1LTSD

Refined structure of e. coli heat labile enterotoxin, a close relative of cholera toxin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1992-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltsD00
1S5BD 1RD9D 1LTBD 4RHSA 3OWEB 4RFBA 4RGMA 1XXGA 1S5DD 1KLUD 1LTSD 1UNSA 1JCKB 2NTSA 1BCPB 1KLGD 1SE4A 3R2IA 1SJED 2XN9C 3BYTB 4RHRA 1SE2A 2SEBD 1I4QA 2WV6D 3R2TA 1PZJD 2Z8LA 3TSSA 2QEJC 3DWAA 1I4XA 4ZYSA 3URYA 1BCPD 1ENFA 5D3DA 2O2LD 5ELEA 1LT3D 1T5XD 1TS5A 1LTAD 1PZKD 2AQ1B 1V1PA 1CHQD 1D6EC 1TY2A 4RGOS 1TS2A 1PRTD 3KLSX 1B1ZA 3BYYB 1LT4D 1ESFA 1L0YB 1PTOB 1LTGD 2ICIA 2XRSD 3MC0B 4RGTA 4BWGB 1EWCA 1L0XB 2IPKD 1BCPC 3DWPA 1STEA 3BZDB 1HQRD 1FGBD 1BCPF 1JQYD 3BVGA 1I4RA 4DXGA 1EFID 4K6LA 4Z9CB 1LT6D 1PYWD 2RDGA 4RH6A 2AQ3B 2J4XA 1LLRD 2NTTA 1I4GA 1JR0D 1QILA 1ET9A 1JWSD 3CHBD 1GOZA 1G8ZD 1CHPD 1FNVA 1HXYD 1CK1A 1EU4A 1EU3A 4O1NA 1DYQA 1LTID 4RCOA 1LTRD 2CHBD 2IJ0A 1M4VA 4L63B 1SE3A 2R61A 1PTOF 3BVZA 1D5XC 1PRTB 1S5CD 5FK9C 1HTLD 1AW7A 5TSSA 1CT1D 1SEBD 1TY0A 1TS3A 1D5ZC 5ELCA 1UUPA 1CQVA 1LT5D 4DXFA 2XRQD 5D3IB 1S5ED 1LTTD 1JWMD 4UDUC 1FNUA 1HA5A 5I4DA 1EEID 1PTOH 3EA6A 1DJRD 4RGNA 1EEFD 3SEBA 2G9HD 3EFXD 1PZID 5FKAC 1V1PB 2TSSA 2QILA 1PRTC 4L6TB 1RDPD 3BVMA 3O13A 1I4HA 1SJHD 4TSSA 1XTCD 3GP7A 5ELBA 4OHJA 1FD7D 1SBBB 1S5FD 1JWUD 3R8BA 1KTKA 1PRTF 1D5MC 5ELFA 4C56C 3V05A 1MD2D 1SXTA 1B44D 1F77A 1PTOC 1I4PA 1BXTA 1AN8A 2XNAC 1RF2D 3MFGA 1PTOD 3W2DA 1LO5D 1ET6A 1RCVD 2RDHA 2AQ2B 1V1OA 5ELDA 1TS4A 3DWQA 1FNWA
chains in the Genus database with same CATH superfamily
2O5JC 4JOIC 1CM9A 4JI5Q 1IHZA 4JI4Q 4LF8L 1OXUA 1UEAB 4PZ8A 2HQEA 2K75A 3K5NA 1XMOL 1FYCA 2D2CC 1STHA 2HCCA 5I9PA 4HN7A 3A8IE 2L1BA 1CA6A 2B2YC 3H0GB 2JA8B 3S14B 4IO9A 2UUCQ 4K6DA 1TXYA 4LMQD 1AEXA 5IYBH 2Q2IA 1BCPD 5JJIA 5D3DA 2WB1G 4ME3A 4R4OA 1T5XD 1TS5A 3OIPA 2PQEA 1L1OC 1FGUA 4DAMA 3GTPH 3H09A 4DR1Q 1Y8PB 4HJAA 1B2TA 1TWFH 4GN4B 2Q8IB 1N9WA 4DAVA 3TZDA 1JQYD 4QMGA 5M5XB 3S1NB 2ATWA 2NBFA 5C0XI 3G6JB 1PYWD 1YZ6A 2A5HA 3NE5B 2TMPA 5C3EH 3QG1A 1EU4A 1DYQA 3NTIA 4RCOA 2R7ZB 2CHBD 1M4VA 4B3SL 4IPDA 1U0LA 3J81L 3MXUA 4IJHA 4UP8A 4O0AA 1M1KC 4GKKQ 4BXXH 2XRQD 4R8NA 1HTPA 4N8X1 2CWAA 1TQOA 3SR1A 1VQCA 4HSVA 5A2QE 3U50C 5KNDA 2E2IB 4RGNA 2UXBL 1MKHA 1VS0A 4GNXB 5I2XA 2A6EC 3KLRA 4IJLA 3GTPB 4XQQA 1XNQL 4DV5Q 4LFBL 4YY3Q 1UE7A 1SDFA 5ELBA 1B4OA 3KDFA 2PZUA 3IL8A 3HZXA 1ILQA 1FD7D 1SNPA 1OXVA 3JAMc 2L4NA 1JWUD 3VYRA 5GADC 1I6HB 2HHHL 1EYCA 1I5FA 2WIIB 1O7YA 4OX9L 5M3FB 4KHVA 1AN8A 1WJJA 1VQHA 5C0XG 2MNAA 4B3RQ 4Y52H 1GJXA 3P20A 5I6WA 1WCMB 4KJOA 2B2WA 2F03A 1LTBD 2JYOA 1QZHA 1LABA 1EQRA 2ZXOA 1KAWA 4X3UA 4EQOA 4XQNA 2D9UA 3SGIA 1NMGA 4A3EB 4NDXA 1IBKQ 3X3MA 2EOTA 4RWSC 1BCPB 3R3OA 1K3BC 3CQZB 2L12A 5IGBA 1RIPA 4UP7A 4LF9L 4A3CH 3Q0AA 3S2DB 2CCZA 2R93G 3KF8A 1H9SA 1AE3A 2RCFA 2VQFL 3NP8A 2K5QA 1JE4A 3HOYG 5JJLA 3MXNB 2B2YA 1W2BA 4FYDA 4O2DA 1PZKD 4C3JH 3LX0A 5I2YA 1Z47A 3I73A 1X32A 3TBIB 2X6GA 2BH2A 2ZM6L 4AYBG 2OTJA 4ME5A 2PI2E 3PUXA 2JA5G 3E6ZX 3TZUA 1STEA 5M9OA 3OYYA 3BVGA 4OO1I 4Y7NB 2M00A 3H91A 3ICEA 4DV1L 1PH9A 4LFCL 3SVMA 1ET9A 3CHBD 4IFDI 1XWEA 2X69A 1CHPD 2LKVA 1EU3A 3BU2A 1HZ9A 5L37A 2JA7B 2KA7A 3FVQA 1I6HH 4JI0L 4C3IB 4IFDH 4FF3A 4FXDA 1UEBA 2PW5A 1P16A 2R6GA 2L15A 4ZKBB 4X64Q 3CKIB 3E9HA 1DXMA 3PO3H 1IW7C 3A55A 2ICEC 1AZPA 4QUFA 4KHPL 2HCIA 2L55A 4YCUA 4PMBA 2B29A 1Q46A 3L3OC 3WWVA 3CRLC 3NHHA 1OO9B 2BE5D 1EEFD 3M7NA 1FJGL 2AUKA 2G9HD 1ENCA 1W3SA 2ALYB 1IKMA 3TMEA 5HURA 2JA7G 4WFN3 1WTHA 3NQIA 4RMFA 4OEMB 4X62Q 3V96A 1KAAA 1KHIA 1VQJA 2DN8A 1S5FD 1S4ZA 1U4PA 5IWAQ 4H02A 1SNOA 3E0JA 1KDAA 2Z1CA 1PHJA 1SXTA 2MJ8A 4A3JH 3GDEA 5BN5A 4CJ2C 3PMFA 3GTLB 2CVRA 1V9PA 5C0XH 2F0UA 4A3JG 4C2MH 2EY5A 5M5XH 3FPPA 2N88A 5COYA 4CKBA 4X64L 2F0NA 5EQ0A 4PMWA 1LTSD 1JCKB 2MFIA 1KNAA 1ZKOA 4I7ZC 1STYA 2LSSA 2XTIA 4LAAA 3J7AF 2F3VA 1I50H 2SEBD 1B3QA 4NPSA 1I4QA 1PZJD 2Z6BA 3I91A 2Q2TA 3G7LA 3JC66 2O2LD 5AFWA 3JAME 1SLJA 2JN4A 2R92H 2B8GA 4A3DB 3ZYYX 2OQ0A 5G3LD 4YCVA 1B1ZA 3HOWB 3S2DH 2E2DC 1GUWA 1X3FA 2ICIA 2JA5B 1L0XB 1WVLA 2XWJB 4Q5VA 3M4OH 2DJFC 3D31A 3PQIA 4ZAIA 2UUAL 4BBSG 4DR7L 1X54A 2PZTA 1X56A 3FDTA 3EN2A 3S9WA 3RNUA 5CV8A 1T9HA 4JW0A 4A3KG 1NMFA 5CGKA 1I3QH 1YJ9A 2EY1A 3KDFB 1SYFA 1K8MA 1PMRA 5IODA 2UXBQ 1QOHA 5M3MB 1Y1WG 2PW7A 1D5XC 2L0CA 3M3YH 4BA1I 1HTLD 3I70A 1TY0A 1HPCA 4GNXA 2PNRC 1LT5D 1HCZA 1WD1A 1AFPA 3K59A 4OGQC 4MTKA 1YIJA 1UAPA 2I5HA 4C3IH 3PSIA 4BY7B 4IURA 5C0XJ 3PIP3 4JI3Q 5FLXE 1QB5D 1U5KA 1B3AA 4ZLTF 2VB2X 2K03A 2XIWA 5IYDH 1N34L 1XTCD 3S1QH 4KY6A 4A3LG 1SBBB 3QWNA 3HOXB 1Y1WH 4L8JA 5C4XH 4CDCC 2DY7A 4MHEA 1I4PA 3NWTA 4JYAL 2I5LX 2B2VA 3OW7A 1VMCA 1LO5D 1MIUA 3FKIH 1Y1VB 5C4ZA 3CCQA 2BA1A 5CV9A 2E2HB 1MSGA 2HIVA 1BF4A 2Z4HA 4IUNA 5A35A 4IQZA 1PV4A 4OWWB 4CJ1B 3I72A 3U4VA 3DLLA 4XYOA 3BYTB 1N36L 3PV0A 1QVCA 4S3SA 2JA6B 1DCZA 3I2ZA 3SK8A 4DK0A 1G91A 4ODGA 2AMCB 3BJUA 4G7HC 3J81j 4C1NI 2OT2A 3HGBA 4LUVA 4RKLA 2MHVA 1TS2A 3NBHA 2K7VA 3J7ZC 4ZRZA 2NVTH 1N34Q 2R7DA 2K32A 2LXKA 5CR3A 1VQMA 1EZ8A 2MGSA 1NUCA 1J5EQ 1VQLA 1BCPC 5JEAJ 3P1HA 3IAYA 3S2HB 3DXJC 5JPNC 2XGTA 3IFTA 3UI2A 5JAVA 3LGJA 5KNBA 1TWAB 1VQ5A 5EGTA 3IKJA 2H5XA 3S17H 2LFNA 3G6EA 2X6LA 3T56B 1MHWC 5ELNA 4L63B 3TRZA 2I5MX 3K8AA 1PTOF 5FLMG 3RN2A 3MFYA 4GLVB 1YHAA 3VR3A 2K04A 5FJ8G 4A3EG 4N8FA 3A5ZB 2ZTCA 4Q0FA 5IYDG 2FMCA 1E2VA 3J7YW 2IHFA 2VY3A 1DOLA 1XNRL 1EY0A 5AJ3Q 5DM73 2RA4A 5CC4A 3TP8A 3F2DA 5DNFA 2PZWA 4DR2L 1ENAA 1I50B 1HZAA 4TQUS 2KQ3A 4C1NK 4CKEA 3J81E 3I56A 1K3RA 4UY8C 2A68C 4DV4L 1HUNA 3M9BA 3Q22A 2B2UA 1EWIA 4R1JA 5KEEA 2L9HA 1WTPA 5C4XB 4C56C 2EXZA 2B8FA 1LM0A 5GAHC 4K0KQ 4X3SA 1D2BA 1QUQA 2JEBI 4AH6A 1Y14B 2XNAC 2UUBQ 1C0AA 1RF2D 2KVMA 3W2DA 4BY1G 3I8ZA 2DUDA 4V0BA 1STNA 4QQBX 2RKSA 3OWEB 4RG1A 4LF5L 1XTDA 3FP9A 3U58A 4XT3B 2EE1A 2NTSA 3M3YB 1WOCA 4YHHL 5FLXc 1X6OA 1Y8NB 4KHPQ 4JI6L 3MTSA 5M5WB 1VQKA 1PLFA 1WTQA 1JOKA 5I9OA 2VUMG 3I3CA 1H9JA 1L1OB 3DM3A 1I4XA 1TWGH 2ZJQA 3URYA 3S16H 4OIJA 1WYDA 1H9KA 3A8KE 4CDFC 2Y0SG 4F8MA 2MO0A 5M5WH 2Z9HA 4WJWA 4YWKA 1NE3A 1PH7A 3NQTA 1C8CA 3T16A 4DK6C 4A3EH 1KRTA 3HOUB 2XRSD 4NP5A 4XIGS 2KBNA 2F0JA 3TP7A 3S1RB 4KN4C 4KJNA 1IBLL 1TWHH 1F2ZA 5KNCA 2K14A 1XYIA 4JK1C 4N9TA 2SDFA 2EYMA 2FINB 2QDLA 3A56A 5C5LA 1HZBA 3IFDA 2J0TD 2DGYA 5KYIA 2G9DA 4DUYL 3W1GA 4C3HB 2JA6G 2HDLA 3CRKC 3H94A 2VS1A 1SRUA 1JT8A 1GHKA 4B3TL 3I55A 2IJ0A 3CF5A 1EY9A 1NCVA 1TWFB 4B9XA 2JQOA 1PRTB 5D14A 5IE8A 4X65L 2E75C 4U68A 3NWSA 1CT1D 3RZOB 1SEBD 1GM5A 1F9PA 1E0BA 5LMNL 3U9SA 1A62A 5IT9E 4C2MB 2EZVA 4JI3L 5G3LF 3NUCA 5I4DA 2XSCA 4YIJA 3EA6A 1DJRD 3EFXD 1V1PB 1HNWQ 1R4QB 5M3MH 2H1EA 3CCUA 1AE2A 1CSPA 1Q8IA 2B63B 5EBDA 1JJGA 1DM0B 4QF4A 1A8VA 5CMDA 2F52A 5IT9L 1WTVA 1EY7A 5LL6S 1VQ7A 1PFNA 1HZCA 1MI2A 3T1YL 1O7LA 3P7JA 2PMZB 1FNWA 3AYHB 3NPPA 5T1GA 2PCFB 3VR6A 2E5LL 4FDBA 2ZXPA 3RZOH 4XQJA 5LMNQ 3AFPA 5E4XA 2PMZE 3GO5A 4OIKA 3H0GG 4R9WA 2EXDA 4OX9Q 3R2TA 3AU7A 3J81c 3C46A 5C3WA 4FNFA 4R4CA 2BDOA 5EKLA 1W6JA 3TS2A 4LF7Q 1BR9A 1O78A 4DK3C 1QVFA 5ELEA 1GUSA 5KYLA 1BNZA 2AQ1B 2GN5A 1D6EC 2KCCA 3J81i 3H3VH 2WFWA 5HGQA 1WCMG 1LT4D 4DV6Q 4EVOA 2Z6KC 3BZDB 2E2HH 1J9OA 5IGFA 1TU2B 3U4ZA 1TWHB 2CQOA 5IGEA 3MZ5A 3T1YQ 4HIMA 1A3UA 3STBD 5C4JB 3PUYA 3NSWA 4GS3A 4QB4A 4A3IG 2LMCB 1ZYRD 1JB7A 3F2BA 2E2JB 1YHBA 4CBVA 3HOXH 4DU9A 3K5OA 3HOVH 1LTRD 1SE3A 5H1SE 3M4YA 1CUKA 1XNQQ 1CKNB 4DR2Q 1O80A 3L0OA 4ZKCB 1X3GA 4BBRG 4CGYB 1K0RA 1TWCH 3FPUB 4OL7A 1PTOH 1HQMC 3HOYB 5JEAG 1PH2A 3PO3B 1X3QA 1EIGA 3RD4A 3I4LA 3TP6A 3A7AB 4LUZA 1STGA 1BOSA 3H0GH 2SNMA 1UWVA 3MEHA 3O13A 3KBXA 3VR2A 3GP7A 3I4NH 1VQ4A 3I4MH 2F0MA 4DF7A 3S2HH 1NAPA 2JA9A 3EBEA 1VQ9A 2I0QA 2F0DA 4MN3A 1D5MC 2B2TC 1PTOC 3NXWA 5EKIA 4KN7C 3HOZG 1PTOD 1YNNC 3QJYA 1VQGA 2A69C 3DWQA 1S5BD 1EOVA 4NB3A 4RHSA 2M2LA 3ER0A 2EDGA 2FJ2A 3ZJYC 3SXHA 1RTNA 2D5DA 2DJGC 2OTLA 4DKAC 1RTOA 1K28A 2WAQB 1KDBA 1CKMA 2HHHQ 4MNOA 4DGZA 1WFQA 4DAYB 4NW2A 5IYCH 3SE0A 5E4WC 4OO1G 5K5PA 2MPMA 2Z8LA 3BDCA 1IW7D 1A3VA 2F3WA 1F9RA 4HSPA 1HRJA 1N33L 5C44H 4KD4A 4KY7A 4IPGA 3HS0C 4L5SA 5LMNW 1DOMA 2IX0A 3T13A 3MC0B 4BWGB 1EWCA 1G51A 2ZTDA 3GTGH 1FGBD 2OQKA 1JOQA 2Z6KA 3D3RA 4PG3A 3K80C 2NN6G 4K2KA 4BS9A 3C1EA 1VQAA 1JWSD 4R4IA 2SNSA 4B3TQ 2CW0D 2YYZA 2F0HA 3BZCA 1CK1A 1M90C 4X65Q 2E76C 3TN2A 1B9MA 1JICA 3FEWX 3BS1A 3G48A 1PH5A 4DV0Q 3K0XA 1PDQA 4I7AA 1HA6A 1T5EA 4NXNL 3I7FA 4OWTB 3SDZA 1DGSA 3VDYA 3C1FA 1OXSC 1EIFA 1UE1A 4R4QA 3VR5A 4EQNA 4PV1C 3V2TA 3MEFA 1I6VC 2FHTA 4XYQA 2I46A 5LMUQ 5EPJA 4LFAQ 2NVXH 4G7ZC 3GTQH 3BVMA 1E7ZA 1SN8A 2MQHA 3LWEA 2VQEQ 1X9NA 2AUJD 2F4VQ 1E22A 1O7IA 2JXMB 4DK1A 2K5NA 5A2QL 2CQAA 5K36G 1B50A 2YV5A 3KLSA 2R92B 3TREA 2RHSB 2NN6I 1V43A 2KHSA 4FF4A 1B44D 1IKLA 1YNND 5ELOA 4ZK9B 1F9QA 1RCVD 2ZT9C 1DONA 4RCNA 5D65A 1EEID 2PQAA 1YJWA 1VQ8A 1TR5A 3AQQA 2XWBB 4F88A 4MIUA 3PCOB 1JORA 1EYGA 4AYBB 1EFWA 1SJED 2F0SA 4RHRA 4A3MH 5J22A 1EQTA 2K05A 1HUMA 4KK7A 2DY8A 3TEHB 1EY8A 4JI8Q 4LFAL 1NY4A 4JC0A 1EYAA 4MTNA 1C7YA 5C6AA 4K8JA 3TQYA 3GV3A 5CV7A 2F4VL 1EY4A 3E3XA 4KD3A 1IL2A 4A3JB 2FMMA 2KUMA 4FF1A 2F4IA 2IHEA 4ILWA 4A3BB 1AP0A 4IPCA 3J80L 3K7UC 2KCTA 2EYFA 1SNMA 1Y69U 3IRBA 4KKSA 3F8TA 3SK4A 4LWCA 3T53B 3T1HQ 1PFSA 4PQXA 3FKIG 2EPBA 3HOZH 2F0TA 3A74A 4YWLA 1JOOA 3H3VC 4IALA 1KABA 3GTOB 1A2TA 1Q8KA 2AWOA 2KEEA 1RJTA 3QR8A 1JMCA 4A3LH 4FVMA 2PPBC 3PO2H 4JI8L 5FO7B 4A3FB 3OMGA 3PIOA 1HA5A 2ZJPA 2YU9B 1DD2A 2EY6A 3M7GA 1D7QA 2Q8TA 4C3IG 1R9TB 5FKAC 4UP9A 4IFDJ 4QCLA 1PRTC 4KV6A 3D6CA 4KLKA 1CQFA 1QVGA 1JJCB 2VQEL 3RLFA 3K6OA 2HIXA 2ASBA 4L5TA 4DA2A 1GO3E 1YVCA 3KK7A 3K5MA 1BVSA 2GVBA 1G2TA 3L7ZC 4XT1B 4P72A 1PRTF 4IUTA 4DAYA 1L2FA 3GTQB 1N8RC 5IGCA 1G291 2FFKB 4EQPA 3STBC 2EVBA 4DFAA 4KTAA 2OEOA 5EAYA 3K7AH 1P8LA 5F2DA 1SYEA 3MXPA 2KJXA 4RGMA 1XXGA 2VZAA 1SR3A 1KLUD 2F1MA 3M85A 3CC7A 1VQPA 2F0PA 1SE2A 2B63H 4UAIA 1PH4A 4TVAB 4DR4Q 3DUZA 2R92G 3I4MB 4A3IB 3QO2A 4L5RC 3HKZE 3RLNA 5HY6A 4AQYL 2L5TA 1BBUA 3HKSA 1LTAD 2A19A 1VQDA 4OO1H 4IN3A 1PH3A 2UXCL 4G7OC 3MHBA 2A73B 1SE8A 2OXPA 2ENBA 3GD7A 3HEJA 1IZ6A 1U9RA 2K5WA 1MGSA 2RDGA 2D62A 4JG2A 4HJ7A 1Y1VG 2A8VA 2A69D 4APVA 4A3KH 2K5VA 2NN6H 5ISRA 4JBKA 3HOZB 1J8IA 3AMUA 1X3EA 4BA2I 4WORA 4JVZA 2QDBA 4KHZA 3NEMA 1EWHA 1QUQB 4JOIA 1AW7A 2AWNA 1W6KA 1TS3A 3FKIB 3NBIA 4NXNQ 3CW2C 1SMYC 3HG9A 5D3IB 2E2JH 2EQSA 2D0PA 1JWMD 4LUOA 4V190 5FOBB 4DV1Q 3S24A 1G6ZA 2F0WA 1PVOA 4WRDA 1TWAH 1E2WA 4JYAQ 4DR7Q 5I6YA 1JC7A 3HOUG 1NTGA 3S17B 4BY7G 2H4OA 2QILA 4ABNA 4L6TB 5LHY1 1RDPD 4JBMA 1SJHD 2J7ZA 4GLAC 5E1FA 4GN5A 4K5XA 4HMIA 2RVLA 1XMQL 2UXDQ 1HR0L 1N36Q 1B9NA 5EPKA 2UUAQ 4X3KA 1IBKL 1K9MC 4B3ML 4PNYA 1MBYA 5FLXL 2O5IC 1NJIC 3KBGA 1SFOH 4GN3B 2JA6H 4DUZL 2IT1A 1YITA 1NSNS 3CCRA 2E2IH 2VNUD 4DNIA 4FF2A 2KCMA 1RODA 3CPWA 1TS4A 3FHWA 1FVIA 2Z0SA 2IY5B 1EIYB 2QA4A 4H13C 2NZHA 5C4XG 1BBWA 2NVQH 2C5CA 4B9WA 3W3AA 1HNXL 1IBMQ 1V1QA 3CPFA 4POFA 2IWHA 1GHJA 2N78A 3R2IA 3HFZB 1Q3LA 1CKOA 3K0YA 3DMUA 5IWAL 3Q24A 1H9SB 2O4XA 1VF5C 3N6RA 3U9OA 4J8QA 1BUVT 2PYKA 3DWAA 4A3GG 4B08A 4ZYSA 5C44B 2K6AA 1LYLA 1RKNA 1ENFA 3N52A 3QOLA 4K5WA 1GUNA 3OMCA 1PXUA 4LFCQ 4A3CG 4K2LA 1CHQD 4DR6L 2CFMA 1X3PA 3SHLA 5BR8Q 3KF6B 3KLSX 2ZM6Q 2HD3A 4OXPA 3OSOA 1L1OA 3T51B 2IX3A 1A63A 1IYJB 5GAGC 4LK1C 3S1NH 2QEXA 3AEVA 3HOVG 4DUZQ 1PA6A 1PH1A 4JBWA 3HOXG 4R8IA 1U4LA 5DEHA 2J4XA 1PH6A 4LF7L 2N3SA 3ND8A 1G8ZD 2A6HD 1VQ6A 1F2MA 3WDNA 5CBAE 4DV5L 4LFBQ 4A93B 3W1BA 2JA8H 1IL8A 4QUCA 2C35B 3MAQA 2IL8A 2ZXRA 5KGUA 5DLQE 2QW7A 3BVZA 3MXGA 2BOSA 4JCVE 3LWUA 4GOPC 4ZCKA 2ZJRA 2LXJA 1EL0A 1Z6HA 2NWGA 1B8AA 1SYBA 2NVTB 4UDUC 2EYHA 4A3BH 3VYUA 4JI5L 4JI0Q 1PYSB 2KEDA 5C3XA 1GKHA 1S3OA 2CH4W 4H44C 2R93H 5IYCG 3S15B 3S16B 5T1IA 2K33A 3KF8B 1EIHA 4JI6Q 3PUZA 1MSHA 2RF4A 1HR0Q 4YHHQ 3K81C 3RMHA 5ELFA 4HTHA 3H6MA 3KFUA 4HCEA 1VQOA 1D1KA 3EQLC 1TWGB 1KC8C 3Q23A 1ET6A 2RDHA 4MZ9A 1Y1VH 3H15A 2KENA 2K52A 4PZ7A 2K01A 5JJZA 4A3DH 1J5EL 4RFBA 3KF6A 3JAMi 3JAML 1IBML 3CXCA 2B2WC 2RQXA 2OF1A 4YY3L 3I4MG 3RLOA 2ID0A 2A74C 1F2YA 3S1MH 1R9TH 2XN9C 4DV2L 2Q2HA 1E2ZA 4QL5A 3UDIA 2DNCA 2JA7H 4GKJQ 5EJWA 3FRPB 3CAMA 2BH8A 3GTKH 4L5QA 3ONAB 2PI2A 1Y8OB 1XJVA 4P75A 2F0GA 2B63G 1BO0A 1PRTD 4DPGA 4LF8Q 4GOPB 4JV5Q 1LTGD 2A68D 4DN4M 4RAUC 5BN4A 2FXQA 2B2VC 2JE6I 1I4RA 4DXGA 3CC4A 4Z9CB 3F2UA 2N8NA 1EOTA 2MO1A 1NNXA 2NTTA 1Z9FA 1CSQA 1ZYRC 2NUCA 3CQZH 1GOZA 2E8GA 5JVG3 4O1NA 2F3IA 3J7AV 4GOPA 1Q1BA 3G4SA 1S5CD 1K0SA 5FK9C 3L2PA 4C3HG 3W5OA 1D1IA 1QNKA 1F2LA 2WAQG 1VCIA 3HOWG 2JEAI 4CHTB 1UUPA 4DXFA 2K28A 4IUPA 1S5ED 1SROA 1G6PA 3D0FA 4UHVA 3K5LA 5CBEE 1R4PB 4BBSB 1FR3A 1GUTA 3RUZA 4FXGC 2F0LA 1YEZA 3J7A5 4B3MQ 3SEBA 4JI7L 4KKUA 4DV3L 4JI2Q 1VQEA 3S1MB 2VUMH 4FXKC 4AQYQ 3J80c 4DUYQ 2UXCQ 1XX8A 1TWCB 2WACA 1Q81C 5JOBA 1MJEA 4B3SQ 4LF9Q 3HRZC 5IP9H 4XDXA 3R8BA 1LTLA 2F0KA 3DEOA 1F77A 3I4OA 4NXML 5AJ3L 1CKNA 4X66L 3QB3A 4DNRB 2AQ2B 5IIFA 5LMUL 5EBCA 1TIID 1ASYA 1KL9A 1VDZA 3C2PA 2Q8RE 3M4QA 4DV4Q 1S40A 3HKZG 4NKLA 4BBRB 3E9IA 4DR3Q 1KLGD 5KRUA 1A6XA 1YNJD 2R93B 3CD6A 4K14A 3D6WA 3CCJA 1VF7A 2RSOA 2JJQA 1Q1EA 1SSOA 1Q12A 3UE0A 1RL2A 5M3FH 3MA2B 2BE5C 3PUVA 2UUCL 4JI4L 2F0IA 1BBXC 1FL0A 3GTMB 3OWFA 1YHQA 4HEDA 1GUOA 5C4HA 5FO9B 5LL6X 4JBJA 5JPMC 3BYYB 1ZXTA 1PTOB 1KQSA 1J6QA 2IW3A 3WOFA 1BCPF 4ZQ3A 3GTJH 2MUYA 1JJ2A 1LT6D 5NUCA 2K5HA 4DV7L 4A4IA 5C3EG 2Z4IA 4N9PA 3OPOA 1CZWA 3GTGB 2B2UC 2KOLA 4DV0L 3NTHA 1ESRA 3DHQA 3VYTA 3PF4A 4CJ0B 3HKZB 2AKWB 4G4KA 1I3QB 1GD7A 4E6IA 1HR0W 1XNRQ 2B3GA 1AH9A 2F0QA 2ZTEA 3GTKB 4A3BG 3NBHB 1K8OA 3RN5A 1XPUA 2A6ED 2UU9L 1GUGA 1I94L 4ALPA 3CCVA 4IPHA 1CTMA 3HOWH 3K57A 2KHIA 2HUGA 3ERSX 4J1MA 2SOBA 3OTOL 2QF7A 4IFDG 5E7NA 2R3ZA 1KD1C 3V05A 1OXXK 2JA8G 1CI3M 4O42A 2BA0A 2WAQE 4P73A 2QGQA 3SK5A 3I90A 2EJFC 4BY1H 4LF4Q 2KECA 4XXEA 3NTKA 2HT1A 1VQFA 2GVAA 1PFMA 2HQLA 4YWMA 3BG3A 1YNJC 1UNSA 3D8GA 3ITPA 3TS0A 5IP7H 3EJIA 5CORA 1TT2A 1IXRA 4H7BA 2WV6D 3J80E 4AYBE 1QJOA 1ICWA 1QNUA 1EZ6A 4KY5A 4TKOB 3K7AB 1WTOA 2EYOA 1ILPA 1XPRA 4YCWA 1BKBA 2JK8A 2EIFA 2WKDA 4IOCA 1KDCA 2V4DA 4DR3L 2E5LQ 1ESFA 1TVXA 3VA7A 3UE1A 4RGTA 4CDEC 2IPKD 1IYUA 2CW0C 4R4TA 5CYUA 5FLMH 3H3VI 2F0FA 1HNZQ 2AQ3B 5C4JH 1K8GA 3DM1A 1LLRD 4LF6Q 1SFOB 2E74C 2WKCA 4KMUC 4IUVA 4WJ3M 3CCEA 1EQQA 3NELA 4IOAA 1LTID 3GV6A 2K4KA 4HAEA 3CCSA 4BBSH 4F7XA 1NBWA 4M1UB 3RZDB 3A7LA 1OTCA 2CKZB 1NR2A 1DOKA 3GTLH 1CQVA 3Q8DA 4A3FH 1ML0D 1STBA 1LACA 1E1TA 1FNUA 3HOUH 4HIKA 2N49A 4HIOA 4GKJL 2GA4B 4FO2A 1QCBD 3PGZA 4C3JB 2K50A 5J3BA 4GZYC 2IX1A 3GTOH 4TRDA 3MXNA 4TSSA 4P74A 1V8QA 4LW1A 1MJCA 5IY0A 4DV2Q 3OIQA 2OCEA 1N33Q 3HOVB 1K73C 1A3TA 5IOCA 4LF6L 3QOJA 1MD2D 2VQFQ 3QIAA 3ULPA 4XTCS 3CCMA 2K5DA 3CMAA 1BDOA 1H9RA 3ULJA 1C9OA 1V1OA 4POGA 1YBYA 1RD9D 1SNCA 1II3A 1Z7TA 2B39A 1DZ1A 3A0JA 3D4RA 4JV5L 5IP9G 2JP1A 2WB1E 3PUWA 2JA5H 4GKKL 1XMQQ 3G71A 3GTMH 1HFNA 4DV6L 2WP8J 1VQBA 1IYVA 3BDLA 3CCLA 4DR4L 2QEJC 4GNXC 5JEAH 2MP1A 5IYBG 3HOYH 1VMPA 4QGUA 1E1OA 2RHQB 3AB9A 3A5UA 1V1PA 1ZEQX 2CWPA 3KOJA 3E5SA 1TY2A 4RGOS 1JB3A 3ND9A 4QIWE 3R93A 2LS01 4BBRH 1OXTA 3VA5A 2VB3X 3PO3G 2EJMA 3DWPA 2VW9A 1HH2P 3A54A 2F0VA 4K6LA 4H0LC 5CV5A 1YNXA 3B6YA 1PH8A 4RKBA 4RH6A 1QE6A 1PYBA 2Y0SB 3CU7A 1BQQT 3M4PA 1I4GA 2F0OA 3EIVA 1JR0D 4A3KB 1WD0A 1QILA 2VXWA 5FO8B 1FNVA 1HXYD 4A75A 1TKWB 2D0OA 1HNWL 1SMYD 4LJZC 1L0WA 3S1RH 1A2UA 1Q7YC 5IGGA 2R7FA 4ZUIA 5BR8L 4M8AA 2Y0SE 5CV6A 1WCMH 4J15A 5CV4A 5KIXA 1HHVA 4G57A 3ERQA 1K83H 1ONLA 1CFMA 4EQ5A 5BN3A 5C44G 3KJOA 1LUZA 1O7ZA 4A3GH 3GTJB 1UE5A 3KYHC 1Q82C 4HCSA 4JI1Q 4A3FG 3D4DA 4X6AH 3PO2G 4X62L 2YTXA 4KI0A 4P2CB 1KNEA 1I4HA 1QWYA 2NB0A 5J1ZA 4BXXG 2PQAB 1WI5A 4OHJA 1RHPA 2DNEA 4HR7B 2QKIC 1IBLQ 2P5ZX 1K83B 3CC2A 3PIO3 1B7YB 1BXTA 4IUQA 1EY6A 3CP0A 4QY7A 2CH4A 3VYSA 4K8IA 4HJ5A 3MVVA 3ULLA 1YJNA 4PZ6A 4U673 4AIMA 4JPBW 1HNXQ 2R7ZH 1F9SA 1K8AC 1VQIA 1ASZA 1S5DD 3P75A 4HMJA 3PIPA 4HJ9A 3L9AX 1SE4A 3NK9A 4DR6Q 2NVYB 3I4NG 2NVXB 3M4OB 2EYPA 5M3MG 1Y1WB 2RCNA 2NVQB 2NZ1D 1D8LA 4JI1L 4QIWB 1KRSA 1XMOQ 1FJGQ 4A3MG 2NYZD 3PO2B 4QJFA 2OWOA 4HJ8A 4FP5D 2ES2A 3TDQA 4DR1L 3F1ZA 5IT9c 2BCOA 2L11A 1EFID 5GAEC 2UXDL 2UUBL 3OTOQ 1VQNA 3DEPA 3WOEA 4NXMQ 2A1AA 3KLWA 4CDDC 3KUPA 4B3RL 5E3FA 4A3IH 2B2TA 3F2CA 4A3GB 2C9OA 1Q90A 4WJ4A 2EYLA 2YTVA 4J6HA 3S14H 1UE6A 4IUUA 1KXLA 3A8JE 1U4RA 2EJGC 3C3LA 2R61A 1EQVA 2XVSA 1X65A 3X3NA 1A0IA 1D5ZC 5ELCA 1KIXA 4ID6A 1XPOA 3NENA 3D4WA 1SAPA 1LTTD 2KCNA 4EGVA 1SYDA 4C3JG 2RDFA 4ZUJA 5M5YB 4K0KL 4DNTB 2HDMA 1PZID 4IZ8A 1U4MA 1SYGA 3UDGA 4KKTA 1M8AA 1NR4A 4A3MB 1QZGA 4A93G 3T4AC 5IP7G 5FJ8H 1C4QA 1Q86C 1SYCA 5HGTA 2NVYH 1EYDA 4DAPA 1KTKA 2VUMB 2RSNA 3E0EA 2WINB 4CKCA 1S72A 2NZOA 4LNQA 2YU9H 1HNZL 2A6HC 4JI2L 2EY2A 1WTWA 3GQBA 4NMZA 2M9VA 5C5MA 3S1QB 3OHXC 4LF5Q 1SNQA 4DR5L 3KJPA 4A76A 1GXDC 1WTXA 1QG7A 2G5DA 3UDFA 1N32L 3BDOA 1E3PA 2YTYA 4X3TA 4F87A 1E24A 3MWYW 1ICFB 3TSSA 4BY7H 5GQOA 2UU9Q 1LT3D 1YI2A 5DM63 1CA5A 2KHJA 3OOCA 2V1CC 3HP3A 3PF5A 5J39A 3VR4A 2I07B 1L0YB 3TP5A 4RA8A 1LV9A 1H9MA 3K58A 3BZKA 3J80i 2RBMA 1HQRD 5IGDA 2R7ZG 2VL6A 4HIDA 4UPAA 2EYJA 2N55A 3EROA 3UDXA 5EPLA 4OWXB 4A3DG 3T1HL 1PFBA 4OELB 3FMCA 1G2SA 2QCPX 3Q6SA 1A15A 2PO4A 4I65A 3RZDH 5K36H 4DR5Q 1GVPA 3AFQA 3I4NB 5TSSA 1N32Q 1AZQA 4A93H 2Q2UA 4Y7NH 3OW2A 4LF4L 4P71A 4DV7Q 2WB1B 1HFGA 2JSOA 1B53A 1STAA 3SK6A 4EX5A 1JE5A 3CMEA 1EY5A 1SNDA 4BY1B 4DV3Q 4K5VA 5EKKA 5M3FG 2TSSA 4X66Q 1C48A 3EVQA 5JJKA 4ULLA 1EUJA 2PNHA 4OONA 4PMCA 1I94Q 4C3HH 1H95A 2K1BA 5M5YH 5GROA 1HJPA 1WTRA 2F0EA 2AHOB 2BDNA 1CZGA 5JVH3 4JI7Q 5DAUA 3RR5A 3MFGA 3S15H 1SMXA 3LNNA 5ELDA 4GLXA 1X55A 1B70B 2LY7A 5C3EB
chains in the Genus database with same CATH topology
2O5JC 1CM9A 1IHZA 1OXUA 1UEAB 2HQEA 3K5NA 1FYCA 2D2CC 1STHA 2HCCA 5I9PA 4HN7A 3A8IE 2L1BA 1CA6A 2B2YC 3H0GB 2JA8B 3S14B 4K6DA 4LMQD 1AEXA 1BCPD 5D3DA 1T5XD 1TS5A 3OIPA 2PQEA 3H09A 1Y8PB 1B2TA 2Q8IB 4DAVA 3TZDA 1JQYD 4QMGA 5M5XB 3S1NB 2NBFA 5C0XI 3G6JB 1PYWD 2A5HA 3NE5B 2TMPA 3QG1A 1EU4A 1DYQA 3NTIA 4RCOA 2R7ZB 2CHBD 1M4VA 3J81L 3MXUA 2XRQD 4R8NA 1HTPA 1TQOA 3SR1A 4HSVA 5A2QE 5KNDA 2E2IB 4RGNA 5I2XA 2A6EC 3KLRA 3GTPB 4XQQA 1SDFA 5ELBA 1B4OA 2PZUA 3IL8A 3HZXA 1ILQA 1FD7D 1SNPA 1OXVA 2L4NA 1JWUD 3VYRA 1I6HB 1EYCA 2WIIB 1O7YA 5M3FB 4KHVA 1AN8A 5C0XG 1GJXA 3P20A 5I6WA 1WCMB 4KJOA 2B2WA 2F03A 1LTBD 2JYOA 1LABA 2ZXOA 4XQNA 4X3UA 4EQOA 2D9UA 4A3EB 4NDXA 3X3MA 2EOTA 4RWSC 1BCPB 3R3OA 3CQZB 2L12A 5IGBA 3Q0AA 3S2DB 3KF8A 1H9SA 3NP8A 2K5QA 1JE4A 2B2YA 4FYDA 1PZKD 3LX0A 5I2YA 1Z47A 3I73A 1X32A 3TBIB 2X6GA 4ME5A 3PUXA 3E6ZX 3TZUA 1STEA 5M9OA 3BVGA 4OO1I 4Y7NB 2M00A 3H91A 3SVMA 1ET9A 3CHBD 4IFDI 1XWEA 2X69A 1CHPD 2LKVA 1EU3A 2JA7B 2KA7A 3FVQA 4C3IB 4IFDH 4FF3A 4FXDA 2PW5A 2R6GA 4ZKBB 3CKIB 1DXMA 1IW7C 3A55A 2ICEC 1AZPA 4QUFA 2HCIA 2L55A 4PMBA 3L3OC 3CRLC 3NHHA 1OO9B 2BE5D 1EEFD 3M7NA 2AUKA 2G9HD 1ENCA 1IKMA 3TMEA 5HURA 4WFN3 3NQIA 3V96A 1KAAA 2DN8A 1S5FD 1S4ZA 1U4PA 1SNOA 3E0JA 1KDAA 2Z1CA 1SXTA 2MJ8A 5BN5A 4CJ2C 3GTLB 3PMFA 2CVRA 5C0XH 2F0UA 2EY5A 3FPPA 2N88A 5COYA 4CKBA 2F0NA 5EQ0A 4PMWA 1LTSD 1JCKB 1KNAA 1ZKOA 4I7ZC 1STYA 4LAAA 3J7AF 2F3VA 2SEBD 1I4QA 1PZJD 3I91A 3G7LA 2O2LD 5AFWA 3JAME 4A3DB 2B8GA 3ZYYX 5G3LD 1B1ZA 3HOWB 1GUWA 2E2DC 2ICIA 2JA5B 1L0XB 1WVLA 2XWJB 4Q5VA 3D31A 4ZAIA 2PZTA 3FDTA 3S9WA 5CV8A 5CGKA 2EY1A 1SYFA 1K8MA 1PMRA 5IODA 1QOHA 5M3MB 2PW7A 1D5XC 2L0CA 4BA1I 1HTLD 3I70A 1TY0A 1HPCA 2PNRC 1LT5D 1HCZA 1WD1A 1AFPA 3K59A 4OGQC 1UAPA 4BY7B 4IURA 5C0XJ 3PIP3 5FLXE 1QB5D 1B3AA 4ZLTF 2VB2X 2K03A 2XIWA 1XTCD 4KY6A 1SBBB 3QWNA 3HOXB 4L8JA 2DY7A 4MHEA 1I4PA 3NWTA 2B2VA 3OW7A 1VMCA 1LO5D 1Y1VB 5C4ZA 2BA1A 5CV9A 2E2HB 1MSGA 1BF4A 2Z4HA 4IUNA 5A35A 4IQZA 4CJ1B 3I72A 4XYOA 3BYTB 3PV0A 4S3SA 2JA6B 1DCZA 3SK8A 4DK0A 1G91A 4ODGA 4G7HC 4C1NI 2OT2A 3HGBA 4RKLA 2MHVA 1TS2A 3NBHA 2K7VA 4ZRZA 2K32A 5CR3A 1EZ8A 2MGSA 1NUCA 1BCPC 5JEAJ 3P1HA 3IAYA 3S2HB 3DXJC 5JPNC 3IFTA 3UI2A 5JAVA 5KNBA 1TWAB 5EGTA 3IKJA 2LFNA 2X6LA 3T56B 4L63B 1PTOF 3MFYA 3VR3A 2K04A 4Q0FA 2FMCA 1E2VA 3J7YW 1DOLA 1EY0A 5DM73 2RA4A 5CC4A 3TP8A 5DNFA 2PZWA 1ENAA 1I50B 4TQUS 4CKEA 2KQ3A 4C1NK 3J81E 2A68C 1HUNA 3Q22A 2B2UA 5KEEA 2L9HA 1WTPA 5C4XB 4C56C 2EXZA 2B8FA 4X3SA 1D2BA 2JEBI 2XNAC 1RF2D 2KVMA 3W2DA 3I8ZA 4V0BA 1STNA 2RKSA 3OWEB 4XT3B 2EE1A 2NTSA 3M3YB 1Y8NB 3MTSA 5M5WB 1PLFA 1WTQA 1JOKA 5I9OA 3I3CA 1H9JA 1I4XA 3URYA 4OIJA 1H9KA 3A8KE 4F8MA 4WJWA 3NQTA 1C8CA 3T16A 3HOUB 2XRSD 4NP5A 4XIGS 2F0JA 3TP7A 3S1RB 4KN4C 4KJNA 1F2ZA 5KNCA 1XYIA 4JK1C 4N9TA 2SDFA 2EYMA 2FINB 3A56A 5C5LA 3IFDA 2J0TD 5KYIA 2G9DA 4C3HB 2HDLA 3CRKC 3H94A 1GHKA 2IJ0A 1EY9A 1NCVA 1TWFB 4B9XA 1PRTB 5D14A 2E75C 4U68A 3NWSA 1CT1D 3RZOB 1SEBD 1F9PA 1E0BA 3U9SA 5IT9E 4C2MB 2EZVA 5G3LF 3NUCA 5I4DA 2XSCA 4YIJA 3EA6A 1DJRD 3EFXD 1V1PB 1R4QB 2H1EA 1Q8IA 2B63B 5EBDA 1DM0B 4QF4A 5CMDA 5IT9L 1WTVA 1EY7A 5LL6S 1PFNA 1MI2A 1O7LA 3P7JA 2PMZB 1FNWA 3NPPA 5T1GA 2PCFB 3VR6A 2ZXPA 4XQJA 5E4XA 3GO5A 4OIKA 4R9WA 3R2TA 3AU7A 3C46A 5C3WA 4FNFA 2BDOA 5EKLA 1W6JA 1BR9A 1O78A 5ELEA 1GUSA 5KYLA 1BNZA 2AQ1B 1D6EC 2KCCA 1LT4D 4EVOA 3BZDB 1J9OA 5IGFA 1TU2B 1TWHB 5IGEA 3MZ5A 1A3UA 5C4JB 3PUYA 3NSWA 4QB4A 2LMCB 1ZYRD 2E2JB 4CBVA 4DU9A 3K5OA 1LTRD 1SE3A 3M4YA 1O80A 4ZKCB 4CGYB 3FPUB 4OL7A 1PTOH 1HQMC 3HOYB 5JEAG 3PO3B 1X3QA 1EIGA 3RD4A 3I4LA 3TP6A 3A7AB 1STGA 1BOSA 3MEHA 2SNMA 3O13A 3KBXA 3VR2A 3GP7A 2F0MA 4DF7A 1NAPA 2F0DA 4MN3A 1D5MC 2B2TC 1PTOC 3NXWA 5EKIA 4KN7C 1PTOD 1YNNC 3QJYA 2A69C 3DWQA 1S5BD 4RHSA 2M2LA 2EDGA 2FJ2A 3SXHA 1RTNA 2D5DA 1RTOA 2WAQB 1KDBA 4DGZA 4NW2A 3SE0A 5E4WC 4OO1G 5K5PA 2MPMA 2Z8LA 3BDCA 1IW7D 1A3VA 2F3WA 1F9RA 4HSPA 1HRJA 4KD4A 4KY7A 3HS0C 1DOMA 2IX0A 3T13A 3MC0B 4BWGB 1EWCA 1FGBD 1JOQA 3D3RA 4BS9A 2NN6G 4K2KA 3C1EA 1JWSD 2SNSA 2CW0D 2YYZA 2F0HA 1CK1A 2E76C 3TN2A 1B9MA 1JICA 3FEWX 3BS1A 1PDQA 1HA6A 1T5EA 3SDZA 3C1FA 1OXSC 3VR5A 4EQNA 4PV1C 3V2TA 1I6VC 2FHTA 4XYQA 2I46A 5EPJA 4G7ZC 3BVMA 3LWEA 2AUJD 2JXMB 4DK1A 5A2QL 2CQAA 5K36G 1B50A 3KLSA 2R92B 2NN6I 1V43A 4FF4A 2KHSA 1B44D 1IKLA 1YNND 4ZK9B 1F9QA 1RCVD 2ZT9C 1DONA 4RCNA 5D65A 1EEID 1TR5A 2XWBB 4F88A 4MIUA 1JORA 4AYBB 1SJED 2F0SA 4RHRA 5J22A 1EQTA 2K05A 1HUMA 4KK7A 2DY8A 1EY8A 1EYAA 5C6AA 4K8JA 3GV3A 5CV7A 1EY4A 4KD3A 4A3JB 2FMMA 2KUMA 4FF1A 2F4IA 4ILWA 4A3BB 1AP0A 3J80L 2EYFA 1SNMA 1Y69U 4KKSA 3SK4A 3T53B 4PQXA 2EPBA 2F0TA 1JOOA 3H3VC 4IALA 1KABA 3GTOB 1A2TA 2AWOA 2KEEA 1RJTA 4FVMA 2PPBC 5FO7B 4A3FB 3OMGA 1HA5A 2YU9B 1DD2A 2EY6A 3M7GA 2Q8TA 4C3IG 1R9TB 5FKAC 4IFDJ 4QCLA 1PRTC 4KV6A 3D6CA 1CQFA 3RLFA 3K6OA 4DA2A 3KK7A 3K5MA 1G2TA 3L7ZC 4XT1B 1PRTF 4IUTA 4DAYA 3GTQB 5IGCA 1G291 2FFKB 4EQPA 2EVBA 4DFAA 4KTAA 2OEOA 5F2DA 1SYEA 3MXPA 2KJXA 4RGMA 1XXGA 2F1MA 1KLUD 3M85A 2F0PA 1SE2A 4UAIA 3DUZA 3I4MB 4A3IB 3QO2A 2L5TA 1LTAD 4OO1H 4IN3A 4G7OC 3MHBA 2A73B 2OXPA 2ENBA 3GD7A 3HEJA 1U9RA 2K5WA 1MGSA 2RDGA 2D62A 2A69D 2NN6H 5ISRA 3HOZB 1J8IA 3AMUA 4BA2I 4WORA 2QDBA 4KHZA 1EWHA 1AW7A 2AWNA 1W6KA 1TS3A 3FKIB 3NBIA 1SMYC 3HG9A 5D3IB 1JWMD 4V190 5FOBB 1G6ZA 2F0WA 4WRDA 1E2WA 5I6YA 1JC7A 3S17B 2H4OA 2QILA 4ABNA 4L6TB 5LHY1 1RDPD 1SJHD 2J7ZA 5E1FA 4K5XA 4HMIA 2RVLA 1B9NA 5EPKA 4X3KA 4PNYA 1MBYA 5FLXL 2O5IC 3KBGA 2IT1A 1NSNS 2VNUD 4FF2A 1RODA 1TS4A 4H13C 2C5CA 4B9WA 3W3AA 2IWHA 1GHJA 3R2IA 1Q3LA 3K0YA 3DMUA 3Q24A 1H9SB 2O4XA 1VF5C 3N6RA 3U9OA 4J8QA 1BUVT 2PYKA 3DWAA 4B08A 4ZYSA 5C44B 2K6AA 1RKNA 1ENFA 3N52A 3QOLA 4K5WA 1GUNA 3OMCA 1PXUA 4K2LA 1CHQD 1X3PA 3SHLA 3KLSX 3OSOA 3T51B 2IX3A 4LK1C 4JBWA 4R8IA 1U4LA 5DEHA 2J4XA 3ND8A 1G8ZD 2A6HD 5CBAE 1F2MA 3WDNA 4A93B 1IL8A 4QUCA 3MAQA 2IL8A 2ZXRA 5KGUA 3BVZA 3MXGA 2BOSA 3LWUA 1EL0A 1Z6HA 2NWGA 1SYBA 2NVTB 4UDUC 2EYHA 3VYUA 2KEDA 5C3XA 4H44C 3S15B 3S16B 5T1IA 2K33A 1EIHA 3PUZA 1MSHA 3RMHA 5ELFA 4HTHA 3H6MA 4HCEA 1D1KA 3EQLC 1TWGB 3Q23A 1ET6A 2RDHA 2K01A 5JJZA 4RFBA 3JAML 2B2WC 2RQXA 2OF1A 2ID0A 2A74C 1F2YA 2XN9C 1E2ZA 2DNCA 5EJWA 3FRPB 3ONAB 1Y8OB 2F0GA 1BO0A 1PRTD 1LTGD 2A68D 4DN4M 4RAUC 5BN4A 2B2VC 2JE6I 1I4RA 4DXGA 4Z9CB 3F2UA 1EOTA 2NTTA 1ZYRC 2NUCA 1GOZA 5JVG3 4O1NA 3J7AV 1Q1BA 1S5CD 5FK9C 4C3HG 1D1IA 1QNKA 1F2LA 1VCIA 2JEAI 4CHTB 1UUPA 4DXFA 2K28A 4IUPA 1S5ED 3K5LA 5CBEE 1R4PB 4BBSB 1FR3A 1GUTA 3RUZA 4FXGC 2F0LA 3SEBA 4KKUA 3S1MB 4FXKC 1XX8A 1TWCB 2WACA 5JOBA 3HRZC 4XDXA 3R8BA 2F0KA 3DEOA 1F77A 3QB3A 4DNRB 2AQ2B 5IIFA 5EBCA 1TIID 1VDZA 3C2PA 2Q8RE 4NKLA 4BBRB 1KLGD 5KRUA 1A6XA 1YNJD 2R93B 4K14A 3D6WA 1VF7A 2RSOA 1Q1EA 1SSOA 1Q12A 3MA2B 2BE5C 3PUVA 2F0IA 1BBXC 3GTMB 3OWFA 4HEDA 1GUOA 5C4HA 5FO9B 5LL6X 5JPMC 3BYYB 1ZXTA 1PTOB 2IW3A 3WOFA 1BCPF 4ZQ3A 2MUYA 1LT6D 5NUCA 2Z4IA 4N9PA 3OPOA 1CZWA 3GTGB 2B2UC 2KOLA 3NTHA 1ESRA 3DHQA 3VYTA 4CJ0B 3HKZB 4G4KA 1I3QB 4E6IA 2F0QA 3GTKB 1K8OA 2A6ED 1GUGA 1CTMA 3K57A 2HUGA 4J1MA 2SOBA 2QF7A 4IFDG 2R3ZA 3V05A 1OXXK 1CI3M 4O42A 2BA0A 3SK5A 3I90A 2EJFC 2KECA 4XXEA 3NTKA 1PFMA 3BG3A 1YNJC 1UNSA 3D8GA 3ITPA 3EJIA 5CORA 1TT2A 4H7BA 2WV6D 3J80E 1QJOA 1ICWA 1QNUA 1EZ6A 4KY5A 4TKOB 3K7AB 1WTOA 2EYOA 1ILPA 2WKDA 1KDCA 2V4DA 1ESFA 1TVXA 3VA7A 4RGTA 2IPKD 1IYUA 2CW0C 5CYUA 2F0FA 2AQ3B 3DM1A 1LLRD 1SFOB 2E74C 2WKCA 4KMUC 4IUVA 1LTID 3GV6A 4HAEA 4F7XA 4M1UB 3RZDB 3A7LA 1NR2A 1DOKA 1CQVA 1ML0D 1STBA 1LACA 1FNUA 2GA4B 4FO2A 1QCBD 4C3JB 4GZYC 2IX1A 4TRDA 3MXNA 4TSSA 1V8QA 3OIQA 3HOVB 1A3TA 5IOCA 3QOJA 1MD2D 3QIAA 4XTCS 2K5DA 1BDOA 1H9RA 1V1OA 1RD9D 1SNCA 1II3A 1Z7TA 2B39A 1DZ1A 3D4RA 2JP1A 3PUWA 1HFNA 2WP8J 1IYVA 3BDLA 2QEJC 5JEAH 2MP1A 1VMPA 3AB9A 1V1PA 1ZEQX 3E5SA 1TY2A 4RGOS 1JB3A 3ND9A 3R93A 2LS01 1OXTA 3VA5A 2VB3X 2EJMA 3DWPA 3A54A 2F0VA 4K6LA 4H0LC 5CV5A 4RKBA 4RH6A 1QE6A 2Y0SB 3CU7A 1BQQT 1I4GA 2F0OA 1WD0A 1JR0D 4A3KB 1QILA 2VXWA 5FO8B 1FNVA 1HXYD 1TKWB 1SMYD 4LJZC 1A2UA 5IGGA 4ZUIA 4M8AA 5CV6A 5CV4A 1HHVA 5KIXA 4G57A 3ERQA 1ONLA 1CFMA 5BN3A 1O7ZA 3GTJB 4HCSA 3D4DA 4KI0A 4P2CB 1KNEA 1I4HA 1QWYA 2NB0A 5J1ZA 4OHJA 1RHPA 2DNEA 4HR7B 2QKIC 1K83B 3PIO3 4IUQA 1BXTA 1EY6A 3VYSA 4K8IA 3MVVA 4U673 1F9SA 1S5DD 3P75A 4HMJA 3L9AX 1SE4A 3NK9A 2NVYB 2NVXB 3M4OB 2EYPA 1Y1WB 2NVQB 2NZ1D 4QIWB 2NYZD 3PO2B 4FP5D 3TDQA 2BCOA 2L11A 1EFID 3DEPA 3WOEA 3KUPA 5E3FA 2B2TA 4A3GB 2C9OA 1Q90A 2EYLA 4J6HA 4IUUA 3A8JE 1U4RA 2EJGC 3C3LA 2R61A 1EQVA 2XVSA 3X3NA 1D5ZC 5ELCA 4ID6A 3D4WA 1SAPA 1LTTD 2KCNA 4EGVA 1SYDA 4C3JG 2RDFA 4ZUJA 5M5YB 4DNTB 2HDMA 1PZID 4IZ8A 1U4MA 1SYGA 4KKTA 1M8AA 1NR4A 4A3MB 3T4AC 1C4QA 1SYCA 5HGTA 1EYDA 4DAPA 1KTKA 2VUMB 2RSNA 2WINB 4CKCA 2A6HC 2EY2A 1WTWA 3GQBA 4NMZA 2M9VA 5C5MA 3S1QB 3OHXC 1SNQA 1GXDC 1WTXA 1QG7A 3BDOA 4X3TA 4F87A 3MWYW 3TSSA 1LT3D 5DM63 1CA5A 3OOCA 3HP3A 5J39A 3VR4A 2I07B 1L0YB 3TP5A 3K58A 1LV9A 1H9MA 4RA8A 2RBMA 1HQRD 5IGDA 2EYJA 2N55A 3EROA 5EPLA 1PFBA 3FMCA 1G2SA 2QCPX 3Q6SA 1A15A 2PO4A 4I65A 5K36H 3I4NB 5TSSA 1AZQA 2WB1B 1HFGA 2JSOA 1B53A 1STAA 3SK6A 4BY1B 1EY5A 1SNDA 4K5VA 5EKKA 2TSSA 1C48A 3EVQA 4ULLA 4PMCA 2K1BA 1WTRA 2F0EA 2BDNA 1CZGA 5JVH3 5DAUA 3MFGA 3LNNA 5ELDA 2LY7A 5C3EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5B D;  1RD9 D;  1LTB D;  4RHS A;  3OWE B;  4RFB A;  4RGM A;  1XXG A;  1S5D D;  1KLU D;  1LTS D;  1UNS A;  1JCK B;  2NTS A;  1BCP B;  1KLG D;  1SE4 A;  3R2I A;  1SJE D;  2XN9 C;  3BYT B;  4RHR A;  1SE2 A;  2SEB D;  1I4Q A;  2WV6 D;  3R2T A;  1PZJ D;  2Z8L A;  3TSS A;  2QEJ C;  3DWA A;  1I4X A;  4ZYS A;  3URY A;  1BCP D;  1ENF A;  5D3D A;  2O2L D;  5ELE A;  1LT3 D;  1T5X D;  1TS5 A;  1LTA D;  1PZK D;  2AQ1 B;  1V1P A;  1CHQ D;  1D6E C;  1TY2 A;  4RGO S;  1TS2 A;  1PRT D;  3KLS X;  1B1Z A;  3BYY B;  1LT4 D;  1ESF A;  1L0Y B;  1PTO B;  1LTG D;  2ICI A;  2XRS D;  3MC0 B;  4RGT A;  4BWG B;  1EWC A;  1L0X B;  2IPK D;  1BCP C;  3DWP A;  1STE A;  3BZD B;  1HQR D;  1FGB D;  1BCP F;  1JQY D;  3BVG A;  1I4R A;  4DXG A;  1EFI D;  4K6L A;  4Z9C B;  1LT6 D;  1PYW D;  2RDG A;  4RH6 A;  2AQ3 B;  2J4X A;  1LLR D;  2NTT A;  1I4G A;  1JR0 D;  1QIL A;  1ET9 A;  1JWS D;  3CHB D;  1GOZ A;  1G8Z D;  1CHP D;  1FNV A;  1HXY D;  1CK1 A;  1EU4 A;  1EU3 A;  4O1N A;  1DYQ A;  1LTI D;  4RCO A;  1LTR D;  2CHB D;  2IJ0 A;  1M4V A;  4L63 B;  1SE3 A;  2R61 A;  1PTO F;  3BVZ A;  1D5X C;  1PRT B;  1S5C D;  5FK9 C;  1HTL D;  1AW7 A;  5TSS A;  1CT1 D;  1SEB D;  1TY0 A;  1TS3 A;  1D5Z C;  5ELC A;  1UUP A;  1CQV A;  1LT5 D;  4DXF A;  2XRQ D;  5D3I B;  1S5E D;  1LTT D;  1JWM D;  4UDU C;  1FNU A;  1HA5 A;  5I4D A;  1EEI D;  1PTO H;  3EA6 A;  1DJR D;  4RGN A;  1EEF D;  3SEB A;  2G9H D;  3EFX D;  1PZI D;  5FKA C;  1V1P B;  2TSS A;  2QIL A;  1PRT C;  4L6T B;  1RDP D;  3BVM A;  3O13 A;  1I4H A;  1SJH D;  4TSS A;  1XTC D;  3GP7 A;  5ELB A;  4OHJ A;  1FD7 D;  1SBB B;  1S5F D;  1JWU D;  3R8B A;  1KTK A;  1PRT F;  1D5M C;  5ELF A;  4C56 C;  3V05 A;  1MD2 D;  1SXT A;  1B44 D;  1F77 A;  1PTO C;  1I4P A;  1BXT A;  1AN8 A;  2XNA C;  1RF2 D;  3MFG A;  1PTO D;  3W2D A;  1LO5 D;  1ET6 A;  1RCV D;  2RDH A;  2AQ2 B;  1V1O A;  5ELD A;  1TS4 A;  3DWQ A;  1FNW A; 
#chains in the Genus database with same CATH topology
 2O5J C;  4JOI C;  1CM9 A;  4JI5 Q;  1IHZ A;  4JI4 Q;  4LF8 L;  1OXU A;  1UEA B;  4PZ8 A;  2HQE A;  2K75 A;  3K5N A;  1XMO L;  1FYC A;  2D2C C;  1STH A;  2HCC A;  5I9P A;  4HN7 A;  3A8I E;  2L1B A;  1CA6 A;  2B2Y C;  3H0G B;  2JA8 B;  3S14 B;  4IO9 A;  2UUC Q;  4K6D A;  1TXY A;  4LMQ D;  1AEX A;  5IYB H;  2Q2I A;  1BCP D;  5JJI A;  5D3D A;  2WB1 G;  4ME3 A;  4R4O A;  1T5X D;  1TS5 A;  3OIP A;  2PQE A;  1L1O C;  1FGU A;  4DAM A;  3GTP H;  3H09 A;  4DR1 Q;  1Y8P B;  4HJA A;  1B2T A;  1TWF H;  4GN4 B;  2Q8I B;  1N9W A;  4DAV A;  3TZD A;  1JQY D;  4QMG A;  5M5X B;  3S1N B;  2ATW A;  2NBF A;  5C0X I;  3G6J B;  1PYW D;  1YZ6 A;  2A5H A;  3NE5 B;  2TMP A;  5C3E H;  3QG1 A;  1EU4 A;  1DYQ A;  3NTI A;  4RCO A;  2R7Z B;  2CHB D;  1M4V A;  4B3S L;  4IPD A;  1U0L A;  3J81 L;  3MXU A;  4IJH A;  4UP8 A;  4O0A A;  1M1K C;  4GKK Q;  4BXX H;  2XRQ D;  4R8N A;  1HTP A;  4N8X 1;  2CWA A;  1TQO A;  3SR1 A;  1VQC A;  4HSV A;  5A2Q E;  3U50 C;  5KND A;  2E2I B;  4RGN A;  2UXB L;  1MKH A;  1VS0 A;  4GNX B;  5I2X A;  2A6E C;  3KLR A;  4IJL A;  3GTP B;  4XQQ A;  1XNQ L;  4DV5 Q;  4LFB L;  4YY3 Q;  1UE7 A;  1SDF A;  5ELB A;  1B4O A;  3KDF A;  2PZU A;  3IL8 A;  3HZX A;  1ILQ A;  1FD7 D;  1SNP A;  1OXV A;  3JAM c;  2L4N A;  1JWU D;  3VYR A;  5GAD C;  1I6H B;  2HHH L;  1EYC A;  1I5F A;  2WII B;  1O7Y A;  4OX9 L;  5M3F B;  4KHV A;  1AN8 A;  1WJJ A;  1VQH A;  5C0X G;  2MNA A;  4B3R Q;  4Y52 H;  1GJX A;  3P20 A;  5I6W A;  1WCM B;  4KJO A;  2B2W A;  2F03 A;  1LTB D;  2JYO A;  1QZH A;  1LAB A;  1EQR A;  2ZXO A;  1KAW A;  4X3U A;  4EQO A;  4XQN A;  2D9U A;  3SGI A;  1NMG A;  4A3E B;  4NDX A;  1IBK Q;  3X3M A;  2EOT A;  4RWS C;  1BCP B;  3R3O A;  1K3B C;  3CQZ B;  2L12 A;  5IGB A;  1RIP A;  4UP7 A;  4LF9 L;  4A3C H;  3Q0A A;  3S2D B;  2CCZ A;  2R93 G;  3KF8 A;  1H9S A;  1AE3 A;  2RCF A;  2VQF L;  3NP8 A;  2K5Q A;  1JE4 A;  3HOY G;  5JJL A;  3MXN B;  2B2Y A;  1W2B A;  4FYD A;  4O2D A;  1PZK D;  4C3J H;  3LX0 A;  5I2Y A;  1Z47 A;  3I73 A;  1X32 A;  3TBI B;  2X6G A;  2BH2 A;  2ZM6 L;  4AYB G;  2OTJ A;  4ME5 A;  2PI2 E;  3PUX A;  2JA5 G;  3E6Z X;  3TZU A;  1STE A;  5M9O A;  3OYY A;  3BVG A;  4OO1 I;  4Y7N B;  2M00 A;  3H91 A;  3ICE A;  4DV1 L;  1PH9 A;  4LFC L;  3SVM A;  1ET9 A;  3CHB D;  4IFD I;  1XWE A;  2X69 A;  1CHP D;  2LKV A;  1EU3 A;  3BU2 A;  1HZ9 A;  5L37 A;  2JA7 B;  2KA7 A;  3FVQ A;  1I6H H;  4JI0 L;  4C3I B;  4IFD H;  4FF3 A;  4FXD A;  1UEB A;  2PW5 A;  1P16 A;  2R6G A;  2L15 A;  4ZKB B;  4X64 Q;  3CKI B;  3E9H A;  1DXM A;  3PO3 H;  1IW7 C;  3A55 A;  2ICE C;  1AZP A;  4QUF A;  4KHP L;  2HCI A;  2L55 A;  4YCU A;  4PMB A;  2B29 A;  1Q46 A;  3L3O C;  3WWV A;  3CRL C;  3NHH A;  1OO9 B;  2BE5 D;  1EEF D;  3M7N A;  1FJG L;  2AUK A;  2G9H D;  1ENC A;  1W3S A;  2ALY B;  1IKM A;  3TME A;  5HUR A;  2JA7 G;  4WFN 3;  1WTH A;  3NQI A;  4RMF A;  4OEM B;  4X62 Q;  3V96 A;  1KAA A;  1KHI A;  1VQJ A;  2DN8 A;  1S5F D;  1S4Z A;  1U4P A;  5IWA Q;  4H02 A;  1SNO A;  3E0J A;  1KDA A;  2Z1C A;  1PHJ A;  1SXT A;  2MJ8 A;  4A3J H;  3GDE A;  5BN5 A;  4CJ2 C;  3PMF A;  3GTL B;  2CVR A;  1V9P A;  5C0X H;  2F0U A;  4A3J G;  4C2M H;  2EY5 A;  5M5X H;  3FPP A;  2N88 A;  5COY A;  4CKB A;  4X64 L;  2F0N A;  5EQ0 A;  4PMW A;  1LTS D;  1JCK B;  2MFI A;  1KNA A;  1ZKO A;  4I7Z C;  1STY A;  2LSS A;  2XTI A;  4LAA A;  3J7A F;  2F3V A;  1I50 H;  2SEB D;  1B3Q A;  4NPS A;  1I4Q A;  1PZJ D;  2Z6B A;  3I91 A;  2Q2T A;  3G7L A;  3JC6 6;  2O2L D;  5AFW A;  3JAM E;  1SLJ A;  2JN4 A;  2R92 H;  2B8G A;  4A3D B;  3ZYY X;  2OQ0 A;  5G3L D;  4YCV A;  1B1Z A;  3HOW B;  3S2D H;  2E2D C;  1GUW A;  1X3F A;  2ICI A;  2JA5 B;  1L0X B;  1WVL A;  2XWJ B;  4Q5V A;  3M4O H;  2DJF C;  3D31 A;  3PQI A;  4ZAI A;  2UUA L;  4BBS G;  4DR7 L;  1X54 A;  2PZT A;  1X56 A;  3FDT A;  3EN2 A;  3S9W A;  3RNU A;  5CV8 A;  1T9H A;  4JW0 A;  4A3K G;  1NMF A;  5CGK A;  1I3Q H;  1YJ9 A;  2EY1 A;  3KDF B;  1SYF A;  1K8M A;  1PMR A;  5IOD A;  2UXB Q;  1QOH A;  5M3M B;  1Y1W G;  2PW7 A;  1D5X C;  2L0C A;  3M3Y H;  4BA1 I;  1HTL D;  3I70 A;  1TY0 A;  1HPC A;  4GNX A;  2PNR C;  1LT5 D;  1HCZ A;  1WD1 A;  1AFP A;  3K59 A;  4OGQ C;  4MTK A;  1YIJ A;  1UAP A;  2I5H A;  4C3I H;  3PSI A;  4BY7 B;  4IUR A;  5C0X J;  3PIP 3;  4JI3 Q;  5FLX E;  1QB5 D;  1U5K A;  1B3A A;  4ZLT F;  2VB2 X;  2K03 A;  2XIW A;  5IYD H;  1N34 L;  1XTC D;  3S1Q H;  4KY6 A;  4A3L G;  1SBB B;  3QWN A;  3HOX B;  1Y1W H;  4L8J A;  5C4X H;  4CDC C;  2DY7 A;  4MHE A;  1I4P A;  3NWT A;  4JYA L;  2I5L X;  2B2V A;  3OW7 A;  1VMC A;  1LO5 D;  1MIU A;  3FKI H;  1Y1V B;  5C4Z A;  3CCQ A;  2BA1 A;  5CV9 A;  2E2H B;  1MSG A;  2HIV A;  1BF4 A;  2Z4H A;  4IUN A;  5A35 A;  4IQZ A;  1PV4 A;  4OWW B;  4CJ1 B;  3I72 A;  3U4V A;  3DLL A;  4XYO A;  3BYT B;  1N36 L;  3PV0 A;  1QVC A;  4S3S A;  2JA6 B;  1DCZ A;  3I2Z A;  3SK8 A;  4DK0 A;  1G91 A;  4ODG A;  2AMC B;  3BJU A;  4G7H C;  3J81 j;  4C1N I;  2OT2 A;  3HGB A;  4LUV A;  4RKL A;  2MHV A;  1TS2 A;  3NBH A;  2K7V A;  3J7Z C;  4ZRZ A;  2NVT H;  1N34 Q;  2R7D A;  2K32 A;  2LXK A;  5CR3 A;  1VQM A;  1EZ8 A;  2MGS A;  1NUC A;  1J5E Q;  1VQL A;  1BCP C;  5JEA J;  3P1H A;  3IAY A;  3S2H B;  3DXJ C;  5JPN C;  2XGT A;  3IFT A;  3UI2 A;  5JAV A;  3LGJ A;  5KNB A;  1TWA B;  1VQ5 A;  5EGT A;  3IKJ A;  2H5X A;  3S17 H;  2LFN A;  3G6E A;  2X6L A;  3T56 B;  1MHW C;  5ELN A;  4L63 B;  3TRZ A;  2I5M X;  3K8A A;  1PTO F;  5FLM G;  3RN2 A;  3MFY A;  4GLV B;  1YHA A;  3VR3 A;  2K04 A;  5FJ8 G;  4A3E G;  4N8F A;  3A5Z B;  2ZTC A;  4Q0F A;  5IYD G;  2FMC A;  1E2V A;  3J7Y W;  2IHF A;  2VY3 A;  1DOL A;  1XNR L;  1EY0 A;  5AJ3 Q;  5DM7 3;  2RA4 A;  5CC4 A;  3TP8 A;  3F2D A;  5DNF A;  2PZW A;  4DR2 L;  1ENA A;  1I50 B;  1HZA A;  4TQU S;  2KQ3 A;  4C1N K;  4CKE A;  3J81 E;  3I56 A;  1K3R A;  4UY8 C;  2A68 C;  4DV4 L;  1HUN A;  3M9B A;  3Q22 A;  2B2U A;  1EWI A;  4R1J A;  5KEE A;  2L9H A;  1WTP A;  5C4X B;  4C56 C;  2EXZ A;  2B8F A;  1LM0 A;  5GAH C;  4K0K Q;  4X3S A;  1D2B A;  1QUQ A;  2JEB I;  4AH6 A;  1Y14 B;  2XNA C;  2UUB Q;  1C0A A;  1RF2 D;  2KVM A;  3W2D A;  4BY1 G;  3I8Z A;  2DUD A;  4V0B A;  1STN A;  4QQB X;  2RKS A;  3OWE B;  4RG1 A;  4LF5 L;  1XTD A;  3FP9 A;  3U58 A;  4XT3 B;  2EE1 A;  2NTS A;  3M3Y B;  1WOC A;  4YHH L;  5FLX c;  1X6O A;  1Y8N B;  4KHP Q;  4JI6 L;  3MTS A;  5M5W B;  1VQK A;  1PLF A;  1WTQ A;  1JOK A;  5I9O A;  2VUM G;  3I3C A;  1H9J A;  1L1O B;  3DM3 A;  1I4X A;  1TWG H;  2ZJQ A;  3URY A;  3S16 H;  4OIJ A;  1WYD A;  1H9K A;  3A8K E;  4CDF C;  2Y0S G;  4F8M A;  2MO0 A;  5M5W H;  2Z9H A;  4WJW A;  4YWK A;  1NE3 A;  1PH7 A;  3NQT A;  1C8C A;  3T16 A;  4DK6 C;  4A3E H;  1KRT A;  3HOU B;  2XRS D;  4NP5 A;  4XIG S;  2KBN A;  2F0J A;  3TP7 A;  3S1R B;  4KN4 C;  4KJN A;  1IBL L;  1TWH H;  1F2Z A;  5KNC A;  2K14 A;  1XYI A;  4JK1 C;  4N9T A;  2SDF A;  2EYM A;  2FIN B;  2QDL A;  3A56 A;  5C5L A;  1HZB A;  3IFD A;  2J0T D;  2DGY A;  5KYI A;  2G9D A;  4DUY L;  3W1G A;  4C3H B;  2JA6 G;  2HDL A;  3CRK C;  3H94 A;  2VS1 A;  1SRU A;  1JT8 A;  1GHK A;  4B3T L;  3I55 A;  2IJ0 A;  3CF5 A;  1EY9 A;  1NCV A;  1TWF B;  4B9X A;  2JQO A;  1PRT B;  5D14 A;  5IE8 A;  4X65 L;  2E75 C;  4U68 A;  3NWS A;  1CT1 D;  3RZO B;  1SEB D;  1GM5 A;  1F9P A;  1E0B A;  5LMN L;  3U9S A;  1A62 A;  5IT9 E;  4C2M B;  2EZV A;  4JI3 L;  5G3L F;  3NUC A;  5I4D A;  2XSC A;  4YIJ A;  3EA6 A;  1DJR D;  3EFX D;  1V1P B;  1HNW Q;  1R4Q B;  5M3M H;  2H1E A;  3CCU A;  1AE2 A;  1CSP A;  1Q8I A;  2B63 B;  5EBD A;  1JJG A;  1DM0 B;  4QF4 A;  1A8V A;  5CMD A;  2F52 A;  5IT9 L;  1WTV A;  1EY7 A;  5LL6 S;  1VQ7 A;  1PFN A;  1HZC A;  1MI2 A;  3T1Y L;  1O7L A;  3P7J A;  2PMZ B;  1FNW A;  3AYH B;  3NPP A;  5T1G A;  2PCF B;  3VR6 A;  2E5L L;  4FDB A;  2ZXP A;  3RZO H;  4XQJ A;  5LMN Q;  3AFP A;  5E4X A;  2PMZ E;  3GO5 A;  4OIK A;  3H0G G;  4R9W A;  2EXD A;  4OX9 Q;  3R2T A;  3AU7 A;  3J81 c;  3C46 A;  5C3W A;  4FNF A;  4R4C A;  2BDO A;  5EKL A;  1W6J A;  3TS2 A;  4LF7 Q;  1BR9 A;  1O78 A;  4DK3 C;  1QVF A;  5ELE A;  1GUS A;  5KYL A;  1BNZ A;  2AQ1 B;  2GN5 A;  1D6E C;  2KCC A;  3J81 i;  3H3V H;  2WFW A;  5HGQ A;  1WCM G;  1LT4 D;  4DV6 Q;  4EVO A;  2Z6K C;  3BZD B;  2E2H H;  1J9O A;  5IGF A;  1TU2 B;  3U4Z A;  1TWH B;  2CQO A;  5IGE A;  3MZ5 A;  3T1Y Q;  4HIM A;  1A3U A;  3STB D;  5C4J B;  3PUY A;  3NSW A;  4GS3 A;  4QB4 A;  4A3I G;  2LMC B;  1ZYR D;  1JB7 A;  3F2B A;  2E2J B;  1YHB A;  4CBV A;  3HOX H;  4DU9 A;  3K5O A;  3HOV H;  1LTR D;  1SE3 A;  5H1S E;  3M4Y A;  1CUK A;  1XNQ Q;  1CKN B;  4DR2 Q;  1O80 A;  3L0O A;  4ZKC B;  1X3G A;  4BBR G;  4CGY B;  1K0R A;  1TWC H;  3FPU B;  4OL7 A;  1PTO H;  1HQM C;  3HOY B;  5JEA G;  1PH2 A;  3PO3 B;  1X3Q A;  1EIG A;  3RD4 A;  3I4L A;  3TP6 A;  3A7A B;  4LUZ A;  1STG A;  1BOS A;  3H0G H;  2SNM A;  1UWV A;  3MEH A;  3O13 A;  3KBX A;  3VR2 A;  3GP7 A;  3I4N H;  1VQ4 A;  3I4M H;  2F0M A;  4DF7 A;  3S2H H;  1NAP A;  2JA9 A;  3EBE A;  1VQ9 A;  2I0Q A;  2F0D A;  4MN3 A;  1D5M C;  2B2T C;  1PTO C;  3NXW A;  5EKI A;  4KN7 C;  3HOZ G;  1PTO D;  1YNN C;  3QJY A;  1VQG A;  2A69 C;  3DWQ A;  1S5B D;  1EOV A;  4NB3 A;  4RHS A;  2M2L A;  3ER0 A;  2EDG A;  2FJ2 A;  3ZJY C;  3SXH A;  1RTN A;  2D5D A;  2DJG C;  2OTL A;  4DKA C;  1RTO A;  1K28 A;  2WAQ B;  1KDB A;  1CKM A;  2HHH Q;  4MNO A;  4DGZ A;  1WFQ A;  4DAY B;  4NW2 A;  5IYC H;  3SE0 A;  5E4W C;  4OO1 G;  5K5P A;  2MPM A;  2Z8L A;  3BDC A;  1IW7 D;  1A3V A;  2F3W A;  1F9R A;  4HSP A;  1HRJ A;  1N33 L;  5C44 H;  4KD4 A;  4KY7 A;  4IPG A;  3HS0 C;  4L5S A;  5LMN W;  1DOM A;  2IX0 A;  3T13 A;  3MC0 B;  4BWG B;  1EWC A;  1G51 A;  2ZTD A;  3GTG H;  1FGB D;  2OQK A;  1JOQ A;  2Z6K A;  3D3R A;  4PG3 A;  3K80 C;  2NN6 G;  4K2K A;  4BS9 A;  3C1E A;  1VQA A;  1JWS D;  4R4I A;  2SNS A;  4B3T Q;  2CW0 D;  2YYZ A;  2F0H A;  3BZC A;  1CK1 A;  1M90 C;  4X65 Q;  2E76 C;  3TN2 A;  1B9M A;  1JIC A;  3FEW X;  3BS1 A;  3G48 A;  1PH5 A;  4DV0 Q;  3K0X A;  1PDQ A;  4I7A A;  1HA6 A;  1T5E A;  4NXN L;  3I7F A;  4OWT B;  3SDZ A;  1DGS A;  3VDY A;  3C1F A;  1OXS C;  1EIF A;  1UE1 A;  4R4Q A;  3VR5 A;  4EQN A;  4PV1 C;  3V2T A;  3MEF A;  1I6V C;  2FHT A;  4XYQ A;  2I46 A;  5LMU Q;  5EPJ A;  4LFA Q;  2NVX H;  4G7Z C;  3GTQ H;  3BVM A;  1E7Z A;  1SN8 A;  2MQH A;  3LWE A;  2VQE Q;  1X9N A;  2AUJ D;  2F4V Q;  1E22 A;  1O7I A;  2JXM B;  4DK1 A;  2K5N A;  5A2Q L;  2CQA A;  5K36 G;  1B50 A;  2YV5 A;  3KLS A;  2R92 B;  3TRE A;  2RHS B;  2NN6 I;  1V43 A;  2KHS A;  4FF4 A;  1B44 D;  1IKL A;  1YNN D;  5ELO A;  4ZK9 B;  1F9Q A;  1RCV D;  2ZT9 C;  1DON A;  4RCN A;  5D65 A;  1EEI D;  2PQA A;  1YJW A;  1VQ8 A;  1TR5 A;  3AQQ A;  2XWB B;  4F88 A;  4MIU A;  3PCO B;  1JOR A;  1EYG A;  4AYB B;  1EFW A;  1SJE D;  2F0S A;  4RHR A;  4A3M H;  5J22 A;  1EQT A;  2K05 A;  1HUM A;  4KK7 A;  2DY8 A;  3TEH B;  1EY8 A;  4JI8 Q;  4LFA L;  1NY4 A;  4JC0 A;  1EYA A;  4MTN A;  1C7Y A;  5C6A A;  4K8J A;  3TQY A;  3GV3 A;  5CV7 A;  2F4V L;  1EY4 A;  3E3X A;  4KD3 A;  1IL2 A;  4A3J B;  2FMM A;  2KUM A;  4FF1 A;  2F4I A;  2IHE A;  4ILW A;  4A3B B;  1AP0 A;  4IPC A;  3J80 L;  3K7U C;  2KCT A;  2EYF A;  1SNM A;  1Y69 U;  3IRB A;  4KKS A;  3F8T A;  3SK4 A;  4LWC A;  3T53 B;  3T1H Q;  1PFS A;  4PQX A;  3FKI G;  2EPB A;  3HOZ H;  2F0T A;  3A74 A;  4YWL A;  1JOO A;  3H3V C;  4IAL A;  1KAB A;  3GTO B;  1A2T A;  1Q8K A;  2AWO A;  2KEE A;  1RJT A;  3QR8 A;  1JMC A;  4A3L H;  4FVM A;  2PPB C;  3PO2 H;  4JI8 L;  5FO7 B;  4A3F B;  3OMG A;  3PIO A;  1HA5 A;  2ZJP A;  2YU9 B;  1DD2 A;  2EY6 A;  3M7G A;  1D7Q A;  2Q8T A;  4C3I G;  1R9T B;  5FKA C;  4UP9 A;  4IFD J;  4QCL A;  1PRT C;  4KV6 A;  3D6C A;  4KLK A;  1CQF A;  1QVG A;  1JJC B;  2VQE L;  3RLF A;  3K6O A;  2HIX A;  2ASB A;  4L5T A;  4DA2 A;  1GO3 E;  1YVC A;  3KK7 A;  3K5M A;  1BVS A;  2GVB A;  1G2T A;  3L7Z C;  4XT1 B;  4P72 A;  1PRT F;  4IUT A;  4DAY A;  1L2F A;  3GTQ B;  1N8R C;  5IGC A;  1G29 1;  2FFK B;  4EQP A;  3STB C;  2EVB A;  4DFA A;  4KTA A;  2OEO A;  5EAY A;  3K7A H;  1P8L A;  5F2D A;  1SYE A;  3MXP A;  2KJX A;  4RGM A;  1XXG A;  2VZA A;  1SR3 A;  1KLU D;  2F1M A;  3M85 A;  3CC7 A;  1VQP A;  2F0P A;  1SE2 A;  2B63 H;  4UAI A;  1PH4 A;  4TVA B;  4DR4 Q;  3DUZ A;  2R92 G;  3I4M B;  4A3I B;  3QO2 A;  4L5R C;  3HKZ E;  3RLN A;  5HY6 A;  4AQY L;  2L5T A;  1BBU A;  3HKS A;  1LTA D;  2A19 A;  1VQD A;  4OO1 H;  4IN3 A;  1PH3 A;  2UXC L;  4G7O C;  3MHB A;  2A73 B;  1SE8 A;  2OXP A;  2ENB A;  3GD7 A;  3HEJ A;  1IZ6 A;  1U9R A;  2K5W A;  1MGS A;  2RDG A;  2D62 A;  4JG2 A;  4HJ7 A;  1Y1V G;  2A8V A;  2A69 D;  4APV A;  4A3K H;  2K5V A;  2NN6 H;  5ISR A;  4JBK A;  3HOZ B;  1J8I A;  3AMU A;  1X3E A;  4BA2 I;  4WOR A;  4JVZ A;  2QDB A;  4KHZ A;  3NEM A;  1EWH A;  1QUQ B;  4JOI A;  1AW7 A;  2AWN A;  1W6K A;  1TS3 A;  3FKI B;  3NBI A;  4NXN Q;  3CW2 C;  1SMY C;  3HG9 A;  5D3I B;  2E2J H;  2EQS A;  2D0P A;  1JWM D;  4LUO A;  4V19 0;  5FOB B;  4DV1 Q;  3S24 A;  1G6Z A;  2F0W A;  1PVO A;  4WRD A;  1TWA H;  1E2W A;  4JYA Q;  4DR7 Q;  5I6Y A;  1JC7 A;  3HOU G;  1NTG A;  3S17 B;  4BY7 G;  2H4O A;  2QIL A;  4ABN A;  4L6T B;  5LHY 1;  1RDP D;  4JBM A;  1SJH D;  2J7Z A;  4GLA C;  5E1F A;  4GN5 A;  4K5X A;  4HMI A;  2RVL A;  1XMQ L;  2UXD Q;  1HR0 L;  1N36 Q;  1B9N A;  5EPK A;  2UUA Q;  4X3K A;  1IBK L;  1K9M C;  4B3M L;  4PNY A;  1MBY A;  5FLX L;  2O5I C;  1NJI C;  3KBG A;  1SFO H;  4GN3 B;  2JA6 H;  4DUZ L;  2IT1 A;  1YIT A;  1NSN S;  3CCR A;  2E2I H;  2VNU D;  4DNI A;  4FF2 A;  2KCM A;  1ROD A;  3CPW A;  1TS4 A;  3FHW A;  1FVI A;  2Z0S A;  2IY5 B;  1EIY B;  2QA4 A;  4H13 C;  2NZH A;  5C4X G;  1BBW A;  2NVQ H;  2C5C A;  4B9W A;  3W3A A;  1HNX L;  1IBM Q;  1V1Q A;  3CPF A;  4POF A;  2IWH A;  1GHJ A;  2N78 A;  3R2I A;  3HFZ B;  1Q3L A;  1CKO A;  3K0Y A;  3DMU A;  5IWA L;  3Q24 A;  1H9S B;  2O4X A;  1VF5 C;  3N6R A;  3U9O A;  4J8Q A;  1BUV T;  2PYK A;  3DWA A;  4A3G G;  4B08 A;  4ZYS A;  5C44 B;  2K6A A;  1LYL A;  1RKN A;  1ENF A;  3N52 A;  3QOL A;  4K5W A;  1GUN A;  3OMC A;  1PXU A;  4LFC Q;  4A3C G;  4K2L A;  1CHQ D;  4DR6 L;  2CFM A;  1X3P A;  3SHL A;  5BR8 Q;  3KF6 B;  3KLS X;  2ZM6 Q;  2HD3 A;  4OXP A;  3OSO A;  1L1O A;  3T51 B;  2IX3 A;  1A63 A;  1IYJ B;  5GAG C;  4LK1 C;  3S1N H;  2QEX A;  3AEV A;  3HOV G;  4DUZ Q;  1PA6 A;  1PH1 A;  4JBW A;  3HOX G;  4R8I A;  1U4L A;  5DEH A;  2J4X A;  1PH6 A;  4LF7 L;  2N3S A;  3ND8 A;  1G8Z D;  2A6H D;  1VQ6 A;  1F2M A;  3WDN A;  5CBA E;  4DV5 L;  4LFB Q;  4A93 B;  3W1B A;  2JA8 H;  1IL8 A;  4QUC A;  2C35 B;  3MAQ A;  2IL8 A;  2ZXR A;  5KGU A;  5DLQ E;  2QW7 A;  3BVZ A;  3MXG A;  2BOS A;  4JCV E;  3LWU A;  4GOP C;  4ZCK A;  2ZJR A;  2LXJ A;  1EL0 A;  1Z6H A;  2NWG A;  1B8A A;  1SYB A;  2NVT B;  4UDU C;  2EYH A;  4A3B H;  3VYU A;  4JI5 L;  4JI0 Q;  1PYS B;  2KED A;  5C3X A;  1GKH A;  1S3O A;  2CH4 W;  4H44 C;  2R93 H;  5IYC G;  3S15 B;  3S16 B;  5T1I A;  2K33 A;  3KF8 B;  1EIH A;  4JI6 Q;  3PUZ A;  1MSH A;  2RF4 A;  1HR0 Q;  4YHH Q;  3K81 C;  3RMH A;  5ELF A;  4HTH A;  3H6M A;  3KFU A;  4HCE A;  1VQO A;  1D1K A;  3EQL C;  1TWG B;  1KC8 C;  3Q23 A;  1ET6 A;  2RDH A;  4MZ9 A;  1Y1V H;  3H15 A;  2KEN A;  2K52 A;  4PZ7 A;  2K01 A;  5JJZ A;  4A3D H;  1J5E L;  4RFB A;  3KF6 A;  3JAM i;  3JAM L;  1IBM L;  3CXC A;  2B2W C;  2RQX A;  2OF1 A;  4YY3 L;  3I4M G;  3RLO A;  2ID0 A;  2A74 C;  1F2Y A;  3S1M H;  1R9T H;  2XN9 C;  4DV2 L;  2Q2H A;  1E2Z A;  4QL5 A;  3UDI A;  2DNC A;  2JA7 H;  4GKJ Q;  5EJW A;  3FRP B;  3CAM A;  2BH8 A;  3GTK H;  4L5Q A;  3ONA B;  2PI2 A;  1Y8O B;  1XJV A;  4P75 A;  2F0G A;  2B63 G;  1BO0 A;  1PRT D;  4DPG A;  4LF8 Q;  4GOP B;  4JV5 Q;  1LTG D;  2A68 D;  4DN4 M;  4RAU C;  5BN4 A;  2FXQ A;  2B2V C;  2JE6 I;  1I4R A;  4DXG A;  3CC4 A;  4Z9C B;  3F2U A;  2N8N A;  1EOT A;  2MO1 A;  1NNX A;  2NTT A;  1Z9F A;  1CSQ A;  1ZYR C;  2NUC A;  3CQZ H;  1GOZ A;  2E8G A;  5JVG 3;  4O1N A;  2F3I A;  3J7A V;  4GOP A;  1Q1B A;  3G4S A;  1S5C D;  1K0S A;  5FK9 C;  3L2P A;  4C3H G;  3W5O A;  1D1I A;  1QNK A;  1F2L A;  2WAQ G;  1VCI A;  3HOW G;  2JEA I;  4CHT B;  1UUP A;  4DXF A;  2K28 A;  4IUP A;  1S5E D;  1SRO A;  1G6P A;  3D0F A;  4UHV A;  3K5L A;  5CBE E;  1R4P B;  4BBS B;  1FR3 A;  1GUT A;  3RUZ A;  4FXG C;  2F0L A;  1YEZ A;  3J7A 5;  4B3M Q;  3SEB A;  4JI7 L;  4KKU A;  4DV3 L;  4JI2 Q;  1VQE A;  3S1M B;  2VUM H;  4FXK C;  4AQY Q;  3J80 c;  4DUY Q;  2UXC Q;  1XX8 A;  1TWC B;  2WAC A;  1Q81 C;  5JOB A;  1MJE A;  4B3S Q;  4LF9 Q;  3HRZ C;  5IP9 H;  4XDX A;  3R8B A;  1LTL A;  2F0K A;  3DEO A;  1F77 A;  3I4O A;  4NXM L;  5AJ3 L;  1CKN A;  4X66 L;  3QB3 A;  4DNR B;  2AQ2 B;  5IIF A;  5LMU L;  5EBC A;  1TII D;  1ASY A;  1KL9 A;  1VDZ A;  3C2P A;  2Q8R E;  3M4Q A;  4DV4 Q;  1S40 A;  3HKZ G;  4NKL A;  4BBR B;  3E9I A;  4DR3 Q;  1KLG D;  5KRU A;  1A6X A;  1YNJ D;  2R93 B;  3CD6 A;  4K14 A;  3D6W A;  3CCJ A;  1VF7 A;  2RSO A;  2JJQ A;  1Q1E A;  1SSO A;  1Q12 A;  3UE0 A;  1RL2 A;  5M3F H;  3MA2 B;  2BE5 C;  3PUV A;  2UUC L;  4JI4 L;  2F0I A;  1BBX C;  1FL0 A;  3GTM B;  3OWF A;  1YHQ A;  4HED A;  1GUO A;  5C4H A;  5FO9 B;  5LL6 X;  4JBJ A;  5JPM C;  3BYY B;  1ZXT A;  1PTO B;  1KQS A;  1J6Q A;  2IW3 A;  3WOF A;  1BCP F;  4ZQ3 A;  3GTJ H;  2MUY A;  1JJ2 A;  1LT6 D;  5NUC A;  2K5H A;  4DV7 L;  4A4I A;  5C3E G;  2Z4I A;  4N9P A;  3OPO A;  1CZW A;  3GTG B;  2B2U C;  2KOL A;  4DV0 L;  3NTH A;  1ESR A;  3DHQ A;  3VYT A;  3PF4 A;  4CJ0 B;  3HKZ B;  2AKW B;  4G4K A;  1I3Q B;  1GD7 A;  4E6I A;  1HR0 W;  1XNR Q;  2B3G A;  1AH9 A;  2F0Q A;  2ZTE A;  3GTK B;  4A3B G;  3NBH B;  1K8O A;  3RN5 A;  1XPU A;  2A6E D;  2UU9 L;  1GUG A;  1I94 L;  4ALP A;  3CCV A;  4IPH A;  1CTM A;  3HOW H;  3K57 A;  2KHI A;  2HUG A;  3ERS X;  4J1M A;  2SOB A;  3OTO L;  2QF7 A;  4IFD G;  5E7N A;  2R3Z A;  1KD1 C;  3V05 A;  1OXX K;  2JA8 G;  1CI3 M;  4O42 A;  2BA0 A;  2WAQ E;  4P73 A;  2QGQ A;  3SK5 A;  3I90 A;  2EJF C;  4BY1 H;  4LF4 Q;  2KEC A;  4XXE A;  3NTK A;  2HT1 A;  1VQF A;  2GVA A;  1PFM A;  2HQL A;  4YWM A;  3BG3 A;  1YNJ C;  1UNS A;  3D8G A;  3ITP A;  3TS0 A;  5IP7 H;  3EJI A;  5COR A;  1TT2 A;  1IXR A;  4H7B A;  2WV6 D;  3J80 E;  4AYB E;  1QJO A;  1ICW A;  1QNU A;  1EZ6 A;  4KY5 A;  4TKO B;  3K7A B;  1WTO A;  2EYO A;  1ILP A;  1XPR A;  4YCW A;  1BKB A;  2JK8 A;  2EIF A;  2WKD A;  4IOC A;  1KDC A;  2V4D A;  4DR3 L;  2E5L Q;  1ESF A;  1TVX A;  3VA7 A;  3UE1 A;  4RGT A;  4CDE C;  2IPK D;  1IYU A;  2CW0 C;  4R4T A;  5CYU A;  5FLM H;  3H3V I;  2F0F A;  1HNZ Q;  2AQ3 B;  5C4J H;  1K8G A;  3DM1 A;  1LLR D;  4LF6 Q;  1SFO B;  2E74 C;  2WKC A;  4KMU C;  4IUV A;  4WJ3 M;  3CCE A;  1EQQ A;  3NEL A;  4IOA A;  1LTI D;  3GV6 A;  2K4K A;  4HAE A;  3CCS A;  4BBS H;  4F7X A;  1NBW A;  4M1U B;  3RZD B;  3A7L A;  1OTC A;  2CKZ B;  1NR2 A;  1DOK A;  3GTL H;  1CQV A;  3Q8D A;  4A3F H;  1ML0 D;  1STB A;  1LAC A;  1E1T A;  1FNU A;  3HOU H;  4HIK A;  2N49 A;  4HIO A;  4GKJ L;  2GA4 B;  4FO2 A;  1QCB D;  3PGZ A;  4C3J B;  2K50 A;  5J3B A;  4GZY C;  2IX1 A;  3GTO H;  4TRD A;  3MXN A;  4TSS A;  4P74 A;  1V8Q A;  4LW1 A;  1MJC A;  5IY0 A;  4DV2 Q;  3OIQ A;  2OCE A;  1N33 Q;  3HOV B;  1K73 C;  1A3T A;  5IOC A;  4LF6 L;  3QOJ A;  1MD2 D;  2VQF Q;  3QIA A;  3ULP A;  4XTC S;  3CCM A;  2K5D A;  3CMA A;  1BDO A;  1H9R A;  3ULJ A;  1C9O A;  1V1O A;  4POG A;  1YBY A;  1RD9 D;  1SNC A;  1II3 A;  1Z7T A;  2B39 A;  1DZ1 A;  3A0J A;  3D4R A;  4JV5 L;  5IP9 G;  2JP1 A;  2WB1 E;  3PUW A;  2JA5 H;  4GKK L;  1XMQ Q;  3G71 A;  3GTM H;  1HFN A;  4DV6 L;  2WP8 J;  1VQB A;  1IYV A;  3BDL A;  3CCL A;  4DR4 L;  2QEJ C;  4GNX C;  5JEA H;  2MP1 A;  5IYB G;  3HOY H;  1VMP A;  4QGU A;  1E1O A;  2RHQ B;  3AB9 A;  3A5U A;  1V1P A;  1ZEQ X;  2CWP A;  3KOJ A;  3E5S A;  1TY2 A;  4RGO S;  1JB3 A;  3ND9 A;  4QIW E;  3R93 A;  2LS0 1;  4BBR H;  1OXT A;  3VA5 A;  2VB3 X;  3PO3 G;  2EJM A;  3DWP A;  2VW9 A;  1HH2 P;  3A54 A;  2F0V A;  4K6L A;  4H0L C;  5CV5 A;  1YNX A;  3B6Y A;  1PH8 A;  4RKB A;  4RH6 A;  1QE6 A;  1PYB A;  2Y0S B;  3CU7 A;  1BQQ T;  3M4P A;  1I4G A;  2F0O A;  3EIV A;  1JR0 D;  4A3K B;  1WD0 A;  1QIL A;  2VXW A;  5FO8 B;  1FNV A;  1HXY D;  4A75 A;  1TKW B;  2D0O A;  1HNW L;  1SMY D;  4LJZ C;  1L0W A;  3S1R H;  1A2U A;  1Q7Y C;  5IGG A;  2R7F A;  4ZUI A;  5BR8 L;  4M8A A;  2Y0S E;  5CV6 A;  1WCM H;  4J15 A;  5CV4 A;  5KIX A;  1HHV A;  4G57 A;  3ERQ A;  1K83 H;  1ONL A;  1CFM A;  4EQ5 A;  5BN3 A;  5C44 G;  3KJO A;  1LUZ A;  1O7Z A;  4A3G H;  3GTJ B;  1UE5 A;  3KYH C;  1Q82 C;  4HCS A;  4JI1 Q;  4A3F G;  3D4D A;  4X6A H;  3PO2 G;  4X62 L;  2YTX A;  4KI0 A;  4P2C B;  1KNE A;  1I4H A;  1QWY A;  2NB0 A;  5J1Z A;  4BXX G;  2PQA B;  1WI5 A;  4OHJ A;  1RHP A;  2DNE A;  4HR7 B;  2QKI C;  1IBL Q;  2P5Z X;  1K83 B;  3CC2 A;  3PIO 3;  1B7Y B;  1BXT A;  4IUQ A;  1EY6 A;  3CP0 A;  4QY7 A;  2CH4 A;  3VYS A;  4K8I A;  4HJ5 A;  3MVV A;  3ULL A;  1YJN A;  4PZ6 A;  4U67 3;  4AIM A;  4JPB W;  1HNX Q;  2R7Z H;  1F9S A;  1K8A C;  1VQI A;  1ASZ A;  1S5D D;  3P75 A;  4HMJ A;  3PIP A;  4HJ9 A;  3L9A X;  1SE4 A;  3NK9 A;  4DR6 Q;  2NVY B;  3I4N G;  2NVX B;  3M4O B;  2EYP A;  5M3M G;  1Y1W B;  2RCN A;  2NVQ B;  2NZ1 D;  1D8L A;  4JI1 L;  4QIW B;  1KRS A;  1XMO Q;  1FJG Q;  4A3M G;  2NYZ D;  3PO2 B;  4QJF A;  2OWO A;  4HJ8 A;  4FP5 D;  2ES2 A;  3TDQ A;  4DR1 L;  3F1Z A;  5IT9 c;  2BCO A;  2L11 A;  1EFI D;  5GAE C;  2UXD L;  2UUB L;  3OTO Q;  1VQN A;  3DEP A;  3WOE A;  4NXM Q;  2A1A A;  3KLW A;  4CDD C;  3KUP A;  4B3R L;  5E3F A;  4A3I H;  2B2T A;  3F2C A;  4A3G B;  2C9O A;  1Q90 A;  4WJ4 A;  2EYL A;  2YTV A;  4J6H A;  3S14 H;  1UE6 A;  4IUU A;  1KXL A;  3A8J E;  1U4R A;  2EJG C;  3C3L A;  2R61 A;  1EQV A;  2XVS A;  1X65 A;  3X3N A;  1A0I A;  1D5Z C;  5ELC A;  1KIX A;  4ID6 A;  1XPO A;  3NEN A;  3D4W A;  1SAP A;  1LTT D;  2KCN A;  4EGV A;  1SYD A;  4C3J G;  2RDF A;  4ZUJ A;  5M5Y B;  4K0K L;  4DNT B;  2HDM A;  1PZI D;  4IZ8 A;  1U4M A;  1SYG A;  3UDG A;  4KKT A;  1M8A A;  1NR4 A;  4A3M B;  1QZG A;  4A93 G;  3T4A C;  5IP7 G;  5FJ8 H;  1C4Q A;  1Q86 C;  1SYC A;  5HGT A;  2NVY H;  1EYD A;  4DAP A;  1KTK A;  2VUM B;  2RSN A;  3E0E A;  2WIN B;  4CKC A;  1S72 A;  2NZO A;  4LNQ A;  2YU9 H;  1HNZ L;  2A6H C;  4JI2 L;  2EY2 A;  1WTW A;  3GQB A;  4NMZ A;  2M9V A;  5C5M A;  3S1Q B;  3OHX C;  4LF5 Q;  1SNQ A;  4DR5 L;  3KJP A;  4A76 A;  1GXD C;  1WTX A;  1QG7 A;  2G5D A;  3UDF A;  1N32 L;  3BDO A;  1E3P A;  2YTY A;  4X3T A;  4F87 A;  1E24 A;  3MWY W;  1ICF B;  3TSS A;  4BY7 H;  5GQO A;  2UU9 Q;  1LT3 D;  1YI2 A;  5DM6 3;  1CA5 A;  2KHJ A;  3OOC A;  2V1C C;  3HP3 A;  3PF5 A;  5J39 A;  3VR4 A;  2I07 B;  1L0Y B;  3TP5 A;  4RA8 A;  1LV9 A;  1H9M A;  3K58 A;  3BZK A;  3J80 i;  2RBM A;  1HQR D;  5IGD A;  2R7Z G;  2VL6 A;  4HID A;  4UPA A;  2EYJ A;  2N55 A;  3ERO A;  3UDX A;  5EPL A;  4OWX B;  4A3D G;  3T1H L;  1PFB A;  4OEL B;  3FMC A;  1G2S A;  2QCP X;  3Q6S A;  1A15 A;  2PO4 A;  4I65 A;  3RZD H;  5K36 H;  4DR5 Q;  1GVP A;  3AFQ A;  3I4N B;  5TSS A;  1N32 Q;  1AZQ A;  4A93 H;  2Q2U A;  4Y7N H;  3OW2 A;  4LF4 L;  4P71 A;  4DV7 Q;  2WB1 B;  1HFG A;  2JSO A;  1B53 A;  1STA A;  3SK6 A;  4EX5 A;  1JE5 A;  3CME A;  1EY5 A;  1SND A;  4BY1 B;  4DV3 Q;  4K5V A;  5EKK A;  5M3F G;  2TSS A;  4X66 Q;  1C48 A;  3EVQ A;  5JJK A;  4ULL A;  1EUJ A;  2PNH A;  4OON A;  4PMC A;  1I94 Q;  4C3H H;  1H95 A;  2K1B A;  5M5Y H;  5GRO A;  1HJP A;  1WTR A;  2F0E A;  2AHO B;  2BDN A;  1CZG A;  5JVH 3;  4JI7 Q;  5DAU A;  3RR5 A;  3MFG A;  3S15 H;  1SMX A;  3LNN A;  5ELD A;  4GLX A;  1X55 A;  1B70 B;  2LY7 A;  5C3E B; 
#chains in the Genus database with same CATH homology
 2O5J C;  1CM9 A;  1IHZ A;  1OXU A;  1UEA B;  2HQE A;  3K5N A;  1FYC A;  2D2C C;  1STH A;  2HCC A;  5I9P A;  4HN7 A;  3A8I E;  2L1B A;  1CA6 A;  2B2Y C;  3H0G B;  2JA8 B;  3S14 B;  4K6D A;  4LMQ D;  1AEX A;  1BCP D;  5D3D A;  1T5X D;  1TS5 A;  3OIP A;  2PQE A;  3H09 A;  1Y8P B;  1B2T A;  2Q8I B;  4DAV A;  3TZD A;  1JQY D;  4QMG A;  5M5X B;  3S1N B;  2NBF A;  5C0X I;  3G6J B;  1PYW D;  2A5H A;  3NE5 B;  2TMP A;  3QG1 A;  1EU4 A;  1DYQ A;  3NTI A;  4RCO A;  2R7Z B;  2CHB D;  1M4V A;  3J81 L;  3MXU A;  2XRQ D;  4R8N A;  1HTP A;  1TQO A;  3SR1 A;  4HSV A;  5A2Q E;  5KND A;  2E2I B;  4RGN A;  5I2X A;  2A6E C;  3KLR A;  3GTP B;  4XQQ A;  1SDF A;  5ELB A;  1B4O A;  2PZU A;  3IL8 A;  3HZX A;  1ILQ A;  1FD7 D;  1SNP A;  1OXV A;  2L4N A;  1JWU D;  3VYR A;  1I6H B;  1EYC A;  2WII B;  1O7Y A;  5M3F B;  4KHV A;  1AN8 A;  5C0X G;  1GJX A;  3P20 A;  5I6W A;  1WCM B;  4KJO A;  2B2W A;  2F03 A;  1LTB D;  2JYO A;  1LAB A;  2ZXO A;  4XQN A;  4X3U A;  4EQO A;  2D9U A;  4A3E B;  4NDX A;  3X3M A;  2EOT A;  4RWS C;  1BCP B;  3R3O A;  3CQZ B;  2L12 A;  5IGB A;  3Q0A A;  3S2D B;  3KF8 A;  1H9S A;  3NP8 A;  2K5Q A;  1JE4 A;  2B2Y A;  4FYD A;  1PZK D;  3LX0 A;  5I2Y A;  1Z47 A;  3I73 A;  1X32 A;  3TBI B;  2X6G A;  4ME5 A;  3PUX A;  3E6Z X;  3TZU A;  1STE A;  5M9O A;  3BVG A;  4OO1 I;  4Y7N B;  2M00 A;  3H91 A;  3SVM A;  1ET9 A;  3CHB D;  4IFD I;  1XWE A;  2X69 A;  1CHP D;  2LKV A;  1EU3 A;  2JA7 B;  2KA7 A;  3FVQ A;  4C3I B;  4IFD H;  4FF3 A;  4FXD A;  2PW5 A;  2R6G A;  4ZKB B;  3CKI B;  1DXM A;  1IW7 C;  3A55 A;  2ICE C;  1AZP A;  4QUF A;  2HCI A;  2L55 A;  4PMB A;  3L3O C;  3CRL C;  3NHH A;  1OO9 B;  2BE5 D;  1EEF D;  3M7N A;  2AUK A;  2G9H D;  1ENC A;  1IKM A;  3TME A;  5HUR A;  4WFN 3;  3NQI A;  3V96 A;  1KAA A;  2DN8 A;  1S5F D;  1S4Z A;  1U4P A;  1SNO A;  3E0J A;  1KDA A;  2Z1C A;  1SXT A;  2MJ8 A;  5BN5 A;  4CJ2 C;  3GTL B;  3PMF A;  2CVR A;  5C0X H;  2F0U A;  2EY5 A;  3FPP A;  2N88 A;  5COY A;  4CKB A;  2F0N A;  5EQ0 A;  4PMW A;  1LTS D;  1JCK B;  1KNA A;  1ZKO A;  4I7Z C;  1STY A;  4LAA A;  3J7A F;  2F3V A;  2SEB D;  1I4Q A;  1PZJ D;  3I91 A;  3G7L A;  2O2L D;  5AFW A;  3JAM E;  4A3D B;  2B8G A;  3ZYY X;  5G3L D;  1B1Z A;  3HOW B;  1GUW A;  2E2D C;  2ICI A;  2JA5 B;  1L0X B;  1WVL A;  2XWJ B;  4Q5V A;  3D31 A;  4ZAI A;  2PZT A;  3FDT A;  3S9W A;  5CV8 A;  5CGK A;  2EY1 A;  1SYF A;  1K8M A;  1PMR A;  5IOD A;  1QOH A;  5M3M B;  2PW7 A;  1D5X C;  2L0C A;  4BA1 I;  1HTL D;  3I70 A;  1TY0 A;  1HPC A;  2PNR C;  1LT5 D;  1HCZ A;  1WD1 A;  1AFP A;  3K59 A;  4OGQ C;  1UAP A;  4BY7 B;  4IUR A;  5C0X J;  3PIP 3;  5FLX E;  1QB5 D;  1B3A A;  4ZLT F;  2VB2 X;  2K03 A;  2XIW A;  1XTC D;  4KY6 A;  1SBB B;  3QWN A;  3HOX B;  4L8J A;  2DY7 A;  4MHE A;  1I4P A;  3NWT A;  2B2V A;  3OW7 A;  1VMC A;  1LO5 D;  1Y1V B;  5C4Z A;  2BA1 A;  5CV9 A;  2E2H B;  1MSG A;  1BF4 A;  2Z4H A;  4IUN A;  5A35 A;  4IQZ A;  4CJ1 B;  3I72 A;  4XYO A;  3BYT B;  3PV0 A;  4S3S A;  2JA6 B;  1DCZ A;  3SK8 A;  4DK0 A;  1G91 A;  4ODG A;  4G7H C;  4C1N I;  2OT2 A;  3HGB A;  4RKL A;  2MHV A;  1TS2 A;  3NBH A;  2K7V A;  4ZRZ A;  2K32 A;  5CR3 A;  1EZ8 A;  2MGS A;  1NUC A;  1BCP C;  5JEA J;  3P1H A;  3IAY A;  3S2H B;  3DXJ C;  5JPN C;  3IFT A;  3UI2 A;  5JAV A;  5KNB A;  1TWA B;  5EGT A;  3IKJ A;  2LFN A;  2X6L A;  3T56 B;  4L63 B;  1PTO F;  3MFY A;  3VR3 A;  2K04 A;  4Q0F A;  2FMC A;  1E2V A;  3J7Y W;  1DOL A;  1EY0 A;  5DM7 3;  2RA4 A;  5CC4 A;  3TP8 A;  5DNF A;  2PZW A;  1ENA A;  1I50 B;  4TQU S;  4CKE A;  2KQ3 A;  4C1N K;  3J81 E;  2A68 C;  1HUN A;  3Q22 A;  2B2U A;  5KEE A;  2L9H A;  1WTP A;  5C4X B;  4C56 C;  2EXZ A;  2B8F A;  4X3S A;  1D2B A;  2JEB I;  2XNA C;  1RF2 D;  2KVM A;  3W2D A;  3I8Z A;  4V0B A;  1STN A;  2RKS A;  3OWE B;  4XT3 B;  2EE1 A;  2NTS A;  3M3Y B;  1Y8N B;  3MTS A;  5M5W B;  1PLF A;  1WTQ A;  1JOK A;  5I9O A;  3I3C A;  1H9J A;  1I4X A;  3URY A;  4OIJ A;  1H9K A;  3A8K E;  4F8M A;  4WJW A;  3NQT A;  1C8C A;  3T16 A;  3HOU B;  2XRS D;  4NP5 A;  4XIG S;  2F0J A;  3TP7 A;  3S1R B;  4KN4 C;  4KJN A;  1F2Z A;  5KNC A;  1XYI A;  4JK1 C;  4N9T A;  2SDF A;  2EYM A;  2FIN B;  3A56 A;  5C5L A;  3IFD A;  2J0T D;  5KYI A;  2G9D A;  4C3H B;  2HDL A;  3CRK C;  3H94 A;  1GHK A;  2IJ0 A;  1EY9 A;  1NCV A;  1TWF B;  4B9X A;  1PRT B;  5D14 A;  2E75 C;  4U68 A;  3NWS A;  1CT1 D;  3RZO B;  1SEB D;  1F9P A;  1E0B A;  3U9S A;  5IT9 E;  4C2M B;  2EZV A;  5G3L F;  3NUC A;  5I4D A;  2XSC A;  4YIJ A;  3EA6 A;  1DJR D;  3EFX D;  1V1P B;  1R4Q B;  2H1E A;  1Q8I A;  2B63 B;  5EBD A;  1DM0 B;  4QF4 A;  5CMD A;  5IT9 L;  1WTV A;  1EY7 A;  5LL6 S;  1PFN A;  1MI2 A;  1O7L A;  3P7J A;  2PMZ B;  1FNW A;  3NPP A;  5T1G A;  2PCF B;  3VR6 A;  2ZXP A;  4XQJ A;  5E4X A;  3GO5 A;  4OIK A;  4R9W A;  3R2T A;  3AU7 A;  3C46 A;  5C3W A;  4FNF A;  2BDO A;  5EKL A;  1W6J A;  1BR9 A;  1O78 A;  5ELE A;  1GUS A;  5KYL A;  1BNZ A;  2AQ1 B;  1D6E C;  2KCC A;  1LT4 D;  4EVO A;  3BZD B;  1J9O A;  5IGF A;  1TU2 B;  1TWH B;  5IGE A;  3MZ5 A;  1A3U A;  5C4J B;  3PUY A;  3NSW A;  4QB4 A;  2LMC B;  1ZYR D;  2E2J B;  4CBV A;  4DU9 A;  3K5O A;  1LTR D;  1SE3 A;  3M4Y A;  1O80 A;  4ZKC B;  4CGY B;  3FPU B;  4OL7 A;  1PTO H;  1HQM C;  3HOY B;  5JEA G;  3PO3 B;  1X3Q A;  1EIG A;  3RD4 A;  3I4L A;  3TP6 A;  3A7A B;  1STG A;  1BOS A;  3MEH A;  2SNM A;  3O13 A;  3KBX A;  3VR2 A;  3GP7 A;  2F0M A;  4DF7 A;  1NAP A;  2F0D A;  4MN3 A;  1D5M C;  2B2T C;  1PTO C;  3NXW A;  5EKI A;  4KN7 C;  1PTO D;  1YNN C;  3QJY A;  2A69 C;  3DWQ A;  1S5B D;  4RHS A;  2M2L A;  2EDG A;  2FJ2 A;  3SXH A;  1RTN A;  2D5D A;  1RTO A;  2WAQ B;  1KDB A;  4DGZ A;  4NW2 A;  3SE0 A;  5E4W C;  4OO1 G;  5K5P A;  2MPM A;  2Z8L A;  3BDC A;  1IW7 D;  1A3V A;  2F3W A;  1F9R A;  4HSP A;  1HRJ A;  4KD4 A;  4KY7 A;  3HS0 C;  1DOM A;  2IX0 A;  3T13 A;  3MC0 B;  4BWG B;  1EWC A;  1FGB D;  1JOQ A;  3D3R A;  4BS9 A;  2NN6 G;  4K2K A;  3C1E A;  1JWS D;  2SNS A;  2CW0 D;  2YYZ A;  2F0H A;  1CK1 A;  2E76 C;  3TN2 A;  1B9M A;  1JIC A;  3FEW X;  3BS1 A;  1PDQ A;  1HA6 A;  1T5E A;  3SDZ A;  3C1F A;  1OXS C;  3VR5 A;  4EQN A;  4PV1 C;  3V2T A;  1I6V C;  2FHT A;  4XYQ A;  2I46 A;  5EPJ A;  4G7Z C;  3BVM A;  3LWE A;  2AUJ D;  2JXM B;  4DK1 A;  5A2Q L;  2CQA A;  5K36 G;  1B50 A;  3KLS A;  2R92 B;  2NN6 I;  1V43 A;  4FF4 A;  2KHS A;  1B44 D;  1IKL A;  1YNN D;  4ZK9 B;  1F9Q A;  1RCV D;  2ZT9 C;  1DON A;  4RCN A;  5D65 A;  1EEI D;  1TR5 A;  2XWB B;  4F88 A;  4MIU A;  1JOR A;  4AYB B;  1SJE D;  2F0S A;  4RHR A;  5J22 A;  1EQT A;  2K05 A;  1HUM A;  4KK7 A;  2DY8 A;  1EY8 A;  1EYA A;  5C6A A;  4K8J A;  3GV3 A;  5CV7 A;  1EY4 A;  4KD3 A;  4A3J B;  2FMM A;  2KUM A;  4FF1 A;  2F4I A;  4ILW A;  4A3B B;  1AP0 A;  3J80 L;  2EYF A;  1SNM A;  1Y69 U;  4KKS A;  3SK4 A;  3T53 B;  4PQX A;  2EPB A;  2F0T A;  1JOO A;  3H3V C;  4IAL A;  1KAB A;  3GTO B;  1A2T A;  2AWO A;  2KEE A;  1RJT A;  4FVM A;  2PPB C;  5FO7 B;  4A3F B;  3OMG A;  1HA5 A;  2YU9 B;  1DD2 A;  2EY6 A;  3M7G A;  2Q8T A;  4C3I G;  1R9T B;  5FKA C;  4IFD J;  4QCL A;  1PRT C;  4KV6 A;  3D6C A;  1CQF A;  3RLF A;  3K6O A;  4DA2 A;  3KK7 A;  3K5M A;  1G2T A;  3L7Z C;  4XT1 B;  1PRT F;  4IUT A;  4DAY A;  3GTQ B;  5IGC A;  1G29 1;  2FFK B;  4EQP A;  2EVB A;  4DFA A;  4KTA A;  2OEO A;  5F2D A;  1SYE A;  3MXP A;  2KJX A;  4RGM A;  1XXG A;  2F1M A;  1KLU D;  3M85 A;  2F0P A;  1SE2 A;  4UAI A;  3DUZ A;  3I4M B;  4A3I B;  3QO2 A;  2L5T A;  1LTA D;  4OO1 H;  4IN3 A;  4G7O C;  3MHB A;  2A73 B;  2OXP A;  2ENB A;  3GD7 A;  3HEJ A;  1U9R A;  2K5W A;  1MGS A;  2RDG A;  2D62 A;  2A69 D;  2NN6 H;  5ISR A;  3HOZ B;  1J8I A;  3AMU A;  4BA2 I;  4WOR A;  2QDB A;  4KHZ A;  1EWH A;  1AW7 A;  2AWN A;  1W6K A;  1TS3 A;  3FKI B;  3NBI A;  1SMY C;  3HG9 A;  5D3I B;  1JWM D;  4V19 0;  5FOB B;  1G6Z A;  2F0W A;  4WRD A;  1E2W A;  5I6Y A;  1JC7 A;  3S17 B;  2H4O A;  2QIL A;  4ABN A;  4L6T B;  5LHY 1;  1RDP D;  1SJH D;  2J7Z A;  5E1F A;  4K5X A;  4HMI A;  2RVL A;  1B9N A;  5EPK A;  4X3K A;  4PNY A;  1MBY A;  5FLX L;  2O5I C;  3KBG A;  2IT1 A;  1NSN S;  2VNU D;  4FF2 A;  1ROD A;  1TS4 A;  4H13 C;  2C5C A;  4B9W A;  3W3A A;  2IWH A;  1GHJ A;  3R2I A;  1Q3L A;  3K0Y A;  3DMU A;  3Q24 A;  1H9S B;  2O4X A;  1VF5 C;  3N6R A;  3U9O A;  4J8Q A;  1BUV T;  2PYK A;  3DWA A;  4B08 A;  4ZYS A;  5C44 B;  2K6A A;  1RKN A;  1ENF A;  3N52 A;  3QOL A;  4K5W A;  1GUN A;  3OMC A;  1PXU A;  4K2L A;  1CHQ D;  1X3P A;  3SHL A;  3KLS X;  3OSO A;  3T51 B;  2IX3 A;  4LK1 C;  4JBW A;  4R8I A;  1U4L A;  5DEH A;  2J4X A;  3ND8 A;  1G8Z D;  2A6H D;  5CBA E;  1F2M A;  3WDN A;  4A93 B;  1IL8 A;  4QUC A;  3MAQ A;  2IL8 A;  2ZXR A;  5KGU A;  3BVZ A;  3MXG A;  2BOS A;  3LWU A;  1EL0 A;  1Z6H A;  2NWG A;  1SYB A;  2NVT B;  4UDU C;  2EYH A;  3VYU A;  2KED A;  5C3X A;  4H44 C;  3S15 B;  3S16 B;  5T1I A;  2K33 A;  1EIH A;  3PUZ A;  1MSH A;  3RMH A;  5ELF A;  4HTH A;  3H6M A;  4HCE A;  1D1K A;  3EQL C;  1TWG B;  3Q23 A;  1ET6 A;  2RDH A;  2K01 A;  5JJZ A;  4RFB A;  3JAM L;  2B2W C;  2RQX A;  2OF1 A;  2ID0 A;  2A74 C;  1F2Y A;  2XN9 C;  1E2Z A;  2DNC A;  5EJW A;  3FRP B;  3ONA B;  1Y8O B;  2F0G A;  1BO0 A;  1PRT D;  1LTG D;  2A68 D;  4DN4 M;  4RAU C;  5BN4 A;  2B2V C;  2JE6 I;  1I4R A;  4DXG A;  4Z9C B;  3F2U A;  1EOT A;  2NTT A;  1ZYR C;  2NUC A;  1GOZ A;  5JVG 3;  4O1N A;  3J7A V;  1Q1B A;  1S5C D;  5FK9 C;  4C3H G;  1D1I A;  1QNK A;  1F2L A;  1VCI A;  2JEA I;  4CHT B;  1UUP A;  4DXF A;  2K28 A;  4IUP A;  1S5E D;  3K5L A;  5CBE E;  1R4P B;  4BBS B;  1FR3 A;  1GUT A;  3RUZ A;  4FXG C;  2F0L A;  3SEB A;  4KKU A;  3S1M B;  4FXK C;  1XX8 A;  1TWC B;  2WAC A;  5JOB A;  3HRZ C;  4XDX A;  3R8B A;  2F0K A;  3DEO A;  1F77 A;  3QB3 A;  4DNR B;  2AQ2 B;  5IIF A;  5EBC A;  1TII D;  1VDZ A;  3C2P A;  2Q8R E;  4NKL A;  4BBR B;  1KLG D;  5KRU A;  1A6X A;  1YNJ D;  2R93 B;  4K14 A;  3D6W A;  1VF7 A;  2RSO A;  1Q1E A;  1SSO A;  1Q12 A;  3MA2 B;  2BE5 C;  3PUV A;  2F0I A;  1BBX C;  3GTM B;  3OWF A;  4HED A;  1GUO A;  5C4H A;  5FO9 B;  5LL6 X;  5JPM C;  3BYY B;  1ZXT A;  1PTO B;  2IW3 A;  3WOF A;  1BCP F;  4ZQ3 A;  2MUY A;  1LT6 D;  5NUC A;  2Z4I A;  4N9P A;  3OPO A;  1CZW A;  3GTG B;  2B2U C;  2KOL A;  3NTH A;  1ESR A;  3DHQ A;  3VYT A;  4CJ0 B;  3HKZ B;  4G4K A;  1I3Q B;  4E6I A;  2F0Q A;  3GTK B;  1K8O A;  2A6E D;  1GUG A;  1CTM A;  3K57 A;  2HUG A;  4J1M A;  2SOB A;  2QF7 A;  4IFD G;  2R3Z A;  3V05 A;  1OXX K;  1CI3 M;  4O42 A;  2BA0 A;  3SK5 A;  3I90 A;  2EJF C;  2KEC A;  4XXE A;  3NTK A;  1PFM A;  3BG3 A;  1YNJ C;  1UNS A;  3D8G A;  3ITP A;  3EJI A;  5COR A;  1TT2 A;  4H7B A;  2WV6 D;  3J80 E;  1QJO A;  1ICW A;  1QNU A;  1EZ6 A;  4KY5 A;  4TKO B;  3K7A B;  1WTO A;  2EYO A;  1ILP A;  2WKD A;  1KDC A;  2V4D A;  1ESF A;  1TVX A;  3VA7 A;  4RGT A;  2IPK D;  1IYU A;  2CW0 C;  5CYU A;  2F0F A;  2AQ3 B;  3DM1 A;  1LLR D;  1SFO B;  2E74 C;  2WKC A;  4KMU C;  4IUV A;  1LTI D;  3GV6 A;  4HAE A;  4F7X A;  4M1U B;  3RZD B;  3A7L A;  1NR2 A;  1DOK A;  1CQV A;  1ML0 D;  1STB A;  1LAC A;  1FNU A;  2GA4 B;  4FO2 A;  1QCB D;  4C3J B;  4GZY C;  2IX1 A;  4TRD A;  3MXN A;  4TSS A;  1V8Q A;  3OIQ A;  3HOV B;  1A3T A;  5IOC A;  3QOJ A;  1MD2 D;  3QIA A;  4XTC S;  2K5D A;  1BDO A;  1H9R A;  1V1O A;  1RD9 D;  1SNC A;  1II3 A;  1Z7T A;  2B39 A;  1DZ1 A;  3D4R A;  2JP1 A;  3PUW A;  1HFN A;  2WP8 J;  1IYV A;  3BDL A;  2QEJ C;  5JEA H;  2MP1 A;  1VMP A;  3AB9 A;  1V1P A;  1ZEQ X;  3E5S A;  1TY2 A;  4RGO S;  1JB3 A;  3ND9 A;  3R93 A;  2LS0 1;  1OXT A;  3VA5 A;  2VB3 X;  2EJM A;  3DWP A;  3A54 A;  2F0V A;  4K6L A;  4H0L C;  5CV5 A;  4RKB A;  4RH6 A;  1QE6 A;  2Y0S B;  3CU7 A;  1BQQ T;  1I4G A;  2F0O A;  1WD0 A;  1JR0 D;  4A3K B;  1QIL A;  2VXW A;  5FO8 B;  1FNV A;  1HXY D;  1TKW B;  1SMY D;  4LJZ C;  1A2U A;  5IGG A;  4ZUI A;  4M8A A;  5CV6 A;  5CV4 A;  1HHV A;  5KIX A;  4G57 A;  3ERQ A;  1ONL A;  1CFM A;  5BN3 A;  1O7Z A;  3GTJ B;  4HCS A;  3D4D A;  4KI0 A;  4P2C B;  1KNE A;  1I4H A;  1QWY A;  2NB0 A;  5J1Z A;  4OHJ A;  1RHP A;  2DNE A;  4HR7 B;  2QKI C;  1K83 B;  3PIO 3;  4IUQ A;  1BXT A;  1EY6 A;  3VYS A;  4K8I A;  3MVV A;  4U67 3;  1F9S A;  1S5D D;  3P75 A;  4HMJ A;  3L9A X;  1SE4 A;  3NK9 A;  2NVY B;  2NVX B;  3M4O B;  2EYP A;  1Y1W B;  2NVQ B;  2NZ1 D;  4QIW B;  2NYZ D;  3PO2 B;  4FP5 D;  3TDQ A;  2BCO A;  2L11 A;  1EFI D;  3DEP A;  3WOE A;  3KUP A;  5E3F A;  2B2T A;  4A3G B;  2C9O A;  1Q90 A;  2EYL A;  4J6H A;  4IUU A;  3A8J E;  1U4R A;  2EJG C;  3C3L A;  2R61 A;  1EQV A;  2XVS A;  3X3N A;  1D5Z C;  5ELC A;  4ID6 A;  3D4W A;  1SAP A;  1LTT D;  2KCN A;  4EGV A;  1SYD A;  4C3J G;  2RDF A;  4ZUJ A;  5M5Y B;  4DNT B;  2HDM A;  1PZI D;  4IZ8 A;  1U4M A;  1SYG A;  4KKT A;  1M8A A;  1NR4 A;  4A3M B;  3T4A C;  1C4Q A;  1SYC A;  5HGT A;  1EYD A;  4DAP A;  1KTK A;  2VUM B;  2RSN A;  2WIN B;  4CKC A;  2A6H C;  2EY2 A;  1WTW A;  3GQB A;  4NMZ A;  2M9V A;  5C5M A;  3S1Q B;  3OHX C;  1SNQ A;  1GXD C;  1WTX A;  1QG7 A;  3BDO A;  4X3T A;  4F87 A;  3MWY W;  3TSS A;  1LT3 D;  5DM6 3;  1CA5 A;  3OOC A;  3HP3 A;  5J39 A;  3VR4 A;  2I07 B;  1L0Y B;  3TP5 A;  3K58 A;  1LV9 A;  1H9M A;  4RA8 A;  2RBM A;  1HQR D;  5IGD A;  2EYJ A;  2N55 A;  3ERO A;  5EPL A;  1PFB A;  3FMC A;  1G2S A;  2QCP X;  3Q6S A;  1A15 A;  2PO4 A;  4I65 A;  5K36 H;  3I4N B;  5TSS A;  1AZQ A;  2WB1 B;  1HFG A;  2JSO A;  1B53 A;  1STA A;  3SK6 A;  4BY1 B;  1EY5 A;  1SND A;  4K5V A;  5EKK A;  2TSS A;  1C48 A;  3EVQ A;  4ULL A;  4PMC A;  2K1B A;  1WTR A;  2F0E A;  2BDN A;  1CZG A;  5JVH 3;  5DAU A;  3MFG A;  3LNN A;  5ELD A;  2LY7 A;  5C3E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...