1LURA

Crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
325
Chain Sequence
ASGFIEIANKQGLTATLLPFGATLAKLTFPDKNGKNQDLVLGFDTIDEFEKDAASIGKTVGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRANEQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGLLALTNHAYWNLDGSDTVAEHFLEMEADEFVEVDDTFCPTGAIRSVTDTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSAAPNFDHFPDVSLRPGDHYCQEIVYTFSHVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords aldose 1-epimerase
publication title Crystal Structure of the GalM/aldose Epimerase Homologue from C. elegans, Northeast Structural Genomics Target WR66
rcsb
source organism Caenorhabditis elegans
molecule tags Isomerase
total genus 89
structure length 325
sequence length 329
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2002-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lurA00
3K25A 1LF9A 3NJVA 1OJOA 1NSXA 4DUVA 3BGAA 2CISA 1JYNA 1HM2A 2BRWA 1LXMA 3MUZ1 3T09A 1HN1A 1LURA 3MV11 2ZQ0A 2WVXA 1MMZA 3I3EA 1HM3A 3CZJA 3DYMA 3OBAA 1NS4A 2WVYA 1SO0A 1JZ3A 1JZ7A 1JYVA 5A1AA 4BZEA 2CIRA 1I8QA 1K1YA 1NS8A 1F9GA 3DYPA 1N7NA 1HMWA 1MN0A 3E1F1 3VDAA 3ECQA 3MWXA 1X1JA 1NSVA 2WZSA 2XHNA 1JYWA 1RWGA 1LOHA 1NS7A 2WW3A 3VDBA 1NS0A 1N7PA 1CB8A 3OS7A 2CIQA 2BRPA 3SEPA 1YGAA 1JYXA 1N7OA 2Q1FA 2E22A 1N7RA 1TXKA 2D73A 1SNZA 3T0BA 3T0DA 1RW9A 4BZHA 1NSRA 1L7JA 1DP0A 3T08A 3VD7A 3VD4A 2WVXB 1EGUA 5E1QA 2ZXQA 2WVZA 4TTGA 2HTBA 2HTAA 1ULVA 2E24A 4DUWA 1RWFA 1RWHA 3MV01 3T2OA 3VD3A 1JOVA 1MMUA 1J0MA 1OJPA 2XSGA 1JZ8A 1MMXA 1W3YA 1K1WA 2WW0A 2JKAA 1K1XA 3T0AA 1F4AA 1L7KA 4DUXA 2JKPA 1OJNA 3VDCA 4AQ0A 4RNLA 1NSMA 3NJXA 1J0NA 1NS2A 1NSZA 1LXKA 1MMYA 3T2PA 1HMUA 3OB8A 2BRVX 2WDAA 3IMHA 4BZFA 1NSUA 4BZGA 3DECA 3NREA 3VD9A 1C82A 1PX3A 3IAQA 1N7QA 3IAPA 1HN0A 3A24A 1JZ2A 3DYOA 3DCDA 3Q1NA 1RWCA 1YQ2A 2X03A 1X1HA 2WW2A 1JZ4A 3I3BA 3J7HA 3MUY1 3WFAA 1Z45A 1OJMA 1X1IA 1F4HA 1RWAA 1PX4A 1JZ6A 2WCOA 3T2QA 1JZ5A 1F1SA 1NKGA 1UG9A 3VD5A 2WW1A 3I3DA 2JKEA 1NSSA 1LF6A
chains in the Genus database with same CATH superfamily
3NJVA 1OJOA 3SXXA 1D6UA 2CISA 1JYNA 4FNTA 1HM2A 3MI6A 3BVVA 3EJSA 3I3EA 1HM3A 1SPUA 1LVNA 3D4YA 3D51A 4MMIA 2XN1A 3AMOB 3N9HA 2F1BA 3BLCA 3X40A 3X3XA 2OOVA 4EV2A 2YX9A 2OOVC 1IQYA 3X41A 3S4CA 3VDBA 3OS7A 1YGAA 2Q1FA 1TQVA 3T0BA 1RW9A 2WYHA 1NSRA 3RRSA 5KBPA 1TQWA 1TQSA 3BVUA 1R34A 3VD4A 2XN2A 2ZXQA 1RJOA 2OQEA 1RWFA 4KTRA 1J0MA 2OQEC 2E2TA 1JZ8A 2XN0A 1IVXA 3AFJA 3T0UA 4KTPA 1UI8A 1PS3A 2Y74A 4RNLA 3NJXA 4FNRA 1J0NA 4FNUA 3QDEA 1R33A 2WGQA 1IVWA 3IMHA 4BZFA 4FNPA 3IAQA 1PX3A 2FYVA 3WA3A 3AFLA 1WMOA 1RWCA 3WIRA 3S4AA 1A2VA 4FNVA 2F7RA 3I3BA 3QG0A 2WO0A 2CWVA 2WCOA 1JZ5A 1NKGA 2JKEA 3BVWA 1HWWA 1QAFA 4K35A 4BTWA 3BGAA 3W7WA 3MUZ1 1HN1A 1W4NA 1W7CA 3MV11 3ALAA 2WVXA 4J5TA 1HTYA 1MMZA 3EJQA 3BLBA 1JZ3A 1JZ7A 2F7OA 3NBBA 5A1AA 3CZNA 3W7SA 1JRQA 2FUQA 3D52A 3X3YA 3E1F1 2CFKA 3DDFA 3MWXA 1X1JA 1D6YA 2WZSA 1RWGA 3NBJA 4OK4A 1N7PA 1CB8A 1QX1A 1AVKA 1N7RA 2F7PA 1SNZA 3T0DA 5GW7A 5JMFA 2F1AA 2E2UA 2WVXB 3BUIA 4EV5A 3BUPA 2CG1A 2HTBA 1ULVA 2E24A 2WYIA 1W5ZA 2WW0A 4OJZA 2JKAA 3S4BA 1L7KA 4DUXA 4KFEA 3KN4A 3LOYA 1OJNA 3VDCA 1NSMA 2FUTA 3T2PA 3OB8A 1H54A 3X3ZA 4KFDA 2C10A 1NSUA 3CV5A 2E2VA 3DECA 1JZ2A 3IAPA 3DYOA 3W7TA 3BUDA 3A0OA 4MMHA 3KIIA 1JZ6A 3T2QA 1F1SA 1UG9A 3VD5A 2WW1A 1NSSA 1IVVA 2CFLA 1LF6A 5CA3A 4NEIA 1SIIA 1LF9A 2ZL8A 3RSYA 1NSXA 3LVTA 2OW7A 2BRWA 3T09A 3HIGA 2ZQ0A 3VSMA 3VSNA 1V7WA 2D1WA 3DYMA 2EACA 1NS4A 2WVYA 3CZSA 4BZEA 3EJTA 3D50A 4OK2A 4FNQA 1NS8A 1K1YA 1MN0A 3VDAA 3ECQA 1IQXA 2WOFA 2XHNA 3BUQA 1NS7A 2WW3A 3WVFA 1NS0A 3HI7A 3SEPA 1JYXA 1DYUA 1AVLA 3WIQA 3PGBA 1UI7A 3T08A 3VD7A 1IU7A 1WMPA 3K5TA 5E1QA 4UFCA 2WVZA 2HTAA 4DUWA 1RWHA 3T2OA 1V7XA 5JMDA 3BVXA 1MMXA 1W3YA 1F4AA 3EJPA 2EAEA 1TQUA 2JKPA 3DX4A 3HIIA 3E80A 1QAKA 3DX3A 1NSZA 1NS2A 1QWUA 1EKMA 1AV4A 2EABA 1KSIA 2BRVX 2WDAA 4BZGA 4K3AA 1US1A 2CQSA 1N7QA 3WA2X 1IVUA 3X42A 2W0QA 1JZ4A 3D4ZA 1X1IA 1F4HA 2CWUA 1PX4A 1W6CA 3BVTA 1W2ZA 3S4DA 3K25A 2RDYA 2CFGA 4DUVA 2CWTA 1WMNA 3EJUA 2CFWA 1QWNA 3W7UA 1LXMA 1LURA 4BTYA 1O7DD 2F18A 3CZJA 3OBAA 1TU5A 1SO0A 2Y73A 1JYVA 1PU4A 2CIRA 1I8QA 1F9GA 3DYPA 3DX2A 1N7NA 1HMWA 1HXKA 1QALA 1NSVA 1JYWA 1LOHA 4BTXA 2YFNA 2CIQA 3MPHA 1W6GA 2BRPA 4KFFA 1N7OA 3W7XA 2BT3A 3ACTA 2E22A 1TXKA 2D73A 3TY1A 3E7JA 4BZHA 1L7JA 1DP0A 3BUBA 3ACSA 1EGUA 3DX1A 4TTGA 1V7VA 3MV01 3VD3A 1JOVA 2ALWA 3EJRA 1MMUA 3D3IA 1OJPA 2XSGA 2C11A 1K1WA 1K1XA 3T0AA 2WOHA 2EADA 3QFZA 4AQ0A 1LXKA 3DDGA 1MMYA 3SX1A 2OW6A 1HMUA 1OACA 1TQTA 3DX0A 2YFOA 2CQTA 4FNSA 3NREA 3VD9A 1C82A 1N9EA 1HN0A 3A24A 1D6ZA 3DCDA 3Q1NA 1YQ2A 1SIHA 2PNCA 2X03A 3AMOA 1X1HA 2WW2A 3J7HA 3MUY1 3WFAA 1Z45A 2CG0A 1OJMA 3QFYA 1RWAA 2CFDA 3BS6A 1RKYA 2F7QA 3I3DA
chains in the Genus database with same CATH topology
4NEIA 3K25A 1LF9A 3NJVA 1OJOA 1NSXA 4DUVA 3BGAA 2CISA 1JYNA 1HM2A 2BRWA 1LXMA 3MUZ1 3T09A 1HN1A 1LURA 3MV11 2ZQ0A 2WVXA 3VSMA 4J5TA 3VSNA 1MMZA 3I3EA 1HM3A 3CZJA 3DYMA 3OBAA 1NS4A 2WVYA 1SO0A 4MMIA 1JZ3A 1JZ7A 1JYVA 5A1AA 4BZEA 4OK2A 2FUQA 2CIRA 3BLCA 1I8QA 1K1YA 1NS8A 1F9GA 3DYPA 1N7NA 1HMWA 1MN0A 3E1F1 3VDAA 3ECQA 3MWXA 1X1JA 1NSVA 2WZSA 2XHNA 1JYWA 1RWGA 1LOHA 1NS7A 4OK4A 2WW3A 3VDBA 3WVFA 1NS0A 1N7PA 1CB8A 3OS7A 2CIQA 2BRPA 3SEPA 1YGAA 1JYXA 1N7OA 2Q1FA 2E22A 1N7RA 1TXKA 2D73A 1SNZA 3T0BA 3TY1A 3E7JA 3T0DA 1RW9A 4BZHA 1NSRA 1L7JA 1DP0A 5JMFA 3T08A 3VD7A 3VD4A 2WVXB 1EGUA 5E1QA 2ZXQA 2WVZA 4TTGA 2HTBA 2HTAA 1ULVA 2E24A 4DUWA 1RWFA 1RWHA 3MV01 3T2OA 3VD3A 1JOVA 1MMUA 1J0MA 1OJPA 2XSGA 5JMDA 1JZ8A 1MMXA 1W3YA 1K1WA 2WW0A 4OJZA 2JKAA 1K1XA 3T0AA 1F4AA 1L7KA 4DUXA 2JKPA 3E80A 1OJNA 3VDCA 4AQ0A 4RNLA 1NSMA 3NJXA 1J0NA 1NS2A 1NSZA 1LXKA 1MMYA 2FUTA 3T2PA 1HMUA 3OB8A 2BRVX 2WDAA 3IMHA 4BZFA 1NSUA 4BZGA 3DECA 3NREA 3VD9A 1C82A 1PX3A 3IAQA 1N7QA 3IAPA 1HN0A 3A24A 1JZ2A 3AFLA 3DYOA 3DCDA 3Q1NA 1RWCA 1YQ2A 2X03A 4FNVA 1X1HA 2WW2A 1JZ4A 3I3BA 3J7HA 3MUY1 3WFAA 1Z45A 3A0OA 1OJMA 1X1IA 4MMHA 1F4HA 1RWAA 3BS6A 1PX4A 1JZ6A 2WCOA 3T2QA 1JZ5A 1F1SA 1NKGA 1UG9A 3VD5A 2WW1A 3I3DA 2JKEA 1NSSA 1LF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K25 A;  1LF9 A;  3NJV A;  1OJO A;  1NSX A;  4DUV A;  3BGA A;  2CIS A;  1JYN A;  1HM2 A;  2BRW A;  1LXM A;  3MUZ 1;  3T09 A;  1HN1 A;  1LUR A;  3MV1 1;  2ZQ0 A;  2WVX A;  1MMZ A;  3I3E A;  1HM3 A;  3CZJ A;  3DYM A;  3OBA A;  1NS4 A;  2WVY A;  1SO0 A;  1JZ3 A;  1JZ7 A;  1JYV A;  5A1A A;  4BZE A;  2CIR A;  1I8Q A;  1K1Y A;  1NS8 A;  1F9G A;  3DYP A;  1N7N A;  1HMW A;  1MN0 A;  3E1F 1;  3VDA A;  3ECQ A;  3MWX A;  1X1J A;  1NSV A;  2WZS A;  2XHN A;  1JYW A;  1RWG A;  1LOH A;  1NS7 A;  2WW3 A;  3VDB A;  1NS0 A;  1N7P A;  1CB8 A;  3OS7 A;  2CIQ A;  2BRP A;  3SEP A;  1YGA A;  1JYX A;  1N7O A;  2Q1F A;  2E22 A;  1N7R A;  1TXK A;  2D73 A;  1SNZ A;  3T0B A;  3T0D A;  1RW9 A;  4BZH A;  1NSR A;  1L7J A;  1DP0 A;  3T08 A;  3VD7 A;  3VD4 A;  2WVX B;  1EGU A;  5E1Q A;  2ZXQ A;  2WVZ A;  4TTG A;  2HTB A;  2HTA A;  1ULV A;  2E24 A;  4DUW A;  1RWF A;  1RWH A;  3MV0 1;  3T2O A;  3VD3 A;  1JOV A;  1MMU A;  1J0M A;  1OJP A;  2XSG A;  1JZ8 A;  1MMX A;  1W3Y A;  1K1W A;  2WW0 A;  2JKA A;  1K1X A;  3T0A A;  1F4A A;  1L7K A;  4DUX A;  2JKP A;  1OJN A;  3VDC A;  4AQ0 A;  4RNL A;  1NSM A;  3NJX A;  1J0N A;  1NS2 A;  1NSZ A;  1LXK A;  1MMY A;  3T2P A;  1HMU A;  3OB8 A;  2BRV X;  2WDA A;  3IMH A;  4BZF A;  1NSU A;  4BZG A;  3DEC A;  3NRE A;  3VD9 A;  1C82 A;  1PX3 A;  3IAQ A;  1N7Q A;  3IAP A;  1HN0 A;  3A24 A;  1JZ2 A;  3DYO A;  3DCD A;  3Q1N A;  1RWC A;  1YQ2 A;  2X03 A;  1X1H A;  2WW2 A;  1JZ4 A;  3I3B A;  3J7H A;  3MUY 1;  3WFA A;  1Z45 A;  1OJM A;  1X1I A;  1F4H A;  1RWA A;  1PX4 A;  1JZ6 A;  2WCO A;  3T2Q A;  1JZ5 A;  1F1S A;  1NKG A;  1UG9 A;  3VD5 A;  2WW1 A;  3I3D A;  2JKE A;  1NSS A;  1LF6 A; 
#chains in the Genus database with same CATH topology
 3NJV A;  1OJO A;  3SXX A;  1D6U A;  2CIS A;  1JYN A;  4FNT A;  1HM2 A;  3MI6 A;  3BVV A;  3EJS A;  3I3E A;  1HM3 A;  1SPU A;  1LVN A;  3D4Y A;  3D51 A;  4MMI A;  2XN1 A;  3AMO B;  3N9H A;  2F1B A;  3BLC A;  3X40 A;  3X3X A;  2OOV A;  4EV2 A;  2YX9 A;  2OOV C;  1IQY A;  3X41 A;  3S4C A;  3VDB A;  3OS7 A;  1YGA A;  2Q1F A;  1TQV A;  3T0B A;  1RW9 A;  2WYH A;  1NSR A;  3RRS A;  5KBP A;  1TQW A;  1TQS A;  3BVU A;  1R34 A;  3VD4 A;  2XN2 A;  2ZXQ A;  1RJO A;  2OQE A;  1RWF A;  4KTR A;  1J0M A;  2OQE C;  2E2T A;  1JZ8 A;  2XN0 A;  1IVX A;  3AFJ A;  3T0U A;  4KTP A;  1UI8 A;  1PS3 A;  2Y74 A;  4RNL A;  3NJX A;  4FNR A;  1J0N A;  4FNU A;  3QDE A;  1R33 A;  2WGQ A;  1IVW A;  3IMH A;  4BZF A;  4FNP A;  3IAQ A;  1PX3 A;  2FYV A;  3WA3 A;  3AFL A;  1WMO A;  1RWC A;  3WIR A;  3S4A A;  1A2V A;  4FNV A;  2F7R A;  3I3B A;  3QG0 A;  2WO0 A;  2CWV A;  2WCO A;  1JZ5 A;  1NKG A;  2JKE A;  3BVW A;  1HWW A;  1QAF A;  4K35 A;  4BTW A;  3BGA A;  3W7W A;  3MUZ 1;  1HN1 A;  1W4N A;  1W7C A;  3MV1 1;  3ALA A;  2WVX A;  4J5T A;  1HTY A;  1MMZ A;  3EJQ A;  3BLB A;  1JZ3 A;  1JZ7 A;  2F7O A;  3NBB A;  5A1A A;  3CZN A;  3W7S A;  1JRQ A;  2FUQ A;  3D52 A;  3X3Y A;  3E1F 1;  2CFK A;  3DDF A;  3MWX A;  1X1J A;  1D6Y A;  2WZS A;  1RWG A;  3NBJ A;  4OK4 A;  1N7P A;  1CB8 A;  1QX1 A;  1AVK A;  1N7R A;  2F7P A;  1SNZ A;  3T0D A;  5GW7 A;  5JMF A;  2F1A A;  2E2U A;  2WVX B;  3BUI A;  4EV5 A;  3BUP A;  2CG1 A;  2HTB A;  1ULV A;  2E24 A;  2WYI A;  1W5Z A;  2WW0 A;  4OJZ A;  2JKA A;  3S4B A;  1L7K A;  4DUX A;  4KFE A;  3KN4 A;  3LOY A;  1OJN A;  3VDC A;  1NSM A;  2FUT A;  3T2P A;  3OB8 A;  1H54 A;  3X3Z A;  4KFD A;  2C10 A;  1NSU A;  3CV5 A;  2E2V A;  3DEC A;  1JZ2 A;  3IAP A;  3DYO A;  3W7T A;  3BUD A;  3A0O A;  4MMH A;  3KII A;  1JZ6 A;  3T2Q A;  1F1S A;  1UG9 A;  3VD5 A;  2WW1 A;  1NSS A;  1IVV A;  2CFL A;  1LF6 A;  5CA3 A;  4NEI A;  1SII A;  1LF9 A;  2ZL8 A;  3RSY A;  1NSX A;  3LVT A;  2OW7 A;  2BRW A;  3T09 A;  3HIG A;  2ZQ0 A;  3VSM A;  3VSN A;  1V7W A;  2D1W A;  3DYM A;  2EAC A;  1NS4 A;  2WVY A;  3CZS A;  4BZE A;  3EJT A;  3D50 A;  4OK2 A;  4FNQ A;  1NS8 A;  1K1Y A;  1MN0 A;  3VDA A;  3ECQ A;  1IQX A;  2WOF A;  2XHN A;  3BUQ A;  1NS7 A;  2WW3 A;  3WVF A;  1NS0 A;  3HI7 A;  3SEP A;  1JYX A;  1DYU A;  1AVL A;  3WIQ A;  3PGB A;  1UI7 A;  3T08 A;  3VD7 A;  1IU7 A;  1WMP A;  3K5T A;  5E1Q A;  4UFC A;  2WVZ A;  2HTA A;  4DUW A;  1RWH A;  3T2O A;  1V7X A;  5JMD A;  3BVX A;  1MMX A;  1W3Y A;  1F4A A;  3EJP A;  2EAE A;  1TQU A;  2JKP A;  3DX4 A;  3HII A;  3E80 A;  1QAK A;  3DX3 A;  1NSZ A;  1NS2 A;  1QWU A;  1EKM A;  1AV4 A;  2EAB A;  1KSI A;  2BRV X;  2WDA A;  4BZG A;  4K3A A;  1US1 A;  2CQS A;  1N7Q A;  3WA2 X;  1IVU A;  3X42 A;  2W0Q A;  1JZ4 A;  3D4Z A;  1X1I A;  1F4H A;  2CWU A;  1PX4 A;  1W6C A;  3BVT A;  1W2Z A;  3S4D A;  3K25 A;  2RDY A;  2CFG A;  4DUV A;  2CWT A;  1WMN A;  3EJU A;  2CFW A;  1QWN A;  3W7U A;  1LXM A;  1LUR A;  4BTY A;  1O7D D;  2F18 A;  3CZJ A;  3OBA A;  1TU5 A;  1SO0 A;  2Y73 A;  1JYV A;  1PU4 A;  2CIR A;  1I8Q A;  1F9G A;  3DYP A;  3DX2 A;  1N7N A;  1HMW A;  1HXK A;  1QAL A;  1NSV A;  1JYW A;  1LOH A;  4BTX A;  2YFN A;  2CIQ A;  3MPH A;  1W6G A;  2BRP A;  4KFF A;  1N7O A;  3W7X A;  2BT3 A;  3ACT A;  2E22 A;  1TXK A;  2D73 A;  3TY1 A;  3E7J A;  4BZH A;  1L7J A;  1DP0 A;  3BUB A;  3ACS A;  1EGU A;  3DX1 A;  4TTG A;  1V7V A;  3MV0 1;  3VD3 A;  1JOV A;  2ALW A;  3EJR A;  1MMU A;  3D3I A;  1OJP A;  2XSG A;  2C11 A;  1K1W A;  1K1X A;  3T0A A;  2WOH A;  2EAD A;  3QFZ A;  4AQ0 A;  1LXK A;  3DDG A;  1MMY A;  3SX1 A;  2OW6 A;  1HMU A;  1OAC A;  1TQT A;  3DX0 A;  2YFO A;  2CQT A;  4FNS A;  3NRE A;  3VD9 A;  1C82 A;  1N9E A;  1HN0 A;  3A24 A;  1D6Z A;  3DCD A;  3Q1N A;  1YQ2 A;  1SIH A;  2PNC A;  2X03 A;  3AMO A;  1X1H A;  2WW2 A;  3J7H A;  3MUY 1;  3WFA A;  1Z45 A;  2CG0 A;  1OJM A;  3QFY A;  1RWA A;  2CFD A;  3BS6 A;  1RKY A;  2F7Q A;  3I3D A; 
#chains in the Genus database with same CATH homology
 4NEI A;  3K25 A;  1LF9 A;  3NJV A;  1OJO A;  1NSX A;  4DUV A;  3BGA A;  2CIS A;  1JYN A;  1HM2 A;  2BRW A;  1LXM A;  3MUZ 1;  3T09 A;  1HN1 A;  1LUR A;  3MV1 1;  2ZQ0 A;  2WVX A;  3VSM A;  4J5T A;  3VSN A;  1MMZ A;  3I3E A;  1HM3 A;  3CZJ A;  3DYM A;  3OBA A;  1NS4 A;  2WVY A;  1SO0 A;  4MMI A;  1JZ3 A;  1JZ7 A;  1JYV A;  5A1A A;  4BZE A;  4OK2 A;  2FUQ A;  2CIR A;  3BLC A;  1I8Q A;  1K1Y A;  1NS8 A;  1F9G A;  3DYP A;  1N7N A;  1HMW A;  1MN0 A;  3E1F 1;  3VDA A;  3ECQ A;  3MWX A;  1X1J A;  1NSV A;  2WZS A;  2XHN A;  1JYW A;  1RWG A;  1LOH A;  1NS7 A;  4OK4 A;  2WW3 A;  3VDB A;  3WVF A;  1NS0 A;  1N7P A;  1CB8 A;  3OS7 A;  2CIQ A;  2BRP A;  3SEP A;  1YGA A;  1JYX A;  1N7O A;  2Q1F A;  2E22 A;  1N7R A;  1TXK A;  2D73 A;  1SNZ A;  3T0B A;  3TY1 A;  3E7J A;  3T0D A;  1RW9 A;  4BZH A;  1NSR A;  1L7J A;  1DP0 A;  5JMF A;  3T08 A;  3VD7 A;  3VD4 A;  2WVX B;  1EGU A;  5E1Q A;  2ZXQ A;  2WVZ A;  4TTG A;  2HTB A;  2HTA A;  1ULV A;  2E24 A;  4DUW A;  1RWF A;  1RWH A;  3MV0 1;  3T2O A;  3VD3 A;  1JOV A;  1MMU A;  1J0M A;  1OJP A;  2XSG A;  5JMD A;  1JZ8 A;  1MMX A;  1W3Y A;  1K1W A;  2WW0 A;  4OJZ A;  2JKA A;  1K1X A;  3T0A A;  1F4A A;  1L7K A;  4DUX A;  2JKP A;  3E80 A;  1OJN A;  3VDC A;  4AQ0 A;  4RNL A;  1NSM A;  3NJX A;  1J0N A;  1NS2 A;  1NSZ A;  1LXK A;  1MMY A;  2FUT A;  3T2P A;  1HMU A;  3OB8 A;  2BRV X;  2WDA A;  3IMH A;  4BZF A;  1NSU A;  4BZG A;  3DEC A;  3NRE A;  3VD9 A;  1C82 A;  1PX3 A;  3IAQ A;  1N7Q A;  3IAP A;  1HN0 A;  3A24 A;  1JZ2 A;  3AFL A;  3DYO A;  3DCD A;  3Q1N A;  1RWC A;  1YQ2 A;  2X03 A;  4FNV A;  1X1H A;  2WW2 A;  1JZ4 A;  3I3B A;  3J7H A;  3MUY 1;  3WFA A;  1Z45 A;  3A0O A;  1OJM A;  1X1I A;  4MMH A;  1F4H A;  1RWA A;  3BS6 A;  1PX4 A;  1JZ6 A;  2WCO A;  3T2Q A;  1JZ5 A;  1F1S A;  1NKG A;  1UG9 A;  3VD5 A;  2WW1 A;  3I3D A;  2JKE A;  1NSS A;  1LF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...