1LU1A

The structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
253
structure length
253
Chain Sequence
b'ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPSKASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
molecule tags Lectin
source organism Vigna unguiculata subsp. cylindrica
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
total genus 52
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 1998-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lu1A00
1V6JA 1I1EA 4XXPA 1GYKA 3ZPYA 2ZGSA 1DQ6A 4R9CA 2YROA 5HCBA 5T5JA 5DZGA 2PHWA 4PBOA 1WW4A 1W0OA 2DVFA 1QNWA 4XJWA 1GSLA 1S0BA 2ZHNA 1DFQA 5DZFA 1DQ2A 1BJQA 1D2SA 2R49A 1LOBA 2D6OX 3DUIA 3NV2A 3MW2A 1DBNA 2AR6A 1AJKA 1HQWA 2G4IA 2LTNA 2UWCA 1AZDA 1LOFA 2WT0A 5H9QA 4BLJA 5HCAA 1ZA4A 3MW4A 4YGBA 1RITA 5F5QA 2A6VA 1FAYA 5HCFA 5GZFA 2D6KA 2ZBJA 3AZZA 4ATFA 4LBMA 5DUVA 2AUYA 4BPZA 3APBA 3IM0A 3AZXA 2ZA9A 1J1TA 1MS5A 2E7QA 4Y24A 1C4RA 1DGLA 1LOEA 5T54A 4BOWA 3KQRA 2P3IA 3AZYA 1GBGA 2R0HA 2ZKNA 1LECA 1HKDA 3RS6A 2D6LX 2RHPA 5AVAA 1WD4A 3B3QE 3OYWA 3OBRA 2OW4A 1QDCA 4AWDA 3AXDA 1V6KA 2B7YA 3FUQA 1SBFA 1WCSA 4RA0A 2OUHA 3WZ1A 3ZXEA 4L8QA 1DQ0A 3USUB 2WSVA 4XJZA 2YY1A 4YZ3A 2ZHLA 4FPLA 2A6XA 5FREA 5JOWA 5L73A 4BMBA 2ZGKA 1Y7BA 4P14A 3Q9OA 1QNYA 4WVVA 5JOXA 1X50A 3WG3A 3V65A 3WDXA 2ENRA 4YW1A 1S1AA 4IQPA 1G9BA 1YIFA 5IT6A 1VIWB 3U4XA 4YG0A 3LSEA 2ARXA 4XTMA 3UK9A 2FHRA 2D7FA 1SCSA 4DFSA 2VW2A 3N36A 2D3SA 1Q8SA 3M3EA 2C9AA 5EXOA 5H9SA 1MS0A 4ASMB 3AJYA 3SH5A 2ZMNA 3RG0A 4P9XA 4K20A 2LALA 2UURA 2DU1A 4FPEA 2ZGRA 2A3XA 2CWMA 1QOSA 1W6OB 2R1DA 4GALA 4XMAA 3NV3A 3VKMA 1DQ1A 3AYDA 2UWBA 1PZ9A 4XJ8A 2E7TA 2AH2A 2P34A 3ZSKA 1KDKA 4YW5A 4YGDA 3WLUA 4GWMA 4XIOA 2E53A 1H30A 4ZXKA 1Z0HA 1W6QA 5DUXA 1BYHA 2AGSA 2ZMKA 2D43A 3ILRA 3NWKA 2NMOA 3VKOA 3R05A 3M3CA 2W08A 4H55A 5GLZA 1MS1A 4YM3A 2GN7A 3D4KA 1N3PA 4YZ2A 4DRVA 1G8WA 4ISRA 4YM1A 3RMYA 3I8TA 2EALA 1N3OA 4XZPA 3FUOA 4RL7A 3I4IA 3PVNA 4WVWA 1DIWA 4PCRA 3ATGA 4FOYA 1AX1A 1WW7A 1KQRA 2BQPA 2ZGPA 2GNTA 3BIWE 4NOTA 1LHVA 1MS3A 1S0JA 4XILA 3WVJA 1O4ZA 5T50A 1ULGA 4Y20A 3ZYPA 4CRQA 1LGCA 4BLIA 5GZGA 1KJRA 1IS4A 4Y1UA 4YZ1A 4FPCA 1UL9A 1YO8A 4P9WA 3V0BB 4KBBA 1CN1A 1D0HA 2P3KA 1WD3A 3D6EA 3GALA 4LBOA 5GZEA 3W59A 3ZXLA 5KXEA 4AGRA 1GV9A 4M3CE 1WUVA 3N7JA 4YGCA 5EYXA 3ZYRA 3HMYA 1MZ6A 3POYA 1JBCA 1Q8PA 2ZMLA 3WDUA 4F83A 1O4YA 1B09A 4K1ZA 1VAMA 4LBJA 4D69A 2ZGMA 2CWSA 1HLCA 1F9KA 4PF5A 4Q8KA 1H9PA 1F31A 2ZGNA 3INAA 3NV4A 5GM0A 5CBLA 3TAYA 2GN3A 5CNAA 4XOGA 1CONA 4XJAA 5DXDA 1LHUA 1LESA 4XBQA 1XQNA 1CJPA 1LULA 2W52A 4XE9A 2ZGTA 2JJ6A 4M00A 2ZGUA 2UU8A 4Y1YA 1FV3A 1V6LA 4XIKA 1W6MA 5T5OA 3WOGA 1CQ9A 2PHUA 1FNZA 1LOAA 4W65A 2XG3A 1ZM1A 1WLCA 1NXD1 3O0XA 4XJ9A 1SLAA 3HR9A 4Y20B 4U2AA 1KITA 2DWRA 1LEDA 1LENA 1WW5A 3AYEA 5GJ6A 2E51A 4GKYA 2EAKA 1DZQA 4AVVA 3VKFC 4HL0A 2P2KA 1GZWB 1SFYA 2GNDA 4LBQA 2WT1A 4R9BA 5FRAA 2EXJA 3UJOA 3T1MA 3PVEA 3AZVA 4M3CB 3B01A 3IPVA 5T5PA 5JOZA 1UMZA 4FPHA 4YZ4A 1DYPA 3FFZA 3R4UA 3ZXJA 5LK5A 4M01A 1SACA 3WDYA 1JUIA 1N47A 2A6YA 3ZSJA 4Y1XA 5IUQA 3WG1A 2R16A 1JHNA 3ENRA 4R9DA 4FQ4A 2GMMA 2DVAA 1ENSA 1BZWA 2DTYA 3OYWB 1IKQA 4ISQA 5F9TA 2D44A 1NLSA 4LBNA 2DUQA 5T52A 2GDFA 3W58A 1G7YA 2CNAA 1W6MB 4LBLA 3DGTA 1W0PA 2WT2A 5H9PA 1VALA 2VXRA 4GWNA 1PZ7A 4LBKA 1LOFC 1SLTA 1LU1A 3HN1A 3ZSMA 2PHXA 3ILFA 4Q8LA 1RINA 4YFWA 4WZFA 2GNBA 1LJ7A 1LHNA 2D3RA 2YMZA 2H0BA 4FQZA 2OVUA 3QLQA 5GLWA 4Q26A 3OPZA 5DUWA 1DQ4A 1I3HA 2V5YA 4YGEA 3MPPG 1LGBA 4YW4A 3UJQA 4XDQA 4FPYA 1OQ1A 2WNEA 1LGNA 4FOVA 1CR7A 1LHOA 1UN1A 1BKZA 1IKPA 2PHTA 3RMXA 3SH4A 1Q8QA 5H9RA 1AX2A 4XHBA 3V0BA 5KXCA 3IN9A 1S0IA 2JKBA 4CTEA 4XMIA 3POWA 3VUOA 4BM8A 2A75A 3LCPA 1FX5A 1LODA 3MEPA 3AP6A 1S0DA 2YV8A 1IOAA 5DG2A 3RSJA 1MS4A 1UX6A 1YRZA 4XHXA 2WQZC 3LSDA 1QF3A 2DURA 1FV2A 1R1ZA 1LEMA 4Y1VA 1UKGA 1MZ5A 1Z78A 1QGLA 1N1TA 1N1VA 1G9AA 1AXYA 3V0AB 4XBNA 1YYNA 4I30A 4M3CA 2A3YA 4XXAA 5IK8A 3N7KA 4FPOB 1HDKA 1ONAA 3FLTA 2AYHA 4BMEA 3AXEA 1GZWA 2ZZJA 2CYFA 3D5OA 1W6PB 3O5SA 2NM1A 2P37A 4FP3A 4LBQB 1UAIA 1QOTA 4AVSA 2DYCA 3WHUA 5T55A 3VKNA 1A3KA 4PBPA 2HYKA 4C1WA 3SNMA 3AFKA 5JVVA 3R4SA 2PHRA 3WUDA 2JECA 5JLVA 2ZGQA 1WW6A 3T1LA 1QKQA 2DVGA 1MVQA 1TEIA 3BTAA 3UL2A 2P3JA 2R0FA 5CAZA 2D6PA 2ZGLA 3NV1A 1G86A 4FVVA 2DUPA 3AK0A 2GMPA 1JW6A 1WLWA 3VV1A 3M1HA 2CTVA 1KJLA 4M3CF 2ZABA 1MVEA 1SBEA 3O0WA 4Q1RA 4XTPA 1GLHA 4MYEA 4XYXA 1GNHA 3ZXFA 3PVOA 2ZACA 3AP9A 2GNMA 3SLIA 4HANA 1N1SA 3O12A 4FOWA 5JDBA 1MACA 3FLRA 2C5DA 4SLIA 1JOJA 1MR5A 5GALA 4AGGA 2YXSA 3PMEA 1GZ9A 3WDVA 3SH3A 1YI7A 1C57A 4Z8BA 2ZGOA 1GANA 5DG1A 5IK7A 2Q5TA 2WKKA 3KM5A 1JXNA 4TZDA 4Q2FA 2NN8A 3M3QA 1AVBA 4P9YA 1VLNA 4FPKA 2ERFA 1CPNA 4XBLA 5IK4A 3WG4A 3A0NA 2A7AA 1V00A 1AXKA 2UWAA 1W6NA 3MW3A 1JYIA 2DUOA 1LOGA 1IS3A 2VW0A 2YZ4A 1UPSA 1A8DA 1MS9A 3QCWA 2GALA 3IMNA 4YLZA 4ATEA 3JU9A 3A4UA 4DQAA 1V6OA 1S0FA 5EYYA 1W6QB 2VUAA 4Q1PA 1V6MA 5T5LA 4ZKTB 2D3PA 2JE9A 4R9AA 5SV8A 4AGVA 2EIGA 5GLUA 3WCRA 1Q56A 3SISA 2D6MA 5GZCA 2NZ9A 1ULDA 3ASIA 1JYCA 2A70A 5JOYA 4XJUA 1BQPA 3RQ0A 1S0GA 3V0AA 4NO4A 4OZXA 3POSA 4TYSA 3AP5A 3N7LA 1N1YA 3OY8A 5CB7A 1EPWA 3GNEA 5DUUA 4YG6A 3L2YA 3RRDA 1SBDA 3ZXKA 3BOPA 2EXHA 2DVBA 4YG3A 2VW1A 1CESA 2ZAAA 1LHWA 2SLIA 5E88A 5GZDA 1CPMA 1QDOA 2VH9A 3WHTA 1BXHA 3CNAA 1GZCA 2A3WA 1QU0A 1AXZA 1F5FA 3WNXA 2CL2A 1FYUA 3N7MA 2ZHKA 4YW3A 4DPNA 1G9CA 4DRRA 2EXKA 5BYNA 1Q8VA 2ES3A 2DVDA 2R1BA 3IPVB 1SLCA 4UW4A 5DZEA 3WDTA 1FNYA 1AJOA 3WV6A 5JMCA 4AYUA 4DS0A 1S0EA 1HQLA 1H9WA 3TB0A 3OY8B 3WUCA 1PZ8A 2JDZA 2KM2A 2NMNA 1MS8A 3T2TA 1ULCA 1QMJA 1IS6A 1OKQA 3WG2A 1UZZA 2DU0A 2A6ZA 1AX0A 3WCSA 1CVNA 1RIRA 2WSUA 3AYCA 3IKWA 4FP2A 1YXWA 1DYKA 3B00A 3O0VA 4JRAA 1W6NB 1FATA 3OGGA 1WBLA 4FOQA 1W6OA 5KXDA 1W6PA 3ZVXA 1APNA 3AP7A 3H0OA 4U36A 4Y22A 3FBYA 4K21A 4Y1ZA 3AYAA 2JE7A 3WDWA 1UZYA 3B9CA 2A6WA 2XB6C 3M2MA 4YW2A 1Q8OA 2W68A 2PHFA 5GLVA 3AZWA 3SITA 1QOOA 3VKLA 4YZ5A 2SBAA 3N35A 4PQ9A 5E8AA 2Z42A 4Q27A 3V64A 2NP0A 1G9FA 1V6IA 2VY0A 4Y26A 5IK5A 2A5ZA 1KDMA 3BODA 1IS5A 4C1XA 2OUJA 3PJQA 2FMDA 1LTEA 2D6NA 1ULFA 1WBFA 4GKXA 2DV9A 4K1YA 3ILNA 1GKBA 3JUUA 2GMEA 3A0KA 4JCKA 3C2UA 5EWSA 3USUA 1DQ5A 3N3HA 4JC1A 1LU2A 5KXBA 4UW6A 3AP4A 2PELA 1A78A 2AREA 4FPJA 3B69A 2I2SA 1ENQA 3FLPA 4WV8A 1KRIA 2WJSA 4BQ1A 2WLQA 4GA9A 1LCLA 1C1FA 1LOCA 1SLBA 1C1LA 4LBQD 2A71A 2ZHMA 4Y22B 3OJBA 1N3QA 4GXLA 1G9DA 1GICA 2ARBA 2NYYA 2JD4A 4FPGA 2EXIA 1CIWA 2TEPA 2CY6A 1SCRA 1V6NA 2V73A 2W39A 5E89A 1URXA 5GLTA 1SLIA 1VAVA 4FPFA 3AJZA 1OFSA 1ULEA 2AENA 1JN2P 5CA6A 1AF9A 3ZSLA 1DLLA 4YM0A 2DTWA 4UW5A 1WLDA 4CZSA 4ITCA 3OBTA 1S0CA 4YM2A 1U0AA 3AX4A 4AVTA 2E6VA 2VU9A 4YFZA 1SLLA 4UW3A 2EF6A 1GNZA 3M3OA 1ENRA 1DHKB
chains in the Genus database with same CATH superfamily
2ILMA 2VQAA 2X10A 3JXSA 1GYKA 2VZQA 5F2SA 3RWKX 2LW8A 3OUIA 3P3NA 5T5JA 4ZU4A 3PLQA 1W9SA 4L97A 1JOBA 2DVFA 3S30A 2Y60A 2R063 2VL4A 4K6BA 4XJWA 2XKPA 3GZTB 4Q4W3 1DQ2A 5HCHA 1QXPA 3E5UA 4HN1A 1QEXA 3ZOIA 3KV4A 3L2HA 3NAPA 4P08A 1STMA 3MUZ1 3NV2A 4ONUA 3S6PA 1DBNA 1REEA 2AR6A 2J1VA 1AJKA 2LTNA 4Z07A 2XVKA 5H9QA 3ZO0B 2PAEA 1ZA4A 5FP8A 1NKGA 1KS4A 2C0ZA 2VM9A 2Y0OA 3EMRA 5HCFA 5AC92 2ZBJA 4NUBA 2K2SA 2Z79A 1F35A 4IGPA 4QX8A 3LFMA 3I49A 4AK3A 5I0RA 1E5HA 3FFQA 1DGLA 5FLJA 2PFWA 3TEZA 4BOWA 4AI3A 1ZBA3 2V09A 1W8WA 2J7MA 3KQRA 3WP6A 3O1VA 3WNLA 1JYWA 5C9AB 4NPLA 1LECA 3ON7A 1C8M2 1GNYA 3NNLA 5AVAA 1AR73 3T3YA 2X5IA 5IAXA 2BBVA 4WBBA 5C9AA 1ASJ2 2WA3A 4QB6A 2XQRA 1V6KA 2OPKA 3JZVA 4NHKA 3VDCA 1WCSA 4N53B 3ZXEA 4GZ9A 1BHGA 1E5RA 5IVFA 3USUB 2YGLA 1SDDB 3C7EA 3I54A 3PVBB 1RUF1 2VAUA 2Y26A 1QY4A 1X9TA 4CCDA 2ID4A 5FREA 3VBRB 1OPOA 1IPKA 1X8MA 4FFIA 4SBVA 3SKJE 1R092 1Y7BA 2WS93 3Q9OA 4WVVA 4BMBA 4IEZA 4IV3C 4S2DA 4Q0PA 1VBC1 4Q0SA 5JZGC 4CEYA 5CFCA 1XXNA 3P5BA 4QM9A 3T0BA 4IQPA 1YIFA 2ATFA 4ZONA 3NAPB 4A3ZA 2QDNA 3U4XA 4EYUA 3ALQA 2BYVE 3PTRB 3UK9A 4PI2A 3U07A 1MZFA 1K5MA 4D8MA 3DECA 4P9JA 4KNCA 4TSVA 1NCRB 1XOYA 5DQ0A 5BNPC 4YVWB 3RG0A 4COVA 4P9XA 4K20A 4C91A 2UURA 2BV4A 5FYBA 1RMU1 3PMSA 1W6OB 4GALA 5FZAA 3NV3A 3RZGA 3AYDA 2BGOA 4GB31 4OHVA 1PZ9A 2YBSA 4Q5OA 3SXWA 1W99A 2F4PA 1VJ2A 1RXGA 4BIFA 2BP6A 2V4VA 4JAAA 3WLUA 4N9IA 2ZX0A 1Z0HA 3FE5A 1W6QA 3G7DA 3ACIA 2WZEA 1BYHA 4FFGA 4HBNA 4V1PA 1W03A 2FCTA 2WNVB 5DUXA 3E6CC 2ZMKA 4YVSB 2XONA 1DZTA 2NMOA 1R081 4W6YA 3HAGA 4H55A 3VKOA 3VD5A 1XPWA 1BCXA 1A6CA 5GLZA 1PMIA 2GN7A 1RGSA 1VRH3 2R6QA 2RJLA 5E1RA 2GC2A 4DRVA 2VTXJ 1WMEA 3CIHA 1QJU3 2WR9A 4RL7A 1FMD3 1M06G 4MUVA 1CGPA 4W6WA 1R1A1 1SDWA 4FOYA 3THDA 1LRHA 1KQRA 2GNTA 3UGHA 1K5JA 1S0JA 2AEYA 2E32A 4XABA 5CG9A 4MH0E 3ZXDA 2MNGA 2BGCA 2IXCA 5F32A 4CRQA 5ISLA 4X8PA 5A1AA 3OD0A 1U5ZA 2X8KA 4Y1UA 5K0UB 1OA4A 4KBBA 4B1MA 2A73B 1CN1A 1JUHA 5KXEA 4OULA 3JQXA 3I2OA 3ZYRA 5EYXA 1DP0A 3MO4A 4F83A 3CEWA 3VBFB 1O4YA 1B09A 2JG8C 1IG3A 1OT5A 1QQP3 2XMLA 4ES8A 1F9KA 1H9PA 1TMF3 4I02A 2ZGNA 3INAA 5FPLA 1J83A 5GM0A 5L7OB 5FO9B 1GQPA 1KS5A 1XU1A 1HN1A 2BEOA 4YRDA 4RGGA 4P9LA 4WM7A 4DEQA 5FLHA 1LULA 4CCLA 1OHFA 2ZGTA 2XVGA 4W4ZA 3SCFA 2ZGUA 4S2FA 3V56A 4XF0A 4Y1YA 3NKTA 4MHUA 4META 4XIKA 1W6MA 2WS92 3IT8A 1CQ9A 2PHUA 1L7RA 1WLCA 3RZLA 1J3QA 1YIPA 3HR9A 2W0XA 3JBG2 1IZ3A 3TOJA 3CBNA 5K9YA 2DWRA 1WW5A 1RUG2 2GC0A 4PHZA 4ZZ5A 3BALA 1IHMA 4AG4A 2QQLA 4AVVA 1MEC1 5FDBA 3D0JA 4HL0A 2P2KA 1GZWB 2GNDA 4DXSA 1HB2A 3UJOA 1J84A 1S55A 1XSRA 2QKDA 2GP3A 3LWCA 1UMZA 1AL21 3FFZA 3OCPA 5EP9A 1GQGA 1RUI1 3IWZA 4M01A 3MIFA 2A6YA 3WG1A 1JHNA 1RUF3 3D8CA 3EHKA 2LS6A 4DMIA 2XBO1 4HSLA 1QJU1 2JDNA 3MGUA 1AYM3 1Y9MA 2GMMA 1J58A 4PLOA 4PLMA 4HONA 1XU2A 5DABA 4X6QB 1PNFA 1RMU2 4IERA 2XWJB 5F9TA 4DB5A 2VZOA 4LBNA 5CKQA 5CVRA 2DUQA 4QX5A 4ZY9A 4BWOA 2QQWA 1G7YA 3BTYA 4OUEA 1OVSA 3KMHA 3DPRB 1RUNA 3ZXGA 2J42A 2VXRA 3ZSMA 5C33A 2JDKA 4JDNA 1GMMA 2D3RA 1LHNA 2H0BA 1MZEA 3QLQA 2WNVA 4IGOA 4XFHA 4AFAA 4RGKA 1I3HA 2B42B 2W3JA 3MPPG 3VZJA 4FPYA 4FOVA 1D4M3 1CR7A 3K46A 5JXHA 3RMXA 3LIGA 1OH3A 3SCHA 3FBMA 3SH4A 5H9RA 1HW5A 2F17A 5KXCA 3H7JA 1VR3A 1L7QA 3IN9A 2JKBA 4CTEA 1RUH3 2BRTA 1CZVA 1WWYA 1FX5A 2CAUA 2X29A 1UY4A 1LODA 3MEPA 4NVPA 4JQRA 4BH9A 5CIRA 1RUE1 3ZFGC 1YRZA 5FMCA 4BIOA 1VBE3 2VNGA 3BCWA 1QJX2 2HWF2 4QXHA 3IAPA 4CCCA 1FV2A 1XYNA 5F8PA 4K7JA 1O5LA 1UY0A 1N1TA 3R0RA 4BK5A 2GC1A 3N4MA 3V0AB 5JUVA 4TLFA 1Q43A 3OGRA 4XXAA 4BQWA 3FLTA 5FZLA 2AYHA 4LUKA 3D5OA 4Y1XA 1NX9A 1UAIA 4I0AA 4IEVA 3WQ0A 4CDUC 3OTFA 1V9U1 2ORXA 3O1TA 5FPBA 2ZEZA 1GOFA 4AOCA 2JD9A 1NA1A 2JE8A 3WHUA 5GZCA 1CX1A 2HYKA 1RUF2 1AR71 3ETQA 4LO7A 3MF9A 3AFKA 3R4SA 1FT9A 2PHRA 1QJX1 3HBKA 2CGOA 2ZGQA 3GXUA 4P00B 4QKFA 1US2A 1HQNA 4XETA 5C3OA 2DVGA 1JYTA 1MVQA 1RMU3 1JZ8A 3WD5A 1FOD3 3UL2A 1I5PA 5CAZA 4BK4A 1AYM1 5BNOB 2ZGLA 2XH6A 5KHJA 4CEWA 2VZVA 5FZIA 3KVBA 1DZRA 2GMPA 2Q1ZB 2RDNA 5IVBA 1LAJA 3MICA 3WF1A 3VV1A 5C3RA 4XFFA 4AR2A 1AR81 1MVEA 1SBEA 2VZRA 3O0WA 4XTPA 1GLHA 1UD1A 2MEV1 2WZR2 4MYEA 1V70A 1KEXA 4XYXA 4LT5A 4CDWB 1GUIA 4XQ4A 3PVOA 2ZACA 3RZKA 5FZ1A 4LIUA 3SLIA 3VZLA 5J1XA 1GR3A 3MDPA 4MG2A 1OUSA 3K75B 1MEC2 2VUJA 3SEEA 5C8WA 5F6KA 2MPFA 4CDQC 5J7MA 2VMGA 2YXSA 5G04L 4CDWC 4YNIA 3SH3A 2WAOA 1F15A 1C57A 2Q8DA 3PIJA 4OZOA 4XEZA 5DG1A 4EZHA 2DCKA 2W95A 3FHIB 1JXNA 2VOTA 4IE6A 1T6GC 5FQ0B 4AQ6A 4TZDA 3NNFA 4N43A 2NN8A 1UKRA 3OBZA 4RGAA 3WEZA 5FYSA 4E27A 2CGNA 5FY7A 5KR7A 4BQ5A 5DAWA 1KXGA 2XQXA 3ZSEA 4AVCA 1V00A 1FOD1 3DPRA 3DL3A 2ORZA 2VW0A 2OZJA 1ZNPA 1UY1A 1UPSA 2YZ4A 1MS9A 2YB7A 1TQ5A 4B7EA 1POV0 4AQTA 3IMNA 1HRI3 1WCDJ 3ACHA 2DCZA 1S0FA 3I2JA 4LOTA 1W6QB 2VUAA 1EV11 4Q1PA 3VBRC 2JE9A 2DBIA 4XQWA 2ZEYA 5SV8A 4AGVA 5C7GA 3AL5A 3JBG1 5GLUA 2RJKA 2Y6LA 2D6MA 3KV5A 4JDMA 2QQOA 3AMQA 1ND3A 1JYCA 2A70A 3AMHA 3KF3A 4XJUA 4XCAA 3T08A 5FY4A 1S0GA 4DUWA 3POSA 3N7LA 4MGQA 2BNNA 2RMU3 3GNEA 3L2YA 2CHHA 1VPHA 2FCUA 1US3A 1P8JA 5JZGA 1SBDA 4I01A 5B4NA 2EXHA 5IVCA 3KF5A 4OYUA 5GZDA 3VDDA 2AC1A 5E88A 2ZTNA 3RZMA 1QJY1 3SC7X 2IXJA 1WMXA 4FAHA 1AXZA 5ANNA 4D3WA 2UY9A 1FYUA 2IC1A 2VXJA 1BBT3 3N7MA 1QXRA 4YW3A 1QHDA 5FYHA 3WNPA 3FX3A 2XJRA 2EVXA 4Y4YA 2GH2A 2ES3A 2WO1A 2WWSA 1Y43B 3ME2A 2BVBA 1PNGA 4AYUA 2I07B 4LO5B 3PUHA 3FL7A 4QM8A 5LB6A 1PIV2 5C4WB 4NN0A 3ZM8A 2D40A 2KM2A 1C5IA 2XGXA 2YU1A 2W5FA 4X8NA 3T2TA 2RE9A 1PVC1 4PI0A 5FMBA 1CVNA 1NA1B 3E6DA 4WVMB 3N9PA 4E9KA 3ZKUA 1DYKA 2P3YA 4LXLA 3TBDA 3ZN6B 1C8M3 1JH5A 1W6PA 3GYDA 4S2GA 3ZVXA 1APNA 2JG9A 4AHZA 3AP7A 4EN0A 1AR62 1ST8A 3J8F1 2LRPA 2JIGA 3FBYA 4LQRA 4K21A 4Y1ZA 3AYAA 4HETA 2YFUA 1NT0A 1HXS3 3BPSA 4D94A 1RC6A 2QQKA 4KU8A 3T2OA 3AZWA 2OQ7A 3NSTA 4O65A 3VKLA 1UF2C 4PQ9A 4CDQA 4N43B 4QQLA 5CKMA 4QPWA 3ZDSA 2VNOA 3U0ZA 3VBHA 2HBTA 4F7ZA 4HK8A 1R093 1W05A 4URTA 4KGQA 4C1XA 1RUI3 5FFOC 3DXUA 2OUJA 4QQ2A 2ZX1A 4BCUA 1ULFA 3Q8EA 4GKXA 2DV9A 2HLEA 3NW4A 4K1YA 4AI8A 4DXRA 1SPPB 5FP3A 5I0TA 1GKBA 4LE3A 2D5FA 2VQ0A 4AL9A 4DXTA 2JDPA 3C2UA 1W39A 1AL23 5IAVA 3OPTA 2VVEA 1H1IA 2RMU1 2JB4A 2B9UA 4E2QA 3QD6A 5JWPA 1X36A 4RQPC 1PGL2 3LAGA 1OLMA 5FYMA 5EZWA 3H1MA 2WLQA 2WO7A 4HPKB 4LBQD 1AR92 3H42B 2A71A 1TNRA 4AEKA 1WKYA 4HLTA 2W46A 4B1LA 4CUBA 5FR3A 3BTXA 2GP5A 4FPGA 4NJ4A 1CIWA 5DDJ1 4Q4V3 3WW3A 4RQPB 3IB3A 4GQ7A 5GLTA 1SLIA 1CIYA 3ROUA 1CX4A 4EWDA 1PVC2 4P5HA 4WM7B 4XURA 5CA6A 1JN2P 1JU3A 1VBA1 4A44A 1M4WA 1AF9A 3PU3A 4UW5A 3QACA 1NY71 5FYTA 1F4HA 2WO2A 4QAWA 4CA9A 5LASA 4CUAA 3KVAA 2XHKA 2VMHA 4UW3A 3M3OA 5HV0A 2EA7A 1BBT2 1ENRA 1POV3 4GAZA 5FPUA 2ZX2A 1V6JA 4MADA 4COZA 3Q8AA 4XXPA 2ZGSA 1DQ6A 5HCBA 5K0UC 4L0PA 4Z82A 3I2KA 4PBOA 5FZ8A 1WW4A 1W0OA 1QNWA 1ZZ9A 2ZHNA 5FZFA 4CXWA 1BJQA 4KWUA 4UBHA 5IVVA 4LKSA 2Q1FA 5F5AA 3H3LA 2HJIA 5JMOA 3VD9A 4INDA 3DUIA 3T09A 4JX0A 3T4HB 4OFGA 5FY1A 4BLJA 5JAXA 5HCAA 1PGW2 1AZDA 3H8XA 1W3XA 2XHNA 5C70A 4NIGA 4P5YA 5A6QA 5A3MA 4PF1A 5ACA1 1RITA 1RUI2 1DGWA 1F2NA 1RYYA 4JTOA 1QJFA 1W2AX 5EQUA 3AZZA 3KGZA 5CYYA 5FY0A 1W9YA 5DUVA 2AUYA 4AEMA 4BPZA 1AUYA 3APBA 3AZXA 2PYTA 2E7QA 5J09A 5D1IA 4FCAA 3F2ZA 3GCWA 2HWB1 3WX5A 4LEJA 1FI2A 1RUJ2 2VZ3A 4XFCA 4YW7A 1PO21 3J7HA 2BUKA 2R062 5FXXA 1GP6A 3MIBA 4AFCA 1GBGA 1GWKA 2R0HA 2YGMA 2QFEA 1HKDA 5C8CC 2D6LX 4G3YC 1WZXA 4RQPA 4XF3A 3RYPA 1O5UA 4MO3M 1KGYA 3IIAA 3KHCA 2WN3A 4BZ4A 4QXKA 4L8QA 5CADA 1NQJA 2DF7A 2WSVA 4LHLA 5CKNA 2N7GA 4XJZA 4ASKA 2B9VA 2YBPA 3NL1A 4XDPA 5FZ3A 4E2SA 3K2OA 4PDWA 1NLRA 2A6XA 3OF1A 2VE1A 3LZZA 5JOWA 5L73A 5FZHA 5F7UA 1O3SA 1H8TC 3HQRA 1NCRC 4HSJA 5JOXA 1X50A 2B8MA 3WDXA 1OH4A 4ZXEA 4YW1A 2XJPA 1G9BA 2BPA2 5DN2A 3HVDA 3RZHA 5FZ6A 5EIYB 1VBC3 1ODMA 1SCSA 2J1UA 3RYKA 3ORJA 2DFCA 1AYM2 4LJHA 1I5ZA 2C9AA 5H9SA 4N8MA 4ASMB 3AJYA 2Y6JA 4XPVA 1YI9A 2IUWA 2R32A 3GBFA 2ZJCA 2Y0IA 3I2IA 3MF6A 3TWIA 2J22A 5C5TA 4A45A 2BJSA 3HQUA 5BXXA 4EJRA 3UGGA 3WQ1A 4D7SA 1HRV2 2FBEA 4HVOA 2BNMA 4LA3A 2UWBA 4R4XA 5IVYA 4XJ8A 2E7TA 4UFLA 1PO11 4B4PA 1POV1 1JU4A 4YGDA 5K7PA 3VBUA 3GJAA 4HZFA 1UYXA 5EJZB 2XOMA 4ZXKA 3X29B 4QKDA 5BV6A 4BJ0A 2BZDA 1UO9A 3NWKA 1T2XA 3R05A 5JI9A 2W08A 2QQJA 1X8EA 2KD7A 5LATA 1MS1A 4CCMA 3UKVA 3D4KA 4YM3A 1DCSA 4GJYA 1G8WA 1PO22 3I8TA 4C0BA 1N3OA 3U37A 2B4KA 2XBO3 2WNUC 3TN91 5A3OA 3I4IA 3H50A 4GWIA 4JQTA 3BGAA 3GBWA 1QXJA 1DIWA 4PCRA 4HVRA 3Q8FA 4LLOA 1UQXA 1AX1A 1H4GA 1QJX3 2Z4FA 5FYUA 3BIWE 3H9AA 3MPBA 2C4XA 1RUE2 4QDSA 3LPGA 4OUSA 4QDQA 2O8OA 1YFXA 1ZZ6A 5I0UA 5A7WB 1O4ZA 3WVJA 4Y20A 3JB4C 1BVVA 3I3QA 4QXCA 4BLIA 5C5UA 1KJRA 1IS4A 4ARXA 2E33A 4YZ1A 4YVWC 5LA0A 1UL9A 5APAA 1YO8A 4P9WA 3THPA 1TME2 1C28A 2IZWA 2E9QA 3D6EA 4C90A 4LBOA 1OA3A 3LF7A 4K8FA 4AGRA 3N7JA 3VBRA 3HMYA 3KZ4C 4CU6A 1JBCA 1JHJA 2HEYF 1YEWA 4OVEA 4LBJA 1RUC3 2VGDA 2WYSA 2ZGMA 5DAPA 4Z92B 3IZOA 5FYIA 1AR91 3M8LA 1ZREA 4CEWC 4Q8KA 4IE7A 2PAKA 3R4DB 4QKBA 4ZPIA 4QWNA 4YVSC 4OCTA 5CBLA 3VD7A 1NCQA 3B93A 5HV4A 1J1LA 5HBAA 2YC4A 3PUAA 4RS5A 4UFIA 1UU6A 4XBQA 1CJPA 3RJ2X 1K42A 1ND2A 3RYRA 5D8AB 1XNCA 4CEYC 5CFCC 3BKZA 2P17A 1FV3A 1Z7S1 4XF4A 4I0WB 5T5OA 3NJXA 1HRV3 3U1XA 2HWE3 4DOUA 4W65A 3WNMA 5LZ6A 3KS7A 1ZM1A 4XJ9A 1SLAA 4EN8B 2ZS6B 4UAPA 1RTVA 5F5CA 1KITA 3USSA 3ZXAC 3AYEA 4XDOA 2E51A 2Y6GA 4GKYA 2EAKA 5DDJ2 4AI9A 5JR7B 4IV3A 5LA1A 4LBQA 1SFYA 2NLRA 2D5HA 2E63A 5JI7A 1X82A 3C7OA 1DGRA 3CDZB 1K45A 2D98A 2QNKA 3PVEA 4G9SB 4QKNA 3IPVA 1JZ2A 3AVSA 4FPHA 4YZ4A 1K12A 3WF0A 2VNRA 3UKNA 1BMV2 5A7PA 4LA2A 3R4UA 2J1RA 1PO23 3O1MA 1OLQA 3JQWA 2ARCA 1AYN2 1JUIA 4J6GA 1AR61 5IUQA 2R16A 2WFF1 2RDSA 4DINB 4TXWA 3JB8A 4XAEA 5C9AC 3GBGA 2VZTA 2DVAA 3CMGA 1ENSA 4J1WA 1BZWA 5FPAA 1UYZA 1IKQA 2VMIA 2D44A 5FTTC 1XYPA 1REFA 2RM22 2PN5A 1UMHA 2GDFA 2WWJA 4AQ2A 4FTEA 5KHGA 4LBLA 3DGTA 2VVFA 1PIV1 5H9PA 5J36A 1VALA 1PZ7A 2X5IB 4JGYA 2LUWA 1EPZA 2PHXA 3ILFA 1IQDC 1RINA 3AMNA 4Q8LA 4Q4W2 4WZFA 4YFWA 4DIQA 3E97A 3L9JT 4XFBA 4LHNA 3OD4A 3OPZA 2JDMA 3W9AA 3S7IA 3RWNA 1OD5A 4YW4A 1GU3A 2QTWB 5JIAA 1LGNA 1UN1A 1YHFA 1IKPA 1ZBA1 2PHTA 2BGPA 3ELNA 5A3WA 4QX2A 2X05A 2RV9A 3V0BA 4QGLA 1S0IA 4XMIA 1Q3EA 3POWA 3RVHA 1SFPA 4BM8A 3LCPA 3H8OA 1RHI2 1VB2A 2YHJA 3T2PA 1UPIA 1MS4A 3SEPA 4KMQA 1WCKA 5GKAC 4H3WA 5JPMB 3LSDA 5HXMA 3VL9A 1UU4A 4YYOA 1QF3A 1ZBA2 4BB3A 3LDKA 1LEMA 3CJXA 1RUC2 3NQHA 1UKGA 4Y1VA 5FZKA 1OOPB 1EUUA 2W1QA 3OBAA 1PO13 5EV7A 4UFMA 2RS11 4J1XA 1QGLA 5EJ3A 1YYNA 2Y33A 4M0NA 4GMP3 4M3CA 5IK8A 2W91A 2R072 1HDKA 3WNOA 1ONAA 3KB5A 3O5SA 5FUPA 2IFWA 4EE2A 4MGZE 1VBB1 4AVSA 1IG0A 4YWAA 3CF6E 1AHSA 4IETA 3VLBB 3OGSA 4KG0A 3THCA 3OPWA 2VOWA 2L9LA 2HWE2 3VKNA 1A3KA 4PBPA 4AI0A 2F6BA 1VBE2 3PUQA 3ABZA 2WN2A 2IXIA 2K0GA 2JECA 2WFF2 1ACCA 1WW6A 4Q4X3 1QJEA 4FTBA 1R1A2 2C26A 5A32A 2YU2A 4ZU5A 3VBOB 1RUH1 5D21A 1NG0A 1YFUA 4RD7A 5CU1A 3J4UH 2P3JA 5KHHA 5E6HA 2WINB 3ZFGA 1H2LA 1ZBE2 2PXJA 3LFIA 3WP3A 5FZ0A 4P9GA 1WLWA 4DNYA 5ABJA 4AXOA 3B7MA 4QPIA 2JKXA 1ZZ8A 3B5LB 4XFAA 1TZOA 5IW0A 4XC9A 4Q1RA 2CSGA 3K3OA 3M3IA 1GNHA 3MIHA 3AP9A 1GFF2 1RVF3 1N1SA 4FOWA 3MIGA 4HANA 4PIZA 3KV9A 4QT6A 3ZMNA 4SLIA 4CP9B 2IFRA 4QQHA 2PTMA 3WF2A 4BA6A 3PMEA 4XAAA 3T0DA 4Z8BA 4NIHA 1GANA 4RYDA 4CDUB 2WKKA 2VQUA 3RZZA 5I0DA 2VPVA 2XXZA 5FZ4A 4Q2FA 3VDDB 5IVEA 4P9YA 1HIXA 1VLNA 1E5SA 3MLLA 4GH4B 2W2IA 2ERFA 1W9TA 1BEV1 1CPNA 5IK4A 2BFUL 3RFRA 4XCBA 3AC0A 3A0NA 2G9GA 2GU9A 4WM7C 5FKCA 3VGIA 5CISA 1H8TA 4NAOA 5D8AC 1AXKA 5BNOA 1VB4A 4XUPA 4C8DA 1AR82 1JYIA 1LOGA 4IGQA 2RS13 5BNOC 1W2OA 1R091 3BI3A 5IWFA 3NJYA 4LKFA 1JODA 4NPMA 1DDLA 3A4UA 1JTZX 4LHSA 1OMIA 2W94A 3ZLIA 5AC91 5L7OA 4MGSA 4ZKTB 3DEMA 3MBWA 4UF0A 1CAXB 1OURA 2Y64A 4R9AA 3MUY1 1A8MA 2NZ9A 1ULDA 2OX0A 3AKTA 1X9PA 2RDRA 3ASIA 2EIBA 2ZCWA 4W8JA 3HNBM 5I8TA 5C8CA 5JOYA 4OZXA 4MV2A 4TYSA 2Z5WA 3RRDA 3ZFFA 1AR72 1O4TA 1EAH3 1Z7S3 3BOPA 4DEVA 4M0HA 1OSGA 3CKHA 5CFDB 1TMF2 1WMFA 5FUNA 1LHWA 4CVUA 3DYOA 1H6YA 4IXLA 3WHTA 2A3WA 4Q0QA 3WNXA 2JEMA 1CAUB 4BXFA 2ZHKA 4WM8B 5A33A 3B94A 4DRRA 2EXKA 3BN6A 1Q8VA 2WQ4A 1VBA3 2O8QA 1D7PM 2PQSA 1SLCA 1CZSA 1AJOA 5JMCA 1VRBA 1S0EA 1XNKA 1HV1A 2ZXQA 4WM8C 4EROA 3H3ZA 3W20A 5I8YA 2JDZA 2K9ZA 2NMNA 2VBPA 3IIIA 1IS6A 3GF6A 4ZS2A 3WG2A 4CCEA 5KBFA 5L19A 3OG2A 3WCSA 2WSUA 1RIRA 3IKWA 4EN9B 4UYBA 3OOXA 1YXWA 3TRSB 3WT3A 4GMP0 1W8UA 2H6BA 3O0VA 3RNSA 3VZNA 1W6NB 1OC1A 1U5XA 1WA4A 3OGGA 3ZMOA 1IPJA 5KXDA 4HKOA 4YARA 5HI0A 3K48A 3H0OA 3M7AA 4RR3B 1O91A 3DCQA 1YC61 3DXTA 3ECQA 4QXBA 2JE7A 2W9XA 5DPNA 1O6UA 1OQEA 1XB9A 1H2NA 3B9CA 5JSRA 4H7MA 4YW2A 1Q8OA 2C1FA 2W68A 2PHFA 5GLVA 5B2GB 5IHRA 2SBAA 5FZCA 5E8AA 1REDA 2VZ1A 1CAVB 1OF3A 1G9FA 2VY0A 3SHRA 2VCCA 1JI6A 5J98B 1OKOA 1KDMA 3OB8A 3BODA 2PHDA 3O1PA 3AFGA 2HH9A 4LIVA 1COV2 4LNVA 2LM3A 5FZEA 4CP0A 1OI6A 3LA7A 1QJU2 4N90A 4CE8A 4V2VA 3ILNA 5IFPA 3ZR6A 2GMEA 3A0KA 1UW8A 1ZZ7A 1DQ5A 3N3HA 4ZZ8A 1LU2A 3DF0A 4AFMA 4UW6A 1VBB2 2GZWA 3AP4A 2R061 3GZEA 1HXS2 3EO6A 1NA1C 3KCXA 4FPJA 4MXWA 1ENQA 1KRIA 3LEGA 2WJSA 4XACA 4BQ1A 2XKOA 1CAWB 1LCLA 1SLBA 4JDOA 4Y22B 1C1LA 2WFPA 3CJIC 2I74A 1RJ7A 4GXLA 1YQCA 4JKLA 1Y9QA 2YBKA 4COUA 3HEIA 2TEPA 2CY6A 5F39A 1T6BX 2W39A 5E89A 5FPZA 1NCQB 1URXA 4JHTA 3WP5A 3NVCA 3MYXA 4FPFA 3I7DA 2WNUA 2AENA 1ULEA 3IDAA 3ZSLA 1DLLA 4O9EA 3SMHA 1BEV3 1WLDA 2WNUB 4ES9A 1ZA7A 1U0AA 4M4RA 3PHMA 5T3NA 4IE0A 4COYA 4BQYA 4YFZA 4PJYA 1SLLA 1W04A 3GM8A 3UV9A 5ANQA 2C24A 1I1EA 3OEAA 2W1SA 2VNVA 3ZPYA 1WMDA 1NLQA 1W06A 3HJRA 1S0BA 4OMDA 1QH7A 5DZFA 1W8TA 3JBG3 2VULA 4GB33 2R49A 1PVC3 1LOBA 1GOHA 4HFSA 3SCGA 4IW3A 5LRRA 5FYZA 3S5AA 5FXZA 2PLV3 2WT0A 1EP0A 2UWCA 3JD72 2VZUA 2BOJA 4YGBA 2WA4A 1RHI1 3VBOA 2A6VA 2JG9B 1PK6A 1COV3 1RUD1 1UY3A 3P1IA 4ATFA 2XUMA 3GGLA 1JOPA 5C8CB 3ZKYA 3PL0A 2WBKA 3IM0A 2ET1A 2BDRA 2VOVA 1VBD1 1MS5A 2W1UA 3I59A 4L92A 1AYN1 1W8FA 1PGL1 2ZAHA 1ZZCA 1LOEA 5T54A 1VBB3 2BOIA 4XFIA 2P3IA 3U4SA 3NMBA 1MEC3 2OKXA 1CWPA 2WL1A 3ZFEB 4QD2A 3RS6A 1WD4A 3OYWA 4HPKA 3OBRA 2QQNA 1QDCA 4AWDA 2IXLA 4OI4A 3FUQA 1SBFA 4JHZA 4QX1A 4RA0A 1JS9A 1YQ5A 2OUHA 3WZ1A 5FZGA 4H7LA 1PX4A 2ADDA 2HWC2 1X7NA 4PT6A 4YVWA 3VZOA 2RS31 2YY1A 2ZHLA 5F3IA 3CZUA 3O1RA 1K5MC 1BK0A 4FPLA 1G6NA 3UETA 3VBSB 4MVTA 1BK1A 2PQQA 2ZGKA 3UESA 1ALYA 3WG3A 4K9SA 2VMCA 5C4WC 4PDWB 3MIDA 3V65A 5JCTA 1ASJ1 4BQXA 1BMV1 1SHWB 2RR11 3E5QA 5TSWA 4Q4V1 1C8M1 4D7YA 4KH9A 4YG0A 3ZYFA 3LSEA 5FZOB 3RZJA 2FHRA 2D7FA 5IYYA 4DFSA 2IVIB 2VW2A 3N36A 4B8EA 1NYWA 5EXOA 3M3EA 3H7YA 4HN0A 5I8SA 2QZ2A 2JDAA 4CU9A 3BOWA 2HWC1 2ZGRA 5LEKA 4O9GA 1ZRCA 5BNNC 1QOSA 4A7ZA 4XMAA 2Y6KA 1W2UA 1SG3A 2VMFA 1DQ1A 4N7UA 1XYOA 3VKMA 3TEWA 3ZSKA 2AH2A 2V5DA 4L2NA 1EYBA 2XLGA 1KDKA 3QOPA 4Y3OA 4NIIA 4BQ3A 1UWWA 2RS53 4OI0A 2E53A 1VRH2 2XUEA 3ZIXA 5IATA 1POQA 3D0SA 2DBNA 3ZN6A 1K3IA 4YW6A 4KL1A 3LIHA 5FY5A 2QQVA 3O1SA 3ZYJB 4COWA 1PGSA 1H4HA 1D0GA 2Q8OA 5FZOA 4IE5A 2ZX4A 1W9FA 2CGPA 3OGJA 5FMDA 3LDRA 3FJSA 5HXVA 4YZ2A 1N3PA 1RVF1 1WGPA 3WP4A 4EQVA 1UIKA 1L3JA 2H6CA 3D3AA 1UZWA 4ISRA 1ZX5A 4YM1A 1GP5A 2EALA 4XZPA 3FUOA 2BBAA 3NNJA 5LA2A 1XNTA 2FZ1A 5JXGA 3PVNA 2PLV2 3VDBA 4ORFA 5J3UA 2VZPA 3ATGA 1SEFA 5A3PA 1I9RA 1ZBE1 2P1BA 1TME1 1UOJA 2ZGPA 4NOTA 1EY2A 1LHVA 1MS3A 1R64A 4UFKA 3KCYA 3AKQA 5F3CA 1PO12 2XJQA 2JDUA 3H3UA 3POBA 1UNBA 3ZYPA 4CXYA 3KT1A 4Y5TA 3U14A 1UOFA 4FPCA 4CEWB 1S2EA 5KC5A 4IEWA 1D0HA 4HVQA 2P3KA 3ZXLA 3GALA 1WCUA 3PJYA 4Q0VA 4XF9A 2J1TA 2JWPA 5I91A 5FK8A 1WUVA 4QPGA 1MZ6A 3POYA 2ZMLA 3TN92 1LNSA 2CWSA 1O3RA 1HLCA 1PM7A 4CDXB 4DUXA 3H8RA 1UZ0A 3NRUA 3ES1A 1EUTA 2UYAA 4OHZA 3J7NA 1F31A 5F3GA 4EWAA 2FDGA 3VBHC 4XFGA 3DN7A 3MZHA 1RL3A 1RUE3 3NNMA 4GMP1 2XJVA 1LESA 4H14A 5FCCA 1QQP2 2MEV3 2W52A 1SZBA 4OHXA 4XE9A 2JJ6A 2FCVA 1IGOA 2GSYA 3FHQA 1V6LA 4IEPA 1OLRA 3WOGA 4FO9A 1D4VB 3A7QA 1FNZA 1LOAA 1VMJA 2XG3A 4LKDA 4Z2WA 2E7AA 4LE4A 1JZ4A 1H1MA 3IBMA 1I6XA 4Y20B 4U2AA 4NRQA 5A7WA 1IPSA 5A1FA 1LEDA 1LENA 5GJ6A 4LHKA 3VL8A 4TN7A 5F5IA 4QQPA 2BWCA 2YDEA 1SFNA 3ZYIB 1LB2A 4QHZA 2WT1A 4IUGA 1RVF2 3FC0A 3VHOA 4MLOA 3T1MA 5G05L 3AZVA 3LKJA 4LK6A 1WCQA 3O7OA 2VCBA 4HXCA 4RFRB 5T5PA 3VHNA 5B4XA 5JOZA 4IE4A 1DYPA 2WIIB 3LQCA 4CSWA 1L7LA 4CUGA 3I2GA 4WM8A 3ZXJA 2BERA 5LK5A 2ZZQA 2HWB2 1SACA 3O1UA 3WDYA 4DXZA 1N47A 3Q8BA 4K8RB 3ZSJA 3J7LA 3SQOA 1UYPA 1UZVA 3ENRA 5FKBA 4Q29A 4MXVA 2VCAA 3MLKA 4R9DA 4FQ4A 1XJAA 3ITQA 2W87A 3OYWB 1E57A 4ISQA 4YPJA 5JZGB 1NLSA 2DCTA 1ZYBA 3K77A 1F4AA 1S2BA 3W58A 4BISA 2CNAA 3GHMA 3ZFEC 4XUNA 4E4DX 1W0PA 2WT2A 3UKTA 2E26A 2WRAA 3FZ3A 4QQOA 4GWNA 4NR1A 5ACA3 4LBKA 4HKWA 3C3VA 3HN1A 4NMIA 1YNAA 2Y8KA 2TNFA 4GIQA 5EJ1B 2GNBA 4AFDA 1LJ7A 2YMZA 5FPXA 2VO5A 4FQZA 4CDXA 4TTGA 4A7KA 1FPN3 2OVUA 4LORA 5D2AA 4Q26A 5DUWA 5GLWA 3LE0A 2D97A 2V5YA 1AYN3 1LGBA 3UJQA 5FK7A 1OQ1A 2EAAA 2WNEA 1HB1A 1LHOA 1UCXA 3LEIA 1YCIA 2QCSB 3MIEA 1Q8QA 5FXWA 3CJIA 2VECA 4BXSV 5AFEA 1AX2A 1OOPC 1B35B 4FTSA 4LO8A 3HD8B 2O14A 1OA2A 3AB0A 2A75A 4MGIE 2RS32 1OOPA 1HRI1 2VVDA 3AP6A 2YV8A 5DG2A 2XJTA 1D4M2 3RSJA 4URAA 4E4HA 5FIXA 2Y6HA 1H2MA 1V9U2 2WQZC 3R6SA 1B35C 3Q8CA 5FMOS 1CAVA 1BVP1 4BQ4A 1XC6A 1R1ZA 2B39A 2H0VA 2NPIA 4TWTA 2VBDA 3AKRA 1N1VA 2EIEA 3CU7A 3LA2A 1AXYA 4IV1A 1G9AA 2P6CA 4RHV3 2QJVA 2VTXA 1EAH1 3O14A 4C0HA 2FDKA 5LBFA 5K8SA 1V0AA 3BU7A 4BMEA 4LBQB 2XLFA 2NM1A 2HWF1 4D6QA 1QOTA 2VUDA 2XJSA 3TNQA 2DYCA 4JGZC 1YQ6A 5KWRA 3SKVA 5T55A 3PUIA 4QPYA 4PQQA 5FYCA 3SNMA 5JVVA 2ADEA 3WUDA 2R7EB 4NIAA 2PMWB 2JICA 5FP7A 1QKQA 3KT4A 1FXZA 1TEIA 1ZRFA 4AEJA 1FMD2 4BHPA 2VBBA 3ZPOA 1ZRDA 2CDOA 2D6PA 4W6XA 3NV1A 1OF4A 1G86A 4Q4Y1 3O1OA 5A33B 4CPBA 1JW6A 1CAUA 5K0UA 4MOAA 3T30A 1PVXA 3HT2A 2CTVA 1KJLA 4M3CF 1VAKA 1TNFA 5FP9A 2PA7A 1O7FA 4S2HA 3EB7A 2C6SA 4HOOA 4IL7A 3ZXFA 3VDDC 2GNMA 3VD4A 2HEWF 4MX3A 1JOJA 1MR5A 1KFUL 3IDCB 5GALA 4AGGA 2MHFA 2YPDA 2IXKA 1GZ9A 3OSDA 1XSQA 3VBSA 1YLLA 2ZGOA 5FAXA 2AZ5A 4AI2A 3ZX7A 3KM5A 4OQ9A 1JMUB 3N9QA 5A80A 3UGFA 1NE4A 4RSUA 2XL9A 4BE3A 5FOBB 3GHNA 1AVBA 3M3QA 5C3PA 2HWD3 1ENXA 4FPKA 1FPN2 1KFXL 1NAEA 3KQ4B 2Q30A 5F2WA 3UYJA 3VBUB 3WG4A 4NWVA 2OYZA 5DAVA 2A7AA 2IXHA 3KD4A 5FY9A 2PHLA 5EFUA 1YQ8A 4RHV2 3BTZA 2HBUA 1XNAA 4JZRA 3NKGA 4D0QA 1YJLA 1IS3A 1RUG1 3U78A 3VHPA 1A8DA 2WFF3 2VZSA 3IAQA 3QCWA 5J37A 2GALA 4YLZA 4ATEA 2RDQA 4NHLA 4DQAA 1DF0A 3H8UA 1ZRIA 1RUG3 5EYYA 4NHMA 1VBE1 3POJA 4CCKA 1V6MA 5T5LA 2D3PA 1RUJ3 4MSVA 1COV1 1RUD3 2EIGA 3DPRC 1Q56A 3SISA 5C71A 2VOXA 3V0AA 3VBFA 5FP4A 5F37A 2G19A 3AP5A 5A7SA 1N1YA 3LOIA 3OY8A 4JVAA 4YG6A 3HNYM 3AMMA 2W1WA 3J7MA 3ZXKA 4OI1A 2OIIA 3C8XA 1YJKA 4MXWB 2IVJA 4YG3A 3THTA 1CESA 2A1XA 2ZAAA 2FZ2A 3DKWA 3PU8A 1CPMA 3C7FA 4N53C 3DYMA 1BXHA 3CNAA 5FBJA 1C8NA 1GZCA 3T0AA 4XUTA 2RS12 4AEDA 3S57A 1F5FA 2CL2A 4W50A 2JG9C 1R082 3VZKA 4DPNA 4GWJA 2VC9A 1G9CA 4GH4C 1W8ZA 4AHWA 4QB2A 5BYNA 3RI9A 3JD73 2R1BA 3IPVB 3WDTA 4MGYE 5DZEA 3K4AA 1FNYA 4JTNA 4DS0A 3BU0A 1HQLA 1H9WA 1S4CA 5A32B 2YUEA 3J26N 3K4DA 1NXMA 3K3NA 3OY8B 4IEUA 3VZMA 3G6JB 1PZ8A 4OHYA 4RR3C 4HMZA 5ABJC 1Y9GA 1MS8A 1ULCA 5FYVA 2G9FA 1UZZA 2A6ZA 4PLNA 3M70A 1XNBA 4FP2A 2CAVA 1CAXA 1U5IA 2XVLA 3KLSA 3HOBA 2ZOEB 4F3JA 1GOGA 5BUVA 3HN3A 3LGRA 4JRAA 4A3XA 5A3TA 1FATA 5SV5A 1WBLA 4FOQA 1W6OA 5JSPA 3PDQA 1YWKA 1W90A 5BNPB 4Q4W1 2FD8A 4U36A 4Y22A 4Q4Y2 4EN7B 2VMDA 3AL6A 3WDWA 1RB8G 2B45X 1UZYA 1H8TB 2R042 4IV1B 1JZ5A 2A6WA 2XB6C 4L9BA 4JRLA 3ZR5A 1LKNA 2HWC3 5FO7B 4N9HA 3BIEA 2WUHA 2XPJA 3H1WA 3GZUC 3KGLA 3EBRA 3N35A 1QWRA 2LROA 2Z42A 2NP0A 4GJZA 1Z7S2 1BBT1 4NROA 4JGYC 2GAUA 3FMGA 4Y26A 3S7EA 4A42A 5A6ZA 5IK5A 1PK6B 2J1SA 1ND3C 3NJZA 3W5NA 1XBFA 4CUCA 2HKXA 2Q8EA 1ZZBA 3VB9A 2WO3A 4D6SA 5DAXA 1LTEA 1WBFA 3WXPA 1UMIA 5FWJA 3E1F1 4NPRA 4AZZA 4LO4B 3B9IA 1ND3B 1VBA2 4QPIB 4JCKA 5EWSA 1MPXA 2JENA 4Y5SA 4A7YA 2X53S 4JC1A 3LD8A 3H1YA 4IEQA 3ZIWA 2JDHA 4B3NA 3IDEA 1A78A 5CFDA 3I2DA 3FLPA 3MFAA 1HX6A 2VCMA 4QHBA 4WV8A 5F1RA 2KA3A 5AC93 1EV13 3BB6A 2ZHMA 1N3QA 4N53A 1GP4A 1TME3 1GICA 4EZ4A 2EXIA 2V73A 2R30A 3HBZA 1NQDA 1W28A 3HNMA 1TE1B 4ASLA 1NZCA 4WVMA 2JDYA 3AJZA 3ZFFC 1OFSA 5JXJA 3K51A 1HN0A 2P4EA 4V2WA 1VBD3 2O1QA 3VBFC 5CG8A 2DTWA 3OUJA 2KXLA 4LTAA 5KHKA 2TBVA 4FI9A 3U10A 4CZSA 4QGMA 1W8OA 4YM2A 5F3EA 3AX4A 5L7OC 2E6VA 4MGTA 2FDFA 2VU9A 3KCCA 2PAMA 1DHKB 2RS51 2V4AA 1XE8A 2VMEA 3AVRA 4QPGB 4IEXA 3I3DA 4R9CA 2YROA 2P5BA 3TEYA 5DZGA 4ET7A 5AFBA 2PHWA 4QHOA 1H2KA 4XF1A 1GSLA 5JR2A 1DFQA 1J59A 1RXFA 3CZJA 1D2SA 3CLPA 2CDPA 1NZIA 2QBXA 4R4ZA 2VTFA 1JZ7A 2D6OX 5C3QA 2TUNA 5FV3A 1HRV1 3KWVA 3MW2A 3NO8A 2I45A 1HQWA 2G4IA 3HIFA 2Y38A 5LY1A 1LOFA 2QVSB 3CL1A 3MW4A 4AW7A 2RG4A 5F5QA 3I3MA 1FAYA 4MHRA 5L9VA 5GZFA 2D6KA 4LBMA 4D7TA 1YFWA 3W21A 1VMHA 2ZA9A 1J1TA 4Y24A 5JPNB 1C4RA 3MV01 4FXGB 3S0MA 4UXAA 2R043 4LK7A 4CP1A 4OHWA 2FDIA 4KBZA 2OA2A 4RFT0 4ZHNA 3I59B 5DAQA 4NIDA 3FWEA 3A21A 3AZYA 1RUOA 1TVGA 2ZKNA 2QUOA 3EYPA 2JG8A 2RHPA 1Q5OA 3B3QE 2OW4A 1RUC1 3LEMA 3AXDA 3P3PA 2B7YA 2B5HA 1NE6A 2JB8A 2XR4A 1DQ0A 4KGGA 5M0TA 3N9NA 2RVAA 4LPLA 4B4RA 2BNOA 1HJFA 4A2UA 2WS91 1RJ8A 5FPVA 4D6RA 1DU3D 4YZ3A 2EICA 1IQAA 3ST7A 4OQ8A 2RR13 4P14A 4BYYA 4NRPA 4QMAA 1AR83 1QNYA 4I3GA 1DGWX 2WWUA 2WLPA 4CDWA 4EV0A 3WW1A 4ZU7A 1EV12 1UIJA 4KWLA 2ENRA 4AVBA 4QU1A 1S1AA 5J48A 5IT6A 2ZPXA 4R8HA 3IDBB 1VIWB 4N43C 2B46X 3OEBA 5ABJB 5FJKA 3W5MA 2ARXA 4XTMA 2XWBB 3J8F3 3PIGA 1D2QA 1O59A 5BPXA 3POIA 2D3SA 1Q8SA 2ZEXA 4N7IA 4DO0A 4NE9A 1MS0A 4E2GA 4NHXA 4WZCA 1HXS1 3SH5A 4CYDA 2ZMNA 5EPAA 2DCJA 2LALA 2FQPA 1AL0G 2DU1A 4FPEA 3EQEA 2A3XA 1ND2B 1VMFA 4K40A 1B35A 2CWMA 4F8AA 2R1DA 3I2FA 3QBQA 4FBFA 2XLAA 2R073 4O61A 2P34A 1ODNA 1OVPA 4YW5A 4I2OA 4GWMA 4XIOA 5D8AA 1H30A 4AAXA 1OQDA 3I2HA 3N9LA 3WW4A 2NQYA 3BVCA 2AGSA 4A4AA 2CV6A 3ACGA 2D43A 3ILRA 4LKEA 4ZS3A 2OXBA 3M3CA 2XJUA 3WNNA 3C7GA 2WZ8A 2BTVC 1OLME 3VBSC 4AAPA 5LW9A 1R1A3 3RMYA 3PUSA 3TEXA 4X6RB 5LEJA 2YC0A 5L9BA 1H8VA 2AACA 2EIDA 4WVWA 1XE7A 4AEDC 2BU9A 1OUXA 1PMHX 5A7QA 2FDHA 1WW7A 2BQPA 4XILA 4CU7A 3CO2A 4QX7A 5HPOA 5FQ0A 1D4M1 4KWJA 1HRI2 4OI2A 4CDUA 5T50A 2HWD1 1ULGA 1YQ2A 5FY8A 1LGCA 1UXXX 5GZGA 2F4LA 2Y34A 4QGNA 3VN4A 1UOGA 4XW3A 4AEDB 3P6BA 4CCJA 3HT1A 3V0BB 3F95A 1NCQC 1WD3A 4LITA 3W59A 3LB9A 5GZEA 2ET7A 4JGZB 4Q4V2 1PMJX 1UXZA 1GV9A 2RR12 4M3CE 1LR5A 4YGCA 2GH8A 1Q8PA 2RMU2 3WDUA 5L36A 4XVHA 3POFA 1VAMA 4K1ZA 4RN5A 3WINE 4D69A 2XL7A 2K46A 3U75A 4J25A 4CDQB 4DUVA 2WC2A 2YPJA 1U12A 4UOJA 3WQBA 5A70A 4PF5A 3KV6A 3NV4A 4B4QA 3TAYA 2GN3A 5CNAA 2RS52 4XQDA 4XOGA 1CONA 4XJAA 1OD3A 5DXDA 1LHUA 1W9WA 2OS2A 1XQNA 1TMF1 4KG8A 3WF4A 3BYWA 5A7OA 1W8HA 2JG8B 4M00A 2YYOA 1Y3TA 2ZX3A 2UU8A 4RS5B 5DDJ3 3M4FA 5C6CA 1F8VA 1HJGA 5A6XA 1NXD1 2VQTA 3O0XA 5FZBA 2FMYA 5I93A 2IWGB 2E31A 4NHYA 4RS5C 3U11A 3PNAA 3POGA 4K3UA 3ZYGA 1DZQA 3KT7A 1C3HA 3VKFC 4R9BA 1MQTC 3J8F2 5FRAA 3UT0A 4AF9A 2EXJA 2ARAA 3ZYHA 3BPZA 3WW2A 3B02A 4M3CB 3B01A 2R041 1AR63 3JCIA 1GZTA 3ZN4A 2X09A 1QIQA 3D82A 2OQ6A 3VHRA 4MZUA 1NUKA 3MV11 2RM23 4Q0UA 3KHBA 4IEYA 3E5XA 5CZKA 1BEV2 2YFZA 2QQUA 3PURA 4HG6B 5A3UA 4XUOA 4CU8A 2Y6FA 3TN93 4BU2A 1CD3G 1RUH2 2KR2A 2DTYA 2Q4SA 4M4PA 2C9KA 5T52A 4H2AA 2Z69A 4NRMA 5BNPA 2VR4A 2JXAA 1W6MB 2GC3A 4IDZA 3WNKA 2XDVA 3TNPB 4L11A 2DCYA 2HWE1 1LOFC 1SLTA 1LU1A 5LK7B 3EJKA 3ACLA 4BDVB 1WA6X 4A6OA 2WAAA 3LOBA 1SMVA 2WDBA 1GQHA 1DQ4A 1ULOA 1K5MB 4YGEA 5LWBA 1AL22 1PK6C 2HWB3 4B7KA 4XDQA 5CFDC 5ERLA 1BKZA 3WQ7A 3A22A 3VDAA 2OT7A 4PDWC 4XHBA 1AR93 1PM4A 3GZAA 3HWJA 4CP9A 3VUOA 2YG0A 5FUIA 4UT5A 1OXCA 1S0DA 1IOAA 3AMPA 1S2KA 4OMCA 3A23A 5DMYA 2WZR3 1OBNA 1UX6A 2VUCA 3CHXA 3N9MA 4XHXA 4G4FA 3NNGA 2VOKA 5FWEA 5BNNA 4EN6B 2DURA 3I3EA 2PLV1 1QJZA 1JYXA 3I3BA 4WVZA 4Z1VA 5JXIA 1MZ5A 1Z78A 3BUCA 1RHI3 5BNNB 1FOD2 1QJY2 5LY2A 4AI1A 4XBNA 1GWMA 4I30A 2A3YA 1W8NA 4FSJA 3N7KA 4A41A 5JSOA 4DY3A 4FPOB 3GJBA 2ZEWA 4QDRA 2BW8A 2D93A 3AXEA 1GZWA 2ZZJA 2CYFA 2G1MA 1W6PB 3ES4A 4FP3A 2P37A 4IV3B 1HB4A 2QQMA 4RHV1 5EHDA 5FBZA 3T2QA 4HKLA 4Z2AA 3FHAA 4GD4A 4Q4X2 5A1LA 3UNPA 3EXUA 3AKPA 4IEOA 5J96B 5ACA2 1J3PA 5IFTA 3OGVA 5IVJA 4YVSA 1V9U3 4C1WA 1PGW1 5JLVA 1ZBE3 2RM21 3LDBA 4LMFA 3T1LA 3RJRA 4Q4Y3 4RR3A 1JYVA 3BTAA 1CAWA 4AQSA 2UYBA 4E8DA 1X33A 2WZPP 2R0FA 2ZKLA 3LEKA 1JYNA 1UOBA 4I09A 4FVVA 4UWDA 4KWKA 2DUPA 3AK0A 4OLLA 3M1HA 4GH4A 3I97A 4E4ZA 1SPPA 2WYFA 5FZ7A 3MFCA 2AEZA 2ZABA 3RI8A 4CEYB 5CFCB 1RUJ1 2O0OA 5LA9A 3ZDVA 3J9SA 5I0SA 5JDBA 2P6HA 1HV0A 1H1AA 1VRH1 3O12A 1MACA 3FLRA 2Q8CA 1FPN1 1W2TA 5FMOL 2C5DA 4CCOA 2W92A 5A6YA 3ZYBA 5C3SA 3CJIB 1FMD1 4CDXC 3KSCA 5BNQA 4XZUG 3WDVA 1YI7A 3QH7A 4QX0A 5IK7A 5LRSA 2Q5TA 5JIUA 1OPMA 3AM2A 3OUHA 3GDBA 3VBHB 2RJ2A 3DKQA 4E8CA 5A3NA 4GB32 5LBCA 3URFA 2QQPA 4UFJA 3GCXA 1NOVA 4XBLA 3ZFFB 1BLZA 5KC6A 1VE0A 2UWAA 4UFHA 1W6NA 3ACFA 3E6BA 1O8SA 1WLTA 1ZRRA 3MW3A 2DUOA 2BVVA 4ARYA 1U5YA 3NJVA 4HK9A 4KU7A 4CPBD 1O3QA 1HB3A 1CJDA 4UF0B 3WF3A 1VBD2 3POEA 2JX9A 3JU9A 1V6OA 4QB1A 2ETEA 2VJXA 1YUDA 4Y4RA 1VBC2 4AHXA 1J3RA 1JZ3A 4QPGC 3C7HA 2G9ZA 4E4SA 1NY72 3WCRA 4JGZA 5L9RA 4R52A 2QDRA 2J1EA 2X5IC 1PIV3 1BQPA 3RQ0A 1O3TA 4NO4A 2UY8A 1YFYA 5CB7A 1EPWA 5DUUA 1QJY3 2WQ8A 1F5JA 1H6XA 4FT8A 4UI9L 4CP2A 4A6SA 3RGBA 2DVBA 2VW1A 3AKSA 4JV4A 2SLIA 2VH9A 1QDOA 1SQ4A 1UY2A 2HWF3 4Y33A 3TYJA 1QU0A 2OZ6A 2Q0AA 4O7XA 1JZ6A 2VD7A 1ND2C 1EAH2 3ZFGB 5E16A 3K4ZA 4P02B 1W3VA 3VBUC 2DVDA 3WR0A 3MI8A 4NAMA 3LA3A 3PTYA 4UW4A 3FN9A 3WV6A 4IESA 1RUD2 5K4LA 1UYYA 2HWD2 4DY5A 1TG7A 3TB0A 3DYPA 1DLCA 4L99A 3WUCA 2XBO2 3JD71 3NAPC 4CCNA 5FJHA 3N9OA 2BWAA 5A7NA 1QMJA 1OKQA 2DU0A 1H0BA 4FXKB 1AX0A 2Q1MA 3AYCA 1E5IA 3QH6A 1UX7A 1MQTA 3ETPA 3RDIA 3B00A 4I3PA 5FXVA 4BQ2A 3HPNA 5FZDA 3ZN5A 4EWEA 5F6LB 4YSFA 1O8PA 4DZGA 2V72A 3CQOA 4JGYB 2Z2SB 5FZ9A 4OUMA 4NWWA 4UBGA 5FOJB 1W0NA 1NCRA 1Y4WA 2CU5A 3T4VA 2QQIA 1DYOA 3M2MA 1VP6A 2DDUA 4AE2A 2WNVC 4I0BA 3SITA 4YZ5A 1QOOA 4TLGA 1KD7A 4FFFA 4Q27A 4QPIC 1UU5A 3V64A 4FFHA 1V6IA 4LOSA 3VBOC 4AHYA 4LR4A 5BY5A 4QU2A 2A5ZA 4Y5Z0 5A3LA 2QZ3A 4AVAA 1IS5A 2J1AA 3PJQA 2FMDA 2D6NA 2FDJA 5CEHA 4KQ7A 1R083 2QE3A 5FYYA 2BFUS 3WSOA 2WNOA 3JUUA 2R071 1GWLA 3USUA 4PIYA 1W2NA 5KXBA 3RPQA 1XE0A 2PELA 1ULPA 1DGRN 2AREA 2JIJA 4KI5M 4QX3A 3B69A 2I2SA 4LUMA 1OFNA 1XNDA 1A34A 5AVPA 4GA9A 4AFBA 1C1FA 1LOCA 4LULA 2W47A 3OJBA 1G9DA 1PX3A 1ASJ3 2ARBA 5LBEA 2NYYA 2RS33 3IMMA 2JD4A 1ZVFA 1SCRA 1V6NA 2HYXA 5LCWL 5IJRA 1CZTA 3ZFEA 1PHMA 1VAVA 4MGKE 4FAGA 4IV1C 3MHZA 1DG6A 3LPFA 4LO6B 4XUQA 5FLIA 2OPWA 5LBBA 2DFBA 4YM0A 3VD3A 3HQXA 1MQTB 5C4WA 2WABA 1XRUA 5FO8B 4ITCA 3OBTA 1S0CA 4P9IA 3WY6A 4B29A 3DV8A 2YC2A 4HT1T 5FZMA 2VG9A 4AVTA 4PIXA 4JKKA 3S5QA 1QQP1 3MLJA 5KHIA 1C5HA 4JKMA 4Q4X1 4LLFA 2MEV2 1QH6A 2EF6A 1GNZA 2WZR1 4CXXA 2HEVF 4GULA
chains in the Genus database with same CATH topology
2ILMA 2VQAA 1GYKA 3P3NA 5T5JA 4ZU4A 3PLQA 4L97A 2DVFA 3S30A 4XJWA 2R063 4K6BA 2XKPA 3GZTB 4Q4W3 1DQ2A 1QXPA 3E5UA 4HN1A 3L2HA 3NAPA 3NV2A 4ONUA 3S6PA 1DBNA 1REEA 2AR6A 4Z07A 1AJKA 2LTNA 5H9QA 2XVKA 3ZO0B 2PAEA 1ZA4A 1KS4A 2C0ZA 2Y0OA 5HCFA 5AC92 2ZBJA 2K2SA 2Z79A 4AK3A 5I0RA 3FFQA 1DGLA 5FLJA 2PFWA 4BOWA 4AI3A 1ZBA3 2V09A 3WP6A 3KQRA 5C9AB 1LECA 1C8M2 5AVAA 1AR73 2X5IA 2BBVA 4WBBA 5C9AA 1ASJ2 2WA3A 1V6KA 2OPKA 3JZVA 4NHKA 1WCSA 4N53B 3ZXEA 3USUB 2YGLA 3I54A 3PVBB 1RUF1 2Y26A 1QY4A 5FREA 3VBRB 1OPOA 1IPKA 1X8MA 4SBVA 4BMBA 1R092 1Y7BA 2WS93 3Q9OA 4WVVA 4IEZA 4IV3C 4S2DA 4Q0PA 1VBC1 4Q0SA 5JZGC 4CEYA 5CFCA 1XXNA 4QM9A 4IQPA 1YIFA 2ATFA 3NAPB 2QDNA 3U4XA 3ALQA 2BYVE 3UK9A 3U07A 1MZFA 1K5MA 4P9JA 4KNCA 4TSVA 1NCRB 5BNPC 4YVWB 3RG0A 4COVA 4P9XA 4K20A 4C91A 2UURA 1RMU1 3PMSA 1W6OB 4GALA 3NV3A 3AYDA 4GB31 4OHVA 1PZ9A 3SXWA 2F4PA 1VJ2A 4BIFA 3WLUA 4JAAA 4N9IA 2ZX0A 1Z0HA 3FE5A 1W6QA 3G7DA 5DUXA 1BYHA 4HBNA 4V1PA 3E6CC 2WNVB 2ZMKA 4YVSB 1DZTA 2NMOA 1R081 4W6YA 3HAGA 4H55A 3VKOA 1BCXA 1A6CA 1GNZA 5GLZA 1PMIA 2GN7A 1RGSA 1VRH3 2R6QA 2RJLA 5E1RA 2GC2A 4DRVA 1WMEA 1QJU3 4RL7A 1FMD3 1M06G 4MUVA 1CGPA 4W6WA 1R1A1 1SDWA 4FOYA 1LRHA 1KQRA 2GNTA 1S0JA 5CG9A 4MH0E 3ZXDA 2MNGA 2BGCA 2IXCA 4CRQA 4X8PA 5K0UB 3OD0A 1U5ZA 2X8KA 4Y1UA 1OA4A 4KBBA 2A73B 1CN1A 1JUHA 5KXEA 4OULA 3JQXA 3ZYRA 5EYXA 4F83A 3CEWA 3VBFB 1O4YA 1B09A 2JG8C 1QQP3 4ES8A 1F9KA 1H9PA 1TMF3 4I02A 2ZGNA 3INAA 5GM0A 5L7OB 5FO9B 1KS5A 1XU1A 2BEOA 4YRDA 4RGGA 4P9LA 4WM7A 5FLHA 1LULA 1OHFA 2ZGTA 2XVGA 3SCFA 2ZGUA 4S2FA 3V56A 4XF0A 4Y1YA 3NKTA 4META 4XIKA 1W6MA 2WS92 3IT8A 1CQ9A 2PHUA 1WLCA 1J3QA 1YIPA 3HR9A 2W0XA 3JBG2 1IZ3A 3TOJA 5K9YA 2DWRA 1WW5A 1RUG2 2GC0A 3BALA 1IHMA 4AG4A 4AVVA 1MEC1 5FDBA 3D0JA 4HL0A 2P2KA 1GZWB 2GNDA 3UJOA 1S55A 2QKDA 3LWCA 1UMZA 1AL21 3FFZA 3OCPA 1GQGA 1RUI1 3IWZA 4M01A 3MIFA 2A6YA 3WG1A 1JHNA 1RUF3 3D8CA 3EHKA 4DMIA 2XBO1 4HSLA 1QJU1 3MGUA 1AYM3 2GMMA 1J58A 4PLOA 4PLMA 1XU2A 4X6QB 1PNFA 1RMU2 4IERA 2XWJB 5F9TA 4DB5A 4LBNA 4BWOA 5CVRA 2DUQA 4QX5A 1G7YA 3KMHA 3DPRB 1RUNA 3ZXGA 2VXRA 3ZSMA 5C33A 4JDNA 2D3RA 1LHNA 2H0BA 1MZEA 3QLQA 2WNVA 4XFHA 4AFAA 1I3HA 2B42B 3MPPG 3VZJA 4FPYA 4FOVA 1D4M3 1CR7A 3RMXA 3SCHA 3FBMA 3SH4A 5H9RA 1HW5A 5KXCA 3H7JA 1VR3A 3IN9A 2JKBA 4CTEA 1RUH3 2X29A 1FX5A 2CAUA 1LODA 3MEPA 4NVPA 4JQRA 4BH9A 5CIRA 1RUE1 3ZFGC 1YRZA 4BIOA 1VBE3 2VNGA 3BCWA 1QJX2 2HWF2 1FV2A 1XYNA 4K7JA 1O5LA 1N1TA 3R0RA 2GC1A 3N4MA 3V0AB 4TLFA 1Q43A 4XXAA 3FLTA 2AYHA 4LUKA 3D5OA 4Y1XA 3WQ0A 1UAIA 4I0AA 4IEVA 4CDUC 3OTFA 1V9U1 1NA1A 3WHUA 2HYKA 1RUF2 1AR71 3ETQA 4LO7A 3MF9A 3AFKA 3R4SA 1FT9A 2PHRA 1QJX1 2CGOA 2ZGQA 1HQNA 4XETA 2DVGA 1MVQA 1RMU3 3WD5A 1FOD3 3UL2A 5CAZA 1AYM1 5BNOB 2ZGLA 2XH6A 5KHJA 4CEWA 1DZRA 2GMPA 2Q1ZB 3MICA 3VV1A 4XFFA 1AR81 1MVEA 1SBEA 3O0WA 4XTPA 1GLHA 1UD1A 2MEV1 2WZR2 4MYEA 1V70A 4XYXA 4LT5A 4CDWB 4XQ4A 3PVOA 2ZACA 3VZLA 3SLIA 1GR3A 3MDPA 1MEC2 2VUJA 5C8WA 5F6KA 2MPFA 4CDQC 5J7MA 2VMGA 2YXSA 4CDWC 4YNIA 3SH3A 1C57A 4XEZA 5DG1A 2DCKA 3FHIB 5FQ0B 1JXNA 4AQ6A 4TZDA 1T6GC 4N43A 2NN8A 1UKRA 4RGAA 4E27A 2CGNA 1KXGA 3ZSEA 4AVCA 1V00A 1FOD1 3DPRA 3DL3A 2VW0A 2OZJA 2YZ4A 1ZNPA 1UPSA 1MS9A 4B7EA 1TQ5A 1POV0 4AQTA 3IMNA 1HRI3 1WCDJ 2DCZA 1S0FA 1W6QB 2VUAA 1EV11 4Q1PA 3VBRC 2JE9A 4XQWA 5FOBB 5SV8A 4AGVA 3JBG1 5GLUA 2RJKA 2D6MA 4JDMA 5GZCA 3AMQA 1ND3A 1JYCA 2A70A 3AMHA 4XJUA 1S0GA 3POSA 3N7LA 2BNNA 2RMU3 3GNEA 3L2YA 5JZGA 1SBDA 4I01A 2EXHA 5GZDA 3VDDA 5E88A 2ZTNA 1QJY1 2IXJA 4FAHA 1AXZA 4D3WA 2UY9A 1FYUA 2IC1A 3N7MA 1BBT3 4YW3A 1QXRA 1QHDA 3FX3A 2XJRA 2EVXA 4Y4YA 2GH2A 2ES3A 2WWSA 1Y43B 3ME2A 2BVBA 1PNGA 4AYUA 2I07B 4LO5B 4QM8A 1PIV2 5C4WB 4NN0A 2D40A 2KM2A 1C5IA 2XGXA 4X8NA 3T2TA 2RE9A 1PVC1 1CVNA 1NA1B 3E6DA 4WVMB 4E9KA 1DYKA 3TBDA 3ZN6B 1C8M3 1JH5A 1W6PA 3GYDA 4S2GA 3ZVXA 1APNA 2JG9A 4AHZA 3AP7A 4EN0A 1AR62 3J8F1 3FBYA 4K21A 4Y1ZA 3AYAA 4HETA 1HXS3 4D94A 1RC6A 4KU8A 3AZWA 3NSTA 3VKLA 1UF2C 4PQ9A 4CDQA 4N43B 4QQLA 3ZDSA 2VNOA 3U0ZA 3VBHA 4F7ZA 4HK8A 1R093 4URTA 4KGQA 4C1XA 1RUI3 5FFOC 2OUJA 4QQ2A 2ZX1A 4BCUA 1ULFA 4GKXA 2DV9A 3NW4A 4K1YA 4AI8A 5I0TA 1GKBA 4LE3A 2D5FA 2VQ0A 3C2UA 1W39A 1AL23 2VVEA 1H1IA 2RMU1 2B9UA 4E2QA 3QD6A 5JWPA 1X36A 4RQPC 1PGL2 3LAGA 5EZWA 3H1MA 2WLQA 4HPKB 4LBQD 1AR92 2A71A 1TNRA 4AEKA 4HLTA 4FPGA 5DDJ1 1CIWA 4Q4V3 3WW3A 4RQPB 4GQ7A 5GLTA 1SLIA 3ROUA 1CX4A 4EWDA 1PVC2 4P5HA 4WM7B 5CA6A 1JN2P 1VBA1 1M4WA 1AF9A 4UW5A 3QACA 1NY71 2XHKA 2VMHA 4UW3A 3M3OA 2FZ2A 2EA7A 1BBT2 1ENRA 1POV3 2ZX2A 1V6JA 4COZA 4XXPA 2ZGSA 1DQ6A 5HCBA 5K0UC 4Z82A 4PBOA 1WW4A 1W0OA 1QNWA 1ZZ9A 2ZHNA 1BJQA 4UBHA 2HJIA 4INDA 3DUIA 4OFGA 4BLJA 5JAXA 5HCAA 1PGW2 1AZDA 5A3MA 5ACA1 1RITA 1RUI2 1DGWA 1F2NA 4JTOA 3AZZA 3KGZA 5DUVA 2AUYA 4AEMA 4BPZA 1AUYA 3APBA 3AZXA 2PYTA 2E7QA 5J09A 5D1IA 4FCAA 2HWB1 3WX5A 4LEJA 1FI2A 1RUJ2 4XFCA 1PO21 2BUKA 2R062 3MIBA 4AFCA 1GBGA 2R0HA 2YGMA 2QFEA 1HKDA 5C8CC 2D6LX 4G3YC 4RQPA 4XF3A 3RYPA 1O5UA 3IIAA 4BZ4A 4QXKA 4L8QA 5CADA 1NQJA 2DF7A 2WSVA 4LHLA 2N7GA 4XJZA 4E2SA 3NL1A 4PDWA 1NLRA 2A6XA 3OF1A 3LZZA 5JOWA 5L73A 1O3SA 1H8TC 1NCRC 4HSJA 5JOXA 1X50A 2B8MA 3WDXA 4YW1A 2XJPA 1G9BA 2BPA2 1VBC3 1SCSA 3RYKA 2DFCA 1AYM2 1I5ZA 2C9AA 5H9SA 4ASMB 3AJYA 4XPVA 1YI9A 2R32A 3MF6A 3GBFA 2ZJCA 2Y0IA 3TWIA 5BXXA 4EJRA 3WQ1A 4D7SA 1HRV2 2FBEA 4HVOA 2BNMA 4LA3A 2UWBA 4R4XA 4XJ8A 2E7TA 1PO11 4B4PA 1POV1 4YGDA 5K7PA 3VBUA 4HZFA 4ZXKA 5BV6A 3X29B 3NWKA 5JI9A 3R05A 2W08A 1X8EA 1MS1A 3UKVA 3D4KA 4YM3A 1G8WA 1PO22 3I8TA 4C0BA 1N3OA 2XBO3 2WNUC 3TN91 3I4IA 3H50A 3GBWA 1QXJA 1DIWA 4PCRA 4HVRA 4LLOA 1AX1A 1H4GA 1QJX3 3BIWE 3H9AA 3MPBA 1RUE2 4OUSA 2O8OA 1YFXA 1ZZ6A 5I0UA 3WVJA 1O4ZA 4Y20A 3JB4C 1BVVA 4BLIA 1KJRA 1IS4A 4YZ1A 4YVWC 1UL9A 1YO8A 4P9WA 3THPA 1TME2 1C28A 2IZWA 2E9QA 3D6EA 4C90A 4LBOA 1OA3A 4K8FA 4AGRA 3N7JA 3VBRA 3HMYA 3KZ4C 1JBCA 2HEYF 4OVEA 4LBJA 1RUC3 2VGDA 2ZGMA 4Z92B 1AR91 3M8LA 1ZREA 4CEWC 4Q8KA 2PAKA 3R4DB 4YVSC 5CBLA 1NCQA 3B93A 1J1LA 5HBAA 4RS5A 4XBQA 1UU6A 3RJ2X 1CJPA 1ND2A 3RYRA 5D8AB 1XNCA 4CEYC 5CFCC 2P17A 1FV3A 1Z7S1 4XF4A 4I0WB 5T5OA 1HRV3 4DOUA 2HWE3 4W65A 3KS7A 1ZM1A 4XJ9A 1SLAA 4EN8B 2ZS6B 1RTVA 1KITA 3USSA 3ZXAC 3AYEA 2E51A 4GKYA 2EAKA 5DDJ2 5JR7B 4IV3A 4LBQA 1SFYA 2NLRA 2D5HA 2E63A 5JI7A 1X82A 1DGRA 2D98A 3PVEA 2QNKA 4G9SB 3IPVA 1BMV2 4FPHA 4YZ4A 2VNRA 3UKNA 4LA2A 3R4UA 1PO23 1OLQA 3JQWA 1AYN2 1JUIA 4J6GA 1AR61 5IUQA 2R16A 2WFF1 4DINB 3JB8A 5C9AC 3GBGA 2DVAA 1ENSA 4J1WA 1BZWA 1IKQA 2VMIA 2D44A 5FTTC 1XYPA 1REFA 2RM22 2PN5A 2GDFA 4AQ2A 4FTEA 5KHGA 4LBLA 3DGTA 2VVFA 1PIV1 5H9PA 5J36A 1VALA 1PZ7A 2X5IB 4JGYA 2LUWA 1EPZA 2PHXA 3ILFA 3AMNA 1RINA 4Q8LA 4Q4W2 4WZFA 4YFWA 3E97A 3L9JT 4XFBA 4LHNA 3OD4A 3OPZA 3W9AA 3S7IA 3RWNA 1OD5A 4YW4A 5JIAA 1LGNA 1UN1A 1YHFA 1IKPA 1ZBA1 2PHTA 3ELNA 3V0BA 4QGLA 1S0IA 4XMIA 1Q3EA 3POWA 4BM8A 3LCPA 1RHI2 1VB2A 2YHJA 1UPIA 1MS4A 1WCKA 5GKAC 4H3WA 5JPMB 3LSDA 3VL9A 1UU4A 4YYOA 1QF3A 1ZBA2 1LEMA 3CJXA 1RUC2 4Y1VA 1UKGA 1OOPB 1PO13 5EV7A 2RS11 4J1XA 1QGLA 5EJ3A 1YYNA 4M0NA 4M3CA 4GMP3 5IK8A 2R072 1HDKA 1ONAA 3KB5A 3O5SA 2IFWA 4MGZE 1VBB1 4AVSA 3CF6E 1AHSA 4IETA 3VLBB 4KG0A 2VOWA 2HWE2 3VKNA 1A3KA 4PBPA 4AI0A 2F6BA 1VBE2 2IXIA 2K0GA 2JECA 2WFF2 1WW6A 4Q4X3 4FTBA 1R1A2 5A32A 4ZU5A 3VBOB 1RUH1 1NG0A 1YFUA 4RD7A 5CU1A 3J4UH 2P3JA 5KHHA 2WINB 3ZFGA 1H2LA 1ZBE2 3WP3A 4P9GA 1WLWA 4DNYA 5ABJA 4AXOA 3B7MA 4QPIA 1ZZ8A 3B5LB 4XFAA 4Q1RA 3M3IA 1GNHA 3MIHA 3AP9A 1GFF2 1RVF3 1N1SA 4FOWA 3MIGA 4HANA 4PIZA 4QT6A 3ZMNA 4SLIA 2IFRA 4QQHA 2PTMA 4BA6A 3PMEA 4Z8BA 1GANA 4CDUB 2WKKA 3RZZA 2VPVA 4Q2FA 3VDDB 4P9YA 1HIXA 1VLNA 3MLLA 4GH4B 2ERFA 1BEV1 1CPNA 5IK4A 2BFUL 3A0NA 2G9GA 2GU9A 4WM7C 3VGIA 1H8TA 5D8AC 1AXKA 5BNOA 1VB4A 1AR82 1JYIA 1LOGA 2RS13 5BNOC 1R091 1DDLA 3A4UA 1JTZX 1OMIA 5AC91