E0BA 1UAPA 1BDOA 3I8ZA 1WTRA 4L6TB 3ONAB 1B4OA 2R92B 4FF1A 4X3SA 5ISRA 3TZDA 4BBSB 2E2HB 1LTRD 1B50A 1PTOH 4PNYA 1UNSA 5ELDA 1PXUA 1S5ED 1TQOA 2JXMB 1LABA 2A69D 2JEAI 3TP6A 1I50B 5JJZA 4HCEA 1II3A 3S15B 1E2WA 3GTLB 1KNAA 4FF3A 2O4XA 1LTGD 2K32A 1EIGA 1SXTA 3R2TA 1HRJA 4CJ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFI D;  1DYQ A;  3BZD B;  1XXG A;  1EEI D;  3MC0 B;  1HTL D;  3MFG A;  5D3I B;  5I4D A;  1JR0 D;  5FK9 C;  1LTI D;  3DWP A;  1BCP D;  1S5D D;  1CQV A;  1LTB D;  1EWC A;  1BCP B;  4RGO S;  2TSS A;  1TS4 A;  1JWS D;  1PZI D;  2AQ2 B;  4DXG A;  1BXT A;  1LLR D;  1TS2 A;  1SJE D;  1FNU A;  1ESF A;  1LTS D;  1EU3 A;  1PTO F;  3R8B A;  1JCK B;  1L0X B;  1KTK A;  4RHS A;  1EU4 A;  3KLS X;  2XRQ D;  1CT1 D;  1FGB D;  2NTS A;  3BVM A;  2RDG A;  3R2I A;  1UUP A;  1SE4 A;  3GP7 A;  1BCP C;  2XRS D;  1KLG D;  4RCO A;  2O2L D;  1PZK D;  3DWA A;  3O13 A;  1D5X C;  1LTA D;  1FNV A;  5ELE A;  1LO5 D;  1D6E C;  3W2D A;  1SBB B;  1DJR D;  1CHQ D;  1KLU D;  1LT4 D;  1MD2 D;  1SJH D;  2IPK D;  1S5B D;  1I4G A;  5TSS A;  2QIL A;  1ET6 A;  1SE3 A;  5ELF A;  2RDH A;  1S5C D;  1F77 A;  1RDP D;  1I4H A;  1I4X A;  4K6L A;  1AW7 A;  1PRT F;  1LTT D;  3URY A;  3BYT B;  4RGM A;  1ENF A;  1QIL A;  1HA5 A;  3EA6 A;  1PZJ D;  3EFX D;  1I4P A;  3BVG A;  4Z9C B;  4RGN A;  4ZYS A;  1I4R A;  4RHR A;  1B1Z A;  1G8Z D;  2G9H D;  1TY0 A;  2NTT A;  1PTO D;  5D3D A;  2XN9 C;  1PTO B;  4C56 C;  1LT3 D;  1TS3 A;  1V1P A;  1TY2 A;  1GOZ A;  1SE2 A;  1XTC D;  3DWQ A;  4DXF A;  2AQ3 B;  4L6T B;  2J4X A;  1EEF D;  1PRT D;  3BYY B;  1FNW A;  1V1P B;  1HQR D;  1PRT B;  1LT6 D;  4L63 B;  1SEB D;  1TS5 A;  1LTR D;  1JWU D;  1RCV D;  3CHB D;  1FD7 D;  1CK1 A;  2IJ0 A;  4RFB A;  5ELB A;  1V1O A;  3OWE B;  1PTO H;  2XNA C;  1UNS A;  1PYW D;  1I4Q A;  5ELD A;  1L0Y B;  1PTO C;  1S5E D;  1T5X D;  2R61 A;  1HXY D;  1AN8 A;  1CHP D;  5FKA C;  1RF2 D;  1D5M C;  1JWM D;  2ICI A;  2QEJ C;  3V05 A;  1PRT C;  4O1N A;  3TSS A;  2WV6 D;  4TSS A;  1RD9 D;  1S5F D;  2SEB D;  4RH6 A;  1BCP F;  1B44 D;  4UDU C;  1STE A;  1JQY D;  2Z8L A;  3BVZ A;  5ELC A;  3SEB A;  1LTG D;  1LT5 D;  1M4V A;  2CHB D;  4OHJ A;  3R2T A;  1SXT A;  4BWG B;  1ET9 A;  4RGT A;  1D5Z C;  2AQ1 B; 
#chains in the Genus database with same CATH topology
 3K5L A;  1E1T A;  2EPB A;  2QDB A;  2PI2 A;  4POF A;  3OPO A;  1SSO A;  1D7Q A;  4C2M H;  2D5D A;  2ZTD A;  3DWP A;  4H0L C;  1KD1 C;  4BY1 B;  1LTB D;  2FMM A;  2JA8 B;  1YHQ A;  3NUC A;  1KAB A;  1QUQ A;  1B7Y B;  5GAG C;  3KUP A;  1YHA A;  4A3D B;  1A2U A;  3VDY A;  3FKI H;  1JE4 A;  3L0O A;  4JI6 L;  2WAQ E;  4CDE C;  2NBF A;  1SAP A;  4FDB A;  5CV9 A;  3ZYY X;  5JEA H;  1IBK Q;  2K4K A;  5JEA J;  1X55 A;  1HZB A;  3CCS A;  3NK9 A;  4NW2 A;  3J7A V;  3D8G A;  3K81 C;  1NMF A;  1A3U A;  1Z7T A;  3JAM c;  2K5D A;  2RHS B;  1DCZ A;  5IOD A;  4BY7 B;  1PH1 A;  1BNZ A;  1DJR D;  2VB2 X;  1KLU D;  5DM7 3;  4ODG A;  2F3V A;  3NTK A;  2MFI A;  1ET6 A;  1EZ8 A;  4UY8 C;  2R93 B;  4MN3 A;  4WRD A;  2UUA Q;  1JOR A;  3I56 A;  3EQL C;  3T1H L;  3K5N A;  1Q8I A;  4DR1 L;  2RHQ B;  2EY5 A;  5M3F G;  1NUC A;  1VQG A;  1HNX Q;  2Z1C A;  1GHJ A;  4DAV A;  3Q24 A;  4RGN A;  1OXS C;  4C3H G;  2K1B A;  4OL7 A;  4WJ3 M;  1QWY A;  2GA4 B;  1VQO A;  2YTV A;  2GVA A;  2XN9 C;  2ZJP A;  1PVO A;  1SE2 A;  4OXP A;  4ZLT F;  1W3S A;  1VQ6 A;  1DD2 A;  3TQY A;  2A68 D;  4JPB W;  1U9R A;  3NEM A;  1PH5 A;  1F9R A;  1PRT B;  3KYH C;  1H9S A;  2EDG A;  5LL6 S;  3C2P A;  2DY7 A;  1S4Z A;  2ATW A;  5G3L F;  4LFB L;  4RFB A;  5J39 A;  1HFG A;  4OGQ C;  1TWA H;  3PSI A;  1PTO C;  4IFD G;  1ENC A;  3CU7 A;  5JJL A;  1C48 A;  3AFQ A;  4N9T A;  2FIN B;  1B44 D;  1XYI A;  2CCZ A;  2AUJ D;  4MIU A;  1DM0 B;  5IGF A;  4ZKB B;  5CV6 A;  1Z47 A;  1K0R A;  4A4I A;  4BXX H;  3D6W A;  2AQ1 B;  1SMX A;  1WCM H;  1EFI D;  3NSW A;  5CBE E;  2M00 A;  1PH9 A;  2Y0S E;  1EEI D;  1PFS A;  4FF4 A;  1SFO H;  5FK9 C;  3MXP A;  5C4X B;  3BDO A;  2TSS A;  2R6G A;  1TS4 A;  2LSS A;  1NBW A;  2EJM A;  3HOY B;  4IFD J;  4DV0 L;  3TS0 A;  1CKN A;  3FP9 A;  4JI3 L;  2K04 A;  5I9O A;  1D1I A;  1HJP A;  2YU9 H;  3DEP A;  3G6E A;  1Y1V H;  2K7V A;  1EY7 A;  1JMC A;  2ALY B;  1KTK A;  3NTH A;  3HG9 A;  4DUY Q;  2BDO A;  1EY5 A;  1PDQ A;  4GOP A;  2X6G A;  3J7A 5;  2JA5 H;  2CWP A;  3OWF A;  5CBA E;  1E2V A;  1PH7 A;  3SK8 A;  3RLN A;  1FNV A;  1VQA A;  2UXD Q;  1MSH A;  3MEH A;  1CHQ D;  2DGY A;  2SNM A;  1HZC A;  1NSN S;  2HHH L;  4HJ5 A;  2F0H A;  3VA5 A;  1C7Y A;  3S1M B;  2A6H C;  1GUO A;  3HOU H;  1S3O A;  1YHB A;  3RR5 A;  2CWA A;  4AIM A;  4R9W A;  3FPP A;  1SNM A;  2VS1 A;  2F0E A;  5M5X H;  1SMY C;  1V9P A;  2Z0S A;  4A93 B;  4GNX C;  2G5D A;  2PW5 A;  4Z9C B;  1WTW A;  4A3I B;  2NN6 G;  1G8Z D;  1Z9F A;  5EPL A;  3KJO A;  3PO2 H;  2F0N A;  3S1Q B;  1L0W A;  5D14 A;  2B2T C;  5E3F A;  1TXY A;  5ELN A;  1EEF D;  5BR8 Q;  4F88 A;  4A75 A;  2I0Q A;  3TRE A;  2OQ0 A;  3LGJ A;  4L5T A;  4AYB B;  3BU2 A;  1FD7 D;  3VR5 A;  5CV7 A;  1Y1W H;  1TWH B;  5EGT A;  4A3F G;  1OTC A;  1TR5 A;  4A3K H;  1QNK A;  2G9D A;  5GQO A;  1KDB A;  1PYW D;  4DV1 L;  2NVT B;  3K6O A;  1CHP D;  1F9S A;  2WKD A;  5FKA C;  3GV6 A;  1RF2 D;  1VMC A;  3HOV H;  4RKB A;  4B3M Q;  3D0F A;  1B3Q A;  2JA6 H;  1JOO A;  3SVM A;  3M9B A;  1SNQ A;  5IYC H;  3CC4 A;  1EIF A;  3HOZ B;  2NVX H;  3A7L A;  2K5H A;  2BA0 A;  4FXD A;  2F1M A;  4C1N I;  2A6H D;  2C35 B;  2QDL A;  4MZ9 A;  1VQH A;  2XVS A;  3M4Y A;  4BWG B;  1QE6 A;  1AE2 A;  1VQI A;  2EJF C;  3H6M A;  1H95 A;  4CDF C;  3J7Z C;  3GD7 A;  1DYQ A;  4EX5 A;  3PIP 3;  4EQP A;  2XWJ B;  3G71 A;  4Y7N B;  5C3E H;  1WTP A;  1QVC A;  2EY2 A;  4KY7 A;  2XIW A;  3KK7 A;  4BA2 I;  2B2U A;  4QQB X;  2C9O A;  2EVB A;  3HKS A;  2XWB B;  1PH2 A;  1AZP A;  1JCK B;  4LFC Q;  2ZTE A;  1EY9 A;  3G6J B;  3A56 A;  4A3G G;  4H02 A;  1VQ5 A;  4JI7 L;  3HOW H;  3SXH A;  4LF7 Q;  4CDD C;  2R7Z G;  2K75 A;  1LTA D;  2B2V A;  5KNB A;  4QF4 A;  1K83 H;  1IBM Q;  4IUP A;  4B3T L;  4B08 A;  4JC0 A;  3M7N A;  4B9W A;  2F0D A;  4ZQ3 A;  1XMQ Q;  3UDI A;  4F7X A;  1SYC A;  4GLA C;  1Q90 A;  1PRT F;  1KRS A;  1BBW A;  2BCO A;  2HIX A;  1K28 A;  1VQL A;  1VQN A;  4XDX A;  2A19 A;  1HA5 A;  2K03 A;  1KRT A;  3GTP H;  4GKJ L;  4WOR A;  1FR3 A;  2PNR C;  2XTI A;  5FLX c;  3EBE A;  1TY0 A;  4A3L G;  1BUV T;  2F0M A;  3J81 j;  1R9T B;  2M2L A;  1XMO Q;  2B63 B;  3BYY B;  2LS0 1;  5JOB A;  1R4P B;  5IYD G;  5CV5 A;  5KYI A;  1IZ6 A;  5E1F A;  2CFM A;  4S3S A;  5IWA Q;  2L0C A;  1F2Z A;  1B2T A;  3QB3 A;  2WKC A;  2I07 B;  4QCL A;  4KN4 C;  1FJG Q;  1HNZ Q;  3AMU A;  1HNX L;  4A3G B;  4FVM A;  1HQM C;  5FO7 B;  4XTC S;  1YZ6 A;  2B3G A;  3RN2 A;  1J8I A;  1WOC A;  2DN8 A;  5C44 H;  3EIV A;  2R7Z B;  5IGD A;  1STH A;  1EQQ A;  4HTH A;  3W1G A;  1CKN B;  2O5I C;  3CC7 A;  2CQO A;  2KCM A;  2PQE A;  3P20 A;  5I6W A;  2JEB I;  1EL0 A;  1RTO A;  4ZK9 B;  3FMC A;  3HOX B;  3QOJ A;  1CQF A;  1U4R A;  2PCF B;  1VQJ A;  3T53 B;  1L1O C;  1Y14 B;  4A3B G;  2N55 A;  1CA6 A;  3RZD B;  4QUF A;  1JOQ A;  1CQV A;  3A8I E;  2RF4 A;  3J7Y W;  1VQB A;  1YJ9 A;  4JG2 A;  2IX3 A;  1TS2 A;  2MUY A;  2Q8I B;  1WVL A;  1J5E Q;  4AYB E;  1SDF A;  1ONL A;  3GTK H;  5BN3 A;  4R4O A;  4J15 A;  4JI6 Q;  2NTS A;  3GTJ H;  4JBK A;  2VUM H;  1E1O A;  4IJL A;  1NR4 A;  4QMG A;  5I9P A;  3AFP A;  2O2L D;  1GD7 A;  1E3P A;  3M3Y H;  1EOT A;  3S17 H;  2R7F A;  1O7I A;  3R3O A;  1S72 A;  4HN7 A;  4X3K A;  3SHL A;  5CC4 A;  2F52 A;  3CAM A;  3I4N H;  3A55 A;  2HCC A;  4PMW A;  1E22 A;  2K05 A;  4LWC A;  5EKK A;  1I4X A;  4DUY L;  3T1H Q;  4DR1 Q;  2E2D C;  2NUC A;  1LTT D;  3BYT B;  4CGY B;  2VW9 A;  5EBC A;  3UI2 A;  4KKT A;  5C4J H;  3VYR A;  2L4N A;  1VS0 A;  3G48 A;  3H0G H;  4RHR A;  2UXD L;  3ULP A;  1NE3 A;  5IYB G;  1C4Q A;  4C56 C;  1O78 A;  2WAQ G;  4DXF A;  2DJG C;  5CYU A;  1B70 B;  2ZXP A;  4ME5 A;  1HHV A;  3VA7 A;  2PZW A;  1XNQ Q;  3N6R A;  5LMN Q;  3PGZ A;  5M3M G;  4RKL A;  3MAQ A;  3CP0 A;  2KEN A;  3DM1 A;  3CME A;  3OMC A;  3MXN B;  1IBL L;  3H3V I;  3PV0 A;  3KF8 B;  3W3A A;  1SNC A;  2XGT A;  4XQJ A;  1K9M C;  3BDC A;  1LV9 A;  3PCO B;  2CH4 W;  1V8Q A;  4LUO A;  4DR5 L;  1QOH A;  2PO4 A;  4JW0 A;  2JP1 A;  3HS0 C;  3WWV A;  1WTQ A;  4KMU C;  3FEW X;  2K5Q A;  3K7A B;  3T16 A;  2EYM A;  5GAE C;  4DK6 C;  2D2C C;  4XYO A;  1NJI C;  4HED A;  4LUZ A;  4P71 A;  4R4C A;  3S1N H;  4DR7 L;  3GQB A;  1OXU A;  2EYL A;  2WB1 G;  1GXD C;  4B3M L;  4HJ9 A;  2HT1 A;  2AQ2 B;  2JA9 A;  3GTG H;  3GTO B;  1BXT A;  2PZT A;  4I7A A;  4DV0 Q;  2E2J B;  1EYD A;  3P75 A;  4KI0 A;  1EYC A;  2KBN A;  4C3I H;  2MQH A;  3OTO Q;  3M4O H;  4APV A;  1EQT A;  3MWY W;  3HP3 A;  1GM5 A;  5EQ0 A;  3QR8 A;  2NWG A;  1DXM A;  1MKH A;  4GNX A;  3TEH B;  4JCV E;  4DAP A;  2F0U A;  3PO3 G;  4A3J H;  2PMZ B;  3NWS A;  1Z6H A;  4MHE A;  2HHH Q;  3AEV A;  2B2T A;  1I5F A;  5IIF A;  4A3C H;  2Y0S G;  4LFC L;  2KJX A;  3IRB A;  4LW1 A;  5FO9 B;  2BH2 A;  4RA8 A;  3QOL A;  1MHW C;  1JB3 A;  4A3E G;  4QL5 A;  2K5N A;  2J7Z A;  3F1Z A;  2B8F A;  1NMG A;  3S14 H;  2G9H D;  4CJ2 C;  1IBM L;  3E3X A;  5BN5 A;  1W6K A;  1C0A A;  1CI3 M;  2CW0 C;  2WB1 B;  2CH4 A;  3PF5 A;  4MTK A;  2EYO A;  2IJ0 A;  2P5Z X;  1GJX A;  4NMZ A;  1IW7 D;  2ENB A;  4IJH A;  1C9O A;  1L2F A;  2PW7 A;  4GS3 A;  4DV1 Q;  1TT2 A;  3CC2 A;  2ICI A;  4HR7 B;  2R92 H;  4TRD A;  4KY5 A;  3E0E A;  5COY A;  2E2H H;  4BBS H;  3CKI B;  1M1K C;  1V43 A;  3ND8 A;  3MXG A;  4YY3 Q;  1LT5 D;  2BA1 A;  1FYC A;  1I94 L;  5C0X I;  2F0W A;  2PNH A;  4CBV A;  2MNA A;  3LNN A;  3PUW A;  1FGU A;  4OWT B;  3V2T A;  4HID A;  4X64 L;  3S15 H;  1I6H B;  4OWX B;  1HNZ L;  3GTL H;  4GKK Q;  1BCP D;  4ZUI A;  1CKO A;  5C3X A;  4JI2 L;  3K0X A;  4HMI A;  4QUC A;  5BN4 A;  2CQA A;  3HKZ B;  4O42 A;  1SJE D;  2K6A A;  3RN5 A;  4M8A A;  3NQT A;  1UEB A;  3FKI G;  3VR3 A;  5KGU A;  4QB4 A;  1EUJ A;  2YTX A;  4FXG C;  2K52 A;  4FO2 A;  1BKB A;  4BY1 H;  2OQK A;  4K5X A;  5JEA G;  2JA8 H;  3K5O A;  4FNF A;  3GV3 A;  3I4O A;  5DNF A;  4JI0 Q;  4L5S A;  4NB3 A;  2OWO A;  1VQ9 A;  4Q5V A;  2RQX A;  4EQN A;  3ERQ A;  3GDE A;  2ASB A;  4A3D H;  2Q2T A;  1SJH D;  4B3T Q;  1O80 A;  4LJZ C;  2UXC L;  4A3M B;  1J5E L;  4JI4 Q;  1PH6 A;  4IUU A;  1ICF B;  2RBM A;  1GKH A;  4J1M A;  4KKS A;  3A5U A;  1F2M A;  5IP7 H;  1A62 A;  2ZJR A;  3B6Y A;  4U67 3;  4O2D A;  2K5W A;  3SK5 A;  4BBR H;  2F0V A;  4LF6 Q;  4GKJ Q;  5IT9 c;  4POG A;  1EQR A;  2A5H A;  1FVI A;  1MJE A;  2Z4I A;  3VYS A;  3ITP A;  4XYQ A;  1W2B A;  5M5Y H;  2I5L X;  3IAY A;  1XTC D;  3MZ5 A;  4DKA C;  3DWQ A;  3KF6 A;  2AQ3 B;  1SRU A;  3CCV A;  1O7Z A;  1FNW A;  1EY6 A;  3IKJ A;  4U68 A;  1I6V C;  1BF4 A;  3CRK C;  1RCV D;  1JWU D;  1STY A;  1PH3 A;  1YBY A;  2E75 C;  2N3S A;  3FVQ A;  4AQY L;  4R1J A;  3MFY A;  1SNO A;  1BOS A;  3P1H A;  5C6A A;  5DLQ E;  2JA7 B;  1L1O A;  4LUV A;  2PMZ E;  1D1K A;  2RCF A;  1NR2 A;  2A1A A;  3K57 A;  2NZO A;  3PUZ A;  3KBG A;  4DAY B;  3I4M B;  2K28 A;  4IQZ A;  3CD6 A;  1S5F D;  2R7D A;  3SK4 A;  1F9P A;  1HUM A;  3BVZ A;  5FOB B;  1EY8 A;  4BXX G;  2F0J A;  1XNQ L;  4DV2 Q;  1WCM G;  3C46 A;  1HA6 A;  5LMN L;  1Q1E A;  2AUK A;  2V1C C;  1M90 C;  1WYD A;  1XXG A;  3MC0 B;  1ICW A;  1OXX K;  1AP0 A;  1UE1 A;  4IN3 A;  4JI5 L;  4KTA A;  4OO1 I;  3CCR A;  3DXJ C;  2EQS A;  4PG3 A;  3BJU A;  4HMJ A;  2H5X A;  3HZX A;  1PZI D;  1VQE A;  2H4O A;  2CKZ B;  2FMC A;  4K5V A;  2D0O A;  2PZU A;  3I7F A;  1FNU A;  4R8I A;  1Y1V G;  1EU3 A;  1U4M A;  4IPD A;  5H1S E;  3NBH A;  3MA2 B;  4JVZ A;  1E24 A;  2BE5 C;  5C4X H;  3PUY A;  2JA5 G;  3NQI A;  3S2H B;  3HOY H;  2KEE A;  3WDN A;  3F2D A;  1VQC A;  1BQQ T;  1VCI A;  2B39 A;  4K2K A;  3EN2 A;  2JQO A;  1STG A;  4K8I A;  1WTV A;  2IHF A;  5DAU A;  5M3F B;  3HOU G;  2QIL A;  1SE3 A;  4OX9 Q;  4DV3 L;  4C3H B;  5GAH C;  3NWT A;  4FP5 D;  3KDF A;  1Q81 C;  3OTO L;  1MI2 A;  3TP7 A;  1HFN A;  3A8J E;  3S9W A;  3RNU A;  3NP8 A;  1DOM A;  1IL8 A;  3S1M H;  3E6Z X;  2EY6 A;  3HKZ E;  3U4Z A;  4X6A H;  1CZW A;  3PO2 G;  1BO0 A;  3I55 A;  3MXU A;  1PTO D;  3E9H A;  4UHV A;  1SFO B;  3VR6 A;  1V1P A;  1GOZ A;  1QCB D;  3J80 i;  1X3Q A;  1B3A A;  2KUM A;  4O0A A;  2ZXR A;  2A73 B;  4A93 H;  2KEC A;  2PQA B;  4K14 A;  2HCI A;  3KLS A;  3A8K E;  5D65 A;  5KND A;  4A3I H;  1X6O A;  5C5M A;  1Y1W G;  3OHX C;  3ICE A;  3TRZ A;  4A3K G;  1T5E A;  1N8R C;  3CMA A;  3S1Q H;  2BE5 D;  3E5S A;  4LNQ A;  4B9X A;  4DA2 A;  5C4Z A;  5AJ3 L;  1CSP A;  2R61 A;  1IBL Q;  1AN8 A;  5L37 A;  4QIW B;  2QA4 A;  3HOV G;  3HRZ C;  2EY1 A;  1PHJ A;  1CTM A;  1JWM D;  3S1R B;  2JA6 G;  5HGQ A;  5IYC G;  4P2C B;  1D8L A;  5EPJ A;  1PRT C;  1BR9 A;  2IX1 A;  3VYT A;  3QJY A;  4ZUJ A;  2IX0 A;  1N33 Q;  1TWH H;  4DR5 Q;  2VB3 X;  2F0S A;  1A3V A;  3HEJ A;  4NP5 A;  3H3V H;  1UE5 A;  3J80 L;  2NVT H;  4DV5 L;  1TU2 B;  1KDC A;  2VY3 A;  3J80 E;  3HOU B;  2AKW B;  5J1Z A;  3NBI A;  3U4V A;  5C3E G;  4DV6 L;  5I4D A;  5EAY A;  3HOZ H;  4DR7 Q;  1PH4 A;  2WII B;  1K8G A;  4F8M A;  5M5W B;  1GUS A;  5A2Q L;  3DHQ A;  3JC6 6;  3RZO B;  1PTO F;  1QUQ B;  1RIP A;  2IL8 A;  3D3R A;  4YY3 L;  2I46 A;  2RVL A;  5A2Q E;  4Y7N H;  3J81 i;  4UP9 A;  5T1I A;  1DGS A;  5FLM H;  5E4X A;  1CT1 D;  3HOW G;  3BVM A;  4LK1 C;  3R2I A;  4JI1 L;  1HR0 L;  1WI5 A;  3TZU A;  1N34 L;  2OCE A;  4X66 Q;  2L12 A;  4CKB A;  2HDM A;  4GKK L;  1SMY D;  5JVH 3;  4KD3 A;  1S5B D;  2EE1 A;  1K8A C;  3QG1 A;  3N52 A;  3RLO A;  4ZAI A;  1SYG A;  5AFW A;  5E7N A;  4DK0 A;  1BVS A;  4KN7 C;  3J81 L;  4JI0 L;  5EKI A;  2OEO A;  3OYY A;  4K2L A;  5IGB A;  2F0G A;  2L1B A;  2UUB Q;  3CQZ B;  3EFX D;  3S24 A;  1XPR A;  3J81 E;  1SE8 A;  4DR3 L;  3P7J A;  5GRO A;  4A3F B;  1TS3 A;  4UAI A;  4IUQ A;  1QVF A;  2HQL A;  1B8A A;  2J4X A;  1SN8 A;  4JI4 L;  1LTL A;  4IZ8 A;  4C3J H;  1X3P A;  4H7B A;  3M4Q A;  1VQK A;  1H9S B;  3OWE B;  4LF5 L;  2R3Z A;  1R9T H;  2VQE L;  3UE1 A;  3CCM A;  1XTD A;  2E2I B;  4OWW B;  4LF6 L;  2ICE C;  3CXC A;  5JJI A;  2QEJ C;  5C44 G;  3TSS A;  2SEB D;  2JE6 I;  4UDU C;  1PLF A;  1YNX A;  4L5Q A;  3X3M A;  4J8Q A;  3NHH A;  3TBI B;  3L3O C;  3H3V C;  4JBW A;  1I94 Q;  4RGT A;  5IY0 A;  4PMC A;  3UE0 A;  4XT3 B;  2B8G A;  4X64 Q;  3S16 B;  3DM3 A;  1R4Q B;  5C0X H;  2RSO A;  5M9O A;  4JI2 Q;  1YIJ A;  1KNE A;  1X3F A;  5C0X J;  2UU9 Q;  3HOX H;  3TS2 A;  1ESF A;  2NVQ B;  3I91 A;  4PZ6 A;  3RZD H;  3C3L A;  2VUM G;  1NNX A;  4DV2 L;  2RDG A;  4DK3 C;  1QNU A;  3RUZ A;  2E74 C;  4H13 C;  2E5L L;  3MHB A;  4KHZ A;  3FRP B;  4GOP B;  1QZG A;  1IYV A;  2JYO A;  1Y8N B;  1VQM A;  5KNC A;  2SDF A;  1SYD A;  4IPC A;  3ER0 A;  1SBB B;  2OTJ A;  5KRU A;  1X54 A;  2IT1 A;  3CCQ A;  1X9N A;  4PZ8 A;  4FYD A;  3I4N G;  2UXC Q;  4K6D A;  4R4Q A;  2K50 A;  3A74 A;  1ZKO A;  1K8O A;  1JIC A;  2EYF A;  1HUN A;  3U58 A;  4KJO A;  2YYZ A;  2MP1 A;  4HIM A;  1QIL A;  2CVR A;  3H0G G;  1K0S A;  1ENA A;  1ZYR C;  4WFN 3;  4CKC A;  4QY7 A;  4FF2 A;  2V4D A;  2MO1 A;  2QEX A;  4DNR B;  3IFD A;  2N49 A;  3NE5 B;  4OX9 L;  3OW7 A;  4IFD I;  1GUT A;  1TS5 A;  3ULJ A;  3CHB D;  2N88 A;  1Q12 A;  5K5P A;  1WJJ A;  4AQY Q;  2FHT A;  1V1O A;  3HFZ B;  1STA A;  4EQO A;  3C1F A;  3E0J A;  5F2D A;  2L55 A;  3CF5 A;  2ZT9 C;  1JJ2 A;  1IKL A;  3AB9 A;  4OIJ A;  2NVY B;  1XPU A;  3ULL A;  3SGI A;  2L9H A;  1UE7 A;  3M3Y B;  3S17 B;  4A3B B;  1D2B A;  4YWM A;  1O7L A;  5EKL A;  4DR2 L;  4OHJ A;  4CKE A;  1B53 A;  3D4D A;  4ZKC B;  1VQD A;  1EZ6 A;  1N36 Q;  1CZG A;  1X65 A;  3D4R A;  3JAM i;  1UE6 A;  3GTQ B;  3AYH B;  4OON A;  4JI5 Q;  1S5D D;  1A6X A;  1BCP B;  1X3E A;  1Y69 U;  1JWS D;  3K7A H;  1HCZ A;  4DXG A;  1KL9 A;  1LLR D;  5A35 A;  1G2S A;  1PFN A;  3KBX A;  4GZY C;  4P74 A;  1N33 L;  4BA1 I;  1G29 1;  2F3W A;  4C3I G;  4OO1 H;  3BDL A;  1F9Q A;  3U50 C;  3J81 c;  3RMH A;  3LWE A;  2Q2H A;  3OMG A;  3PMF A;  4YCW A;  2HUG A;  3ERO A;  4N8F A;  2E2J H;  3D31 A;  3ND9 A;  4JBJ A;  2VXW A;  3FHW A;  2NZ1 D;  2DNC A;  4A3J G;  3JAM L;  1JOK A;  3S2D B;  1G51 A;  1I4G A;  1EYA A;  3JAM E;  4A3C G;  1Q1B A;  3PIP A;  5ELF A;  2KCN A;  2RDH A;  1E2Z A;  5KIX A;  4DV3 Q;  1Q7Y C;  3Q23 A;  1F77 A;  3CPF A;  2NN6 I;  2FJ2 A;  1Q3L A;  5KEE A;  4DNI A;  1PMR A;  2F0L A;  1IHZ A;  3NEL A;  4DV7 Q;  4DK1 A;  2WAQ B;  2AWO A;  5IGE A;  1PZJ D;  4X66 L;  2YTY A;  4DFA A;  4LF8 Q;  5M3M B;  4JYA L;  1IYJ B;  1VDZ A;  5D3D A;  4EGV A;  1I3Q B;  3K8A A;  4YCV A;  2MO0 A;  3IFT A;  1GUG A;  4DNT B;  1HQR D;  1TWF B;  1KDA A;  1JE5 A;  1AZQ A;  4YHH Q;  4N8X 1;  4IPH A;  2OF1 A;  2QF7 A;  1YEZ A;  4UP8 A;  5E4W C;  1HPC A;  1I4Q A;  2UUB L;  2J0T D;  5AJ3 Q;  3WOE A;  4DPG A;  5JVG 3;  2R92 G;  1DOL A;  1TWG H;  2M9V A;  4P72 A;  4BBS G;  2Z6B A;  3NPP A;  1LUZ A;  5IP9 H;  1MJC A;  3STB C;  2VZA A;  1STE A;  1PV4 A;  2FFK B;  1G6P A;  3SEB A;  4DF7 A;  2DY8 A;  5K36 H;  5C4H A;  4DV5 Q;  2EYJ A;  2F0F A;  2AWN A;  2YV5 A;  5C5L A;  2A69 C;  4DV6 Q;  1XJV A;  1TWC B;  2WFW A;  2VQF Q;  1OXT A;  4TKO B;  2RDF A;  5CGK A;  1G2T A;  1U4L A;  3PIO A;  3VYU A;  3BZC A;  4ALP A;  3LWU A;  2D9U A;  2KCC A;  4K0K L;  1PFM A;  2PYK A;  1JT8 A;  1VQF A;  3I73 A;  5HY6 A;  2F3I A;  4BY1 G;  1I6H H;  2JA8 G;  3PO3 B;  3BZK A;  4RG1 A;  1MGS A;  2F0O A;  3W1B A;  2C5C A;  4J6H A;  4JI1 Q;  2PPB C;  5LMU L;  1I50 H;  4G4K A;  4F87 A;  1HR0 Q;  4IAL A;  1N34 Q;  4LAA A;  1Q46 A;  2Y0S B;  3DLL A;  2A6E C;  4A3D G;  1B9N A;  1KAA A;  4KV6 A;  4OIK A;  2IPK D;  1EIH A;  1GVP A;  2UU9 L;  2RKS A;  4A3E B;  1PA6 A;  4JI8 Q;  3D6C A;  4E6I A;  2JK8 A;  2LFN A;  3TP8 A;  5IP7 G;  3GTM B;  1DON A;  1N9W A;  1H9K A;  5HGT A;  2CW0 D;  2K01 A;  4BBR G;  3L2P A;  2N8N A;  2UXB L;  1I4P A;  2GVB A;  4G57 A;  4A3M H;  4K8J A;  3UDF A;  4V0B A;  4DR3 Q;  2R93 G;  1PTO B;  5I6Y A;  1A2T A;  5CV8 A;  4X62 Q;  4ME3 A;  1XNR L;  5I2X A;  3J7A F;  2ZTC A;  1CUK A;  4LF9 L;  4BY7 H;  4LF5 Q;  1K73 C;  2B2W C;  2JSO A;  1YJN A;  3KOJ A;  3M4P A;  1DZ1 A;  2VQE Q;  4B3S L;  2X69 A;  2WIN B;  4DU9 A;  5GAD C;  2R93 H;  2A68 C;  2A6E D;  5JPM C;  4TSS A;  1YVC A;  4KK7 A;  4C2M B;  3QWN A;  4HSV A;  1BCP F;  3I72 A;  4PQX A;  5G3L D;  1JQY D;  4V19 0;  1P8L A;  3CRL C;  3F8T A;  2JA7 H;  4TVA B;  2EIF A;  3I4M H;  3H94 A;  2F4V Q;  2SNS A;  1QJO A;  4KJN A;  2F03 A;  4HAE A;  3FKI B;  5CMD A;  1NAP A;  4RGO S;  1HNW L;  3T51 B;  4TQU S;  2N78 A;  1ESR A;  4XT1 B;  4BBR B;  1RL2 A;  4HJA A;  4N9P A;  1KAW A;  1BBX C;  3KFU A;  2EYP A;  4RHS A;  1EU4 A;  1SNP A;  5C4X G;  4K5W A;  1WTX A;  5M5Y B;  1AH9 A;  3DEO A;  4LF4 L;  2ZJQ A;  3F2C A;  2L15 A;  2L5T A;  3HOY G;  1WFQ A;  1N36 L;  4L8J A;  2XRS D;  1KLG D;  2E5L Q;  3TP5 A;  3O13 A;  3I4L A;  1Y8O B;  2BH8 A;  5DM6 3;  2KHS A;  5IE8 A;  3FPU B;  4JV5 Q;  4GNX B;  3I70 A;  2D62 A;  2WB1 E;  3S2H H;  1XX8 A;  5CV4 A;  1AFP A;  1EYG A;  4HSP A;  4HJ7 A;  1AE3 A;  4DV4 Q;  2F0P A;  3DUZ A;  5IGC A;  1AW7 A;  4GN4 B;  4RGM A;  1ENF A;  1EY0 A;  5M3F H;  1EQV A;  4AH6 A;  3VR4 A;  4C3H H;  4CJ0 B;  5FLX L;  1TWA B;  1SR3 A;  2XSC A;  1X32 A;  3PQI A;  2D0P A;  5FLX E;  4A93 G;  1V1Q A;  1GHK A;  2DJF C;  4X65 L;  4A3I G;  2NB0 A;  3L9A X;  4PZ7 A;  1PFB A;  1J9O A;  4R4I A;  4DV7 L;  2KA7 A;  2RA4 A;  1LAC A;  2XNA C;  1AEX A;  3SDZ A;  4I7Z C;  1CA5 A;  3MEF A;  4NXM L;  4DUZ L;  3RD4 A;  2IHE A;  1MSG A;  4YWL A;  4LF8 L;  4AYB G;  4IFD H;  1WCM B;  2A8V A;  1A3T A;  4IO9 A;  3DMU A;  1K3B C;  2ZM6 Q;  4YWK A;  1DOK A;  2WV6 D;  3OW2 A;  2Q2U A;  4WJW A;  2MPM A;  3Q6S A;  1QB5 D;  4BS9 A;  5ELC A;  2CHB D;  4DR2 Q;  1M4V A;  3MTS A;  1D5Z C;  4YHH L;  5J3B A;  3S1R H;  2YU9 B;  5EJW A;  1Y1V B;  3HOZ G;  1JR0 D;  4DR6 Q;  4RMF A;  1RTN A;  3QIA A;  4CDC C;  3G7L A;  1EWC A;  3CCU A;  4HJ8 A;  1WD1 A;  1GO3 E;  1A15 A;  2JA5 B;  1X56 A;  1CSQ A;  1ZEQ X;  4UP7 A;  1WTO A;  1LTS D;  4IUT A;  3BG3 A;  4P75 A;  3CW2 C;  3R8B A;  1U4P A;  1L0X B;  4KHP L;  3H15 A;  5FLM G;  4G7H C;  4JBM A;  4XQQ A;  3NEN A;  1KHI A;  1X3G A;  3RLF A;  5M5W H;  3NTI A;  5COR A;  1SE4 A;  3GP7 A;  4G7O C;  1IXR A;  3RZO H;  2VQF L;  4Y52 H;  2JN4 A;  3PUX A;  2ID0 A;  3KLR A;  5M5X B;  4XQN A;  1KC8 C;  5TSS A;  4WJ4 A;  4CHT B;  1N32 L;  3PO2 B;  4DR4 L;  5IOC A;  2O5J C;  5JAV A;  1SND A;  4GLV B;  2QW7 A;  1LM0 A;  4ZYS A;  3CCL A;  2NN6 H;  3A7A B;  1Y1W B;  1KQS A;  2K33 A;  2MGS A;  4JYA Q;  3K58 A;  3F2B A;  4A3K B;  3I3C A;  5DEH A;  4C3J G;  2WAC A;  2B2Y C;  4JI8 L;  1PRT D;  2UUC L;  3HOV B;  1TVX A;  3CQZ H;  3KF6 B;  4KD4 A;  2K14 A;  2JA6 B;  3T56 B;  5LMN W;  1NY4 A;  2MHV A;  2LXK A;  2EXZ A;  4R4T A;  1PYS B;  3E9I A;  1MBY A;  1VMP A;  2Z6K C;  3MXN A;  4XIG S;  5ELB A;  2NVX B;  4NXN Q;  3KF8 A;  4A3F H;  3K0Y A;  1GUN A;  1TKW B;  2B63 G;  1T5X D;  3F2U A;  4RWS C;  1L1O B;  1NCV A;  4LMQ D;  4O1N A;  3OIP A;  3FDT A;  3I90 A;  4JOI C;  2EJG C;  1HZ9 A;  1E7Z A;  5C3E B;  3T1Y Q;  1EWH A;  1KXL A;  1U0L A;  2Z8L A;  5LHY 1;  4X62 L;  2E8G A;  4LFA Q;  2E2I H;  3OSO A;  3AU7 A;  3H91 A;  1K8M A;  2JJQ A;  3NXW A;  2AHO B;  3UDX A;  5C0X G;  4NKL A;  2B63 H;  1XPO A;  3HOW B;  2IWH A;  5NUC A;  3T13 A;  4EVO A;  1ILP A;  3HOX G;  1RHP A;  2KHJ A;  3EVQ A;  4K0K Q;  1RJT A;  1K83 B;  5HUR A;  3S16 H;  4RCN A;  4KY6 A;  2H1E A;  4A3G H;  2HIV A;  4C1N K;  1IBK L;  3OIQ A;  5LMU Q;  4C3J B;  4PV1 C;  2F0I A;  2F4V L;  3NBH B;  1CFM A;  3M7G A;  3PUV A;  3DWA A;  1RKN A;  2NVQ H;  2R7Z H;  2ES2 A;  1LO5 D;  1D6E C;  2VL6 A;  3MVV A;  4KKU A;  1LT4 D;  4Q0F A;  3BS1 A;  1YNJ C;  5I2Y A;  2OXP A;  3GTP B;  2EYH A;  3PIO 3;  3A5Z B;  2TMP A;  2UUA L;  1VF5 C;  4DGZ A;  3UDG A;  1ASY A;  1I4H A;  3LX0 A;  4K6L A;  2LKV A;  3KDF B;  1GUW A;  1QZH A;  4QIW E;  2B2W A;  3TME A;  2F0Q A;  2UXB Q;  5JPN C;  4B3R Q;  1C8C A;  2Q8T A;  3L7Z C;  2AMC B;  4JV5 L;  1LT3 D;  2LXJ A;  1TY2 A;  4A3L H;  1QG7 A;  3WOF A;  2F0K A;  3CCJ A;  5CR3 A;  1EOV A;  1YNN C;  4FXK C;  1V1P B;  1XNR Q;  3CPW A;  1G91 A;  5C44 B;  5IYD H;  1STB A;  4DV4 L;  1YJW A;  4LF9 Q;  1VF7 A;  3D4W A;  1CK1 A;  3V96 A;  4RAU C;  5IGG A;  2PI2 E;  3TN2 A;  3Q22 A;  1L0Y B;  1EY4 A;  4B3S Q;  1ROD A;  4X3U A;  2Q8R E;  4H44 C;  1TII D;  5LL6 X;  2QGQ A;  4NDX A;  2E76 C;  1RD9 D;  2DNE A;  3K7U C;  3J80 c;  1YNJ D;  2IW3 A;  1SYE A;  4ABN A;  1ET9 A;  1FL0 A;  1Y8P B;  2ZXO A;  3R93 A;  3OOC A;  1HR0 W;  2K5V A;  2KCT A;  2F0T A;  2SOB A;  4P73 A;  2VNU D;  2KOL A;  2NVY H;  5D3I B;  2IY5 B;  3GTK B;  1S40 A;  4A3B H;  4DAM A;  3GTJ B;  2VUM B;  2GN5 A;  2NZH A;  1CKM A;  1HNW Q;  2BOS A;  1B9M A;  3C1E A;  3SE0 A;  1EIY B;  2ZM6 L;  2HDL A;  1P16 A;  2KQ3 A;  1JJC B;  4A76 A;  4OO1 G;  3U9O A;  2KHI A;  2KED A;  2A74 C;  2HD3 A;  2I5M X;  4MTN A;  3GTQ H;  2EXD A;  5FJ8 G;  1H9M A;  1H9R A;  1YNN D;  2XRQ D;  3KLS X;  4HIK A;  4GLX A;  1FGB D;  1M8A A;  3X3N A;  4LF4 Q;  2QCP X;  5ELO A;  3I4N B;  5JJK A;  1UUP A;  4PMB A;  4JK1 C;  1A8V A;  4RCO A;  4QGU A;  2L11 A;  1ASZ A;  1Q86 C;  5FO8 B;  4DR6 L;  1UWV A;  4YIJ A;  3SR1 A;  1MD2 D;  1SRO A;  1G6Z A;  1ZYR D;  1YIT A;  1EFW A;  5C4J B;  1SLJ A;  4IPG A;  3H0G B;  4G7Z C;  4DN4 M;  3W5O A;  3VR2 A;  1OO9 B;  1S5C D;  1JJG A;  1RDP D;  2QKI C;  1VQ8 A;  1NTG A;  1OXV A;  4GOP C;  4LFB Q;  4R8N A;  5FJ8 H;  2I5H A;  1HTP A;  3URY A;  1O7Y A;  2DUD A;  3S2D H;  3GTO H;  3EA6 A;  1WD0 A;  4IUV A;  1I4R A;  1B1Z A;  4ULL A;  1K3R A;  2B29 A;  4XXE A;  4ID6 A;  2F4I A;  5IT9 L;  4X3T A;  1JB7 A;  2EOT A;  4M1U B;  5J22 A;  5IYB H;  5KYL A;  4IUN A;  5IT9 E;  2NYZ D;  5BR8 L;  2RCN A;  1LT6 D;  4L63 B;  4X65 Q;  1EWI A;  1SEB D;  4KLK A;  5M3M H;  3G4S A;  4I65 A;  4ZCK A;  1I3Q H;  4DAY A;  3A54 A;  4OEL B;  3ERS X;  3ZJY C;  1HXY D;  4NXM Q;  4DUZ Q;  4EQ5 A;  5T1G A;  4MNO A;  1D5M C;  1HZA A;  1T9H A;  1JC7 A;  1STN A;  1VQ7 A;  1TWF H;  5IP9 G;  5EPK A;  3KLW A;  3V05 A;  3S1N B;  4JI3 Q;  2LY7 A;  3EJI A;  4RH6 A;  3IL8 A;  1F2L A;  3K59 A;  5K36 G;  3GTG B;  1IW7 C;  5EBD A;  2RSN A;  4ZRZ A;  3U9S A;  1A0I A;  1ZXT A;  2LMC B;  3I2Z A;  1QVG A;  3BZD B;  3H09 A;  4NXN L;  1HTL D;  1Q8K A;  3MFG A;  4C3I B;  1XWE A;  1LTI D;  3M4O B;  4IUR A;  1H9J A;  1PH8 A;  2EZV A;  1ML0 D;  2Z4H A;  3T1Y L;  3K80 C;  3T4A C;  1A63 A;  1SYB A;  4KHP Q;  1F2Y A;  4YCU A;  4IOA A;  4NPS A;  1IYU A;  1TWC H;  3TDQ A;  4A3J B;  1IKM A;  3Q0A A;  3Q8D A;  4LFA L;  3SK6 A;  2X6L A;  3HKZ G;  1BCP C;  4LF7 L;  1UEA B;  2BDN A;  2HQE A;  2Q2I A;  3QO2 A;  3K5M A;  1PZK D;  2KVM A;  1D5X C;  1ILQ A;  5ELE A;  3M85 A;  3W2D A;  4QJF A;  1Q82 C;  1HH2 P;  2B2U C;  2MJ8 A;  1W6J A;  3PO3 H;  4KHV A;  5C3W A;  1J6Q A;  4UPA A;  4HCS A;  3S14 B;  2B2Y A;  1TWG B;  1XMQ L;  1N32 Q;  1U5K A;  1IL2 A;  2Z9H A;  4DR4 Q;  2OT2 A;  4L5R C;  1VQ4 A;  1CM9 A;  1LYL A;  2WP8 J;  4ILW A;  2Z6K A;  2B2V C;  4A3M G;  3HGB A;  3BVG A;  3GO5 A;  4A3E H;  2NTT A;  1SYF A;  4GN5 A;  1E0B A;  3GTM H;  1UAP A;  1VQP A;  4HIO A;  1BDO A;  4JOI A;  2PQA A;  3I8Z A;  2OTL A;  1XMO L;  4IOC A;  1WTR A;  4L6T B;  3ONA B;  2UUC Q;  1B4O A;  3STB D;  2R92 B;  4FF1 A;  4X3S A;  5ISR A;  3TZD A;  4BY7 G;  4BBS B;  1LTR D;  3A0J A;  1YI2 A;  2E2H B;  1B50 A;  3PF4 A;  5IWA L;  3KJP A;  1PTO H;  4PNY A;  1UNS A;  5ELD A;  2FXQ A;  1FJG L;  4OEM B;  1KIX A;  1PXU A;  1S5E D;  1TQO A;  2JXM B;  1LAB A;  2A69 D;  1WTH A;  2JEA I;  4B3R L;  3TP6 A;  1I50 B;  5JJZ A;  4GN3 B;  4HCE A;  1II3 A;  3S15 B;  1E2W A;  3GTL B;  1MIU A;  1KNA A;  1PYB A;  2O4X A;  4FF3 A;  2JA7 G;  3AQQ A;  1LTG D;  2K32 A;  3I4M G;  1EIG A;  1SXT A;  3R2T A;  4JI7 Q;  3CCE A;  1HRJ A;  4CJ1 B;  1BBU A; 
#chains in the Genus database with same CATH homology
 3K5L A;  2EPB A;  2QDB A;  3OPO A;  1SSO A;  2D5D A;  3DWP A;  4H0L C;  4BY1 B;  1LTB D;  2FMM A;  2JA8 B;  3NUC A;  1KAB A;  3KUP A;  4A3D B;  1A2U A;  1JE4 A;  2NBF A;  1SAP A;  3ZYY X;  5CV9 A;  5JEA H;  5JEA J;  3NK9 A;  4NW2 A;  3J7A V;  3D8G A;  1A3U A;  1Z7T A;  2K5D A;  1DCZ A;  5IOD A;  4BY7 B;  1BNZ A;  1DJR D;  2VB2 X;  1KLU D;  5DM7 3;  4ODG A;  2F3V A;  3NTK A;  1ET6 A;  1EZ8 A;  2R93 B;  4MN3 A;  4WRD A;  1JOR A;  3EQL C;  3K5N A;  1Q8I A;  2EY5 A;  1NUC A;  2Z1C A;  1GHJ A;  4DAV A;  3Q24 A;  4RGN A;  1OXS C;  4C3H G;  2K1B A;  4OL7 A;  1QWY A;  2GA4 B;  2XN9 C;  1SE2 A;  4ZLT F;  1DD2 A;  2A68 D;  1U9R A;  1F9R A;  1PRT B;  1H9S A;  2EDG A;  5LL6 S;  3C2P A;  2DY7 A;  1S4Z A;  5G3L F;  4RFB A;  5J39 A;  1HFG A;  4OGQ C;  1PTO C;  4IFD G;  1ENC A;  3CU7 A;  1C48 A;  4N9T A;  2FIN B;  1B44 D;  1XYI A;  2AUJ D;  4MIU A;  1DM0 B;  5IGF A;  4ZKB B;  5CV6 A;  1Z47 A;  3D6W A;  2AQ1 B;  1EFI D;  3NSW A;  5CBE E;  2M00 A;  1EEI D;  4FF4 A;  5FK9 C;  3MXP A;  5C4X B;  3BDO A;  2TSS A;  2R6G A;  1TS4 A;  2EJM A;  3HOY B;  4IFD J;  2K04 A;  5I9O A;  1D1I A;  3DEP A;  2K7V A;  1EY7 A;  1KTK A;  3NTH A;  3HG9 A;  2BDO A;  1EY5 A;  1PDQ A;  2X6G A;  3OWF A;  5CBA E;  1E2V A;  3SK8 A;  1FNV A;  1MSH A;  3MEH A;  1CHQ D;  2SNM A;  1NSN S;  2F0H A;  3VA5 A;  3S1M B;  2A6H C;  1GUO A;  4R9W A;  3FPP A;  1SNM A;  2F0E A;  4A93 B;  1SMY C;  2PW5 A;  4Z9C B;  1WTW A;  4A3I B;  2NN6 G;  1G8Z D;  5EPL A;  2F0N A;  3S1Q B;  5D14 A;  2B2T C;  5E3F A;  1EEF D;  4F88 A;  4AYB B;  1FD7 D;  3VR5 A;  5CV7 A;  1TWH B;  5EGT A;  1TR5 A;  1QNK A;  2G9D A;  1KDB A;  1PYW D;  2NVT B;  3K6O A;  1CHP D;  1F9S A;  2WKD A;  5FKA C;  3GV6 A;  1RF2 D;  1VMC A;  4RKB A;  1JOO A;  3SVM A;  1SNQ A;  3HOZ B;  3A7L A;  2BA0 A;  4FXD A;  2F1M A;  4C1N I;  2A6H D;  4BWG B;  2XVS A;  3M4Y A;  1QE6 A;  2EJF C;  3H6M A;  3GD7 A;  1DYQ A;  3PIP 3;  4EQP A;  2XWJ B;  4Y7N B;  1WTP A;  2EY2 A;  4KY7 A;  2XIW A;  3KK7 A;  4BA2 I;  2B2U A;  2C9O A;  2EVB A;  2XWB B;  1AZP A;  1JCK B;  1EY9 A;  3G6J B;  3A56 A;  3SXH A;  1LTA D;  2B2V A;  5KNB A;  4QF4 A;  4IUP A;  4B08 A;  3M7N A;  4B9W A;  2F0D A;  4ZQ3 A;  4F7X A;  1SYC A;  1Q90 A;  1PRT F;  2BCO A;  4XDX A;  1HA5 A;  2K03 A;  4WOR A;  1FR3 A;  2PNR C;  1TY0 A;  1BUV T;  2F0M A;  1R9T B;  2M2L A;  2B63 B;  3BYY B;  2LS0 1;  5JOB A;  1R4P B;  5CV5 A;  5KYI A;  5E1F A;  4S3S A;  2L0C A;  1F2Z A;  1B2T A;  3QB3 A;  2WKC A;  2I07 B;  4QCL A;  4KN4 C;  3AMU A;  4A3G B;  4FVM A;  1HQM C;  5FO7 B;  4XTC S;  1J8I A;  2DN8 A;  2R7Z B;  5IGD A;  1STH A;  4HTH A;  2O5I C;  2PQE A;  3P20 A;  5I6W A;  2JEB I;  1EL0 A;  1RTO A;  4ZK9 B;  3FMC A;  3HOX B;  3QOJ A;  1CQF A;  1U4R A;  2PCF B;  3T53 B;  2N55 A;  1CA6 A;  3RZD B;  4QUF A;  1JOQ A;  1CQV A;  3A8I E;  3J7Y W;  2IX3 A;  1TS2 A;  2MUY A;  2Q8I B;  1WVL A;  1SDF A;  1ONL A;  5BN3 A;  2NTS A;  1NR4 A;  4QMG A;  5I9P A;  2O2L D;  1EOT A;  3R3O A;  4HN7 A;  4X3K A;  3SHL A;  5CC4 A;  3A55 A;  2HCC A;  4PMW A;  2K05 A;  5EKK A;  1I4X A;  2E2D C;  2NUC A;  1LTT D;  3BYT B;  4CGY B;  5EBC A;  3UI2 A;  4KKT A;  3VYR A;  2L4N A;  4RHR A;  1C4Q A;  4C56 C;  1O78 A;  4DXF A;  5CYU A;  2ZXP A;  4ME5 A;  1HHV A;  3VA7 A;  2PZW A;  3N6R A;  4RKL A;  3MAQ A;  3DM1 A;  3OMC A;  3PV0 A;  3W3A A;  1SNC A;  4XQJ A;  3BDC A;  1LV9 A;  1V8Q A;  1QOH A;  2PO4 A;  2JP1 A;  3HS0 C;  1WTQ A;  4KMU C;  3FEW X;  2K5Q A;  3K7A B;  3T16 A;  2EYM A;  2D2C C;  4XYO A;  4HED A;  3GQB A;  1OXU A;  2EYL A;  1GXD C;  2AQ2 B;  3GTO B;  1BXT A;  2PZT A;  2E2J B;  1EYD A;  3P75 A;  4KI0 A;  1EYC A;  1EQT A;  3MWY W;  3HP3 A;  5EQ0 A;  2NWG A;  1DXM A;  4DAP A;  2F0U A;  2PMZ B;  3NWS A;  1Z6H A;  4MHE A;  2B2T A;  5IIF A;  2KJX A;  5FO9 B;  4RA8 A;  3QOL A;  1JB3 A;  2J7Z A;  2B8F A;  2G9H D;  4CJ2 C;  5BN5 A;  1W6K A;  1CI3 M;  2CW0 C;  2WB1 B;  2EYO A;  2IJ0 A;  1GJX A;  4NMZ A;  1IW7 D;  2ENB A;  2PW7 A;  1TT2 A;  2ICI A;  4HR7 B;  4TRD A;  4KY5 A;  5COY A;  3CKI B;  1V43 A;  3ND8 A;  3MXG A;  1LT5 D;  2BA1 A;  1FYC A;  5C0X I;  2F0W A;  4CBV A;  3LNN A;  3PUW A;  3V2T A;  1I6H B;  1BCP D;  4ZUI A;  5C3X A;  4HMI A;  4QUC A;  5BN4 A;  2CQA A;  3HKZ B;  4O42 A;  1SJE D;  2K6A A;  4M8A A;  3NQT A;  3VR3 A;  5KGU A;  4QB4 A;  4FXG C;  4FO2 A;  4K5X A;  5JEA G;  3K5O A;  4FNF A;  3GV3 A;  5DNF A;  4Q5V A;  2RQX A;  4EQN A;  3ERQ A;  1SJH D;  1O80 A;  4LJZ C;  4A3M B;  4IUU A;  2RBM A;  4J1M A;  4KKS A;  1F2M A;  4U67 3;  2K5W A;  3SK5 A;  2F0V A;  2A5H A;  2Z4I A;  3VYS A;  3ITP A;  4XYQ A;  3IAY A;  1XTC D;  3MZ5 A;  3DWQ A;  2AQ3 B;  1O7Z A;  1FNW A;  1EY6 A;  3IKJ A;  4U68 A;  1I6V C;  1BF4 A;  3CRK C;  1RCV D;  1JWU D;  1STY A;  2E75 C;  3FVQ A;  3MFY A;  1SNO A;  1BOS A;  3P1H A;  5C6A A;  2JA7 B;  1D1K A;  1NR2 A;  3K57 A;  3I4M B;  3PUZ A;  3KBG A;  2K28 A;  4IQZ A;  1S5F D;  3SK4 A;  1F9P A;  1HUM A;  3BVZ A;  5FOB B;  1EY8 A;  2F0J A;  3C46 A;  1HA6 A;  1Q1E A;  2AUK A;  1XXG A;  3MC0 B;  1ICW A;  1OXX K;  1AP0 A;  4IN3 A;  4KTA A;  4OO1 I;  3DXJ C;  4HMJ A;  3HZX A;  1PZI D;  2H4O A;  2FMC A;  4K5V A;  2PZU A;  1FNU A;  4R8I A;  1EU3 A;  1U4M A;  3NBH A;  3MA2 B;  2BE5 C;  3PUY A;  3NQI A;  3S2H B;  2KEE A;  3WDN A;  1BQQ T;  1VCI A;  2B39 A;  4K2K A;  1STG A;  4K8I A;  1WTV A;  5DAU A;  5M3F B;  2QIL A;  1SE3 A;  4C3H B;  3NWT A;  4FP5 D;  1MI2 A;  3TP7 A;  1HFN A;  3A8J E;  3S9W A;  3NP8 A;  1DOM A;  1IL8 A;  3E6Z X;  2EY6 A;  1CZW A;  1BO0 A;  3MXU A;  1PTO D;  1SFO B;  3VR6 A;  1V1P A;  1GOZ A;  1QCB D;  1X3Q A;  1B3A A;  2KUM A;  2ZXR A;  2A73 B;  2KEC A;  4K14 A;  2HCI A;  3KLS A;  3A8K E;  5D65 A;  5KND A;  5C5M A;  3OHX C;  1T5E A;  2BE5 D;  3E5S A;  4B9X A;  4DA2 A;  5C4Z A;  2R61 A;  1AN8 A;  4QIW B;  3HRZ C;  2EY1 A;  1CTM A;  1JWM D;  3S1R B;  4P2C B;  5EPJ A;  1PRT C;  1BR9 A;  2IX1 A;  3VYT A;  3QJY A;  4ZUJ A;  2IX0 A;  2VB3 X;  2F0S A;  1A3V A;  3HEJ A;  4NP5 A;  3J80 L;  1TU2 B;  1KDC A;  3J80 E;  3HOU B;  5J1Z A;  3NBI A;  5I4D A;  2WII B;  4F8M A;  5M5W B;  1GUS A;  5A2Q L;  3DHQ A;  3RZO B;  1PTO F;  3D3R A;  2IL8 A;  2I46 A;  2RVL A;  5A2Q E;  5T1I A;  5E4X A;  1CT1 D;  3BVM A;  4LK1 C;  3R2I A;  3TZU A;  2L12 A;  4CKB A;  2HDM A;  1SMY D;  5JVH 3;  4KD3 A;  1S5B D;  2EE1 A;  3QG1 A;  3N52 A;  4ZAI A;  1SYG A;  5AFW A;  4DK0 A;  4KN7 C;  3J81 L;  5EKI A;  2OEO A;  5IGB A;  4K2L A;  2F0G A;  2L1B A;  3CQZ B;  3EFX D;  3J81 E;  3P7J A;  4A3F B;  1TS3 A;  4UAI A;  4IUQ A;  2J4X A;  4IZ8 A;  1X3P A;  4H7B A;  1H9S B;  3OWE B;  2R3Z A;  2E2I B;  2ICE C;  2QEJ C;  3TSS A;  2SEB D;  2JE6 I;  4UDU C;  1PLF A;  3X3M A;  4J8Q A;  3NHH A;  3TBI B;  3L3O C;  3H3V C;  4JBW A;  4RGT A;  4PMC A;  4XT3 B;  2B8G A;  3S16 B;  1R4Q B;  5C0X H;  2RSO A;  5M9O A;  1KNE A;  5C0X J;  2NVQ B;  1ESF A;  3I91 A;  3C3L A;  2RDG A;  1QNU A;  3RUZ A;  2E74 C;  4H13 C;  3MHB A;  4KHZ A;  3FRP B;  1IYV A;  2JYO A;  1Y8N B;  5KNC A;  2SDF A;  1SYD A;  1SBB B;  5KRU A;  2IT1 A;  4FYD A;  4K6D A;  1ZKO A;  1K8O A;  1JIC A;  2EYF A;  1HUN A;  4KJO A;  2YYZ A;  2MP1 A;  1QIL A;  2CVR A;  1ENA A;  1ZYR C;  4WFN 3;  4CKC A;  4FF2 A;  2V4D A;  4DNR B;  3IFD A;  3NE5 B;  3OW7 A;  4IFD I;  1GUT A;  1TS5 A;  3CHB D;  2N88 A;  1Q12 A;  5K5P A;  2FHT A;  1V1O A;  1STA A;  4EQO A;  3C1F A;  3E0J A;  5F2D A;  2L55 A;  2ZT9 C;  1IKL A;  3AB9 A;  4OIJ A;  2NVY B;  2L9H A;  3M3Y B;  3S17 B;  4A3B B;  1D2B A;  1O7L A;  5EKL A;  4OHJ A;  4CKE A;  1B53 A;  3D4D A;  4ZKC B;  1EZ6 A;  1CZG A;  3D4R A;  3GTQ B;  1S5D D;  1A6X A;  1BCP B;  1Y69 U;  1JWS D;  1HCZ A;  4DXG A;  1LLR D;  5A35 A;  1G2S A;  1PFN A;  3KBX A;  4GZY C;  4BA1 I;  1G29 1;  2F3W A;  4C3I G;  4OO1 H;  3BDL A;  1F9Q A;  3RMH A;  3LWE A;  3OMG A;  3PMF A;  2HUG A;  3ERO A;  3D31 A;  3ND9 A;  2VXW A;  2NZ1 D;  2DNC A;  3JAM L;  1JOK A;  3S2D B;  1I4G A;  1EYA A;  3JAM E;  1Q1B A;  5ELF A;  2KCN A;  2RDH A;  1E2Z A;  5KIX A;  3Q23 A;  1F77 A;  2NN6 I;  2FJ2 A;  1Q3L A;  5KEE A;  1PMR A;  2F0L A;  1IHZ A;  4DK1 A;  2WAQ B;  2AWO A;  5IGE A;  1PZJ D;  4DFA A;  5M3M B;  1VDZ A;  5D3D A;  4EGV A;  1I3Q B;  3IFT A;  1GUG A;  4DNT B;  1HQR D;  1TWF B;  1KDA A;  1AZQ A;  2OF1 A;  2QF7 A;  5E4W C;  1HPC A;  1I4Q A;  2J0T D;  3WOE A;  5JVG 3;  1DOL A;  2M9V A;  3NPP A;  1STE A;  2FFK B;  3SEB A;  4DF7 A;  2DY8 A;  5K36 H;  5C4H A;  2EYJ A;  2F0F A;  2AWN A;  5C5L A;  2A69 C;  1TWC B;  1OXT A;  4TKO B;  2RDF A;  5CGK A;  1G2T A;  1U4L A;  3VYU A;  3LWU A;  2D9U A;  2KCC A;  1PFM A;  2PYK A;  3I73 A;  3PO3 B;  1MGS A;  2F0O A;  2C5C A;  4J6H A;  2PPB C;  4F87 A;  4G4K A;  4IAL A;  4LAA A;  2Y0S B;  2A6E C;  1B9N A;  1KAA A;  4KV6 A;  4OIK A;  2IPK D;  1EIH A;  2RKS A;  4A3E B;  3D6C A;  4E6I A;  2LFN A;  3TP8 A;  3GTM B;  1DON A;  1H9K A;  5HGT A;  2CW0 D;  2K01 A;  1I4P A;  4G57 A;  4K8J A;  4V0B A;  1PTO B;  5I6Y A;  1A2T A;  5CV8 A;  5I2X A;  3J7A F;  2B2W C;  2JSO A;  1DZ1 A;  2X69 A;  2WIN B;  4DU9 A;  2A68 C;  2A6E D;  5JPM C;  4TSS A;  4KK7 A;  4C2M B;  3QWN A;  4HSV A;  1BCP F;  3I72 A;  4PQX A;  5G3L D;  1JQY D;  4V19 0;  3CRL C;  3H94 A;  2SNS A;  1QJO A;  4KJN A;  2F03 A;  4HAE A;  3FKI B;  5CMD A;  1NAP A;  4RGO S;  3T51 B;  4TQU S;  1ESR A;  4XT1 B;  4BBR B;  4N9P A;  1BBX C;  2EYP A;  4RHS A;  1EU4 A;  1SNP A;  5M5Y B;  4K5W A;  1WTX A;  3DEO A;  2L5T A;  4L8J A;  2XRS D;  1KLG D;  3TP5 A;  3O13 A;  3I4L A;  1Y8O B;  5DM6 3;  2KHS A;  3FPU B;  3I70 A;  2D62 A;  1XX8 A;  5CV4 A;  1AFP A;  4HSP A;  2F0P A;  3DUZ A;  5IGC A;  1AW7 A;  4RGM A;  1ENF A;  1EY0 A;  1EQV A;  3VR4 A;  4CJ0 B;  5FLX L;  1TWA B;  2XSC A;  1X32 A;  5FLX E;  1GHK A;  2NB0 A;  3L9A X;  1PFB A;  1J9O A;  2KA7 A;  2RA4 A;  1LAC A;  2XNA C;  1AEX A;  3SDZ A;  4I7Z C;  1CA5 A;  3RD4 A;  1MSG A;  4IFD H;  1WCM B;  1A3T A;  3DMU A;  1DOK A;  2WV6 D;  4WJW A;  2MPM A;  3Q6S A;  1QB5 D;  4BS9 A;  5ELC A;  2CHB D;  1M4V A;  3MTS A;  1D5Z C;  2YU9 B;  5EJW A;  1Y1V B;  1JR0 D;  1RTN A;  3QIA A;  3G7L A;  1EWC A;  1WD1 A;  1A15 A;  2JA5 B;  1ZEQ X;  1WTO A;  1LTS D;  4IUT A;  3BG3 A;  3R8B A;  1U4P A;  1L0X B;  4G7H C;  4XQQ A;  3RLF A;  3NTI A;  5COR A;  1SE4 A;  3GP7 A;  4G7O C;  3PUX A;  2ID0 A;  3KLR A;  5M5X B;  4XQN A;  5TSS A;  4CHT B;  3PO2 B;  5IOC A;  2O5J C;  5JAV A;  1SND A;  4ZYS A;  2NN6 H;  3A7A B;  1Y1W B;  2K33 A;  2MGS A;  3K58 A;  4A3K B;  3I3C A;  5DEH A;  4C3J G;  2WAC A;  2B2Y C;  1PRT D;  3HOV B;  1TVX A;  4KD4 A;  2JA6 B;  3T56 B;  2MHV A;  2EXZ A;  2NVX B;  1MBY A;  1VMP A;  3MXN A;  5ELB A;  4XIG S;  3KF8 A;  3K0Y A;  1GUN A;  1TKW B;  1T5X D;  3F2U A;  4RWS C;  1NCV A;  4LMQ D;  4O1N A;  3OIP A;  3FDT A;  3I90 A;  2EJG C;  5C3E B;  1EWH A;  2Z8L A;  5LHY 1;  3OSO A;  3AU7 A;  3H91 A;  1K8M A;  3NXW A;  5C0X G;  4NKL A;  3HOW B;  2IWH A;  5NUC A;  3T13 A;  4EVO A;  1ILP A;  1RHP A;  3EVQ A;  1RJT A;  1K83 B;  5HUR A;  4RCN A;  4KY6 A;  2H1E A;  4C1N K;  3OIQ A;  4C3J B;  4PV1 C;  2F0I A;  1CFM A;  3M7G A;  3PUV A;  3DWA A;  1RKN A;  1LO5 D;  1D6E C;  3MVV A;  4KKU A;  1LT4 D;  4Q0F A;  3BS1 A;  1YNJ C;  5I2Y A;  2OXP A;  3GTP B;  2EYH A;  3PIO 3;  2TMP A;  1VF5 C;  4DGZ A;  1I4H A;  3LX0 A;  4K6L A;  2LKV A;  1GUW A;  2B2W A;  3TME A;  2F0Q A;  5JPN C;  1C8C A;  2Q8T A;  3L7Z C;  1LT3 D;  1TY2 A;  1QG7 A;  3WOF A;  2F0K A;  5CR3 A;  1YNN C;  4FXK C;  1V1P B;  1G91 A;  5C44 B;  1STB A;  1VF7 A;  3D4W A;  1CK1 A;  3V96 A;  4RAU C;  5IGG A;  3TN2 A;  3Q22 A;  1L0Y B;  1EY4 A;  1ROD A;  4X3U A;  2Q8R E;  4H44 C;  1TII D;  5LL6 X;  4NDX A;  2E76 C;  1RD9 D;  2DNE A;  1YNJ D;  2IW3 A;  1SYE A;  4ABN A;  1ET9 A;  1Y8P B;  2ZXO A;  3R93 A;  3OOC A;  2F0T A;  2SOB A;  2VNU D;  2KOL A;  5D3I B;  3GTK B;  3GTJ B;  2VUM B;  2BOS A;  1B9M A;  3C1E A;  3SE0 A;  2HDL A;  2KQ3 A;  4OO1 G;  3U9O A;  2KED A;  2A74 C;  1H9M A;  1H9R A;  1YNN D;  2XRQ D;  3KLS X;  1FGB D;  1M8A A;  3X3N A;  2QCP X;  3I4N B;  1UUP A;  4PMB A;  4JK1 C;  4RCO A;  2L11 A;  5FO8 B;  4YIJ A;  3SR1 A;  1MD2 D;  1G6Z A;  1ZYR D;  5C4J B;  3H0G B;  4G7Z C;  4DN4 M;  3VR2 A;  1OO9 B;  1S5C D;  1RDP D;  2QKI C;  1OXV A;  4R8N A;  1HTP A;  3URY A;  1O7Y A;  3EA6 A;  1WD0 A;  4IUV A;  1I4R A;  1B1Z A;  4ULL A;  4XXE A;  4ID6 A;  2F4I A;  5IT9 L;  4X3T A;  2EOT A;  4M1U B;  5J22 A;  5KYL A;  4IUN A;  5IT9 E;  2NYZ D;  1LT6 D;  4L63 B;  1SEB D;  4I65 A;  4DAY A;  3A54 A;  1HXY D;  5T1G A;  1D5M C;  1JC7 A;  1STN A;  5EPK A;  3V05 A;  3S1N B;  2LY7 A;  3EJI A;  4RH6 A;  3IL8 A;  1F2L A;  3K59 A;  5K36 G;  3GTG B;  1IW7 C;  5EBD A;  2RSN A;  4ZRZ A;  3U9S A;  1ZXT A;  2LMC B;  3BZD B;  3H09 A;  1HTL D;  3MFG A;  4C3I B;  1XWE A;  1LTI D;  3M4O B;  4IUR A;  1H9J A;  2EZV A;  1ML0 D;  2Z4H A;  3T4A C;  1SYB A;  1F2Y A;  1IYU A;  4A3J B;  3TDQ A;  1IKM A;  3Q0A A;  3SK6 A;  2X6L A;  1BCP C;  1UEA B;  2BDN A;  2HQE A;  3QO2 A;  3K5M A;  1PZK D;  2KVM A;  1D5X C;  1ILQ A;  5ELE A;  3M85 A;  3W2D A;  2B2U C;  2MJ8 A;  1W6J A;  4KHV A;  5C3W A;  4HCS A;  3S14 B;  2B2Y A;  1TWG B;  2OT2 A;  1CM9 A;  2WP8 J;  4ILW A;  2B2V C;  3HGB A;  3BVG A;  3GO5 A;  2NTT A;  1SYF A;  1E0B A;  1UAP A;  1BDO A;  3I8Z A;  1WTR A;  4L6T B;  3ONA B;  1B4O A;  2R92 B;  4FF1 A;  4X3S A;  5ISR A;  3TZD A;  4BBS B;  2E2H B;  1LTR D;  1B50 A;  1PTO H;  4PNY A;  1UNS A;  5ELD A;  1PXU A;  1S5E D;  1TQO A;  2JXM B;  1LAB A;  2A69 D;  2JEA I;  3TP6 A;  1I50 B;  5JJZ A;  4HCE A;  1II3 A;  3S15 B;  1E2W A;  3GTL B;  1KNA A;  4FF3 A;  2O4X A;  1LTG D;  2K32 A;  1EIG A;  1SXT A;  3R2T A;  1HRJ A;  4CJ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...