1LUQA

Full matrix error analysis of streptavidin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYEAAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Streptavidin
publication title Full Matrix Error Analysis of Streptavidin
rcsb
source organism Streptomyces avidinii
molecule tags Binding protein
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1luqA00
1SWHA 4JHQA 1NC9A 1KL4A 3EW1A 4CPIA 3X00A 2ZSCA 1STSB 2RTGB 2RTCB 1VWDB 1IJ8A 1SWJA 2IZEB 5B5FA 1VWHB 1LELA 1N9YA 1Y53X 2RTHB 5IRUA 1SLGB 2BC3A 1HXLA 1VWQB 1RXKA 1SWKA 4GD9A 2RTDB 2IZLB 3WZOA 1VWMB 3EW2A 3T6LA 1AVDA 4Y59A 2OFBA 3PK2A 2IZJA 4BX6A 1SWLA 4YVBA 1SRJA 2QCBA 2UZ2A 3VHHA 2IZKA 2F01A 3MG5A 3RE6A 2Y32A 2RTJA 1SWNA 3WZQA 1VWKB 1VWFB 1NQNA 5B5GA 2IZIA 4Z2VA 4JNJA 1KL3A 1VWCB 4CPFA 2IZDB 1LCWA 1KL5A 1DF8A 1SRIA 1SWUA 4GGRA 2RTAA 1WBIA 3RDUA 5CHKA 3WZNA 1SLEB 4IRWA 3VHIA 4BX6B 1VWAB 1SRGA 1VWNB 4Z6JA 3RDMA 1VWJB 2C4IA 2RTMA 4BJ8A 2RTRB 4CPHA 1SWAA 2RTPB 2UYWA 4I60A 2IZFB 1MEPA 2JGSA 1VWLB 1VWBB 2G5LA 2A5CA 2A5BA 1VWIB 1SWQA 1MOYA 2RTLA 1NQMA 1VWPB 1SWDA 4BX7A 1VWEB 5L3YA 1RXJA 1SWTA 1VWOB 4GGZA 3RY2A 2RTKA 2C1SA 2RTOB 3T2WA 2RTFB 4EKVA 2IZHB 1SWGA 4GDAA 2RTIB 1SWSA 1N7YA 4GJVA 4CPHB 1LCVA 1N9MA 1RXHA 3RDXA 1KFFA 1MM9A 4BX5A 2C1QA 1NBXA 1NDJA 2MF6A 3WYQA 2OF8A 2RTQB 3RE5A 1LDOA 1PTSA 3T6FA 1VYOA 1SWRA 1I9HA 1SLDB 1SLFB 1SRHA 5CSEA 5K68A 4Z27A 3SZIA 2RTNB 1SWPA 2RTEB 5IRAA 1LCZA 1SWOA 2IZBA 4BX7B 3VHMA 4JO6A 3SZJA 1SWFA 4CPEA 3SZHA 2FHLA 1N43A 1N4JA 2AVIA 5F2BA 4GGTA 1SREA 3MM0A 1AVEA 1VWGB 2IZCB 4U46A 4Z2OA 5JD2A 2Y3EA 1STRB 1HY2A 1Y52X 3RDQA 4BX5B 2IZGB 2A8GA 1HXZA 1RSUB 2Y3FA 3RDSA 3T2XA 4BBOA 4Z2PA 2OFAA 1SRFA 1VWRB 1Y55X 3RY1A 1STPA 3VGWA 3RDOA 1SWEA 3WZPA 1MK5A 2RTBB 3WYPA 5IRWA 2FHNX 4Y5DA 2GH7A 4Z28A 2IZAA 5K67A 2OF9A 1SWBA 4OKAA 1RSTB 1LDQA 1RAVA 1HQQA 2CAMA 1LUQA 3FDCA 4GJSA 4BCSA 1SWCA 4DNEA 2WPUA
chains in the Genus database with same CATH superfamily
1SWHA 3FMZA 1G5WA 5HWZA 3AKNA 3PH6A 4ES7A 4I9RA 4PSQA 1STSB 2RTGB 2AT5X 2HLVA 2RTCB 3GAQA 2X4MA 1EW3A 4D6AA 1SWJA 3BLGA 4ZR2A 1JYDA 1O8VA 2ANSA 3QKGA 1D2UA 2CBSA 5IRUA 1Y9TA 1SWKA 1VYGA 1B8EA 4CPIA 3T6LA 1BLRA 1AVDA 3LV4A 4L1NA 1JZUA 1GT1A 1SMPI 1VPRA 1TW4A 3FA8A 4YVBA 2QCBA 5LJBA 2AKQA 4XMCA 3S5VA 4AZPA 4YKMA 2BLGA 3RE6A 5HZ6A 2OY8A 1CJ5A 2CM9A 1OEKA 2A0AA 4TKHA 3VG3A 1DV9A 1VWKB 2AT8X 3APWA 3HOLA 3EBWA 3I0AA 4I3DA 3S5XA 1JV4A 4Y0SA 1KL3A 4O4OA 2NP1A 5LKEA 1EIOA 1NP4A 1LIFA 1DF8A 2Q4NA 1I04A 1E00A 1OBQA 2RTAA 4NYRA 2BS5A 1BEBA 1S7DA 3BDRA 4IB6A 4ODDA 4BQUA 1KQXA 1W5RA 5IO5A 2F73A 3P6GA 5L8NA 3S26A 2Q2PA 2HYSA 3STMX 1DZMA 4QQ1A 2NNQA 4IRWA 1GM6A 2OFRX 1EIIA 1G7NA 1I78A 1VWNB 1LKEA 3Q34A 5BVSA 1CBRA 2C4IA 3RDMA 1EUOA 2IFBA 3SLOA 4IMOA 3B2JA 1SY2A 2W2BA 4O4SA 2HZRA 2LA7A 1JJUA 5HZ9A 4IAWA 3P24A 1A3YA 4ON1A 1VWIB 4MEEA 4AYHA 3P6DA 5HZ5A 4CSBA 1FE3A 3RKGA 3JQOA 2RTLA 3F8AA 2K62A 3BU1A 5H8TA 2RD7C 1SWDA 3DSZA 1QY2A 4HPAA 1BRQA 1KT7A 4XMFA 5F6ZA 4NV7A 1VWEB 4YDAA 1SWTA 3RY2A 2RTKA 1RLBE 1ZNGA 4IB9A 3UEXA 2G79A 3SLJA 3T2WA 3UAQA 3NQ3A 3DTQA 3VE2A 3ZW2A 2IZHB 2VDFA 2JU8A 2RTIB 4GDAA 3VG4A 2GTLO 3D96A 1RXHA 4GNYA 4WHIA 1KFFA 4AZMA 5EDBA 2VFCA 1NDJA 1Y9LA 4O3XB 3RE5A 4XMDA 4YDBA 4YFRA 2P8GA 3PQSA 5K68A 1SLDB 3PP6A 3SZIA 1FDQA 4O3ZA 3T1DA 1ZNDA 5IRAA 5F58A 4AZRA 4ZJ0A 1SWOA 1TOUA 4CDDA 4FBRA 2OZQA 4CV7A 3WVMA 3BSZE 4K19A 1HBQA 2L67A 3ELZA 1E2TA 2N93A 4NP1A 1JMXA 4GZVA 4CPEA 3S60A 2FKJA 2X56A 1KT3A 2X8FA 1IW2A 5FQ7E 2O62A 3CBSA 2IZCB 3MM0A 4U46A 5EZ2A 4ALOA 4BGFA 5D8JA 2GTLM 2FGSA 1DFVA 2IZGB 1HXZA 2Y3FA 1BBPA 3FR2A 3U9PC 5D45A 2FR3A 3ZUIA 4NNTA 2OVDA 4YCEA 2WQAE 4O4UA 1MVGA 2OVEA 5HZQA 3H3IA 5LKFA 3WYPA 2QO5A 3PDFA 2KTSA 5IRWA 2FHNX 3IFBA 1QY1A 4FGIB 2OVAA 2MHDA 4U8UN 4Y5DA 1A18A 4TKJA 2X32A 2IZAA 2AL0X 1ZNEA 3AUMO 1SWBA 1RSTB 1LDQA 4QAEA 1RAVA 5B27A 2LKKA 3FDCA 4GJSA 3RBYA 3VU1A 4DNEA 5B3MO 1LPJA 1O1UA 5HA0A 2FRSA 4WFUA 5B2AO 1RBPA 2OFMX 1KL4A 3K3LA 2GJ5A 4XMGA 1BSYA 1JYJA 4Y0PA 3GE2A 5F7GA 3X00A 4HPBA 4ORSA 1Z24A 2X55A 3BRNA 4O4XA 5IO6A 4I95A 1Y53X 1N9YA 1QY0A 2QOMA 3E3CA 3D4RA 1IKJA 2Q9SA 1RXKA 1SY0A 5HA1A 1OPAA 2IZLB 1VWMB 4R0BA 4OMWA 4QYNA 4INNA 2GC9A 5FAZA 3ZW0A 1QABE 1BSQA 1ERXA 1I05A 4YFPA 4ARHA 2Y32A 2RTJA 2RA6A 3APUA 1W6FA 1X89A 2HZQA 4IMNA 1VWFB 3KFFA 5HCCC 3FW4A 4Z2VA 2Q2MA 4JNJA 4AW8A 3AEHA 3TGAA 1LCWA 3PH5A 5KIDA 2KTDA 2Q39A 2R73A 1WBIA 4ORUA 4KC7A 3RDUA 1MX8A 4ZCBA 5HTDA 3HWDA 3FIDA 2MO5A 3WZNA 1B0OA 1SLEB 3VHIA 1KQWA 1YP7A 3BX8A 3MX7A 1VWJB 4Z6JA 5B29A 1BRPA 2HMBA 3FR4A 1K3BA 4CPHA 2RTPB 1GKAA 2DJFA 2UYWA 3HWGA 2IZFB 1G85A 2PY1A 2JGSA 2WSJA 4HWMA 1DC9A 1PBYA 3VG2A 5CE4A 1CBQA 4MVIA 1LNMA 4QZUA 4IB7A 4TJZA 4OELA 4UU3A 3BU9A 3VE1A 5IO7A 4EFGA 2LBVA 2K23A 4COTA 1MOYA 3ZZVA 5HZ8A 1AB0A 4GDZA 3BS2A 3NR3A 4WBKA 5LJGA 1QQSA 1VWPB 3STKA 3WJGA 1ALBA 3EBKA 2KT4B 4HPDA 2JW1A 4N7CA 3Q6LA 4GKCA 3HPEA 3D97A 4CK4A 1EPBA 1FJ1E 1ERBA 2RTFB 3P6EA 4EKVA 4M7MA 2KW1A 1SWGA 2RCTA 4CPHB 1SWSA 1N7YA 1YP6A 1ACDA 1GKAB 1P6PA 2Z4IA 1ZNLA 3TZSA 3P6CA 2C1QA 3P6FA 4U3QA 3SLTA 2OF8A 1JJXA 1B56A 2RTQB 1LDOA 2YG2A 5D48A 1VYFA 1VYOA 1YWCA 1SWRA 1I06A 2JMBA 1KOIA 2LBAA 4GETA 4A60A 2G8CO 1XCAA 1JMZA 1I4UA 3FLLA 5JR8A 1E02A 1JBHA 3TF6A 1SWPA 1LCZA 3F9DA 1A57A 2IZBA 1GT4A 4EDEA 2ASNX 1UZ2X 5BVTA 3SZJA 3APVA 4NLJA 3B2IA 3PEDA 3SZHA 1ADLA 4XMHA 3WBGA 4GUZA 4IB8A 3APXA 1DZKA 5HTEA 2BS6A 2W2AA 2W2FA 3PECA 4DQ4A 1SREA 3MVFA 4IBAA 4QZTA 1AVEA 4Z2OA 4RUNA 3O22A 3JS1A 1YWDA 2DM5A 3NPOA 5CYBA 3ZUOA 1HMSA 3C78X 3RDQA 3SAOA 3FW5A 1RSUB 1A2DA 1ZNHA 1BJ7A 1PMPA 2MJIA 2RCQA 3KFHA 4A8ZA 3PPTA 4MVLA 3VGWA 1SWEA 3WZPA 4I3CA 4JGLA 3AKMA 4OS0A 3CMPA 4MISA 5H9KA 4DCBA 4M6SA 4ML7B 2OF9A 2QOSC 2VFBA 4RUUA 4U9CA 2LB6A 3NQKA 1UYOX 1HMRA 3UEVA 3NADA 3VG7A 2WPUA 3CWKA 4GU8A 5EEEA 4JHQA 4XMEA 1NC9A 2QMIA 1IFBA 3FA9A 2ZSCA 1E06A 3FA7A 5FENA 2CZTA 4LQZA 4NNSA 4YH0A 3QQ2A 2IZEB 4TQ2A 4YBPA 1VWHB 1OEJA 4ORRA 1LELA 2CM4A 2WR6A 3NBXX 2BC3A 1HXLA 4N7DA 4ORYA 3WZOA 2A13A 4ZHDA 2Z4HA 4GNWA 2G7BA 2R74A 1IIUA 4O3YA 2OFBA 3PK2A 4I3BA 4BX6A 1SWLA 4UU2A 4YGZA 2AT6X 1KGLA 2UZ2A 3VHHA 4YKOA 4Y0RA 4FBOA 2AF5A 2A3FX 1SWNA 4OS3A 1X71A 1X8NA 1QWDA 3WJDA 3CKFA 4O3WA 1KT4A 5AJBA 3L4RA 2IZDB 1KXOA 5H9AA 1KL5A 1L6MA 1SA8A 2QO4A 1DF3A 1JQPA 1JIWI 1PBOA 2BSZA 3V8UA 2QO6A 3B2KA 4BOEA 3EYCA 4YCHA 2JU7A 4GH7A 1OBPA 5LJDA 4C5PA 3FELA 5B11O 5BVQA 3WJFA 3B2LA 3KFGA 4U8UO 4BX6B 5L8OA 1VWAB 2ACPX 3KFIA 1ZNKA 2ACOA 3O19A 5FQ6E 4BJ8A 1MUPA 2HNXA 4WFVA 3FEKA 4EXZA 1MDCA 1YWBA 4ZGUA 2FT9A 4ZHFA 3TGCA 3FIQA 4AZOA 2L68A 1AELA 1FELA 1VWBB 2G5LA 5EEDA 2A5CA 2F09A 2WEXA 1EALA 1CBSA 2A5BA 1GX3A 2AMMX 4EQAC 1ICNA 2AH7X 3HTYA 3PQUA 2MM3A 3VG5A 3WJBA 4CDFA 2ZAGA 3RSWA 1NQMA 1U0XA 2A2GA 1YIVA 3CQNA 4MIRA 3HWEA 1KZWA 1RXJA 4IABA 3C77X 3B2HA 4U8UM 1UYNX 1T8VA 3EC5A 1LCVA 1X8OA 2QM9A 3CBCA 3OBLA 4Y0QA 3RDXA 3ZW0B 4B55A 1LIBA 3WJCA 1EQDA 1NBXA 1CRBA 2MF6A 2X8SA 4FQBB 4QGWA 5F6BA 5AEOA 3T6FA 1PTSA 4ZH9A 4LZVA 4QYPA 1FENA 1SLFB 1B4MA 1H91A 1YWAA 2JN3A 4TKBA 1E5PA 2POAA 2RTNB 3NQ9A 5L8IA 1BM5A 1NGLA 4GE1A 1W4TA 4MVKA 4O9SA 1LIEA 4NV8A 2RQ0A 2OL6O 4ZHHA 3VHMA 1N0SA 2OL7A 1SWFA 1HQPA 4NW4A 3OE3A 2JOZA 4AZNA 4LKPA 5KHPA 2CZUA 1GX8A 1N43A 3EM0A 1N4JA 1R0UA 3BX7A 1SY3A 3NP1A 4GGTA 5F2BA 1NP1A 1VWGB 3CQRA 2MWHA 5D4AA 2Y3EA 5JD2A 2M4LA 2FWVA 2LFOA 1Y52X 4ORXA 1SXYA 1QG5A 4Z2PA 4NLIA 1SRFA 1VWRB 1Y55X 3RY1A 2JU3A 2OVSA 3JSQA 4KCAA 3RDOA 1AVGI 1LF7A 2XKLA 2XSTA 4ZGFA 5F1EA 3ZQ3A 1EPAA 2AT0X 1K24A 1LIDA 2X34A 4OEMA 1KZXA 4YBUA 3WJEA 2ALLX 1KT5A 3FA6A 1GGLA 2PI3O 4OKAA 5BYPA 4QGXA 1HQQA 3RZYA 5LJCA 3U03A 2OY1O 1SWCA 1EXSA 1X8PA 2I5VO 3WXQA 3EW1A 2R56A 4LKTA 2AT3X 4TLJA 2YMSA 1S2PA 1VWDB 1IJ8A 5KICA 5C0NA 2OYBO 5B5FA 4CDEA 2RTHB 2NNDA 1XKIA 4I9SA 1OBUA 1HN2A 1SLGB 5HCEC 5FFHA 1VWQB 4ZHGA 5HAEA 4FBVA 4GD9A 2RTDB 3EW2A 4AZQA 4PJ2A 4Y59A 4OS8A 4TNNA 2IZJA 2FS6A 3KQ0A 1SRJA 3EMMA 4GRJA 3G7XA 2L9CA 2IZKA 5AQ6A 1LICA 2OY5O 2F01A 1FTPA 2GTLN 2OL8O 3MG5A 4KC8A 3HK1A 2HKDA 3LHNA 3WZQA 5HBSA 1WUBA 1NQNA 1X8UA 2X8TA 2IZIA 5EPQA 1U17A 5B5GA 4ZFXA 1VWCB 1X8QA 2KD2A 4CPFA 1ICMA 1HMTA 3FENA 1DZPA 1SXUA 1SWUA 1SRIA 4GGRA 3RWXA 3VG6A 1YUPA 4A1YA 4ORWA 4YFQA 3TGBA 1PM1X 1SXXA 2GTFX 2E4JA 4ID2A 5CHKA 4NYQA 5HCDC 5DPQA 5EDCA 2OY7A 1QFTA 4DQ3A 3N91A 1LFOA 4LZUA 4A1HA 1SRGA 5H9NA 2RTMA 2BHVA 2WUTA 3CR6A 2RTRB 5FQ8E 4GK9A 1T68X 2RN4A 1SWAA 5IXGA 4I60A 1MEPA 3CKGA 4OMXA 2BT9A 2X45A 1GXAA 1VWLB 4QNIA 3FYFA 2ZAIA 1FEMA 1SWQA 1D3SA 1G74A 4HPCA 2WEWA 1OSPO 4ZH6A 5LJEA 2FR2A 3KVNA 2G78A 3WOVA 2FKGA 4ZHCA 1ZRYA 3OJYC 5AJCA 3VPJE 4O49A 5B10O 3ZWEA 4BX7A 3FR5A 1EI5A 3STNA 4ALBA 3O2YA 5L3YA 1VWOB 4GGZA 1PEEA 3UEUA 4YMYA 2C1SA 4CDCA 2FLJA 2RTOB 5K06A 3NX1A 4KT5A 1KT6A 4D6BA 2DJGA 1O1VA 3HOEA 3UEWA 4GJVA 3OD9A 2NNEA 1N9MA 1MM9A 3C76X 1CBIA 4QRLA 4BX5A 3D95A 2FTBA 3ZW1A 3WYQA 1I9HA 4L3RA 1SRHA 2FS7A 3KZAA 5CSEA 1TVQA 4Z27A 1BSOA 1IFCA 1TOWA 2RTEB 1DZJA 3HWFA 4HFOA 4IAXA 3SOTA 1GX9A 4BX7B 1ML7A 1QFVA 3LTWA 4JO6A 4MVEA 1MX7A 2FHLA 1Y0GA 2A2UA 1OPBA 3ZI8A 2WQ9A 2L5PA 3NX2A 2AVIA 5LJHA 1AQBA 2WWPA 5D47A 1GT3A 1SY1A 3FEPA 5LJKA 3IA8A 1STRB 1HY2A 3D9WA 4BX5B 4YGGA 3U0DA 2A8GA 4QGVA 3ZW1B 3RDSA 3T2XA 4KH8A 4BBOA 1BWYA 3P02A 2OFAA 4EEJA 4YGHA 3F6ZB 1STPA 2CBRA 2EU7X 1MK5A 1U18A 2RTBB 4I6SA 5DG4A 1UREA 1S44A 2GH7A 4KIIA 4Z28A 1GT5A 1JJJA 3MBTA 3I17A 1SXWA 5K67A 4BVMA 5H9LA 1T0VA 1HBPA 1OEEA 2CAMA 1LUQA 1TXLA 3BY0A 2I5ZO 3ELXA 2X46A 1IKEA 3P6HA 4BCSA
chains in the Genus database with same CATH topology
1SWHA 4JHQA 1NC9A 1KL4A 3EW1A 4CPIA 3X00A 2ZSCA 1STSB 2RTGB 2RTCB 1VWDB 1IJ8A 1SWJA 2IZEB 5B5FA 1VWHB 1LELA 1N9YA 1Y53X 2RTHB 5IRUA 1SLGB 2BC3A 1HXLA 1VWQB 1RXKA 1SWKA 4GD9A 2RTDB 2IZLB 3WZOA 1VWMB 3EW2A 3T6LA 1AVDA 4Y59A 2OFBA 3PK2A 2IZJA 4BX6A 1SWLA 4YVBA 1SRJA 2QCBA 2UZ2A 3VHHA 2IZKA 2F01A 3MG5A 3RE6A 2Y32A 2RTJA 1SWNA 3WZQA 1VWKB 1VWFB 1NQNA 5B5GA 2IZIA 4Z2VA 4JNJA 1KL3A 1VWCB 4CPFA 2IZDB 1LCWA 1KL5A 1DF8A 1SRIA 1SWUA 4GGRA 2RTAA 1WBIA 3RDUA 5CHKA 3WZNA 1SLEB 4IRWA 3VHIA 4BX6B 1VWAB 1SRGA 1VWNB 4Z6JA 3RDMA 1VWJB 2C4IA 2RTMA 4BJ8A 2RTRB 4CPHA 1SWAA 2RTPB 2UYWA 4I60A 2IZFB 1MEPA 2JGSA 1VWLB 1VWBB 2G5LA 2A5CA 2A5BA 1VWIB 1SWQA 1MOYA 2RTLA 1NQMA 1VWPB 1SWDA 4BX7A 1VWEB 5L3YA 1RXJA 1SWTA 1VWOB 4GGZA 3RY2A 2RTKA 2C1SA 2RTOB 3T2WA 2RTFB 4EKVA 2IZHB 1SWGA 4GDAA 2RTIB 1SWSA 1N7YA 4GJVA 4CPHB 1LCVA 1N9MA 1RXHA 3RDXA 1KFFA 1MM9A 4BX5A 2C1QA 1NBXA 1NDJA 2MF6A 3WYQA 2OF8A 2RTQB 3RE5A 1LDOA 1PTSA 3T6FA 1VYOA 1SWRA 1I9HA 1SLDB 1SLFB 1SRHA 5CSEA 5K68A 4Z27A 3SZIA 2RTNB 1SWPA 2RTEB 5IRAA 1LCZA 1SWOA 2IZBA 4BX7B 3VHMA 4JO6A 3SZJA 1SWFA 4CPEA 3SZHA 2FHLA 1N43A 1N4JA 2AVIA 5F2BA 4GGTA 1SREA 3MM0A 1AVEA 1VWGB 2IZCB 4U46A 4Z2OA 5JD2A 2Y3EA 1STRB 1HY2A 1Y52X 3RDQA 4BX5B 2IZGB 2A8GA 1HXZA 1RSUB 2Y3FA 3RDSA 3T2XA 4BBOA 4Z2PA 2OFAA 1SRFA 1VWRB 1Y55X 3RY1A 1STPA 3VGWA 3RDOA 1SWEA 3WZPA 1MK5A 2RTBB 3WYPA 5IRWA 2FHNX 4Y5DA 2GH7A 4Z28A 2IZAA 5K67A 2OF9A 1SWBA 4OKAA 1RSTB 1LDQA 1RAVA 1HQQA 2CAMA 1LUQA 3FDCA 4GJSA 4BCSA 1SWCA 4DNEA 2WPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWH A;  4JHQ A;  1NC9 A;  1KL4 A;  3EW1 A;  4CPI A;  3X00 A;  2ZSC A;  1STS B;  2RTG B;  2RTC B;  1VWD B;  1IJ8 A;  1SWJ A;  2IZE B;  5B5F A;  1VWH B;  1LEL A;  1N9Y A;  1Y53 X;  2RTH B;  5IRU A;  1SLG B;  2BC3 A;  1HXL A;  1VWQ B;  1RXK A;  1SWK A;  4GD9 A;  2RTD B;  2IZL B;  3WZO A;  1VWM B;  3EW2 A;  3T6L A;  1AVD A;  4Y59 A;  2OFB A;  3PK2 A;  2IZJ A;  4BX6 A;  1SWL A;  4YVB A;  1SRJ A;  2QCB A;  2UZ2 A;  3VHH A;  2IZK A;  2F01 A;  3MG5 A;  3RE6 A;  2Y32 A;  2RTJ A;  1SWN A;  3WZQ A;  1VWK B;  1VWF B;  1NQN A;  5B5G A;  2IZI A;  4Z2V A;  4JNJ A;  1KL3 A;  1VWC B;  4CPF A;  2IZD B;  1LCW A;  1KL5 A;  1DF8 A;  1SRI A;  1SWU A;  4GGR A;  2RTA A;  1WBI A;  3RDU A;  5CHK A;  3WZN A;  1SLE B;  4IRW A;  3VHI A;  4BX6 B;  1VWA B;  1SRG A;  1VWN B;  4Z6J A;  3RDM A;  1VWJ B;  2C4I A;  2RTM A;  4BJ8 A;  2RTR B;  4CPH A;  1SWA A;  2RTP B;  2UYW A;  4I60 A;  2IZF B;  1MEP A;  2JGS A;  1VWL B;  1VWB B;  2G5L A;  2A5C A;  2A5B A;  1VWI B;  1SWQ A;  1MOY A;  2RTL A;  1NQM A;  1VWP B;  1SWD A;  4BX7 A;  1VWE B;  5L3Y A;  1RXJ A;  1SWT A;  1VWO B;  4GGZ A;  3RY2 A;  2RTK A;  2C1S A;  2RTO B;  3T2W A;  2RTF B;  4EKV A;  2IZH B;  1SWG A;  4GDA A;  2RTI B;  1SWS A;  1N7Y A;  4GJV A;  4CPH B;  1LCV A;  1N9M A;  1RXH A;  3RDX A;  1KFF A;  1MM9 A;  4BX5 A;  2C1Q A;  1NBX A;  1NDJ A;  2MF6 A;  3WYQ A;  2OF8 A;  2RTQ B;  3RE5 A;  1LDO A;  1PTS A;  3T6F A;  1VYO A;  1SWR A;  1I9H A;  1SLD B;  1SLF B;  1SRH A;  5CSE A;  5K68 A;  4Z27 A;  3SZI A;  2RTN B;  1SWP A;  2RTE B;  5IRA A;  1LCZ A;  1SWO A;  2IZB A;  4BX7 B;  3VHM A;  4JO6 A;  3SZJ A;  1SWF A;  4CPE A;  3SZH A;  2FHL A;  1N43 A;  1N4J A;  2AVI A;  5F2B A;  4GGT A;  1SRE A;  3MM0 A;  1AVE A;  1VWG B;  2IZC B;  4U46 A;  4Z2O A;  5JD2 A;  2Y3E A;  1STR B;  1HY2 A;  1Y52 X;  3RDQ A;  4BX5 B;  2IZG B;  2A8G A;  1HXZ A;  1RSU B;  2Y3F A;  3RDS A;  3T2X A;  4BBO A;  4Z2P A;  2OFA A;  1SRF A;  1VWR B;  1Y55 X;  3RY1 A;  1STP A;  3VGW A;  3RDO A;  1SWE A;  3WZP A;  1MK5 A;  2RTB B;  3WYP A;  5IRW A;  2FHN X;  4Y5D A;  2GH7 A;  4Z28 A;  2IZA A;  5K67 A;  2OF9 A;  1SWB A;  4OKA A;  1RST B;  1LDQ A;  1RAV A;  1HQQ A;  2CAM A;  1LUQ A;  3FDC A;  4GJS A;  4BCS A;  1SWC A;  4DNE A;  2WPU A; 
#chains in the Genus database with same CATH topology
 1SWH A;  3FMZ A;  1G5W A;  5HWZ A;  3AKN A;  3PH6 A;  4ES7 A;  4I9R A;  4PSQ A;  1STS B;  2RTG B;  2AT5 X;  2HLV A;  2RTC B;  3GAQ A;  2X4M A;  1EW3 A;  4D6A A;  1SWJ A;  3BLG A;  4ZR2 A;  1JYD A;  1O8V A;  2ANS A;  3QKG A;  1D2U A;  2CBS A;  5IRU A;  1Y9T A;  1SWK A;  1VYG A;  1B8E A;  4CPI A;  3T6L A;  1BLR A;  1AVD A;  3LV4 A;  4L1N A;  1JZU A;  1GT1 A;  1SMP I;  1VPR A;  1TW4 A;  3FA8 A;  4YVB A;  2QCB A;  5LJB A;  2AKQ A;  4XMC A;  3S5V A;  4AZP A;  4YKM A;  2BLG A;  3RE6 A;  5HZ6 A;  2OY8 A;  1CJ5 A;  2CM9 A;  1OEK A;  2A0A A;  4TKH A;  3VG3 A;  1DV9 A;  1VWK B;  2AT8 X;  3APW A;  3HOL A;  3EBW A;  3I0A A;  4I3D A;  3S5X A;  1JV4 A;  4Y0S A;  1KL3 A;  4O4O A;  2NP1 A;  5LKE A;  1EIO A;  1NP4 A;  1LIF A;  1DF8 A;  2Q4N A;  1I04 A;  1E00 A;  1OBQ A;  2RTA A;  4NYR A;  2BS5 A;  1BEB A;  1S7D A;  3BDR A;  4IB6 A;  4ODD A;  4BQU A;  1KQX A;  1W5R A;  5IO5 A;  2F73 A;  3P6G A;  5L8N A;  3S26 A;  2Q2P A;  2HYS A;  3STM X;  1DZM A;  4QQ1 A;  2NNQ A;  4IRW A;  1GM6 A;  2OFR X;  1EII A;  1G7N A;  1I78 A;  1VWN B;  1LKE A;  3Q34 A;  5BVS A;  1CBR A;  2C4I A;  3RDM A;  1EUO A;  2IFB A;  3SLO A;  4IMO A;  3B2J A;  1SY2 A;  2W2B A;  4O4S A;  2HZR A;  2LA7 A;  1JJU A;  5HZ9 A;  4IAW A;  3P24 A;  1A3Y A;  4ON1 A;  1VWI B;  4MEE A;  4AYH A;  3P6D A;  5HZ5 A;  4CSB A;  1FE3 A;  3RKG A;  3JQO A;  2RTL A;  3F8A A;  2K62 A;  3BU1 A;  5H8T A;  2RD7 C;  1SWD A;  3DSZ A;  1QY2 A;  4HPA A;  1BRQ A;  1KT7 A;  4XMF A;  5F6Z A;  4NV7 A;  1VWE B;  4YDA A;  1SWT A;  3RY2 A;  2RTK A;  1RLB E;  1ZNG A;  4IB9 A;  3UEX A;  2G79 A;  3SLJ A;  3T2W A;  3UAQ A;  3NQ3 A;  3DTQ A;  3VE2 A;  3ZW2 A;  2IZH B;  2VDF A;  2JU8 A;  2RTI B;  4GDA A;  3VG4 A;  2GTL O;  3D96 A;  1RXH A;  4GNY A;  4WHI A;  1KFF A;  4AZM A;  5EDB A;  2VFC A;  1NDJ A;  1Y9L A;  4O3X B;  3RE5 A;  4XMD A;  4YDB A;  4YFR A;  2P8G A;  3PQS A;  5K68 A;  1SLD B;  3PP6 A;  3SZI A;  1FDQ A;  4O3Z A;  3T1D A;  1ZND A;  5IRA A;  5F58 A;  4AZR A;  4ZJ0 A;  1SWO A;  1TOU A;  4CDD A;  4FBR A;  2OZQ A;  4CV7 A;  3WVM A;  3BSZ E;  4K19 A;  1HBQ A;  2L67 A;  3ELZ A;  1E2T A;  2N93 A;  4NP1 A;  1JMX A;  4GZV A;  4CPE A;  3S60 A;  2FKJ A;  2X56 A;  1KT3 A;  2X8F A;  1IW2 A;  5FQ7 E;  2O62 A;  3CBS A;  2IZC B;  3MM0 A;  4U46 A;  5EZ2 A;  4ALO A;  4BGF A;  5D8J A;  2GTL M;  2FGS A;  1DFV A;  2IZG B;  1HXZ A;  2Y3F A;  1BBP A;  3FR2 A;  3U9P C;  5D45 A;  2FR3 A;  3ZUI A;  4NNT A;  2OVD A;  4YCE A;  2WQA E;  4O4U A;  1MVG A;  2OVE A;  5HZQ A;  3H3I A;  5LKF A;  3WYP A;  2QO5 A;  3PDF A;  2KTS A;  5IRW A;  2FHN X;  3IFB A;  1QY1 A;  4FGI B;  2OVA A;  2MHD A;  4U8U N;  4Y5D A;  1A18 A;  4TKJ A;  2X32 A;  2IZA A;  2AL0 X;  1ZNE A;  3AUM O;  1SWB A;  1RST B;  1LDQ A;  4QAE A;  1RAV A;  5B27 A;  2LKK A;  3FDC A;  4GJS A;  3RBY A;  3VU1 A;  4DNE A;  5B3M O;  1LPJ A;  1O1U A;  5HA0 A;  2FRS A;  4WFU A;  5B2A O;  1RBP A;  2OFM X;  1KL4 A;  3K3L A;  2GJ5 A;  4XMG A;  1BSY A;  1JYJ A;  4Y0P A;  3GE2 A;  5F7G A;  3X00 A;  4HPB A;  4ORS A;  1Z24 A;  2X55 A;  3BRN A;  4O4X A;  5IO6 A;  4I95 A;  1Y53 X;  1N9Y A;  1QY0 A;  2QOM A;  3E3C A;  3D4R A;  1IKJ A;  2Q9S A;  1RXK A;  1SY0 A;  5HA1 A;  1OPA A;  2IZL B;  1VWM B;  4R0B A;  4OMW A;  4QYN A;  4INN A;  2GC9 A;  5FAZ A;  3ZW0 A;  1QAB E;  1BSQ A;  1ERX A;  1I05 A;  4YFP A;  4ARH A;  2Y32 A;  2RTJ A;  2RA6 A;  3APU A;  1W6F A;  1X89 A;  2HZQ A;  4IMN A;  1VWF B;  3KFF A;  5HCC C;  3FW4 A;  4Z2V A;  2Q2M A;  4JNJ A;  4AW8 A;  3AEH A;  3TGA A;  1LCW A;  3PH5 A;  5KID A;  2KTD A;  2Q39 A;  2R73 A;  1WBI A;  4ORU A;  4KC7 A;  3RDU A;  1MX8 A;  4ZCB A;  5HTD A;  3HWD A;  3FID A;  2MO5 A;  3WZN A;  1B0O A;  1SLE B;  3VHI A;  1KQW A;  1YP7 A;  3BX8 A;  3MX7 A;  1VWJ B;  4Z6J A;  5B29 A;  1BRP A;  2HMB A;  3FR4 A;  1K3B A;  4CPH A;  2RTP B;  1GKA A;  2DJF A;  2UYW A;  3HWG A;  2IZF B;  1G85 A;  2PY1 A;  2JGS A;  2WSJ A;  4HWM A;  1DC9 A;  1PBY A;  3VG2 A;  5CE4 A;  1CBQ A;  4MVI A;  1LNM A;  4QZU A;  4IB7 A;  4TJZ A;  4OEL A;  4UU3 A;  3BU9 A;  3VE1 A;  5IO7 A;  4EFG A;  2LBV A;  2K23 A;  4COT A;  1MOY A;  3ZZV A;  5HZ8 A;  1AB0 A;  4GDZ A;  3BS2 A;  3NR3 A;  4WBK A;  5LJG A;  1QQS A;  1VWP B;  3STK A;  3WJG A;  1ALB A;  3EBK A;  2KT4 B;  4HPD A;  2JW1 A;  4N7C A;  3Q6L A;  4GKC A;  3HPE A;  3D97 A;  4CK4 A;  1EPB A;  1FJ1 E;  1ERB A;  2RTF B;  3P6E A;  4EKV A;  4M7M A;  2KW1 A;  1SWG A;  2RCT A;  4CPH B;  1SWS A;  1N7Y A;  1YP6 A;  1ACD A;  1GKA B;  1P6P A;  2Z4I A;  1ZNL A;  3TZS A;  3P6C A;  2C1Q A;  3P6F A;  4U3Q A;  3SLT A;  2OF8 A;  1JJX A;  1B56 A;  2RTQ B;  1LDO A;  2YG2 A;  5D48 A;  1VYF A;  1VYO A;  1YWC A;  1SWR A;  1I06 A;  2JMB A;  1KOI A;  2LBA A;  4GET A;  4A60 A;  2G8C O;  1XCA A;  1JMZ A;  1I4U A;  3FLL A;  5JR8 A;  1E02 A;  1JBH A;  3TF6 A;  1SWP A;  1LCZ A;  3F9D A;  1A57 A;  2IZB A;  1GT4 A;  4EDE A;  2ASN X;  1UZ2 X;  5BVT A;  3SZJ A;  3APV A;  4NLJ A;  3B2I A;  3PED A;  3SZH A;  1ADL A;  4XMH A;  3WBG A;  4GUZ A;  4IB8 A;  3APX A;  1DZK A;  5HTE A;  2BS6 A;  2W2A A;  2W2F A;  3PEC A;  4DQ4 A;  1SRE A;  3MVF A;  4IBA A;  4QZT A;  1AVE A;  4Z2O A;  4RUN A;  3O22 A;  3JS1 A;  1YWD A;  2DM5 A;  3NPO A;  5CYB A;  3ZUO A;  1HMS A;  3C78 X;  3RDQ A;  3SAO A;  3FW5 A;  1RSU B;  1A2D A;  1ZNH A;  1BJ7 A;  1PMP A;  2MJI A;  2RCQ A;  3KFH A;  4A8Z A;  3PPT A;  4MVL A;  3VGW A;  1SWE A;  3WZP A;  4I3C A;  4JGL A;  3AKM A;  4OS0 A;  3CMP A;  4MIS A;  5H9K A;  4DCB A;  4M6S A;  4ML7 B;  2OF9 A;  2QOS C;  2VFB A;  4RUU A;  4U9C A;  2LB6 A;  3NQK A;  1UYO X;  1HMR A;  3UEV A;  3NAD A;  3VG7 A;  2WPU A;  3CWK A;  4GU8 A;  5EEE A;  4JHQ A;  4XME A;  1NC9 A;  2QMI A;  1IFB A;  3FA9 A;  2ZSC A;  1E06 A;  3FA7 A;  5FEN A;  2CZT A;  4LQZ A;  4NNS A;  4YH0 A;  3QQ2 A;  2IZE B;  4TQ2 A;  4YBP A;  1VWH B;  1OEJ A;  4ORR A;  1LEL A;  2CM4 A;  2WR6 A;  3NBX X;  2BC3 A;  1HXL A;  4N7D A;  4ORY A;  3WZO A;  2A13 A;  4ZHD A;  2Z4H A;  4GNW A;  2G7B A;  2R74 A;  1IIU A;  4O3Y A;  2OFB A;  3PK2 A;  4I3B A;  4BX6 A;  1SWL A;  4UU2 A;  4YGZ A;  2AT6 X;  1KGL A;  2UZ2 A;  3VHH A;  4YKO A;  4Y0R A;  4FBO A;  2AF5 A;  2A3F X;  1SWN A;  4OS3 A;  1X71 A;  1X8N A;  1QWD A;  3WJD A;  3CKF A;  4O3W A;  1KT4 A;  5AJB A;  3L4R A;  2IZD B;  1KXO A;  5H9A A;  1KL5 A;  1L6M A;  1SA8 A;  2QO4 A;  1DF3 A;  1JQP A;  1JIW I;  1PBO A;  2BSZ A;  3V8U A;  2QO6 A;  3B2K A;  4BOE A;  3EYC A;  4YCH A;  2JU7 A;  4GH7 A;  1OBP A;  5LJD A;  4C5P A;  3FEL A;  5B11 O;  5BVQ A;  3WJF A;  3B2L A;  3KFG A;  4U8U O;  4BX6 B;  5L8O A;  1VWA B;  2ACP X;  3KFI A;  1ZNK A;  2ACO A;  3O19 A;  5FQ6 E;  4BJ8 A;  1MUP A;  2HNX A;  4WFV A;  3FEK A;  4EXZ A;  1MDC A;  1YWB A;  4ZGU A;  2FT9 A;  4ZHF A;  3TGC A;  3FIQ A;  4AZO A;  2L68 A;  1AEL A;  1FEL A;  1VWB B;  2G5L A;  5EED A;  2A5C A;  2F09 A;  2WEX A;  1EAL A;  1CBS A;  2A5B A;  1GX3 A;  2AMM X;  4EQA C;  1ICN A;  2AH7 X;  3HTY A;  3PQU A;  2MM3 A;  3VG5 A;  3WJB A;  4CDF A;  2ZAG A;  3RSW A;  1NQM A;  1U0X A;  2A2G A;  1YIV A;  3CQN A;  4MIR A;  3HWE A;  1KZW A;  1RXJ A;  4IAB A;  3C77 X;  3B2H A;  4U8U M;  1UYN X;  1T8V A;  3EC5 A;  1LCV A;  1X8O A;  2QM9 A;  3CBC A;  3OBL A;  4Y0Q A;  3RDX A;  3ZW0 B;  4B55 A;  1LIB A;  3WJC A;  1EQD A;  1NBX A;  1CRB A;  2MF6 A;  2X8S A;  4FQB B;  4QGW A;  5F6B A;  5AEO A;  3T6F A;  1PTS A;  4ZH9 A;  4LZV A;  4QYP A;  1FEN A;  1SLF B;  1B4M A;  1H91 A;  1YWA A;  2JN3 A;  4TKB A;  1E5P A;  2POA A;  2RTN B;  3NQ9 A;  5L8I A;  1BM5 A;  1NGL A;  4GE1 A;  1W4T A;  4MVK A;  4O9S A;  1LIE A;  4NV8 A;  2RQ0 A;  2OL6 O;  4ZHH A;  3VHM A;  1N0S A;  2OL7 A;  1SWF A;  1HQP A;  4NW4 A;  3OE3 A;  2JOZ A;  4AZN A;  4LKP A;  5KHP A;  2CZU A;  1GX8 A;  1N43 A;  3EM0 A;  1N4J A;  1R0U A;  3BX7 A;  1SY3 A;  3NP1 A;  4GGT A;  5F2B A;  1NP1 A;  1VWG B;  3CQR A;  2MWH A;  5D4A A;  2Y3E A;  5JD2 A;  2M4L A;  2FWV A;  2LFO A;  1Y52 X;  4ORX A;  1SXY A;  1QG5 A;  4Z2P A;  4NLI A;  1SRF A;  1VWR B;  1Y55 X;  3RY1 A;  2JU3 A;  2OVS A;  3JSQ A;  4KCA A;  3RDO A;  1AVG I;  1LF7 A;  2XKL A;  2XST A;  4ZGF A;  5F1E A;  3ZQ3 A;  1EPA A;  2AT0 X;  1K24 A;  1LID A;  2X34 A;  4OEM A;  1KZX A;  4YBU A;  3WJE A;  2ALL X;  1KT5 A;  3FA6 A;  1GGL A;  2PI3 O;  4OKA A;  5BYP A;  4QGX A;  1HQQ A;  3RZY A;  5LJC A;  3U03 A;  2OY1 O;  1SWC A;  1EXS A;  1X8P A;  2I5V O;  3WXQ A;  3EW1 A;  2R56 A;  4LKT A;  2AT3 X;  4TLJ A;  2YMS A;  1S2P A;  1VWD B;  1IJ8 A;  5KIC A;  5C0N A;  2OYB O;  5B5F A;  4CDE A;  2RTH B;  2NND A;  1XKI A;  4I9S A;  1OBU A;  1HN2 A;  1SLG B;  5HCE C;  5FFH A;  1VWQ B;  4ZHG A;  5HAE A;  4FBV A;  4GD9 A;  2RTD B;  3EW2 A;  4AZQ A;  4PJ2 A;  4Y59 A;  4OS8 A;  4TNN A;  2IZJ A;  2FS6 A;  3KQ0 A;  1SRJ A;  3EMM A;  4GRJ A;  3G7X A;  2L9C A;  2IZK A;  5AQ6 A;  1LIC A;  2OY5 O;  2F01 A;  1FTP A;  2GTL N;  2OL8 O;  3MG5 A;  4KC8 A;  3HK1 A;  2HKD A;  3LHN A;  3WZQ A;  5HBS A;  1WUB A;  1NQN A;  1X8U A;  2X8T A;  2IZI A;  5EPQ A;  1U17 A;  5B5G A;  4ZFX A;  1VWC B;  1X8Q A;  2KD2 A;  4CPF A;  1ICM A;  1HMT A;  3FEN A;  1DZP A;  1SXU A;  1SWU A;  1SRI A;  4GGR A;  3RWX A;  3VG6 A;  1YUP A;  4A1Y A;  4ORW A;  4YFQ A;  3TGB A;  1PM1 X;  1SXX A;  2GTF X;  2E4J A;  4ID2 A;  5CHK A;  4NYQ A;  5HCD C;  5DPQ A;  5EDC A;  2OY7 A;  1QFT A;  4DQ3 A;  3N91 A;  1LFO A;  4LZU A;  4A1H A;  1SRG A;  5H9N A;  2RTM A;  2BHV A;  2WUT A;  3CR6 A;  2RTR B;  5FQ8 E;  4GK9 A;  1T68 X;  2RN4 A;  1SWA A;  5IXG A;  4I60 A;  1MEP A;  3CKG A;  4OMX A;  2BT9 A;  2X45 A;  1GXA A;  1VWL B;  4QNI A;  3FYF A;  2ZAI A;  1FEM A;  1SWQ A;  1D3S A;  1G74 A;  4HPC A;  2WEW A;  1OSP O;  4ZH6 A;  5LJE A;  2FR2 A;  3KVN A;  2G78 A;  3WOV A;  2FKG A;  4ZHC A;  1ZRY A;  3OJY C;  5AJC A;  3VPJ E;  4O49 A;  5B10 O;  3ZWE A;  4BX7 A;  3FR5 A;  1EI5 A;  3STN A;  4ALB A;  3O2Y A;  5L3Y A;  1VWO B;  4GGZ A;  1PEE A;  3UEU A;  4YMY A;  2C1S A;  4CDC A;  2FLJ A;  2RTO B;  5K06 A;  3NX1 A;  4KT5 A;  1KT6 A;  4D6B A;  2DJG A;  1O1V A;  3HOE A;  3UEW A;  4GJV A;  3OD9 A;  2NNE A;  1N9M A;  1MM9 A;  3C76 X;  1CBI A;  4QRL A;  4BX5 A;  3D95 A;  2FTB A;  3ZW1 A;  3WYQ A;  1I9H A;  4L3R A;  1SRH A;  2FS7 A;  3KZA A;  5CSE A;  1TVQ A;  4Z27 A;  1BSO A;  1IFC A;  1TOW A;  2RTE B;  1DZJ A;  3HWF A;  4HFO A;  4IAX A;  3SOT A;  1GX9 A;  4BX7 B;  1ML7 A;  1QFV A;  3LTW A;  4JO6 A;  4MVE A;  1MX7 A;  2FHL A;  1Y0G A;  2A2U A;  1OPB A;  3ZI8 A;  2WQ9 A;  2L5P A;  3NX2 A;  2AVI A;  5LJH A;  1AQB A;  2WWP A;  5D47 A;  1GT3 A;  1SY1 A;  3FEP A;  5LJK A;  3IA8 A;  1STR B;  1HY2 A;  3D9W A;  4BX5 B;  4YGG A;  3U0D A;  2A8G A;  4QGV A;  3ZW1 B;  3RDS A;  3T2X A;  4KH8 A;  4BBO A;  1BWY A;  3P02 A;  2OFA A;  4EEJ A;  4YGH A;  3F6Z B;  1STP A;  2CBR A;  2EU7 X;  1MK5 A;  1U18 A;  2RTB B;  4I6S A;  5DG4 A;  1URE A;  1S44 A;  2GH7 A;  4KII A;  4Z28 A;  1GT5 A;  1JJJ A;  3MBT A;  3I17 A;  1SXW A;  5K67 A;  4BVM A;  5H9L A;  1T0V A;  1HBP A;  1OEE A;  2CAM A;  1LUQ A;  1TXL A;  3BY0 A;  2I5Z O;  3ELX A;  2X46 A;  1IKE A;  3P6H A;  4BCS A; 
#chains in the Genus database with same CATH homology
 1SWH A;  4JHQ A;  1NC9 A;  1KL4 A;  3EW1 A;  4CPI A;  3X00 A;  2ZSC A;  1STS B;  2RTG B;  2RTC B;  1VWD B;  1IJ8 A;  1SWJ A;  2IZE B;  5B5F A;  1VWH B;  1LEL A;  1N9Y A;  1Y53 X;  2RTH B;  5IRU A;  1SLG B;  2BC3 A;  1HXL A;  1VWQ B;  1RXK A;  1SWK A;  4GD9 A;  2RTD B;  2IZL B;  3WZO A;  1VWM B;  3EW2 A;  3T6L A;  1AVD A;  4Y59 A;  2OFB A;  3PK2 A;  2IZJ A;  4BX6 A;  1SWL A;  4YVB A;  1SRJ A;  2QCB A;  2UZ2 A;  3VHH A;  2IZK A;  2F01 A;  3MG5 A;  3RE6 A;  2Y32 A;  2RTJ A;  1SWN A;  3WZQ A;  1VWK B;  1VWF B;  1NQN A;  5B5G A;  2IZI A;  4Z2V A;  4JNJ A;  1KL3 A;  1VWC B;  4CPF A;  2IZD B;  1LCW A;  1KL5 A;  1DF8 A;  1SRI A;  1SWU A;  4GGR A;  2RTA A;  1WBI A;  3RDU A;  5CHK A;  3WZN A;  1SLE B;  4IRW A;  3VHI A;  4BX6 B;  1VWA B;  1SRG A;  1VWN B;  4Z6J A;  3RDM A;  1VWJ B;  2C4I A;  2RTM A;  4BJ8 A;  2RTR B;  4CPH A;  1SWA A;  2RTP B;  2UYW A;  4I60 A;  2IZF B;  1MEP A;  2JGS A;  1VWL B;  1VWB B;  2G5L A;  2A5C A;  2A5B A;  1VWI B;  1SWQ A;  1MOY A;  2RTL A;  1NQM A;  1VWP B;  1SWD A;  4BX7 A;  1VWE B;  5L3Y A;  1RXJ A;  1SWT A;  1VWO B;  4GGZ A;  3RY2 A;  2RTK A;  2C1S A;  2RTO B;  3T2W A;  2RTF B;  4EKV A;  2IZH B;  1SWG A;  4GDA A;  2RTI B;  1SWS A;  1N7Y A;  4GJV A;  4CPH B;  1LCV A;  1N9M A;  1RXH A;  3RDX A;  1KFF A;  1MM9 A;  4BX5 A;  2C1Q A;  1NBX A;  1NDJ A;  2MF6 A;  3WYQ A;  2OF8 A;  2RTQ B;  3RE5 A;  1LDO A;  1PTS A;  3T6F A;  1VYO A;  1SWR A;  1I9H A;  1SLD B;  1SLF B;  1SRH A;  5CSE A;  5K68 A;  4Z27 A;  3SZI A;  2RTN B;  1SWP A;  2RTE B;  5IRA A;  1LCZ A;  1SWO A;  2IZB A;  4BX7 B;  3VHM A;  4JO6 A;  3SZJ A;  1SWF A;  4CPE A;  3SZH A;  2FHL A;  1N43 A;  1N4J A;  2AVI A;  5F2B A;  4GGT A;  1SRE A;  3MM0 A;  1AVE A;  1VWG B;  2IZC B;  4U46 A;  4Z2O A;  5JD2 A;  2Y3E A;  1STR B;  1HY2 A;  1Y52 X;  3RDQ A;  4BX5 B;  2IZG B;  2A8G A;  1HXZ A;  1RSU B;  2Y3F A;  3RDS A;  3T2X A;  4BBO A;  4Z2P A;  2OFA A;  1SRF A;  1VWR B;  1Y55 X;  3RY1 A;  1STP A;  3VGW A;  3RDO A;  1SWE A;  3WZP A;  1MK5 A;  2RTB B;  3WYP A;  5IRW A;  2FHN X;  4Y5D A;  2GH7 A;  4Z28 A;  2IZA A;  5K67 A;  2OF9 A;  1SWB A;  4OKA A;  1RST B;  1LDQ A;  1RAV A;  1HQQ A;  2CAM A;  1LUQ A;  3FDC A;  4GJS A;  4BCS A;  1SWC A;  4DNE A;  2WPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...