1LU1A

The structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
253
structure length
253
Chain Sequence
ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPSKASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
source organism Vigna unguiculata subsp. cylindrica
molecule tags Lectin
molecule keywords LECTIN
total genus 52
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 1998-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lu1A00
3LSDA 3V65A 2YZ4A 4P9XA 4Y1UA 4XZPA 3SLIA 1WD3A 2D43A 1LGNA 1C57A 1MS0A 1MACA 3GALA 1NLSA 3SH5A 1I1EA 3M2MA 3UL2A 1VALA 2DUPA 4YGEA 2UWCA 2ENRA 3AXEA 4XBQA 1W6NA 2P3KA 3MEPA 2DVFA 2ZZJA 5GZCA 1GZ9A 5HCFA 2A3YA 2D6MA 3AZVA 4YW2A 2EAKA 4BM8A 1IKPA 3M1HA 2AYHA 3FLTA 5T52A 3M3OA 1YO8A 1S0JA 1YIFA 2A6XA 2FHRA 3N7LA 4XMAA 2P34A 3WCRA 2NZ9A 1GBGA 1QKQA 2E51A 4SLIA 3ZSLA 4FPYA 3T1MA 2ZGPA 2D6PA 2ZHNA 1WW6A 5CB7A 2D6KA 1S0CA 4YG0A 5DG2A 5HCBA 2AUYA 4YM1A 4ATFA 4AVSA 2P2KA 2DVDA 2Z42A 3WDVA 2GNTA 2D7FA 1OKQA 4PQ9A 1N3QA 4CZSA 3WG1A 2WT2A 1GZWB 5L73A 3WV6A 4JRAA 1GZWA 3AYCA 4GA9A 4YM0A 5T50A 3O12A 3FLRA 4Y1XA 3USUB 1CONA 1F9KA 4M01A 1MS1A 3B9CA 1QOTA 3ZXFA 4AGGA 2YROA 5IT6A 3T1LA 1Q8QA 1Q8SA 4BMEA 1WW4A 3BOPA 4YM2A 1WW5A 2ZAAA 3LSEA 3M3CA 5DUXA 2XG3A 3C2UA 2VU9A 1WD4A 4AVVA 4XE9A 1SBFA 4D69A 2GMEA 3WHTA 3PVOA 3MPPG 5CBLA 1YXWA 2YY1A 2ZGSA 1Q8VA 1SLAA 4C1XA 1CPNA 3AZYA 3VKOA 1WBLA 2W52A 2EIGA 1LODA 4Y1ZA 1V6MA 5DZEA 4UW3A 1WW7A 1MZ6A 4FP2A 2A3XA 2OUJA 1CJPA 2PHRA 3L2YA 4GKYA 4FQZA 2JE9A 4XHBA 1ZM1A 4GALA 3SNMA 2CTVA 3KQRA 5HCAA 1Y7BA 4Q8LA 2SBAA 4BQ1A 2RHPA 4YW5A 1AXYA 2W39A 4Q8KA 3NV3A 5GLZA 2WLQA 1QDOA 1AF9A 4FPFA 1AJKA 1C1FA 4Y20A 4XJWA 5GLTA 2YXSA 3JU9A 3AP4A 2JKBA 4YW3A 2EXHA 5E89A 1NXD1 1MS9A 4UW4A 4LBOA 2BQPA 2PHFA 5F9TA 1PZ7A 1GANA 1CR7A 4YZ5A 2AREA 5IK8A 2ARBA 1IS5A 1V6JA 1H9WA 3ZXKA 1LOBA 3AP5A 1I3HA 5GZEA 1IS4A 3M3EA 4XTPA 1SLTA 2EALA 2CYFA 1SCSA 2CWMA 1DQ0A 4AWDA 4DQAA 1JUIA 1W6PA 3ZSJA 1N3OA 1G9DA 1WUVA 2A75A 4Q1PA 1YYNA 1LHNA 2ZACA 1FAYA 1FNZA 1O4ZA 1MVEA 1HDKA 4FOWA 3BIWE 5GLUA 5JLVA 4Y24A 2VW2A 5IUQA 2ZGMA 5GZGA 1HQLA 1G8WA 2ERFA 3PJQA 1SBDA 1W6NB 2D6OX 4R9CA 2V73A 4XJ8A 1GNZA 3N7JA 3PVNA 3I8TA 3NV2A 4XBNA 4YGDA 1WCSA 3AK0A 4ZXKA 3BTAA 5IK5A 1SACA 3WDXA 1W6MB 2P3JA 3V0BB 1CIWA 4TYSA 5DG1A 2D44A 2D3PA 2TEPA 5JMCA 2OVUA 4DPNA 1FATA 2ZGNA 1VAVA 4FOQA 4XJ9A 4Y20B 1PZ8A 1Q8PA 4P9YA 3RMYA 2DVBA 4XOGA 4GXLA 2WSUA 3SITA 3AJZA 1VLNA 4OZXA 5IK4A 1AVBA 3M3QA 3VKNA 3V64A 1G86A 1S1AA 3NWKA 2ZA9A 4ZKTB 3WDYA 3AFKA 5T54A 5EYYA 1SFYA 1DHKB 2GMPA 3UK9A 1S0GA 1N47A 5DZGA 3RQ0A 3O0WA 3IPVA 4YZ4A 3QCWA 3WUCA 3R4SA 1GLHA 3OBTA 3FUOA 2DU1A 3TB0A 5E8AA 1BYHA 2ZKNA 1Z0HA 3ATGA 1JW6A 2ZGUA 4WVWA 2FMDA 2GNBA 3POWA 2DWRA 3ZXJA 1MS3A 1W6QA 2ES3A 1LHVA 4XIOA 4YM3A 2OW4A 3AYDA 3WDTA 3AZXA 4YZ1A 2ZMLA 3RG0A 1RIRA 1ULCA 5IK7A 1KRIA 1LU2A 1G7YA 4U36A 4XILA 2DTYA 2JE7A 1F31A 4PF5A 1MS8A 1CVNA 4K1YA 2W68A 4BMBA 1HLCA 3OBRA 3H0OA 3WCSA 4M3CE 2ZMKA 3ZXEA 1DQ2A 3O5SA 5AVAA 2OUHA 1LOGA 1KQRA 3D6EA 4BLJA 5KXEA 1V6NA 3ASIA 1WLDA 1S0BA 4FPCA 4ISQA 1N1YA 3APBA 2HYKA 4LBQB 1LECA 1MS5A 1QNYA 1SBEA 4ITCA 1URXA 4JC1A 1DYPA 4GWNA 5BYNA 5FREA 1KJLA 2A70A 4FP3A 2G4IA 5H9RA 2GNDA 5JOWA 1A8DA 2DYCA 1FNYA 2VXRA 3AYAA 5H9SA 3V0AA 4R9AA 2P3IA 4XDQA 5T5PA 3TAYA 4M3CA 2ZBJA 1LTEA 4MYEA 1LHOA 4YW1A 1IKQA 4M3CF 1ZA4A 3AYEA 4WV8A 4Y1YA 2SLIA 2D6NA 1W6OB 4FPHA 2R16A 2GALA 1GSLA 1D2SA 3N35A 4XYXA 1B09A 4YZ3A 1UKGA 1HKDA 1UMZA 1UN1A 1FYUA 3N7KA 4Y22A 1LESA 5EXOA 3WNXA 1DQ5A 2B7YA 4Q1RA 4C1WA 2WSVA 1UL9A 4I30A 2C9AA 2A6VA 2NYYA 4UW5A 1LOFC 1AX1A 2WKKA 3VV1A 3WG4A 3WG3A 1AXKA 2DVGA 1C1LA 3USUA 2WT0A 1V6LA 3QLQA 4Y22B 5LK5A 1LHUA 5EYXA 1N1SA 1JN2P 2WNEA 4LBKA 1ENSA 3OYWB 4F83A 3BODA 1LJ7A 4Z8BA 2JJ6A 3ZYRA 1U0AA 1N1VA 3UJQA 1D0HA 1QOOA 1KDMA 1JBCA 1MVQA 2DVAA 1AXZA 1V6KA 2E6VA 1A78A 3NV4A 4LBNA 4M3CB 1OQ1A 1IS6A 1QOSA 2R1BA 4NO4A 3RSJA 2DTWA 1IOAA 1OFSA 2GN7A 4RL7A 4YZ2A 5KXDA 2DU0A 2A6WA 3D4KA 3MW3A 4Q27A 5JVVA 4LBLA 4FOYA 1QNWA 1AX2A 4YFZA 5KXCA 2PHTA 5JDBA 4XBLA 3KM5A 3SH4A 3IPVB 3ZPYA 1XQNA 3A0KA 3ILFA 5T5OA 3WHUA 3GNEA 2NMNA 1UAIA 3A0NA 2EXJA 3MW4A 1BQPA 2A6YA 4RA0A 2AR6A 2R1DA 2DUOA 1JOJA 1WLCA 2ZGKA 4Q2FA 3VKMA 1G9BA 2E7QA 4YG3A 2E53A 1WBFA 3AP6A 1FX5A 1GV9A 1RINA 2V5YA 3ENRA 4L8QA 4LBMA 2D6LX 3IKWA 4GWMA 1KDKA 5H9QA 4TZDA 3HR9A 1H30A 3N7MA 1SLLA 2NM1A 1LOAA 4FPKA 4FQ4A 4XJAA 1SLIA 2VY0A 4PBOA 3RMXA 2KM2A 2ZHKA 1EPWA 1PZ9A 4FPEA 4BPZA 4DS0A 2GNMA 1V00A 3PMEA 2VW1A 1SLBA 1GZCA 1S0IA 4FOVA 4Y1VA 3AX4A 4DRRA 1LGCA 3WZ1A 1WLWA 3N3HA 1GNHA 1BXHA 1UPSA 3AXDA 5GJ6A 4XJZA 5KXBA 1ONAA 2UURA 5GLWA 1APNA 3HMYA 4Q26A 3WVJA 4AVTA 4UW6A 2YV8A 1N3PA 3UJOA 3ZSKA 2EXKA 2ZGQA 5FRAA 4YGBA 1DQ4A 1DIWA 2ZGLA 1LULA 3Q9OA 5GZDA 2A6ZA 1UX6A 4FPGA 5CAZA 1DFQA 3AP9A 5GLVA 2W08A 1C4RA 4XTMA 1BZWA 1ULDA 4LBJA 1W6PB 3U4XA 1CN1A 1BKZA 1R1ZA 4NOTA 3OY8A 1FV3A 3IMNA 4AGVA 3POSA 2C5DA 4H55A 4AGRA 3I4IA 3LCPA 5JOZA 1QGLA 3ILRA 4XXAA 1G9AA 1O4YA 4DRVA 5SV8A 1LEMA 4KBBA 4PCRA 4WVVA 3OPZA 1QF3A 4JCKA 1H9PA 1S0DA 1ULGA 5CNAA 3WLUA 2R0FA 4AYUA 3WUDA 4CTEA 5DUWA 4YG6A 4ATEA 2UWAA 3DGTA 1ENQA 3INAA 1AX0A 3R4UA 5EWSA 5GALA 3AP7A 1MR5A 1JYCA 3OYWA 2WQZC 1W6OA 2NMOA 3FLPA 1N1TA 2CY6A 2VW0A 3WG2A 3AZWA 4Y26A 2R0HA 5E88A 1J1TA 4YFWA 2GDFA 3O0VA 4HANA 1VAMA 3O0XA 1QU0A 1LOCA 2UU8A 4FPLA 5DUVA 2D3SA 3ZYPA 3A4UA 3B00A 2JD4A 1GYKA 2NN8A 3WOGA 4BLIA 1G9CA 3V0AB 1DYKA 1LCLA 2LTNA 1F5FA 5H9PA 1YRZA 2PHXA 3OY8B 1TEIA 2EXIA 2LALA 4ISRA 3B3QE 3ZVXA 4XMIA 3WDUA 1JHNA 1JYIA 1LGBA 2CL2A 2AENA 3MW2A 2VUAA 3ZSMA 2WT1A 2ZHLA 1KJRA 2ARXA 1FV2A 1ULFA 2DV9A 1LOFA 2E7TA 3ILNA 1ULEA 5DXDA 5F5QA 1A3KA 1HQWA 5GM0A 2ZHMA 2DUQA 4XHXA 4YW4A 4U2AA 1DQ1A 1ENRA 3IM0A 4XXPA 3B69A 3W59A 3VUOA 1W0PA 2AH2A 2CNAA 4FVVA 4P9WA 1UZZA 2NP0A 4YLZA 3RRDA 2XB6C 3OGGA 3T2TA 3HN1A 3NV1A 2R49A 1DBNA 1GICA 1S0FA 2JECA 1QDCA 2ZGTA 4LBQA 1X50A 2WJSA 4GKXA 4WZFA 1BJQA 3N36A 1W6QB 4PBPA 5DZFA 3RS6A 1CQ9A 1SCRA 4P14A 3AZZA 3AJYA 2D3RA 3SISA 3VKLA 3ZXLA 2CWSA 3CNAA 2VH9A 1GKBA 3B01A 5GZFA 1V6OA 5DUUA 4CRQA 1MS4A 2I2SA 2EF6A 1LOEA 1V6IA 2UWBA 4K21A 2A5ZA 1DZQA 1W6MA 4ASMB 3V0BA 1Q8OA 4K20A 1DGLA 3SH3A 1LENA 1QMJA 5JOXA 4BOWA 4IQPA 1W0OA 4LBQD 2AGSA 2ZMNA 3DUIA 2GN3A 2H0BA 1S0EA 2A7AA 1AZDA 5T55A 5T5JA 3POYA 1SLCA 3FBYA 4R9BA 5T5LA 2YMZA 3W58A 4DFSA 1G9FA 1LEDA 1YI7A 2ZGOA 5CA6A 2GMMA 1UZYA 3OJBA 2A71A 4XJUA 3PVEA 4W65A 1VIWB 3FUQA 1KITA 1LU1A 3VKFC 1RITA 2P37A 2ZABA 4XIKA 2ZGRA 2DURA 1DQ6A 4K1ZA 3FFZA 5JOYA 1Z78A 2A3WA 2PELA 3IN9A 1CPMA 1MZ5A 2PHUA 2Q5TA 3WDWA 1JXNA 1IS3A 3R05A 1DLLA 1LHWA 1Q56A 2JDZA 4FPOB 1AJOA 4HL0A 3D5OA 4FPJA 3JUUA 1CESA 4R9DA 4M00A 4YGCA 2PHWA
chains in the Genus database with same CATH superfamily
2AC1A 2KXLA 2YZ4A 4XZPA 4JGYB 1ZBA2 3FWEA 4UBGA 4IEZA 2W95A 3RWKX 1BEV2 1JUHA 1YWKA 3I3MA 2RJ2A 3KCYA 2C4XA 3CZUA 3M2MA 3SMHA 2ID4A 3UL2A 3WW4A 5AFEA 3CU7A 4LTAA 3O14A 1W6NA 2P3KA 3MEPA 4BK4A 2C6SA 3LIHA 1YNAA 3DV8A 4RR3A 4EYUA 1UOBA 2EAKA 3UGHA 5FPUA 1WGPA 1IKPA 2WC2A 1QJX1 1SPPA 3M3OA 2A6XA 2QQLA 4MOAA 4E4HA 3SEPA 2XWBB 3B02A 2E51A 4SLIA 3N9QA 1JTZX 2ZGPA 3VBSB 1WW6A 1RUNA 4XQ4A 5FCCA 1YCIA 1F8VA 3TEZA 2WFPA 3GBFA 3H42B 4XFGA 1BK1A 4HSJA 4KWKA 4EWAA 1RUG3 1JS9A 3S5QA 3VDBA 1YEWA 2J1UA 3T3YA 3T30A 4JRAA 1PM7A 2ZEWA 3PDQA 5FMOS 4YM0A 1GU3A 4RS5A 1JYVA 2WAAA 5FZ9A 3J7MA 5FZ8A 3O1OA 2JIJA 1CONA 4D7YA 3RNSA 1QOTA 1TE1B 4M0HA 1H2MA 3VBUC 2VZSA 2WO2A 1WW5A 2YBSA 4YM2A 3AB0A 3POBA 1GQHA 4NAMA 3WNMA 4CCMA 2XVGA 2XG3A 2HWC2 3MIEA 1TZOA 2HEVF 2P4EA 2QE3A 5IAVA 1YHFA 3HT1A 2YUEA 5FZKA 2XBO2 3VBHC 1ZZBA 4QX5A 3T0DA 4I0AA 1ND3C 1CPNA 2XXZA 3HQUA 1H6YA 4KWUA 4WVMA 2EIGA 3D8CA 5LBBA 4OI1A 3I49A 5AVPA 5JAXA 1WW7A 5FZAA 2YU1A 2YU2A 4FP2A 1RUI2 3L2YA 2MPFA 5FYIA 4QDQA 3KB5A 2CTVA 3KQRA 5HCAA 5AC91 2YFUA 3K3NA 4Q8LA 2J1RA 1MEC3 1X9TA 4Q8KA 5GLZA 4Y20A 1QDOA 2NQYA 3NSTA 1UOJA 5F5AA 1ZZ8A 2GH2A 2ZOEB 4ZU5A 3AP4A 1CAVB 3ZKYA 1NXD1 1PO12 5F9TA 4NN0A 3C7OA 3EO6A 3K3OA 3LAGA 5A7SA 3BTYA 2PHLA 2VOTA 5IK8A 1Y9GA 1V6JA 3ZMNA 1H9WA 2W1WA 1PMJX 4LHSA 2G1MA 2X5IB 5GZEA 1C8M2 1ZZ7A 1QH7A 2ZXQA 2EALA 2VZVA 3PTRB 5C9AC 4AWDA 1SCSA 5IVVA 1W6PA 4JGZA 3IB3A 1WUVA 2A75A 4Q1PA 2BERA 2HYXA 5FBJA 1CIYA 4IESA 3GBGA 3BIWE 4Y24A 5LEJA 3UGGA 3ZSEA 4HOOA 1G8WA 2VMDA 2ERFA 1SBDA 3BU7A 3VBRB 1K5JA 3TEWA 3FE5A 5CYYA 5GKAC 3VLBB 1RUOA 3I8TA 3BALA 2VMIA 3NV2A 1NA1C 1RB8G 1CGPA 2EIBA 4LULA 3ZXDA 4TYSA 4WM8B 3PJYA 2AEZA 2D3PA 5FZFA 4ASKA 2TEPA 1H4HA 1VE0A 2JEMA 2VMEA 3H3LA 4MLOA 4DPNA 5JMCA 5LA0A 4XJ9A 4A2UA 3WD5A 4MG2A 4DY3A 4Q5OA 4M4RA 1NCQC 2QDNA 2DVBA 5F8PA 2CGPA 3NVCA 4N9IA 4LMFA 2WSUA 3GM8A 3I2OA 2PQSA 3VKNA 2VBDA 3AMQA 1G86A 3CKHA 3NWKA 3V64A 2ZA9A 5LATA 2R072 1J3QA 3QOPA 2VTXJ 1AYN2 1ZYBA 3O0WA 4RR3C 2WZR3 3J7NA 3QCWA 2XMLA 5A6XA 3R4SA 3LDBA 1GLHA 1VBB2 2ATFA 2YGLA 3OBTA 4OI2A 3VBRC 5A1LA 4QWNA 5IFPA 4CEYB 5E8AA 2PLV3 4YPJA 1H4GA 3MO4A 4CCEA 5EIYB 4IV3A 4H3WA 1JW6A 1W2TA 2CDPA 4UXAA 3GGLA 4WVWA 5FP3A 5IVCA 3PUSA 2DCJA 2XGXA 3POWA 4Y4YA 3CIHA 4YM3A 1BK0A 3Q8FA 1AR61 2CDOA 3WDTA 4LNVA 5F3EA 2VNRA 4XFBA 4IGPA 1RIRA 5D8AA 1W04A 4ZONA 1VB2A 3BUCA 1LU2A 1G7YA 2MEV1 2PLV1 2VVEA 5FLIA 1SHWB 4XILA 4JGYA 3IZOA 3OBAA 4QKBA 3WP5A 1F31A 3GHNA 4CU7A 5JCTA 5CFDA 1FMD1 1SDDB 4K1YA 5FPZA 4E8CA 1RMU2 1RUJ1 1RYYA 1OPOA 3B94A 2VZ3A 5IAXA 5FZBA 4M3CE 3ZXEA 1AYN3 2W87A 5AVAA 3O5SA 2QQJA 1US2A 3D6EA 1KQRA 3DEMA 2XUMA 3IWZA 3ASIA 2LW8A 3POIA 4HETA 3SXWA 4MGSA 3ROUA 4J1XA 3BOWA 2HYKA 1LECA 1QNYA 3J7HA 4Q4V2 5E16A 1AUYA 5FREA 1KJLA 1CAWA 2HWF1 5FY5A 2GNDA 1A8DA 4IETA 4L97A 5J48A 4OUEA 4LQRA 4R9AA 4XQDA 3TAYA 2PYTA 1TNFA 4M3CA 5EZWA 2ZBJA 3P1IA 5ANNA 1OUXA 1LTEA 4AG4A 5FIXA 1R1A3 4KL1A 4MYEA 4E4SA 1LHOA 4YW1A 2JDHA 5L9BA 1ZA4A 1QJEA 5A3OA 5K9YA 2WS93 5ACA1 3DN7A 1I9RA 3VD5A 1ZBA1 2D6NA 2GALA 4QX1A 4DMIA 1RUI3 3JD71 3GZTB 5BNPB 2H6BA 5HBAA 4Y22A 1L7LA 1LESA 4XUNA 1STMA 1XNAA 2H6CA 1RUH2 4Q1RA 4RN5A 1W9TA 4PJYA 2E9QA 4AHYA 2Y0IA 1DF0A 3GCWA 4I30A 1GOHA 5FZLA 4BXFA 1AR83 1OBNA 3SC7X 2WA3A 4E8DA 2VMGA 4META 1NE4A 4CDQA 4A42A 2Q8EA 3FZ3A 1AX1A 1YFUA 3WG4A 2O14A 1UZ0A 3LDRA 1PK6B 1UZWA 2Y60A 3QLQA 1LHUA 2ZZQA 5FZEA 5LK7B 1OLME 1JN2P 3CHXA 1NZCA 4XF1A 2RV9A 1VBA1 2XLGA 5JPNB 4GMP0 4O9EA 4MGKE 2VVDA 2JJ6A 4BQXA 2WA4A 1D0HA 5DN2A 1ASJ3 1QOOA 1U5XA 2Q1MA 1EPZA 2DVAA 1V6KA 2VUCA 3H3ZA 3NV4A 4NJ4A 4Z92B 4NO4A 3EXUA 4X8PA 2DTWA 3OUHA 2OPKA 1IOAA 4NRQA 3J7LA 1OFSA 5KBFA 4DXRA 1XRUA 1RXGA 1XYPA 4COUA 3PMSA 1B35C 2OZ6A 3THTA 4Q27A 3ZX7A 1ZRCA 2CAUA 3MW3A 5F6KA 2HEWF 2QQOA 1KXGA 4XF4A 4YFZA 1W90A 4GJYA 2TNFA 5IHRA 3ZPYA 1XQNA 1LB2A 1SDWA 3A0KA 1JZ7A 4LHNA 3ILFA 5T5OA 2WNOA 3WHUA 5FR3A 4Q4V3 2R042 4LA3A 1GQPA 2ZEXA 2A6YA 3NJZA 5FV3A 5A6ZA 5FXWA 4OYUA 3T2OA 4Q2FA 1WLCA 4ARXA 4RGGA 3W9AA 3ZFEA 5C5UA 2EVXA 4L8QA 1RINA 2V5YA 3ENRA 3MLKA 1GR3A 2WABA 3ZOIA 3IKWA 4GWMA 5DAWA 4QXCA 5H9QA 3HR9A 3WX5A 4TZDA 3N7MA 2WN3A 1YI9A 3AL5A 5LBCA 2NM1A 2DCZA 3SCGA 3ZYHA 2KM2A 3G6JB 4FPEA 1NZIA 3T2QA 1XNBA 1DGRN 2GNMA 3O1VA 1AL23 2GSYA 2Y26A 2VOWA 3NL1A 3UETA 2ZEZA 2CGOA 1BBT3 4QX2A 4YVSC 3N3HA 1GNHA 5F2WA 1TG7A 4IE7A 5LEKA 4GAZA 2L9LA 3WNPA 1GNYA 5LBFA 4AVTA 1APNA 1QXPA 5A33B 2KA3A 4UW6A 3I3QA 4AAPA 4C90A 3VHNA 1GP6A 3GJAA 4YGBA 2WZEA 2E33A 4YVSA 1UX6A 4HT1T 3AP9A 5ABJC 2WNUB 1C4RA 3AKTA 2B45X 4LBJA 1BVP1 1EAH3 4CDWB 1EV12 1W6PB 4JGZB 4IEQA 4NOTA 2VUDA 1TNRA 2C5DA 2W2IA 5I91A 5A32A 1HXS2 5C4WB 5FKBA 2RDRA 1HB1A 5C3SA 1J1LA 2WS92 2O8OA 5SV8A 3M70A 3I2KA 3TN93 1LEMA 5L36A 1NA1A 4KBBA 4LR4A 5EJZB 4D6SA 4C91A 2FCVA 1H9PA 1Y3TA 3UYJA 2R0FA 4GWIA 1GUIA 3LZZA 3WUDA 5DUWA 4ATEA 1CAVA 3VDCA 1ENQA 4XABA 1AX0A 2QQUA 5EWSA 4WM8A 1UY4A 1RUE1 1W6OA 1IPJA 1FXZA 2NMOA 3WG2A 2CY6A 5CISA 5LA2A 2R0HA 5E88A 1OPMA 4P02B 3WW2A 1J1TA 1LR5A 3GZAA 4YFWA 4LHKA 3BPSA 5C3RA 4LUKA 1PGSA 4HANA 3H8RA 4NIDA 3U07A 3HWJA 1HRI3 1OT5A 3B00A 5I8SA 5LRRA 1PGL2 1DYKA 4MZUA 2LTNA 2VPVA 3GYDA 2RS31 1ND2A 1W8UA 2PHXA 4ISRA 1Y9MA 5FY0A 3I2JA 2QQKA 5ACA3 4XDPA 5K8SA 3J8F1 5FY4A 1HV1A 5HV0A 1X9PA 2OT7A 3ZSMA 3LEGA 3U1XA 2BTVC 4OLLA 3W20A 4N7UA 3H7JA 3NMBA 5HCHA 4BK5A 2Q8DA 1X82A 3LA7A 4AOCA 3RZHA 3OPWA 2DUQA 5EV7A 4CP9B 1DQ1A 1ENRA 1QJX3 2DBIA 3IM0A 4QX7A 5FP9A 3W59A 3ZMOA 2CNAA 2AH2A 1ULOA 3OBZA 4P9WA 3RRDA 3OGGA 1Y43B 3T2TA 1RUD3 1VBC2 2VNVA 2XQXA 3TRSB 2KD7A 1S0FA 3F95A 5FY8A 2RMU3 1Y4WA 1QY4A 3KMHA 1YQ5A 5FBZA 4LBQA 5KC6A 3ZFGA 4WZFA 1CX1A 5FYHA 2PLV2 2F4LA 3PLQA 4XAEA 1W6QB 3KQ4B 2XOMA 5DZFA 1RUJ3 4JKLA 1R093 1H0BA 2WN2A 2WNUC 3FN9A 2CWSA 3ZM8A 3RPQA 1RUJ2 1RMU3 5GZFA 3DYPA 4KU8A 2RDNA 4N9HA 2I2SA 4W6YA 4D6RA 5JXHA 4CDXA 1U12A 1VRH2 3USSA 4XFCA 1W6MA 3V0BA 4NIAA 2BEOA 1UYZA 2WWUA 5FK8A 5FZ4A 3SCFA 3IDCB 3BTXA 5FYTA 3MF9A 4HN0A 3RZLA 5JOXA 1V0AA 3HBZA 2VZUA 4JDOA 1IPSA 4LUMA 2AGSA 2GN3A 2H0BA 4GMP3 2XJVA 1O3TA 3MUY1 1AZDA 1PX4A 3H9AA 5EHDA 5LASA 4CPBA 1NAEA 5T5JA 4DIQA 1RVF1 4R9BA 5T5LA 3W58A 1DDLA 1D4M3 1LEDA 1SQ4A 2WDBA 3C7HA 4AFCA 1NQDA 1PX3A 1TME2 2B46X 5KHGA 1CWPA 5EQUA 1J59A 2VG9A 2B42B 4MGYE 2XL9A 2UYAA 2VZQA 4JKMA 5JPMB 4GMP1 1W2AX 1OKOA 3MICA 1RITA 2P37A 4GZ9A 4XIKA 3HT2A 1J84A 5ACA2 4HXCA 1OXCA 1PO23 3ZYGA 5FO9B 3JB4C 4QD2A 3FFZA 4IEVA 1Q5OA 2HWD1 4TWTA 2WO1A 3MIBA 4OZOA 1ZZ9A 1W28A 1Q56A 2JDZA 4FPOB 4HL0A 3B93A 5FYMA 2VGDA 2VOXA 4FPJA 3JUUA 2DFBA 3MIGA 4YGCA 4OHYA 2R30A 3KCCA 4P9XA 5ABJB 5F3CA 2QQMA 4UFHA 3SLIA 1NQJA 1WD3A 4KWJA 1W3VA 1C57A 3GALA 2ZKLA 2RM22 2VMHA 3NKGA 3OPTA 4LO4B 1VBD3 4OHVA 1UYXA 2CHHA 4W6WA 2ZPXA 1VALA 2EIEA 2K9ZA 4H7MA 2X53S 2DUPA 4YGEA 1QHDA 2ENRA 3AXEA 4NHMA 5C6CA 1VBD2 3CEWA 1NCRA 1NCQA 2X09A 1HRI2 5HCFA 4PIZA 5FYUA 1RUD1 1QH6A 3AZVA 4YW2A 4B1MA 3MPBA 4BM8A 2F17A 3ES1A 3CLPA 3VD3A 4XF9A 4A7YA 1OA2A 3BN6A 1QQP2 1YO8A 1YIFA 5F3IA 5FZOA 1OQEA 1UF2C 4AEDA 4CA9A 2Z79A 1W05A 2PAEA 2DCTA 2P34A 1C8M3 1H2NA 1Q43A 3S6PA 3C7FA 3ZSLA 4FT8A 4FPYA 3CJXA 1OFNA 2D6PA 3S57A 2D6KA 3P3NA 5F5IA 2IVJA 5HCBA 2AUYA 4YM1A 4URAA 2P2KA 1HRV2 2DVDA 3IT8A 5JZGA 4IEPA 3ALQA 4ET7A 3HAGA 3NAPB 2ILMA 1YUDA 3MF6A 4PQ9A 5CZKA 1N3QA 1E5IA 3MDPA 4IL7A 1O5LA 2WYSA 1GZWB 4IEUA 5L73A 1KS4A 1OI6A 1ZRRA 3PUHA 3CO2A 4IE5A 5FJHA 4GA9A 4HKWA 5T50A 1UY1A 1UOGA 3O12A 3ZR5A 1QJY2 1SG3A 1UU4A 4V2WA 4FAHA 3USUB 4CDUC 4DEQA 1RUC3 1D0GA 2UYBA 2FCUA 2YROA 2VAUA 5IT6A 3T1LA 3ECQA 3UGFA 2OS2A 1WWYA 1NLQA 4JV4A 4S2HA 3KD4A 4BMEA 5I8YA 3BOPA 2WL1A 4RFRB 2ZAAA 2B9UA 1AR91 1U5IA 3GBWA 3LSEA 3M3CA 5FPLA 5DUXA 3WSOA 5A32B 5C4WA 4AVVA 1WZXA 4XE9A 1S2EA 4UI9L 2GMEA 4XAAA 3WHTA 3UESA 5A3PA 2Q8CA 3MPPG 1PIV2 4LEJA 5CBLA 2D98A 4Q4W2 3EQEA 4ONUA 4D8MA 5KHKA 2XLFA 4O7XA 1WKYA 3W5NA 1U5ZA 3NAPA 1LODA 4Y1ZA 1V6MA 4A41A 2BBAA 2XVLA 3FX3A 3I59A 1MZ6A 2A3XA 4PQQA 1CJPA 2PHRA 3FMGA 4XHBA 3WF0A 2XHKA 3SNMA 4AI3A 5A3LA 2OKXA 1EV11 2SBAA 4N43A 4BQ1A 3WW3A 4Q4Y3 2WLQA 5GLTA 5ABJA 4UWDA 3SKVA 4LIVA 4C0BA 1Y9QA 5BNPC 1MPXA 4YW3A 1DCSA 1MS9A 1XBFA 4LBOA 4UW4A 2BQPA 1PZ7A 3J26N 3T4HB 4NRPA 1CR7A 2AREA 1AYM1 1AL21 4YNIA 2ARBA 4F8AA 2V4AA 1OOPB 1VMJA 3ZXKA 1T2XA 1T6BX 5EPAA 1I3HA 4BISA 3VBFB 3WQ0A 1IS4A 3M3EA 3PURA 3PIJA 4HKLA 4XTPA 4BQ4A 4CVUA 4AFDA 3KWVA 4LOTA 3SCHA 3VBHB 1BBT2 1WLTA 1N3OA 2B4KA 4QGMA 5G04L 2R062 3MUZ1 1LHNA 4UFKA 5FXZA 1MVEA 3WEZA 1FPN1 1OVSA 1R083 2ADEA 2JENA 3KHCA 3A21A 2BU9A 1UXZA 2OYZA 5GZGA 4NHKA 5L7OB 3PJQA 2D6OX 2V73A 4PDWB 4XJ8A 5FZDA 4FTBA 4WM7A 4XBNA 5C71A 4LXLA 2K2SA 4YGDA 1WCSA 3AK0A 1NKGA 1BVVA 3BTAA 1SACA 5F6LB 1VJ2A 1W6MB 3WDXA 3V0BB 1CIWA 2GC1A 1W99A 2LM3A 2D44A 3NJXA 4HK9A 4CEWC 2OVUA 3CBNA 2Q30A 2WFF1 4MGZE 1REDA 4QB6A 4FOQA 4JX0A 4Y20B 4KWLA 3OCPA 4WVZA 5HPOA 1PZ8A 1VBE3 1FOD3 5FMDA 2BGOA 4Z07A 2YBPA 1NLRA 4P9YA 5FZGA 1RL3A 1HW5A 4K3UA 4XOGA 4CDQC 5CG8A 3K4ZA 2D5HA 2O8QA 3AJZA 1SZBA 2NPIA 3SITA 4OZXA 3GDBA 4FI9A 1V9U3 1Z7S1 4I09A 3NJVA 1CZTA 1X8EA 3FHQA 4RQPB 3WDYA 1DHKB 2GMPA 1K12A 1POQA 4EN0A 5FMCA 2BGCA 3U37A 4P5YA 1FOD1 1EY2A 1UD1A 3ACLA 1CAXB 1MQTB 3TB0A 3VZKA 1PHMA 3C7GA 3HBKA 2WNVB 1PVC1 3ATGA 1HN0A 3AMNA 3LFIA 4NIHA 1W8HA 2IXLA 2R32A 1RHI3 1MS3A 1W6QA 2VVFA 1LHVA 3E97A 4XIOA 3RJRA 2YC4A 3E6BA 1W8FA 3AYDA 1VRH1 2ZMLA 5IK7A 3ZN4A 4CSWA 1E5SA 1NOVA 3DL3A 4Q0SA 2DTYA 4FFFA 1T6GC 2JICA 2XUEA 4GULA 4FXGB 4CDXB 1JOBA 3ST7A 1VP6A 3BCWA 2YPDA 4MHUA 1HLCA 3AMHA 1H8VA 3OBRA 4KH9A 3WCSA 1BMV2 2ZMKA 1R091 1I5PA 3DPRC 1OA3A 2VUJA 4CDQB 2WZR2 2RJLA 5L9VA 1ND3B 3WP6A 3VGIA 5FUPA 5C3PA 1V6NA 3OEAA 4A3XA 1WLDA 5BNOC 1TME1 1S0BA 4QX0A 4NPRA 4UOJA 4CEWB 1UPIA 4CU9A 4IV1A 3APBA 1JZ2A 4LBQB 1MS5A 4G4FA 4ITCA 1OA4A 1URXA 1FI2A 3J4UH 1DYPA 3RYPA 1EUTA 1RHI2 5BYNA 4UT5A 4NWVA 2G4IA 5JOWA 4LLFA 4PDWC 5FPAA 1LNSA 2DYCA 2VXRA 5H9SA 3K51A 3L2HA 2Q4SA 4QAWA 1UY3A 1W8WA 2HKXA 5E6HA 4HMZA 4WM8C 3DECA 3VDDB 2DF7A 3ZR6A 3AYEA 4WV8A 5CFDC 3L9JT 3HNMA 4Y1YA 1UY0A 1ASJ2 2SLIA 5C9AA 1OLMA 1R082 4XFIA 2BOJA 2A73B 3N35A 1OF3A 1K5MB 2RS11 4IGQA 1B09A 1HKDA 3N7KA 2BV4A 5JR7B 1H1IA 2YGMA 3TBDA 1DQ5A 2XR4A 1UMHA 4GH4B 3FFQA 3RI9A 4C1WA 3O1UA 4PT6A 3SKJE 1UL9A 5JIAA 2ZAHA 2C9AA 3HVDA 4BQ2A 1RUD2 1VBC3 2A6VA 3MFAA 1RUG1 3VBUB 4Z1VA 2RR12 1WMFA 1LOFC 4L9BA 4M4PA 4D6QA 1F35A 3PVBB 3WG3A 3USUA 1C1LA 4QM9A 4JQRA 5JZGC 4I0WB 4DNYA 4E2SA 2D5FA 4QHOA 2IXIA 5EYXA 3JXSA 2FZ1A 1ENSA 1PO22 3IAPA 4ZU7A 1ND2C 4LKEA 2V72A 4Y33A 1PGW1 3OGSA 1IG3A 4RHV2 3ZYRA 1J3RA 2HJIA 5B4NA 4MHRA 1KDMA 2P6HA 1ODMA 2JB4A 3SHRA 2E6VA 2YDEA 4QMAA 3AKSA 3RSJA 3T09A 5KWRA 2R063 2GC2A 4DINB 1OLRA 5D8AC 5BY5A 2C24A 4RL7A 4LKDA 1H8TA 5FLJA 2A6WA 4ZS3A 4DEVA 4LK7A 2RMU2 5C70A 5FO8B 5FZOB 2RG4A 5KXCA 3ZFFA 1NX9A 1UYYA 2C0ZA 2PHTA 1H6XA 1IQDC 1XU2A 1K5MA 3KSCA 3WNLA 5I0UA 2BZDA 2WNUA 3GNEA 3MBWA 2NMNA 3HN3A 1RTVA 4XUPA 3A0NA 2X5IA 3MW4A 3LOIA 5EJ3A 4C0HA 1JOJA 2W5FA 3VKMA 4LA2A 3ZFGC 1O59A 4J1WA 2VCCA 1WBFA 1V9U1 1BHGA 1GV9A 1KS5A 1Z7S3 3AP6A 2Q8OA 4AEKA 4AFMA 4WBBA 5KHJA 1KDKA 3B9IA 5FKCA 2WR9A 1ZA7A 3EBRA 2QKDA 4UF0B 1RUC1 3RMXA 2VY0A 2YG0A 4PBOA 3WXPA 2ZHKA 3HD8B 4CE8A 4BPZA 1PK6A 4DS0A 4D7SA 1V00A 4PLMA 2ADDA 4A7KA 4IE4A 4E4ZA 2VW1A 5A80A 1GZCA 1UOFA 4AQ2A 4DRRA 4WM7B 1R64A 1WLWA 2C26A 5IVFA 4FTEA 1BXHA 1UPSA 1YQ6A 4RFT0 4QPIB 5GJ6A 2VULA 5KXBA 1REEA 3S7EA 2W1UA 2TUNA 1NY71 4AQTA 5D1IA 2YV8A 3J9SA 3UJOA 2EXKA 2J42A 2ZGQA 3CJIB 4MGQA 5GZDA 4RS5B 3KF5A 2A6ZA 4RSUA 2I45A 5GLVA 1PNGA 1OOPC 4Y5Z0 3U14A 1TMF2 3NNMA 5CADA 4AFAA 3U4XA 1CN1A 1R1ZA 4UAPA 2VD7A 4UFIA 2ORZA 3POSA 3I4IA 3LCPA 5JOZA 4XXAA 5AC93 4V2VA 3H8XA 3DXUA 5J37A 1O4YA 3LA2A 5DDJ1 4XVHA 4B7KA 2ZX4A 4KG0A 1BBT1 4WM7C 2HWB2 3OGRA 4PCRA 5CKMA 4CDUA 4RHV3 1AR71 1S0DA 3NNJA 1EAH1 1US3A 1XPWA 2BWAA 4AYUA 2WNVA 1GQGA 3DGTA 4GWJA 4XUQA 5DMYA 2XHNA 3OUIA 1C5HA 5GALA 3RYKA 2WO7A 3IDBB 1MR5A 2BW8A 2W94A 4JDNA 1OC1A 5LCWL 1UIKA 1QJX2 1JU3A 4Y26A 1JU4A 5FZ1A 3R4DB 1H8TC 1UKRA 3O0VA 1OQDA 1POV1 3I2GA 2VR4A 2D3SA 3A4UA 3T4VA 3WOGA 4RQPC 5DAPA 1LCLA 5H9PA 1D2QA 1GP5A 2EXIA 4NPMA 3RYRA 1FPN3 3ZVXA 3ZIWA 3VBOB 5FQ0A 4CCCA 4QU2A 1JHNA 3TN92 3ZFFB 4W4ZA 5FLHA 4IEXA 1Z7S2 3U75A 5G05L 5BNPA 3VBFA 1OMIA 2VTFA 2ZHLA 1KJRA 4XDOA 2C9KA 5I8TA 3LFMA 4QGLA 3Q8AA 3KGZA 1LOFA 3TOJA 4AFBA 2YBKA 1ULEA 4KMQA 5F5QA 1FOD2 3DYMA 3OEBA 4JTNA 2VNOA 3H8UA 3D3AA 1ODNA 4J6GA 5GM0A 4U2AA 2W1QA 2J7MA 1YQCA 2D93A 4K9SA 1PNFA 4CEYA 3VUOA 3V56A 2NP0A 4YLZA 2QCSB 3HN1A 3NV1A 1GOGA 1DBNA 2XBO1 2JECA 1QDCA 5EP9A 2ZGTA 3EHKA 4HKOA 4I01A 5FOBB 1NT0A 2XONA 3WW1A 3N36A 1JI6A 1O8PA 1SCRA 1TME3 3SISA 4N53A 1F5JA 3DXTA 4JHTA 4BE3A 2R7EB 4AXOA 3CNAA 5AC92 2VOKA 4QXKA 4KI5M 3B01A 3VN4A 5BPXA 1V6OA 2PXJA 3ZFFC 1ZZ6A 3BPZA 4CRQA 4CUBA 1BMV1 3T2PA 4I2OA 2A5ZA 3LE0A 4EWDA 4ASMB 1XE8A 5CFDB 2K46A 1VMHA 2W47A 3FL7A 1QMJA 1AR63 1AR93 4AEJA 4OHXA 4EZHA 4D94A 4NVPA 2HEYF 1CAUB 4IQPA 4LBQD 3AM2A 3WF1A 3DUIA 4MVTA 1RHI1 1S0EA 4IEYA 1GWMA 3I59B 1VR3A 5T55A 3POYA 3JD73 1D4VB 4QT6A 2AEYA 4MXWA 1XNCA 1X36A 1G9FA 2ZGOA 2Q1FA 1COV3 3M3IA 5CA6A 4DXTA 1OURA 2GMMA 4ZU4A 5JI7A 5L9RA 1UZYA 2GH8A 3OJBA 3PVEA 4QGNA 3A7QA 1UYPA 4XZUG 3X29B 1LU1A 1POV3 3LKJA 1KGYA 3CJIC 4B29A 1NCRC 1XU1A 3KVAA 4XUOA 5FUIA 2Y6LA 4KGQA 2IC1A 4CUCA 3EMRA 4ZHNA 1UZVA 2A3WA 1CPMA 1MZ5A 3PUAA 3WDWA 5KHIA 1IS3A 2JWPA 3FBMA 4YARA 1ACCA 4IDZA 3LIGA 1E57A 3HJRA 1CESA 3LSDA 2Q0AA 2Y34A 2GC3A 3GHMA 3THDA 4LITA 5IVYA 2FCTA 4BA6A 2D43A 1MS0A 4AVAA 1MACA 5APAA 3ACFA 5DQ0A 3SH5A 3FHAA 3Q8BA 5HI0A 5JI9A 4CYDA 1I1EA 1WA6X 4E4DX 2YC0A 1QJY3 5D21A 4HLTA 5B2GB 1BCXA 3QH6A 5CEHA 3VBRA 5BNOB 2R071 1PGW2 2ZZJA 4GJZA 2VOVA 5GZCA 4OMDA 2A3YA 2VZOA 4XACA 3M1HA 4RGKA 2AYHA 3FLTA 2ZCWA 4PIXA 2A1XA 3B5LB 2FHRA 4XMAA 4S2FA 3VBOA 1AR81 4CEWA 1RGSA 3WCRA 2P17A 1GBGA 1QKQA 2NZ9A 2JDPA 5I93A 3T0BA 1RC6A 1GOFA 2ZHNA 2RMU1 5CB7A 3VDAA 4YG0A 1S0CA 4ATFA 3VL9A 2Z42A 4QQOA 1JZ5A 3WDVA 2GNTA 1O7FA 1OKQA 2CAVA 1VMFA 2EAAA 4W8JA 4CZSA 1IPKA 3IIIA 3WV6A 1K45A 1UNBA 1WMEA 5CVRA 3ABZA 5J3UA 1F4AA 4AQ6A 1FMD2 3CF6E 2AACA 2BBVA 1NCQB 1RXFA 3K48A 5FXVA 1F9KA 2VE1A 1H2LA 3B9CA 1REFA 1V70A 2P6CA 4FFGA 3E5XA 2H0VA 1EV13 5JWPA 1Q8SA 3I3DA 2GU9A 3PU3A 4QHZA 1O4TA 2ET1A 2Z2SB 4E9KA 3C2UA 5FTTC 1WD4A 3RDIA 5EJ1B 4D69A 4LE3A 5E1RA 4JZRA 2IXJA 3PVOA 2X29A 4HK8A 1YXWA 2YY1A 4Q4V1 1Q8VA 1SLAA 1XJAA 4KQ7A 4BQ5A 1WCQA 3DCQA 3VKOA 4Q4X3 1WBLA 2OA2A 2W52A 1NY72 4H14A 5DZEA 3T08A 2HWF2 1XNKA 2VBBA 4BYYA 1COV1 4FAGA 4N7IA 4DB5A 2QQPA 4GKYA 2OPWA 3K46A 2VCAA 5F1RA 2RS52 1ZM1A 3BIEA 4OMCA 4MX3A 3MLLA 2ORXA 2KR2A 1Y7BA 3POJA 1FMD3 3LEKA 4GH4C 4DXZA 2J22A 5F37A 2W39A 3NV3A 5IWFA 1GWKA 1AJKA 2HBTA 4FPFA 2YB7A 1VPHA 3TNQA 5CKQA 5JUVA 2EXHA 5DDJ2 1UU5A 5E89A 3JD72 4XF0A 2HWB1 4DZGA 2F6BA 1GANA 1LRHA 4YZ5A 4NIIA 1RUH1 1EAH2 4CP0A 4IEWA 1JZ3A 5A7OA 4RQPA 5CKNA 1LOBA 3AP5A 5JSRA 3AMPA 4LK6A 1SLTA 3K75B 2YHJA 1DQ0A 3WQ1A 1JUIA 2G9GA 3ZSJA 1JMUB 1G9DA 3WF2A 5DABA 2FDHA 1YYNA 4Q0UA 2ZACA 1FAYA 1YFWA 2WLPA 4Q29A 5JLVA 1HB3A 1MZEA 2WIIB 2IVIB 3CJIA 2ZGMA 1HQLA 2QQNA 4JDMA 3WINE 1W2NA 1W6NB 4R9CA 3LA3A 1ZBA3 3LGRA 4QPIA 1LKNA 1QJFA 1SMVA 3UKNA 2ZTNA 3I7DA 4ZXKA 2AZ5A 4XURA 3M8LA 1ZBE3 2XL7A 3P3PA 1VBE2 4HSLA 1XSQA 3KS7A 5EFUA 4MADA 1VAVA 2N7GA 2UY9A 5C9AB 5FZCA 4XEZA 1BEV1 1Q8PA 2ZX1A 3LD8A 4MXVA 1GZTA 2BGPA 4GXLA 2JDMA 3B7MA 2R041 1AVBA 1QEXA 3M3QA 3VHOA 1S1AA 2JKXA 4HPKA 4LPLA 4KBZA 5EYYA 1OD3A 1SFYA 2R6QA 3THPA 3UK9A 2RJKA 4BCUA 1S0GA 5KR7A 3RZKA 5JXGA 2VMCA 4INDA 3IPVA 3N9LA 3E6CC 4YZ4A 3WUCA 2RS53 4Q4X1 3T0AA 2J1SA 3WNOA 1SPPB 4B3NA 1DZTA 3FUOA 2DU1A 4BQYA 5FYVA 2XJTA 3ON7A 2PA7A 3UV9A 4B7EA 2FMDA 3ZDVA 3O1MA 1HN1A 2DWRA 2VBPA 3HEIA 3ZXJA 3VDDA 2ES3A 3AFGA 4D0QA 2OW4A 4YZ1A 4BQWA 2GP5A 5LW9A 1JOPA 2X5IC 3RG0A 1ULCA 3POFA 1KRIA 1K5MC 1ENXA 4U36A 5A6QA 1KFXL 3ZXGA 2BDRA 4PF5A 4CU8A 1JH5A 2HWB3 5FQ0B 1VRBA 3KLSA 2IXHA 4BMBA 4AL9A 3MV11 2W9XA 3O1SA 3ACHA 1OHFA 5FWEA 1DP0A 3VBFC 1DQ2A 4J25A 2Z5WA 4K8RB 1LOGA 4N53B 3U11A 4LORA 3OSDA 5KXEA 2X10A 2WS91 5J7MA 2JG9B 3UT0A 2JIGA 2C1FA 2EA7A 2HWC1 1GFF2 4LLOA 1W9YA 4K8FA 2QZ3A 5LBEA 4ISQA 4AEDB 4B8EA 3ZPOA 4JC1A 3LDKA 1RUE3 1NG0A 4GQ7A 3E5UA 3GF6A 3Q8EA 2A70A 3PUIA 2QVSB 4FP3A 1RUE2 1RUI1 2Y64A 2W91A 3DPRB 2P3IA 3O1RA 1XB9A 2DBNA 5FY9A 1ZRIA 1MEC1 5FP4A 1QQP3 2EICA 1TQ5A 1KFUL 1IKQA 4CDXC 4R52A 4QKFA 4XETA 4FPHA 2FDKA 2R16A 4P08A 4AAXA 1GSLA 1W8NA 2IZWA 2RS32 4YVWC 4Z8BA 1PO11 1W8TA 3JBG3 3KV6A 4IXLA 4N53C 2FZ2A 3WNXA 4BHPA 4BDVB 1H1MA 4IV1B 3ZKUA 4L0PA 3TEYA 1W8ZA 3HOBA 4NIGA 4QPGC 3RZJA 2RDQA 1C8M1 4UFLA 4W50A 3AKRA 2NYYA 3I2FA 2XJPA 4QB1A 4UW5A 3N9MA 5SV5A 4Q0PA 4G3YC 5J98B 3VV1A 3ZN6B 5J96B 3D0SA 5A3MA 2DVGA 1AR82 3HQRA 3H8OA 1V6LA 4GB33 4QKNA 4Y22B 5LK5A 4AVCA 1OVPA 4UFMA 3I3EA 4LBKA 5DPNA 2NLRA 2YC2A 3UKTA 4JTOA 2F4PA 1LJ7A 1VBC1 4PLOA 1N1VA 1UMIA 1XE0A 1CX4A 4QPIC 3UJQA 4COZA 4EE2A 3S5AA 5F7UA 2VQUA 1JBCA 3HIFA 4LBNA 1AXZA 1H2KA 1A78A 1HJGA 4M3CB 2XJRA 2VECA 1IS6A 2R1BA 1S2BA 4BWOA 2GP3A 4H7LA 1L7RA 3ITQA 5LWBA 2YYOA 4JVAA 5FZIA 4QQPA 4QPGB 4YZ2A 2DU0A 5CG9A 3ZYBA 5C3OA 5J36A 5FY7A 1QNWA 1AX2A 2X8KA 5FZHA 4HVRA 4G9SB 5JDBA 1ZX5A 4XBLA 2HWE3 2JDAA 1QIQA 3IPVB 3KM5A 3SH4A 2VJXA 1JYXA 3SQOA 4EV0A 4HN1A 5FYYA 3NNGA 1UAIA 4EWEA 3JCIA 4P9GA 4LT5A 3AL6A 3U78A 1BQPA 1OH4A 2AR6A 4XW3A 2R1DA 1G6NA 4QXBA 2E31A 4PI2A 2E7QA 4E2GA 5C8WA 2E53A 1AYN1 1W9FA 1P8JA 2WBKA 3MHZA 3WQBA 5FXXA 2WWJA 4C8DA 1X8MA 2DFCA 5KC5A 5K0UA 2JDUA 1LOAA 3JQXA 4FPKA 4FQ4A 2ZS6B 4XJAA 4YW7A 2RS51 1EPWA 1PZ9A 4N8MA 5IATA 5D8AB 1H8TB 3PMEA 1TVGA 2PMWB 1SLBA 4FOVA 4XUTA 1LGCA 2ZEYA 2VQAA 4L2NA 4KU7A 3O1TA 3MLJA 2UY8A 2JE8A 3W5MA 4XPVA 1O3QA 5GLWA 4Q26A 1QJZA 3KZ4C 4EN9B 1N3PA 2RE9A 3NAPC 4I3PA 4QX3A 2BVVA 2HWD2 1DQ4A 2ZGLA 2TBVA 3Q9OA 5CIRA 3LF7A 2WZ8A 4FPGA 5JIUA 5CAZA 5L7OC 2WO3A 2MHFA 5ERLA 4NE9A 1KEXA 2GAUA 1W39A 3AVRA 4N43C 1BZWA 1RMU1 5FY1A 1SEFA 4CCLA 3RFRA 3AC0A 3CZJA 3ZYJB 4NPLA 1FV3A 4QPYA 2WQ8A 4P00B 3IMNA 1OF4A 4H55A 5FZ6A 4FO9A 1QGLA 1W2UA 2OIIA 1G9AA 3VBUA 5FMOL 1ZRDA 4QPWA 5JMOA 1I6XA 5IW0A 3NO8A 1CAUA 4ES8A 1JHJA 1UWWA 3OPZA 4JCKA 1WCUA 4XCBA 1A6CA 1A8MA 5CNAA 1ULGA 4CXXA 4RS5C 1OH3A 3WLUA 4COYA 2CSGA 3E1F1 4YG6A 2UWAA 5LY2A 1DYOA 1OD5A 4QDSA 1RVF3 1AYM3 2PHWA 1B35A 1JYCA 3OYWA 2V4VA 4MXWB 5LA1A 1N1TA 2K0GA 1XNTA 1QQP1 3KV4A 4ZY9A 4A44A 5A70A 5I0RA 4CDWC 4YWAA 2XPJA 2VZPA 2GDFA 4A3ZA 1LOCA 1VBE1 5DUVA 1G9CA 3WR0A 4BLIA 4JQTA 2JD4A 1GYKA 3S7IA 3V0AB 1PO13 3JBG1 4IW3A 3G7DA 1HRV1 1YRZA 1ZRFA 4LIUA 3N9OA 4LO7A 1TEIA 4EN7B 3B3QE 5I0DA 5DAVA 3WDUA 5A7WB 4HFSA 1LGBA 2VUAA 2WT1A 5FZ3A 2VMFA 1QJY1 1ULFA 2G9ZA 2DV9A 3I3BA 5FJKA 5FK7A 4ES9A 1X33A 3ACIA 3ILNA 2BVBA 3VBOC 5DXDA 1F2NA 3C3VA 1ZBE1 3RGBA 2PFWA 1A3KA 3GXUA 4Q4X2 5FYCA 1NA1B 2VZTA 5A7NA 2OQ7A 2ZHMA 4YW4A 3PL0A 4TLFA 2HWE2 1AR92 2IXKA 2P5BA 2BPA2 1VBA2 2VCBA 2E63A 3R0RA 1UZZA 1PK6C 4LE4A 3VBSC 1PIV1 5FOJB 2B5HA 2O1QA 1UX7A 3URFA 2EIDA 2BNMA 3P6BA 1X50A 5FPBA 3C7EA 4GKXA 2BNOA 4UBHA 3RS6A 1CQ9A 2VZRA 2YFZA 1J83A 3MGUA 4JGZC 3AJYA 5A33A 4XFFA 3ZDSA 2JDYA 3VKLA 2CGNA 5C33A 1WMDA 4CCOA 3BVCA 1JODA 2VH9A 4HZFA 4IE6A 5FYSA 4DUWA 5DUUA 1EUUA 2EF6A 1LOEA 3U10A 3AVSA 3ACGA 1DZQA 4L92A 2W92A 1Q8OA 4K20A 1DGLA 5C8CC 3QH7A 1LENA 1W9WA 4OCTA 2XBO3 3VZJA 4EN6B 2HLEA 4QB2A 1AYM2 4BOWA 5IVBA 5IFTA 1W0OA 1AL22 2ZMNA 3ES4A 4XQWA 1RUH3 4RGAA 2A7AA 2W0XA 5K4LA 4PHZA 2ETEA 3GZEA 5KHHA 2YMZA 3WT3A 4DFSA 4F7ZA 1CAWB 1W06A 1YI7A 2IFWA 2Z4FA 4L99A 4E2QA 1MEC2 2A71A 4CP9A 4XJUA 1UIJA 5JR2A 2RS13 2XKPA 5LB6A 2LS6A 1FPN2 3VKFC 4CCDA 3PU8A 1FT9A 2ZABA 4QPGA 1ZNPA 2Y6KA 2DURA 4HONA 5FZ0A 2OX0A 4A45A 4FCAA 2J1AA 4K1ZA 4Q4W3 4BXSV 5JOYA 2BWCA 1IGOA 5C4WC 3I2HA 1JXNA 2I74A 1DLLA 2QNKA 4ZPIA 3THCA 1Q3EA 1LHWA 4NAOA 3ZFGB 1PVXA 1AJOA 2ET7A 5A7WA 1JZ6A 1YLLA 4YVWA 2OZJA 2Y6JA 4M00A 1IQAA 1ST8A 3V65A 1DG6A 3RZGA 4Y1UA 1O91A 4AI0A 3IMMA 1HXS1 2BJSA 2WFF2 3LPFA 1LGNA 2PTMA 5FYBA 4AQSA 1YQ2A 1NLSA 5F32A 4OVEA 2WYFA 2IFRA 2JX9A 5FWJA 1M4WA 4B4QA 2GC0A 5FPXA 5T3NA 3VBSA 2UWCA 4XBQA 5A7PA 2DVFA 4CEYC 1GZ9A 2D6MA 4X6QB 4Y5SA 3VZMA 4OQ9A 4OI0A 3MFCA 1NE6A 1XSRA 4LOSA 3OD0A 5T52A 1CAXA 2QFEA 3CMGA 3VL8A 1S0JA 3N7LA 4ORFA 3E5QA 4FXKB 3IIAA 4UYBA 1PVC2 4JRLA 5FDBA 3T1MA 4W6XA 4Z2AA 1HQNA 5LA9A 5DG2A 4COVA 1VRH3 1L3JA 3WP4A 1PGL1 4XF3A 1O8SA 4S2GA 4AVSA 4O65A 4HVOA 4BB3A 2VL4A 5JXIA 1LAJA 2D7FA 5BNNA 3DPRA 2QUOA 4GIQA 3J8F2 3WG1A 3KHBA 2WT2A 3PHMA 1F15A 1GZWA 2RDSA 3AYCA 4LO6B 3WQ7A 1ZVFA 4YVSB 3ZN5A 3FLRA 4IV3C 5A1AA 4Y1XA 3MIDA 2JG8A 3BB6A 1UCXA 1MS1A 1HIXA 4M01A 4QU1A 1RUF3 3ZXFA 4AGGA 2ZX0A 4COWA 1VB4A 1Q8QA 3EJKA 2QJVA 2G9FA 2WZR1 4AHWA 1WW4A 2ZX3A 4LJHA 2QQVA 4JHZA 4NWWA 1JYTA 4MH0E 2VU9A 3KV5A 4AZZA 1SBFA 2V5DA 3GJBA 3BTZA 2PQQA 3DKQA 1PVC3 3TYJA 1A34A 4LHLA 2ZGSA 2IXCA 3H1MA 4TN7A 1RUF1 2Y38A 2X05A 4C1XA 1MZFA 3BGAA 3AZYA 1HV0A 3E6DA 4AI9A 4FFHA 3POGA 4UW3A 2FBEA 5C7GA 1C28A 1CZSA 2DCKA 3R6SA 2OUJA 3ORJA 3OGJA 4FQZA 2JE9A 4Q4Y2 4A4AA 3KF3A 3OGVA 4GALA 5BUVA 3VZNA 3I97A 1D4M2 5A3UA 4Y5TA 5J1XA 2JD9A 2MNGA 2RHPA 4NR1A 1AXYA 4YW5A 4Z2WA 2Y0OA 1AF9A 1C1FA 4XJWA 1XOYA 2XQRA 2YXSA 4ZXEA 4EQVA 3IAQA 3JU9A 3RZZA 4YVWB 1ZREA 1R081 3WY6A 4B4PA 1C8NA 2JKBA 4QHBA 4CU6A 5A3NA 4P5HA 4URTA 5A7QA 3ZO0B 2PHFA 1BLZA 5C8CA 3A23A 4YRDA 4I3GA 4Y3OA 3BKZA 5B4XA 1AHSA 4AHXA 5C3QA 2D40A 1IS5A 4NROA 3ZFEC 1ZZCA 4HPKB 3WF4A 1ND3A 1PMIA 2W46A 1NXMA 2FQPA 5LRSA 1OLQA 4SBVA 1RVF2 1S2KA 3S0MA 3NNLA 3ZLIA 2D97A 5K7PA 2Y6GA 3C8XA 2RR11 4KNCA 2CYFA 4DQAA 2CWMA 5IVJA 3MYXA 2WAOA 1XXNA 3KT4A 2VNGA 4TLGA 1FNZA 1O4ZA 4YW6A 1HDKA 4FOWA 1PO21 5FZ7A 5GLUA 1JYNA 3U0ZA 1R1A1 4LKFA 2OQ6A 2VW2A 3JBG2 1DGWX 3J8F3 4PIYA 5IUQA 4RHV1 4AK3A 4BZ4A 1J3PA 2GZWA 1GNZA 3N7JA 3PVNA 2WRAA 3HNYM 3RWNA 4DUXA 4FBFA 3A22A 1SFPA 2R043 5IK5A 2P3JA 4AF9A 1YJKA 5DG1A 1XC6A 3ZIXA 3LWCA 4HBNA 5HXMA 1FATA 2ZGNA 4P9IA 2B8MA 2XJQA 3H1WA 4OFGA 1ZBE2 4NRMA 2RM21 4CDUB 3RMYA 5A3TA 2XVKA 3OTFA 3ZXAC 4ASLA 2HWE1 3ZFEB 2VCMA 1VLNA 2RS33 5IK4A 5ISLA 2J1EA 3U4SA 2RVAA 1VBD1 4ZKTB 1VBB3 3CDZB 3AFKA 4TSVA 5T54A 1W9SA 3OF1A 1HRI1 2E26A 1N47A 1W03A 5DZGA 3RQ0A 4D7TA 1V9U2 4MO3M 3VZOA 4MV2A 3HPNA 1RJ8A 4EROA 2RM23 2R073 1BEV3 3PTYA 5IYYA 1MQTA 5BNQA 4OUSA 3O1PA 3O7OA 2BFUS 2HBUA 1BYHA 2ZKNA 1Z0HA 4RR3B 4AHZA 4P9LA 3S30A 3FJSA 4AVBA 3RJ2X 2ZGUA 1YFYA 4M0NA 1QJU1 4BIOA 4GB32 1XYOA 2GNBA 4AI8A 5I0SA 1UY2A 1I5ZA 2Z69A 5FMBA 4CXWA 1MQTC 1CD3G 3AZXA 4Y4RA 3WF3A 5FUNA 4NMIA 3VB9A 2JE7A 1MS8A 1CVNA 4CPBD 1XE7A 2W68A 5TSWA 3VHRA 4CXYA 2CV6A 3PNAA 2IUWA 3RI8A 3H0OA 3ZN6A 3FHIB 3MIFA 1IHMA 1UU6A 4QKDA 2QBXA 3BI3A 3IDEA 1OOPA 2OUHA 2JG9A 4BLJA 3DKWA 2OXBA 2XJSA 3MV01 4OQ8A 5I0TA 2XWJB 3OOXA 1TMF3 4FPCA 3VZLA 4GH4A 4IV3B 3VD9A 1XYNA 5IJRA 5CFCB 2QQWA 1N1YA 2JDNA 1AR72 1CJDA 4Q4W1 4ZZ8A 1SBEA 5JXJA 3F2ZA 3GCXA 3LOBA 2B39A 5FPVA 1YFXA 1VAKA 1GMMA 5BXXA 1DGRA 3KVBA 4GWNA 4UF0A 2RR13 4IE0A 5L19A 2JG9C 4XFHA 5H9RA 2BYVE 1U5YA 1FNYA 2CU5A 3AYAA 4L11A 3V0AA 2G19A 2HWC3 5T5PA 4XDQA 2LRPA 4BIFA 4DO0A 4HVQA 1E5HA 3LB9A 4X8NA 4R4XA 2ARAA 4I02A 1O6UA 4M3CF 5FYZA 3H7YA 3JQWA 4QXHA 1DU3D 3POEA 5FFOC 5CFCC 1W6OB 4MUVA 1D2SA 2QTWB 3VD7A 2BNNA 4XYXA 5FZMA 4YZ3A 1UKGA 1UMZA 1AL0G 1FYUA 1UN1A 1WA4A 5EXOA 1DZRA 4XCAA 1W8OA 4LO8A 2QZ2A 3TN91 5CFCA 4OUMA 2B7YA 2XJUA 3OG2A 1VBA3 2WSVA 4EZ4A 3SEEA 2Q1ZB 2JB8A 3NQHA 4QQLA 3AKQA 1O3SA 3GZUC 4OHZA 2Y33A 3MZHA 1E5RA 4KG8A 5BNNC 2JXAA 3JB8A 4IUGA 2WKKA 4A6OA 1AXKA 3EB7A 1HX6A 2WT0A 2R061 5FAXA 4K6BA 1N1SA 2WNEA 3FC0A 5FP8A 3OYWB 4F83A 2FDGA 3BODA 4O9GA 4HG6B 3NRUA 1U0AA 1JZ4A 3H1YA 5HV4A 3VD4A 2FDFA 4DXSA 4NUBA 1MVQA 5JZGB 1NUKA 4FFIA 1YIPA 1OQ1A 1QOSA 3IBMA 3MIHA 4XFAA 1QWRA 4B1LA 1W3XA 2FD8A 1YC61 2VC9A 2GN7A 1WCDJ 4V1PA 2WFF3 2VQ0A 1PMHX 5KXDA 1POV0 3D4KA 4CCJA 5JVVA 2HH9A 3IDAA 4FTSA 4LBLA 3OD4A 4FOYA 4O61A 1WCKA 4NHLA 4PLNA 3NNFA 3P5BA 2I07B 5HXVA 5DAQA 1OSGA 1WMXA 4CP1A 1UW8A 1NCRB 3ME2A 5D2AA 2VTXA 1XNDA 1YJLA 1DLCA 1J58A 2EXJA 1W0NA 4OHWA 2J1VA 4RA0A 4S2DA 2ZGKA 2DUOA 4CCNA 5A6YA 1G9BA 4YG3A 4QX8A 1ULPA 1QXRA 2W3JA 1FX5A 1RUF2 4LBMA 4NHXA 4OULA 3VDDC 3I2IA 2D6LX 4YYOA 3K2OA 1H30A 4QQHA 1SLLA 3LEMA 3BU0A 2V09A 1B35B 5A3WA 1ALYA 1SLIA 4RYDA 4Q4Y1 4F3JA 4PI0A 2BRTA 5K0UB 3ETPA 1D4M1 3HQXA 1S0IA 4Y1VA 3AX4A 3K4DA 4MGIE 4X6RB 3WZ1A 3RZMA 5C5TA 3CL1A 3AXDA 3VHPA 1HB4A 4AE2A 4XJZA 3M4FA 1ONAA 1NYWA 2MEV3 2UURA 2W1SA 5F5CA 5LZ6A 3HMYA 3WVJA 2VO5A 2PAKA 3LQCA 4IEOA 2XDVA 4BQ3A 3ZSKA 2ZX2A 5F3GA 5FRAA 1GP4A 1DIWA 4Z82A 1LULA 4H2AA 4B4RA 4BH9A 1DFQA 1EP0A 2W08A 4XTMA 4CUGA 5F2SA 1O5UA 4WVMB 1ULDA 3N9PA 4QDRA 4CDWA 1BKZA 4D3WA 2DCYA 3OY8A 4R4ZA 4N90A 1R092 4AGVA 1KD7A 4AGRA 3ILRA 1IZ3A 1L7QA 2WQ4A 4DRVA 2LROA 5JSPA 3TEXA 1C3HA 2ARCA 3DYOA 4IGOA 4WVVA 2WZPP 1QF3A 4YSFA 1IG0A 2BP6A 2VQTA 5FO7B 5K0UC 2O0OA 5ANQA 2BFUL 4AI2A 4Q0QA 4CTEA 1R1A2 4EJRA 1DGWA 1W2OA 4PF1A 3INAA 3R4UA 4ZZ5A 3AP7A 4TXWA 1HRV3 2WNVC 4Q0VA 2VXJA 2FDIA 2WQZC 3D82A 3ZYFA 3FLPA 2VW0A 3AZWA 4E27A 2HWD3 3WNNA 5F39A 2ZJCA 3TNPB 2IWGB 4PDWA 1VAMA 3O0XA 1QU0A 2UU8A 4FPLA 4MGTA 5FP7A 3ZYPA 4CCKA 5L7OA 2NN8A 2JDKA 5DDJ3 2P1BA 1EYBA 1ASJ1 3MI8A 3N9NA 3Q8CA 2E7AA 4XC9A 3RVHA 1UQXA 1F5FA 3OY8B 2RS12 1GWLA 2LALA 1OUSA 4JAAA 3TWIA 4XMIA 4AEDC 4WZCA 4R8HA 3NW4A 3QACA 4A6SA 4K40A 2PAMA 3AKPA 4K7JA 4CUAA 1JYIA 1M06G 2CL2A 1S4CA 2AENA 3MW2A 3NKTA 3PIGA 2BUKA 3K4AA 2ARXA 3QBQA 1FV2A 4ZS2A 1RUG2 4DUVA 2E7TA 3KT7A 4BU2A 1HQWA 1QJU3 2VZ1A 3I54A 4XHXA 3ZYIB 3N4MA 2QDRA 1RJ7A 4JKKA 3B69A 4XXPA 4AR2A 2XKOA 3H50A 4NHYA 1W0PA 4OI4A 2Y6FA 1QJU2 4FVVA 2XB6C 4GB31 1YQ8A 1F4HA 2R49A 1GICA 4IERA 4QQ2A 3AMMA 3KT1A 4GD4A 3VBHA 4EN8B 5BNNB 3JZVA 2WJSA 3H3UA 1VBB1 4I0BA 2QQIA 3HNBM 4RD7A 4AEMA 1COV2 1BJQA 2YPJA 4PBPA 4LKSA 4QM8A 4P14A 3W21A 1JZ8A 3AZZA 1HB2A 5A1FA 2D3RA 2Y8KA 2XLAA 2XH6A 1JYWA 3ZXLA 5BV6A 5J09A 3ELNA 3EYPA 1H1AA 2LUWA 2PHDA 2J1TA 1GKBA 4DOUA 3QD6A 5C8CB 2JG8C 4AI1A 2HWF3 3I2DA 4FSJA 1MS4A 3OB8A 2UWBA 1V6IA 2DDUA 4K21A 1AR62 2E32A 1D7PM 4A7ZA 3PUQA 2MEV2 3SH3A 1ND2B 4MSVA 5DAXA 1PIV3 1C5IA 2VM9A 4AW7A 5BNOA 3M7AA 4IV1C 3D0JA 2WWSA 3WP3A 5LY1A 2WINB 4N43B 4DY5A 4UFJA 1AR73 4ARYA 1X7NA 3CQOA 3WNKA 2PN5A 1O3RA 1SLCA 2BOIA 3ETQA 3FBYA 1RUC2 5AFBA 5JSOA 3NJYA 2P3YA 4JGYC 2WUHA 1HXS3 2B9VA 4BJ0A 2FMYA 1CZVA 4TTGA 3KCXA 4LO5B 4CP2A 3OUJA 4W65A 1VIWB 5M0TA 3FUQA 1KITA 3DF0A 2Y6HA 3KV9A 5IVEA 3K77A 2ZGRA 3UKVA 2FDJA 3KGLA 1DQ6A 3UNPA 1PM4A 4P9JA 1Z78A 3IN9A 2PELA 1HJFA 1S55A 2PHUA 1UO9A 1SFNA 2Q5TA 3LPGA 5CU1A 3R05A 2JG8B 1TMF1 3D5OA 4KGGA 3LEIA 4R9DA 1K3IA 3BYWA 1K42A 1UXXX 1QXJA
chains in the Genus database with same CATH topology
2KXLA 2YZ4A 4XZPA 4JGYB 1ZBA2 3FWEA 4UBGA 4IEZA 1BEV2 1JUHA 1YWKA 3M2MA 3KCYA 3SMHA 3UL2A 3WW4A 5AFEA 3CU7A 4LTAA 3O14A 1W6NA 2P3KA 3MEPA 4RR3A 1YNAA 3DV8A 2EAKA 1WGPA 1IKPA 2WC2A 1QJX1 3M3OA 2A6XA 2XWBB 3B02A 2E51A 4SLIA 1JTZX 2ZGPA 3VBSB 1WW6A 1RUNA 4XQ4A 5FCCA 1YCIA 1F8VA 2WFPA 3GBFA 4XFGA 1BK1A 4HSJA 4KWKA 4EWAA 1RUG3 4JRAA 1PM7A 5FMOS 4YM0A 4RS5A 1CONA 4D7YA 3RNSA 1QOTA 1TE1B 4M0HA 1H2MA 3VBUC 4YM2A 1WW5A 3AB0A 1GQHA 2XVGA 2XG3A 2HWC2 3MIEA 2HEVF 2QE3A 1YHFA 3HT1A 2YUEA 3VBHC 2XBO2 1ZZBA 4QX5A 4I0AA 1ND3C 1CPNA 4WVMA 4OI1A 2EIGA 3D8CA 5AVPA 1WW7A 4FP2A 1RUI2 3L2YA 2MPFA 3KB5A 2CTVA 3KQRA 5HCAA 5AC91 4Q8LA 1MEC3 4Q8KA 5GLZA 4Y20A 1QDOA 2NQYA 3NSTA 1ZZ8A 2GH2A 2ZOEB 4ZU5A 3AP4A 1CAVB 1NXD1 1PO12 5F9TA 4NN0A 3EO6A 3LAGA 2PHLA 5IK8A 1V6JA 3ZMNA 1H9WA 2X5IB 5GZEA 1C8M2 1ZZ7A 1QH7A 2EALA 5C9AC 4AWDA 1SCSA 1W6PA 4JGZA 1WUVA 2A75A 4Q1PA 4IESA 3GBGA 3BIWE 4Y24A 5LEJA 3ZSEA 1G8WA 2ERFA 1SBDA 3BU7A 3VBRB 3FE5A 5GKAC 3VLBB 1RUOA 3I8TA 3BALA 2VMIA 3NV2A 1NA1C 1RB8G 1CGPA 4LULA 3ZXDA 4TYSA 4WM8B 3PJYA 2D3PA 2TEPA 1H4HA 4MLOA 2JEMA 5JMCA 4DPNA 4XJ9A 4A2UA 3WD5A 4DY3A 1NCQC 2QDNA 2DVBA 2CGPA 3NVCA 4N9IA 2WSUA 3VKNA 3AMQA 1G86A 3NWKA 3V64A 2ZA9A 2R072 1J3QA 3QOPA 1AYN2 1ZYBA 3O0WA 4RR3C 2WZR3 3QCWA 3R4SA 1GLHA 1VBB2 2ATFA 2YGLA 3OBTA 4OI2A 3VBRC 4CEYB 5E8AA 2PLV3 1H4GA 4IV3A 4H3WA 1JW6A 4UXAA 4WVWA 2DCJA 2XGXA 3POWA 4Y4YA 4YM3A 1AR61 3WDTA 4LNVA 2VNRA 4XFBA 1RIRA 5D8AA 1VB2A 1LU2A 1G7YA 2MEV1 2PLV1 2VVEA 5FLIA 4XILA 4JGYA 3WP5A 5JCTA 1F31A 3GHNA 5CFDA 1FMD1 4K1YA 5FPZA 1RMU2 1RUJ1 1OPOA 3B94A 4M3CE 3ZXEA 1AYN3 5AVAA 3O5SA 3IWZA 3D6EA 1KQRA 2XUMA 3ASIA 4HETA 3SXWA 3ROUA 4J1XA 3BOWA 2HYKA 1LECA 1QNYA 4Q4V2 5E16A 1AUYA 5FREA 1KJLA 1CAWA 2HWF1 2GNDA 1A8DA 4IETA 4L97A 5J48A 4R9AA 4XQDA 3TAYA 2PYTA 1TNFA 4M3CA 5EZWA 2ZBJA 4AG4A 1LTEA 1R1A3 4KL1A 4MYEA 4E4SA 1LHOA 4YW1A 1ZA4A 5K9YA 2WS93 5ACA1 3DN7A 1I9RA 1ZBA1 2D6NA 2GALA 4DMIA 1RUI3 3JD71 3GZTB 5BNPB 2H6BA 5HBAA 4Y22A 1LESA 2H6CA 1RUH2 4Q1RA 4PJYA 2E9QA 4AHYA 2Y0IA 1DF0A 4I30A 1AR83 2WA3A 2VMGA 4META 1NE4A 4CDQA 3FZ3A 1AX1A 1YFUA 3WG4A 1PK6B 3QLQA 1LHUA 2ZZQA 5LK7B 1JN2P 1NZCA 4XF1A 1VBA1 2XLGA 5JPNB 4GMP0 4O9EA 4MGKE 2VVDA 2JJ6A 2WA4A 1D0HA 1ASJ3 1QOOA 1U5XA 2Q1MA 1EPZA 2DVAA 1V6KA 3NV4A 3H3ZA 4Z92B 4NO4A 3EXUA 4X8PA 2DTWA 2OPKA 1IOAA 1OFSA 5KBFA 1XRUA 1XYPA 4COUA 3PMSA 1B35C 2OZ6A 3THTA 4Q27A 3ZX7A 1ZRCA 2CAUA 3MW3A 5F6KA 2HEWF 1KXGA 4XF4A 4YFZA 2TNFA 3ZPYA 1XQNA 1SDWA 3A0KA 4LHNA 3ILFA 5T5OA 3WHUA 4Q4V3 2R042 4LA3A 2A6YA 3NJZA 4Q2FA 1WLCA 4RGGA 3W9AA 3ZFEA 2EVXA 4L8QA 1RINA 2V5YA 3ENRA 3MLKA 1GR3A 3IKWA 4GWMA 5H9QA 3WX5A 3HR9A 4TZDA 3N7MA 1YI9A 2NM1A 2DCZA 3SCGA 2KM2A 3G6JB 4FPEA 1XNBA 1DGRN 2GNMA 1AL23 2GSYA 2Y26A 2VOWA 3NL1A 2CGOA 1BBT3 4YVSC 3N3HA 1GNHA 5LEKA 4AVTA 1APNA 1QXPA 5A33B 2KA3A 4UW6A 4C90A 3VHNA 4YGBA 4YVSA 1UX6A 4HT1T 3AP9A 5ABJC 2WNUB 1C4RA 3AKTA 2B45X 4LBJA 1BVP1 1EAH3 4CDWB 1EV12 1W6PB 4JGZB 4IEQA 4NOTA 1TNRA 2C5DA 5I91A 5A32A 1HXS2 5C4WB 1J1LA 2WS92 2O8OA 5SV8A 3M70A 3TN93 5L36A 1LEMA 1NA1A 4KBBA 4LR4A 4C91A 1H9PA 1Y3TA 2R0FA 3LZZA 3WUDA 5DUWA 4ATEA 1CAVA 1ENQA 1AX0A 5EWSA 4WM8A 1RUE1 1W6OA 1IPJA 1FXZA 2NMOA 3WG2A 2CY6A 2R0HA 5E88A 1OPMA 3WW2A 1J1TA 1LR5A 3GZAA 4YFWA 4LHKA 4LUKA 1PGSA 4HANA 3U07A 3HWJA 1HRI3 3B00A 5I8SA 5LRRA 1PGL2 1DYKA 4MZUA 2LTNA 2VPVA 3GYDA 2RS31 1ND2A 2PHXA 4ISRA 5ACA3 5K8SA 3J8F1 1HV1A 3ZSMA 2BTVC 4OLLA 4N7UA 3H7JA 1X82A 3LA7A 2DUQA 5EV7A 1DQ1A 1ENRA 1QJX3 3IM0A 3W59A 2CNAA 2AH2A 4P9WA 3RRDA 3OGGA 1Y43B 3T2TA 1RUD3 1VBC2 3TRSB 1S0FA 2RMU3 1QY4A 3KMHA 5FBZA 4LBQA 5KC6A 3ZFGA 4WZFA 2PLV2 3PLQA 1W6QB 5DZFA 1RUJ3 1R093 1H0BA 2WNUC 2CWSA 3RPQA 1RUJ2 1RMU3 5GZFA 4KU8A 4N9HA 2I2SA 4W6YA 4CDXA 1U12A 1VRH2 3USSA 4XFCA 1W6MA 3V0BA 2BEOA 3SCFA 3IDCB 3MF9A 4HN0A 5JOXA 3HBZA 4JDOA 4LUMA 2AGSA 2GN3A 2H0BA 4GMP3 2XJVA 1O3TA 1AZDA 3H9AA 5T5JA 1RVF1 4R9BA 5T5LA 3W58A 1DDLA 1D4M3 1LEDA 1SQ4A 4AFCA 1NQDA 1TME2 2B46X 5KHGA 1J59A 2VG9A 2B42B 4MGYE 2XL9A 2UYAA 5JPMB 4GMP1 5ACA2 3MICA 1RITA 2P37A 4XIKA 3HT2A 1PO23 3ZYGA 5FO9B 3JB4C 4QD2A 3FFZA 4IEVA 1Q5OA 2HWD1 4TWTA 3MIBA 1ZZ9A 1Q56A 2JDZA 4FPOB 4HL0A 3B93A 2VGDA 2VOXA 4FPJA 3JUUA 2DFBA 3MIGA 4YGCA 4OHYA 2R30A 3KCCA 4P9XA 5ABJB 3SLIA 1NQJA 1WD3A 4KWJA 1C57A 3GALA 2ZKLA 2RM22 2VMHA 3NKGA 4LO4B 1VBD3 4OHVA 4W6WA 2ZPXA 1VALA 2K9ZA 4H7MA 2X53S 2DUPA 4YGEA 1QHDA 2ENRA 3AXEA 4NHMA 5C6CA 1VBD2 3CEWA 1NCRA 1NCQA 5HCFA 1HRI2 4PIZA 1RUD1 1QH6A 3AZVA 4YW2A 4BM8A 3MPBA 3ES1A 3CLPA 4XF9A 4A7YA 1OA2A 5JAXA 1QQP2 1YO8A 1YIFA 4AEDA 1OQEA 1UF2C 2Z79A 2PAEA 2DCTA 2P34A 1C8M3 1H2NA 1Q43A 3S6PA 3ZSLA 4FT8A 4FPYA 3CJXA 1OFNA 2D6PA 2D6KA 3P3NA 5HCBA 2AUYA 4YM1A 2P2KA 1HRV2 2DVDA 3IT8A 5JZGA 4IEPA 3ALQA 3HAGA 3NAPB 2ILMA 1YUDA 3MF6A 4PQ9A 1N3QA 3MDPA 4IL7A 1O5LA 1GZWB 4IEUA 5L73A 1KS4A 1OI6A 1ZRRA 3CO2A 4GA9A 4HKWA 5T50A 3O12A 4FAHA 1QJY2 1UU4A 3USUB 4CDUC 1RUC3 1D0GA 2UYBA 2YROA 5IT6A 3T1LA 3ECQA 4S2HA 4JV4A 3KD4A 4BMEA 5I8YA 3BOPA 2WL1A 2ZAAA 2B9UA 1AR91 1U5IA 3GBWA 3LSEA 3M3CA 5DUXA 5A32B 5C4WA 4AVVA 4XE9A 2GMEA 3WHTA 5CBLA 3MPPG 1PIV2 4LEJA 2D98A 4Q4W2 3EQEA 4ONUA 5KHKA 2XLFA 1U5ZA 3NAPA 1LODA 4Y1ZA 1V6MA 2XVLA 3FX3A 3I59A 1MZ6A 2A3XA 1CJPA 2PHRA 3FMGA 4XHBA 2XHKA 3SNMA 4AI3A 5A3LA 1EV11 2SBAA 4N43A 4BQ1A 3WW3A 4Q4Y3 2WLQA 5GLTA 5ABJA 4C0BA 1Y9QA 5BNPC 4YW3A 1MS9A 4UW4A 4LBOA 2BQPA 1PZ7A 3J26N 1CR7A 2AREA 1AYM1 1AL21 4YNIA 2ARBA 4F8AA 1OOPB 3ZXKA 1I3HA 3VBFB 3WQ0A 1IS4A 3M3EA 4HKLA 4XTPA 4AFDA 3SCHA 3VBHB 1BBT2 1WLTA 1N3OA 4QGMA 2R062 1LHNA 1MVEA 1FPN1 1R083 2JENA 2OYZA 5GZGA 4NHKA 5L7OB 3PJQA 2D6OX 2V73A 4PDWB 4XJ8A 4FTBA 4WM7A 4XBNA 2K2SA 4YGDA 1WCSA 3AK0A 1BVVA 3BTAA 1SACA 5F6LB 1VJ2A 1W6MB 3WDXA 3V0BB 1CIWA 2GC1A 4HK9A 2LM3A 2D44A 4CEWC 2OVUA 4MGZE 2Q30A 2WFF1 1REDA 4FOQA 4Y20B 4KWLA 3OCPA 4WVZA 1PZ8A 1VBE3 1FOD3 4Z07A 4CDQC 1NLRA 4P9YA 1RL3A 1HW5A 4K3UA 4XOGA 5CG8A 2D5HA 2O8QA 3AJZA 3SITA 2NPIA 4OZXA 1V9U3 1Z7S1 4I09A 1X8EA 4RQPB 3WDYA 1DHKB 2GMPA 4EN0A 2BGCA 1FOD1 1EY2A 1UD1A 3ACLA 1CAXB 1MQTB 3TB0A 3VZKA 1PHMA 2WNVB 1PVC1 3ATGA 3AMNA 2IXLA 2R32A 1RHI3 1MS3A 1W6QA 2VVFA 1LHVA 3E97A 4XIOA 3RJRA 3E6BA 3AYDA 1VRH1 2ZMLA 5IK7A 3ZN4A 1NOVA 3DL3A 4Q0SA 2DTYA 1T6GC 2JICA 4GULA 4FXGB 4CDXB 3ST7A 1VP6A 3BCWA 1HLCA 3AMHA 1H8VA 3OBRA 4KH9A 3WCSA 1BMV2 2ZMKA 1R091 3DPRC 1OA3A 2VUJA 4CDQB 2WZR2 2RJLA 1ND3B 3WP6A 3VGIA 1V6NA 4A3XA 1WLDA 5BNOC 1TME1 1S0BA 4NPRA 4CEWB 1UPIA 4IV1A 3APBA 4LBQB 1MS5A 4G4FA 4ITCA 1OA4A 1URXA 1FI2A 3J4UH 1DYPA 3RYPA 1RHI2 5BYNA 4NWVA 2G4IA 5JOWA 4LLFA 4PDWC 2DYCA 2VXRA 5H9SA 3K51A 3L2HA 2Q4SA 2HKXA 4HMZA 4WM8C 3VDDB 2DF7A 3AYEA 4WV8A 5CFDC 3L9JT 4Y1YA 2SLIA 1ASJ2 5C9AA 1R082 4XFIA 2A73B 3N35A 1K5MB 2RS11 1B09A 1HKDA 3N7KA 5JR7B 1H1IA 2YGMA 3TBDA 1DQ5A 4GH4B 3FFQA 3RI9A 4C1WA 1UL9A 5JIAA 2ZAHA 2C9AA 1RUD2 1VBC3 2A6VA 3MFAA 1RUG1 3VBUB 4Z1VA 2RR12 1WMFA 1LOFC 4L9BA 3PVBB 3WG3A 3USUA 1C1LA 4QM9A 4JQRA 5JZGC 4I0WB 4DNYA 4E2SA 2D5FA 5EYXA 2IXIA 2FZ1A 1ENSA 1PO22 4ZU7A 1ND2C 1PGW1 4RHV2 3ZYRA 1J3RA 2HJIA 1KDMA 3SHRA 2E6VA 2YDEA 4QMAA 3AKSA 3RSJA 5KWRA 2R063 2GC2A 4DINB 1OLRA 5D8AC 5BY5A 4RL7A 1H8TA 5FLJA 2A6WA 2RMU2 5FO8B 5KXCA 3ZFFA 2C0ZA 2PHTA 1XU2A 1K5MA 3KSCA 5I0UA 2WNUA 3GNEA 2NMNA 1RTVA 3A0NA 2X5IA 3MW4A 3LOIA 5EJ3A 4C0HA 1JOJA 3VKMA 4LA2A 3ZFGC 4J1WA 2Q8OA 1WBFA 1V9U1 1GV9A 1Z7S3 1KS5A 3AP6A 5KHJA 4AEKA 4AFMA 4WBBA 1KDKA 3B9IA 3EBRA 2QKDA 3RMXA 1RUC1 3WXPA 2VY0A 4PBOA 2ZHKA 3HD8B 4BPZA 1PK6A 4DS0A 4D7SA 1V00A 4PLMA 4A7KA 4E4ZA 2VW1A 4AQ2A 1GZCA 4DRRA 4WM7B 1WLWA 4FTEA 1BXHA 1UPSA 4RFT0 4QPIB 5GJ6A 2VULA 5KXBA 1REEA 3S7EA 2TUNA 1NY71 4AQTA 5D1IA 2YV8A 3J9SA 3UJOA 2EXKA 2ZGQA 5GZDA 3CJIB 4RS5B 2A6ZA 4RSUA 2I45A 5GLVA 1PNGA 1OOPC 4Y5Z0 1TMF2 5CADA 4AFAA 3U4XA 1CN1A 1R1ZA 3POS