1LV8A

Crystal structure of calf spleen purine nucleoside phosphorylase in a new space group with full trimer in the asymmetric unit
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
282
structure length
265
Chain Sequence
NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Crystal structure of calf spleen purine nucleoside phosphorylase with two full trimers in the asymmetric unit: important implications for the mechanism of catalysis
pubmed doi rcsb
molecule tags Transferase
total genus 80
structure length 265
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2002-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lv8A00
1RCTE 4FFSA 1LV8A 1ODIA 2AI3A 4QASA 3GB9A 4E1VA 1T0UA 5EUBA 1SD2A 1PW7A 1B8NA 1PR2A 4LKRA 2A8YA 3MMSA 1JP7A 1SD1A 1JDVA 1Y1SA 3E0QA 4G41A 1JPVA 2H8GA 3O6VA 4X24A 4R2WA 4BMYA 2A0XA 3DDOA 1OU4A 1A9RA 1RYZA 4TS3A 1G2OA 2QSUA 3P0FA 1U1GA 3U40A 2XRFA 1Y1QA 4F1WA 4DABA 5I3CA 1JDSA 3OF3A 2OECA 3EEIA 5F76A 2I4TA 1Z37A 1Z5OA 3PNSA 3LA8A 1OTYA 1A69A 1TCUA 4DA6A 1QE5A 1OTXA 4M1EA 2ON6A 1VHWA 1RXCA 3F8WA 3UAYA 3KU4A 2QTGA 1Z35A 1RXSA 4DAEA 1T8SA 1JDUA 3K8OE 5K1ZA 1TCVA 2HSWA 4JOSA 4L5CA 3OOHA 1PR0A 2I8AA 1ZL2A 1OV6A 3NBQA 3OCCA 3FWPA 1T8YA 4OJTA 2HN9A 2AI1A 4TXLA 1PR1A 4EARA 3INYA 4OY3A 1Y6RA 4GMHA 4M3NA 1Z33A 4D9HA 5EFOA 3KVVA 1SJ9A 4R2XA 4L5YA 3UAZA 4RJ2A 4GLFA 2OC4A 1C3XA 1XE3A 1JYSA 1I80A 1YR3A 5F73A 5IU6A 1CG6A 1N3IA 1Y1TA 5F7XA 1Z38A 3K8QA 1RFGE 1NC1A 4WKPA 2OXFA 3E9RA 2A0YA 3GGSA 4D8VA 4ECEA 1PK9A 1TGYA 1ODKA 2HRDA 1YBFA 3FUCA 4DA0A 4WKNA 4JP5A 4L5AA 3KVRA 1Q1GA 4R31A 2GUWA 3OPVA 1ODJA 5DK6A 4QEZA 5B7QA 5B7NA 4OGKA 4OEHA 1T8RA 4GLJA 3MB8A 4NSNA 3DJFA 4K6OA 1PBNA 1A9TA 5CYGA 4F3KA 4D8YA 2BSXA 5FAKA 4D98A 5CCDA 4YNBA 1V3QE 4OF4A 3KHSA 3NM4A 3D1VA 3OZEA 4MCIA 3SCZA 5F78A 1PR5A 4LNAA 3EMVA 3ENZA 4YMLA 1RR6A 4L6IA 5CXSA 1NC3A 1Z34A 4DAOA 3EUFA 3DF9A 1U1DA 4JWTA 2Q7OE 1VFNA 1K3FA 1YQQA 3PNPA 1PF7E 4LNHA 1V41E 1LX7A 2AC7A 1V2HE 3T94A 3FNQA 4H1TA 1V4NA 5CXQA 4DANA 4GKAA 5CYFA 3IOMA 3UAXA 4PNPA 4QFBA 1Z39A 5JPCA 1NW4A 2QDKA 4TTJA 3O4VA 1A9QA 3LGSA 1K9SA 1JE0A 4WKOA 3IEXA 4F2PA 5EPUA 3BJEA 2QTTA 3FOWA 2HWUA 1U1FA 4TYMA 3TL6A 3DPSA 4TXNA 1U1CA 1OUMA 4TXMA 4MCHA 4DA7A 4WKCA 3OZCA 4WKBA 5F7ZA 1LVUA 1YRYE 3BSFA 1Y1RA 4LDNA 2B94A 1ULAA 1CB0A 3LBAA 1PK7A 4F3CA 4G8JA 4EB8A 3ONVA 5F7JA 3FB1A 2ISCA 4TTIA 3UAVA 1V48A 1B8OA 1PKEA 1VMKA 1ZOSA 2AI2A 4L0MA 1PR6A 1PR4A 4F2WA 4OGLA 4YO8A 4DARA 5B7PA 3FAZA 1RT9A 4PR3A 3UT6A 4MARA 2PGAA 4BN0A 1ULBA 2P4SA 3E9ZA 4DA8A 4TXJA 3DP9A 4TTAA 4QARA 1OVGA 1PWYE 4IP0A 1ODLA 1ECPA 1RSZA 1YQUA 1RXYA 4I2VA 4TXHA 3OZBA 4M7WA 1A9SA 1Z5NA 1A9PA 2A0WA 3KVYA 2IQ5A 4D8XA 5KB3A 1SQ6A 5ETJA 1WTAA 3NM6B 1VHJA 4YJKA 4LZWA 1K27A 4NS1A 4P54A 1RXUA 1JE1A 3NM5A 1V45E 1JDZA 3QPBA 5B7GA 5C80A 1TD1A 4NY1A 3OOEA 3C74A 2QPLA 1M73E 4U2KA 1Y6QA 4TS9A 1Z5PA 1JDTA 3PHBE 4BMXA 3ODGA 5IFKA 4QATA 3OZDA 1U1EA 1T8WA 5CCEA 1Z36A 3UAWA 4G89A 3BL6A 3P0EA 3PHCA 1FXUA 2OC9A 4QAQA 1TGVA 3EUEA 3KUKA 4KN5A 5F7OA 3BGSA 2RJ3A 1A9OA 4UC0A 5F77A 4BMZA
chains in the Genus database with same CATH superfamily
3RFTA 2RH4A 2O5CA 4FFSA 3M0EA 3OJWA 4OMDA 5FWYB 5I7AA 3WLIA 1VB3A 2QTRA 4OH7A 4PSKA 1GQ2A 4TX1A 4JI0B 3FUUA 4G36A 4QOHA 3GA7A 3THWB 2WWVD 4HN4B 2WSSA 3O9VA 3HXMA 1QAQA 2IFTA 3ZHQA 1YKGA 4DE5A 2PM8A 3IQHX 4C4TA 3IBYA 1RKVA 4JL8A 4C05A 2J6HA 4XIIA 5AK3A 3E5NA 3WLKX 3UW3A 4A0GA 3LBIA 1SD2A 2PSJA 1O6ZA 3AK4A 1NDQA 1OQAA 1PP4A 1Q7GA 1QIJA 2FF5A 4OOEA 1SRRA 3RRFA 3T0FA 2Y71A 4HBGA 5JJKA 4LOKA 2ZUBA 1GTG1 2RARA 3KQKA 4UUBA 3DZDA 1C4KA 4X85A 3ADOA 4W9MC 1DIOB 4OQYA 1NVMB 1PZXA 3VYTB 4AZTA 1USWA 4PPNA 5FUWA 4CMIA 1Q1NA 4PLPA 1HNZB 1L5ZA 2VAXA 3ZK9A 4AIRA 1E8DA 1EP9A 1PYDA 3G88A 1C4WA 2WJ3A 1MENA 1R5NA 2X3UA 1WXDA 3BQ9A 1GQOA 5BNTA 3KYDB 2W6IA 1Y1SA 4G0ZA 2NP6A 4G41A 3OQ1A 2OCPA 2PLAA 4RZ3A 3TRKA 1FUIA 1JPVA 3SZOA 4BOYA 1WW8A 1W7AA 3AW9A 4LE0A 5DYGA 4DUPA 1OA0A 1CNMA 1LBHA 4MRAA 3K9FC 3GT0A 1KZ4A 4KTVE 2NUAB 1Q57A 1NLMA 5JADA 3OFJA 1YHZA 1QLJA 2HK6A 2XE8A 3DLAA 4GBGA 1UFOA 4HRYA 3U3DA 2O2JA 2A0XA 5KSPA 2KQUA 3G2QA 1C0LA 1QGYA 2KB0A 3PSHA 1WULS 4RTNA 1JB9A 3LHSA 4RD4A 3GFOA 4MUKA 3T41A 1QH1B 3MAAC 2G25A 3FYUC 3O2NA 1T43A 3KDSE 4DLKA 2CWDA 4XJXA 1KJNA 1GKKA 3GLQA 1TJ5A 3FLEA 2PSSA 3BOSA 3RYIA 1VTKA 3IVXA 2HK9A 9ABPA 2IYZA 2WJZB 1HF3A 4DABA 1F0NA 2VHJA 1I6MA 2HK7A 1PSZA 4H0FA 1WV1A 4D0SA 3Q9SA 4V39A 1S1MA 1NVDA 1U28C 5K0BA 3A37A 3AU9A 4CT0A 4X8LA 4ANFA 3JYHA 5E9AA 4GUAA 5JCPA 1J09A 3D8RA 1TW3A 2JD0A 3ZV5A 2H7VA 4MYUA 4ZXPA 4U7JA 1JT9A 4XAQA 3KSAC 1RI2A 3KWFA 4MS4B 3ABIA 2I9KA 1FLVA 2W6NA 4UCWA 3FJOA 3C3MA 5AVOA 4NNPA 3V97A 1QE5A 4FX2A 5CLJA 2YV1A 1T9AA 3BERA 3E3NA 2DF8A 4KIGA 2IBTA 3KZXA 3IDOA 4INAA 1G8YA 1I3LA 1JQ5A 2B7CA 4RE6A 1O2DA 3WLOA 2R5FA 4KN9S 2IYQA 1G17A 4JU9A 2WM9B 1M6EX 3ELDA 4YH1A 4FD3A 3S1AB 5EJ4A 2QQEA 2WIBA 4DG8A 1DINA 2FZGA 3O84A 1VYVA 2XT6A 3M5WA 3VO2A 4XLLA 1L8LA 2QNBA 1N0WA 2I2FA 4M7RA 2DUWA 3WHLA 3QOWA 2C59A 2IDKA 5HE8A 2QTFA 3DXYA 1E92A 4QBIA 1XHLA 3A6PC 3LH5A 1U65A 2ZBFA 3NBAA 3NGXA 5AI0A 5H16A 1EQ2A 2YXPX 5DCLA 5F1PA 1KJ9A 5KNBA 3EMKA 2M32A 3A0UA 4WZBE 1S6YA 1YBHA 4RIFA 5JCJA 4YUZA 1FFYA 2VQDA 2ES4A 5CCXA 5G1PA 3MBIA 1TYZA 4MNTA 4NK4A 4QNRA 5I4BA 2R1VB 1MFPA 3I6IA 1VLHA 2Y27A 4FT4A 3G2HA 3TLKA 4D4MA 1JLKA 3D0OA 5FJIA 2GD6A 2C31A 4FB4A 3HUFA 1ZGHA 3ZD6A 1OX6A 3EPRA 3ESAA 4QEKA 2HFKA 3RTGA 4TTVA 1ESEA 1RWBA 4DYDA 3QTBA 1BWSA 1U7DA 4BWGA 4F9EA 3LCCA 3DH0A 4P4UA 3EFOB 3PJEA 4L5YA 3UAZA 3ELWA 3QYJA 3UMJA 3W7BA 1QR6A 2GVZC 3G1UA 1LNQA 2PH5A 3HG7A 1ONPA 3ND5A 3ACCA 1G20A 1XE3A 3W2HA 3SYKA 3HCNA 3VZSA 4P4SA 2HHCA 1KSJA 3AL3A 3IBFA 3MWKA 1HQYE 4M60A 1H8EA 3MWJA 3DDZX 3OHMA 5KYVA 5B6IA 1H6AA 1GKLA 5EP4A 3W2GA 2GJ4A 1LPAB 3R6DA 4TLAA 2X8JA 1I4WA 5MGNA 3BHNA 1CS0B 3CRMA 4HH3C 2NT3A 1RQ7A 3QIAA 1T3HA 2GBPA 3DONA 4A5SA 3PJGA 2PWAA 2LWIA 4FGKA 3ZU5A 5T4BA 1N25A 5I5GA 3UGQA 4ECEA 3PFGA 3EPJA 2ZR9A 2QE7A 1ZNXA 1QRDA 3QX9A 3ZTWA 3ZVLA 2CUNA 4JYZA 4TQ9A 2FDCA 2C9MA 3DHWC 1QGZA 1Q50A 2H7YA 2X7XA 4LSMA 1SH7A 3EDMA 2DECA 2X9LA 1BQ4A 4LQ4A 4BU1A 1FBNA 2XCLA 3I04M 3WLMA 2UZIR 1PJAA 3OIWA 1T34A 4RJLA 5AOAA 3RASA 5HJ7A 5T7BA 1OXXK 4XI9A 1P73A 4EPXA 1W87A 1DUVG 2V1XA 3BREA 5EE3A 2FETA 3LY5A 3T5BA 2Z08A 4ZC1A 5FIUA 3HJTA 4FFBA 5FYDA 1TDJA 3W79A 1H9BA 4LX8A 4DQLA 1GV0A 4O0MA 3WXMA 1JWBB 4YXWA 1JFRA 3LWDA 3OEYA 3ZHZA 2Z83A 1UDRA 4RLQA 4F6RB 1K4YA 1L0BA 3HVUA 3MB8A 2PR7A 1NI3A 2BM8A 1RI3A 2FFQA 3V8PA 3X44A 1NNUA 4ZAXA 3CF4A 1YVRA 2X8WA 1U2RA 4NZOA 3T1OA 1P2TA 1MA0A 4TM7A 4K6OA 4DJDC 3EVDA 5JH7A 5JVDA 4ED9A 2HBYA 5CYGA 2PUGA 1NQ5A 1KMHA 1IUPA 1PEKE 1X0XA 5HR5A 1TEVA 2PZLA 1U3UA 2D7DA 5DV9A 4N9QA 5JSHA 1EDEA 3A32A 2JHAA 2WPDD 4XSHA 4ERNA 4KREA 1RCFA 2AWOA 3MMXA 4Z7QB 3CA8A 3THRA 3TRDA 5JTUA 3WHIA 5LQUA 1WXWA 4KQCA 2W8BB 2FEAA 2WWIA 4IEEA 3TLGB 2IVZA 5EMJA 3C4JA 3KB8A 2B9EA 3H5RA 4NC9A 4UU0A 5H83A 1PR5A 2R7AA 2DULA 4ZT6A 4DLVA 2PX6A 3HRIA 1DADA 1ZDMA 3M4YA 3RTAA 4F8EA 4K8OA 4A0HA 3BT7A 2CHQA 1ZN7A 1QORA 1YVUA 2BEUB 1LI7A 1CRWG 2CN1A 2V6MA 2G08A 4Y1RB 3VAAA 1DQZA 3EG9A 3ITEA 4QOSA 3AEXA 1KZ6A 1M54A 1FPMA 1XRMA 1TM5E 2NUTB 3LQ1A 3TLZA 2GPBA 3CLUC 3QVTA 3N1UA 5JNSA 1RYEA 1JG4A 1E5XA 1KK1A 3CRVA 3EQZA 1LPSA 3L7AA 4QXQA 4D3DA 4HJRA 4CT5A 1GQRA 1QFMA 3GR6A 1RI1A 2G0AA 1WQ1R 4Q12A 2BMWA 4PS1A 4J94A 4IIHA 1PF7E 2W93A 2YRWA 3H42B 3RODA 5KVAA 4B3XA 1N6RA 1TIKA 4HAYA 4R6XA 3M81A 1WPQA 1CUWA 5BSGA 3UG6A 1TKRA 2OFWA 2ZTUA 3BILA 4P84A 4D0RA 4NBRA 1SZPA 4K40A 5EJAA 3UMSA 1AQ6A 2WJ6A 1R0BA 4YJ2F 3GYBA 1Z5WA 1JALA 3UWMA 5CYFA 2F9MA 4ZARA 3R3SA 1ZINA 5K0TA 2IW3A 2JI6A 3A31A 4P4TA 4CV0A 3BPSA 4FW9A 2G1PA 3PQ4A 3O9ZA 2NSLA 2YFHA 5DGCA 1PWEA 3IUMA 3ZI0A 4WAUA 2IGBA 1POWA 1L5YA 3V4VB 1H85A 2AEFA 3H6KA 4ENSA 1MVOA 3DOCA 4IS2A 5JARA 3QXJA 5TMPA 1ZBDA 2Q27A 3NS7A 4MV6A 5I7VA 4R40A 3TOVA 3SZRA 2QJWA 1PQPA 4L9AA 3GVPA 3M70A 1X8XA 3DEYX 2OHXA 4LRSB 3ZYZA 3NWEA 3S7ZA 3O03A 3IE0A 3ER6A 1PO7A 3JX9A 5B3LA 5CDTA 1QIDA 1HGXA 3QMMA 5JANA 3CRRA 3TE7A 2FMIA 1U1CA 4J49A 3R6WA 1CDZA 1E3JA 4ND7A 3AHEA 3E23A 4GGOA 2VLIA 3IXMA 2RHOA 3TNDA 3AJEA 3TK1A 2C42A 2ARKA 2Q1TA 4ESHA 5A0TA 5CX4A 2WTMA 4KXYA 3D6TB 4KQMA 4P1ZA 1JNXX 2Y99A 3ZH9B 1Y4DE 4EKGA 3ASVA 3ICCA 4G1EB 2J3DA 4HS4A 5HF8A 3PHLA 2ZQZA 4EMTA 2VP4A 1J0BA 2QI9F 4FHCA 4AAYA 3ITNA 1YZLA 2AJLI 1PGPA 2AG5A 4N01A 1GYQA 1EP3B 2FUCA 2BGJA 4LXXA 3OBIA 4E88A 5A4MS 2CJWB 2CZQA 5DSXA 1SZCA 4GLLA 1N2OA 1FYXA 2R48A 1ZK0A 3L8YA 4XWYA 1JXQA 5DI3A 1NQXA 2K6GA 1G63A 1CZUA 2P1ZA 4I50A 5HS4A 4NYMQ 2Z6AA 4EB8A 2G80A 4NATA 5E95A 4ZHQB 4N9WA 1H23A 1OWMA 4AY4A 1AKEA 1KDRA 2I1LA 2VPWA 4MUGA 4B87A 1GAQA 1B8OA 1K68A 1ZITA 2YFYA 3FMPB 2AI2A 3OPNA 4XLTA 3WZMA 4YCNA 4CM7A 3RHZA 5KU7A 1FFCA 2BFDB 5AKGA 1E8MA 3ACDA 3B1WA 2P65A 4FFOA 4ACAA 1PR6A 2C2ZA 1LS6A 1NN3A 3N0RA 4FGLA 4LXUA 4MHOA 1V6CA 3BZBA 1QS0B 4UUOA 5EY5B 3AONB 2BL4A 3ZZTA 2W6PA 2XB4A 6NULA 3GLGB 2ZK7A 3R5XA 1JG7A 2PMFA 3KFLA 3O38A 1EA7A 1JG6A 2AQIA 1VYTA 4DJ5X 4EA8A 5GOZA 1VA5A 4R81A 2W6ZA 2UUBB 4C7OA 2PGAA 3F5SA 5F1OA 4G85A 5CNJA 4INOA 3VSEA 3GJZA 2HL6A 4R1UA 3IIEA 1DIRA 4F5YA 1XZCA 2E49A 4IVNA 3CINA 3EX7C 3WIOA 4YT8A 2R7MA 3RBVA 1NVVQ 4QUAA 4TMFA 2TRSB 3ICVA 3N0TA 4WK0B 3CKLA 2FQYA 5F35A 5KOJA 4CXMA 2C4VA 4TWBA 3HCFA 3ZU3A 4X90A 2G06A 2NX2A 2RBKA 5IJ9B 1SEPA 1YS9A 3ID6C 4KAAA 1D8TA 1C9JA 4L5JA 5JCOC 1Y42X 3JQDA 3W5CA 2FN7A 2Z95A 5EZ5A 1A5TA 4XFKA 1OYYA 2GF9A 2HOQA 2Q6TA 1T3LA 3L4BC 4XRGA 1QQBA 1JJVA 1ISGA 4XD7D 1UKZA 1GPUA 2ZJ8A 4DQUA 1A9SA 5A9RA 4BE9A 3A28A 3T7JA 4EEXA 3U80A 4EGCB 4PYIA 3NRJA 1QKIA 2A0WA 2F1OA 4LZJA 4EYKA 2F4NA 2V55B 3QMVA 1N57A 4GSKA 2ZE5A 4IHQA 4YMWA 3TRJA 1KS9A 4A8JB 2A1TS 4BMPB 3V00A 2W6MA 3L6CA 4KWEA 3R7WA 1IY0A 1QIKA 3TL2A 721PA 2PD6A 4XVCA 1BX0A 1E7SA 1JIVA 2ZSKA 3DBHB 4MEAA 3U81A 3NGMA 2VT2A 1NJ1A 3A8TA 3LDUA 1CQJB 1S2OA 2ID7A 3S55A 1VMAA 3BAFA 3TD9A 3U4DA 5IHPA 1J0CA 1JKXA 2WUFA 2PDAA 4GF5A 5J2UB 1JJAA 1M76A 3TGLA 2FPPB 3HY6A 2H17A 1K27A 1PVOA 2BLNA 2UYYA 3H5OA 5CVCA 3OY7A 2PKYX 5T4HA 1GRCA 1JV2B 4IV8A 2ANBA 4FGWA 3A1UA 3R44A 4ZAVA 3CJQA 5BR1A 1Z07A 1I3CA 3GUYA 1IEQA 5ER6A 3UOAB 1N9GA 1VM6A 2Q3JA 4IIJA 3KKKA 3NVAA 1E58A 4PLTA 1MB4A 1P80A 3FKJA 4O4JF 3D0QA 4Q3OA 5K09A 3OJCA 4YAFA 1KI9A 3F5MA 1L4UA 1ZMBA 1ORTA 2ECOA 2DM6A 3QLVA 4UBKA 3WKDA 3MK31 1IVYA 3KPJA 1IZ8A 5JXWA 3PC6A 4LOHA 3GMSA 4JODA 1SA0B 1Z4QA 3PB3A 4R1MA 3AVPA 2ZR7A 3Q15C 4ZCPA 4EG3A 4Q18A 3B3FA 1GG5A 1MEJA 5L4NA 5K0EA 2CL0X 1U8YA 3QWFA 1TGVA 1ZH6A 1L4YA 1E2LA 2ZWPA 5IKXA 3T7RA 5FO0A 1VLLA 2AZXA 4R7ZA 4V0OA 3Q8KA 2SECE 3K6RA 3I9NA 2NVBA 2JI8A 5GIPE 1ZSYA 5EWLB 2REQA 4WACA 4L78A 3PWSA 2G9VA 4NU6A 5TMDA 5JZ9A 2QIPA 3B6ZA 3BCSA 3KAJA 3QVWA 7REQB 1JU3A 5CM8B 2Y0EA 1EWVA 4HQNA 2RHBA 2PZEA 4Q1EA 1E2UA 1E66A 1GGVA 1WBJB 3C5CA 1AD2A 1WMDA 1XQ6A 2VN8A 4MLPA 1MIOA 3V4OA 3IQEA 4DMLA 5JC1A 2V7PA 1ORIA 3LJKA 2BGMA 4PY2A 1I3NA 5F2NA 2YW2A 4D79A 5M3BA 3LUBA 221PA 2YC2C 1K86A 3BDVA 5IH7A 4BNFA 2HREA 2XJ9A 3PXEA 4EY3A 2O7VA 3QI7A 1YI1A 3PX3A 4PGAA 4EB3A 2K7FA 3QBVA 4ZC8A 1N6HA 5DGXA 2XV1A 3RC2A 2CXSA 2POQX 4NDZA 5B1EA 1ZK4A 2QN3A 4F86A 3A1EA 4MRPA 4W7IA 4R8LA 2V4MA 4ZRDA 1US8A 2QTVA 2KPOA 2J9ZB 2WHQA 4HDKA 3T99A 1GPJA 2DPLA 2AYYA 2A8YA 3JV7A 4DM4A 3MMSA 4F0JA 4RLSA 3UOGA 2HMTA 1G9TA 4UEQA 2FWRA 3FWHA 1Y48E 2D1YA 5JYCA 1RHRA 1V1RB 2XDWA 4MWEA 4BN5A 3C5EA 3D1JA 5BR8B 4L5IA 4WH0A 2OAGA 3HY3A 1I2AA 2I62A 2FDXA 4QELA 5H82A 4I5GA 2ZJ4A 2HSJA 4AG5A 2DU8A 1N5OX 4AUNA 5AD1A 3O8QB 2LD4A 5AVXA 4W5WA 4YRNA 5KWSA 5LQCA 2J4DA 4CM8B 4LBWA 1II9A 1T91A 1WUYA 4PCAA 1XZNA 3EIUA 4JOCA 1A95A 4NYMR 4DCJA 2IF2A 3WDKA 1VIYA 2WF9A 1X2EA 4X24A 5H7XA 4AJKA 2P2CA 1XN4A 4G8CA 3SJCA 4IKOA 5JSZB 3DB1A 4Q7KA 4DVGA 4I5IA 2C82A 2XCIA 2VYCA 2ATCA 3PXXA 1QNLA 4H7JA 3RAGA 1OX5A 2W2PA 4IQ4A 4TS3A 3QLUC 2C7OA 3FCYA 3LNCA 4YIHA 1ILEA 1JQBA 4YO7A 5JE8A 4HNAB 5BR4A 4K87A 4PHFA 3RUHA 3ZOKA 4KX3A 4YT5A 1RDFA 2ODAA 4MPDA 2NU7A 1BC5A 4JX9A 1U1GA 3WL7A 1M2JA 2FK8A 1Q7CA 1DKNA 1MGOA 2VDLB 2YUIA 3F6SA 2XB8A 4GKBA 2QGNA 4FMCF 4MDEA 3JU3A 3T15A 2AFHA 2IKSA 1JH8A 4TOIA 1ULUA 5CTJA 4BLRA 3PJRA 3ZXXA 1ST3A 1EGMB 3ADPA 1WD7A 1UUFA 4LFAB 1ZUWA 4G5FA 3ND8A 5BPHA 4Z4FA 3L8HA 3RS9A 2XKBA 4EF4A 2BGIA 2I4TA 1Z37A 1HO3A 2PBLA 3IUYA 2ODNA 2I80A 3LDGA 1NVVR 4W99A 4B2YA 2BGNA 3GJ3A 3QNWA 2FRDC 3DCJA 4NPCA 3UVEA 1P60A 4BQPA 4CMIB 4D3XA 4LFBB 1TCUA 1AGXA 3GLUA 3SD7A 1LQTA 1A77A 1B6GA 3IMCA 4RVUA 2R6JA 5AW1A 4DQXA 2WWWA 3UGKA 3WWDA 1JZSA 2CXPA 4L9RA 5GONF 4RABA 3BH7A 4H0CA 4HDRA 3PXGA 1RAFA 4QTTB 5IDYA 1FTQA 1PJTA 2XKJE 3V6LA 3G23A 1XDSA 3DQPA 5EJMA 3X2EA 3D8BA 3T5TA 5CHYA 2GNPA 3W5VA 2RMKA 1SG6A 2UU9B 2IV2X 1DKLA 1K75A 1K7XB 2YUTA 5LP6F 3IAAA 3PC8C 1M2OA 3AX6A 4K3UA 1O4VA 1Z26A 4JU8A 4FT2A 1Y6ZA 2VT3A 1ZO8A 3V8RA 2H4HA 2JFWA 3B1ZA 3IAXA 4OHBA 5ANRB 4E5MA 5HKBA 2W2MA 2ADFA 1N4DA 2CNWA 1RC1A 3FFWA 4XIJA 4F46A 2P2YA 4G8BA 2XCOA 5E7JA 5JFGA 2G72A 4MZXA 1X3SA 3FWPA 3RYIB 3L5OA 4DCPA 3EJ6A 5DTQA 2MYTA 4B09A 2Q3BA 3HU5A 3EWAA 4L5BA 3FM9A 4B75A 3WQQA 1T1SA 1O6GA 3AHDA 5CBPB 2G4LA 3INYA 1ZM3A 4BV2A 2R86A 1AKNA 4FNOA 4A0SA 3TLYA 2IH2A 1Q77A 1K88A 1H2EA 1U6IA 2DQZA 2I87A 1SHKA 5E3HA 4QHSA 4AMBA 1N5MA 1IY1A 2Z1DA 3RANA 3FI9A 2WAMA 1IXYA 1GM5A 2O54A 1TUIA 2A58A 1XMOB 3K0FA 1KYIA 5HUQA 2HHLA 3B6JA 3TFOA 2BT4A 3TJMA 2H7XA 1YR3A 4N8DA 5A5DA 1ST2A 2DAPA 4F2GA 1IJKA 1MX5A 4HDCA 4WLFA 4P5EA 2GZMA 1KARA 4W9NC 4PAQA 1N36B 1SMKA 1YVEI 5M29A 4FWBA 3O83A 4BO0A 1RLMA 1QQAA 1M1YA 4YUVA 3ZXSA 1ZKDA 2XMSA 4IINA 2VNAA 4L76A 2OHFA 5CCBA 3FH0A 1Y5NA 5LNK6 4OHKA 5BMVB 2FPGA 1GZHB 2OXFA 1ZP6A 2VL7A 4S0ZA 3OE7D 3H9QA 3GGSA 3IV6A 4H6WA 5SZIA 3LX6A 2WD7A 3IAEA 3T3HA 4AG6A 1VDZA 3R5TA 4KOAA 4AZWA 1ML3A 2CJYA 1WQ4A 1U0JA 2FEKA 3HBAA 4L02A 5DX0A 3RROA 4WCFC 2FUKA 3SZGA 3WVNA 1YSCA 4KFUA 4BFWA 5ECWA 3OTOB 1EUDB 1T25A 3AP3A 2O1SA 1OJ7A 3L77A 4WT7A 4ECAA 4M8IA 2X0EA 2OV6A 5BUQA 5F51A 5CB0A 4RCZA 1X7HA 3KT0A 3L1HA 3Q11A 5ALKA 3H8SA 5EQFA 3VUEA 1VG0B 4B33A 4AQDA 4DRZA 2V54A 1ZCJA 2EATA 1NLYA 2OHVA 2OTCA 3LUFA 4FMDF 3M1YA 4KU4A 4U7GA 1I36A 1X77A 3KKLA 4M9CA 4P93A 3UXEA 4X8MA 4ZWNA 4UM5A 1OXKB 4XFDA 3WTBA 4EJFA 1NW9B 2ATIA 3OWHA 2VBIA 3U3JA 4D4IA 1I5EA 5DH9A 4OHFA 1WW3A 3DTVD 1YZFA 2PLWA 3KZOA 3BJZA 1L3CA 1QG2A 1T8RA 1UBLS 2ZJ3A 3MCWA 3EGVA 5E4FA 4MVXA 5EGNA 1VLVA 2HUPA 5LQJA 3Q8MA 5DX8A 2HU2A 2EJCA 1QM5A 5A5VA 4MO9A 4DCGA 4TRJA 1G20B 3MS7A 4KC0A 3EZFA 4NVRA 4IIFA 1DKUA 3IEPA 3CLKA 3PZRA 4G6ZA 4M8KA 1EKXA 4DCCA 2PO5A 4X1KB 4DIDA 4RIIA 3RU7A 1LQUA 1YRWA 2GEKA 5FFNA 3UGJA 3GRRA 4EFMA 1LTQA 3WBBA 1UM8A 4PONA 3IP8A 4QHTA 3MERA 4LY0A 3ZY5A 2QRQA 4HLQB 4YNBA 5F5NA 4ASUD 1ONOA 3LRTA 2QN1A 4KI7A 4FKZA 3KHSA 1ZN2A 4C0AC 2PJRA 5A71A 2WJHA 1KXJA 1FDTA 3PE6A 4QPDA 3M6MD 4LHZA 1IWBB 1NQTA 1NQVA 1Q7EA 4OJKA 4IIGA 1FFSA 1XQYA 4IM7A 5TGTA 3RF7A 1ADCA 1WWKA 1KY3A 3S40A 3E5HA 1IVSA 3P0HA 2CDCA 4RA6A 2C9OA 1VBMA 1LFDB 4LC1A 1AQLA 3H2ZA 1P9OA 2G5TA 4QOFA 1HH4A 4CEIA 1TAUA 2ECKA 2Z30A 2GX6A 4UTVA 4FYMA 1X7YA 3UXYA 3NETA 5C1OA 1P0CA 2OORC 4CN8A 1N7HA 3IUSA 1F38A 4UVGA 3CX8A 4P3XA 2V7GA 4F8JA 1ZI8A 3PJDA 1PK8A 1T5OA 3PF9A 2PUJA 2YNMA 3OMWA 3W04A 4FFBB 1TZCA 4NABA 2YRFA 4V2UA 5CDHA 5HM6A 1XVAA 2Q1WA 1U8TA 4YAJA 3RVKA 5K45A 1QVAA 5DNVA 3A1CA 2Q49A 3BMNB 1XTUA 4RTMA 5FTLA 3EVCA 1GNRA 3BX1A 4L51A 2J3EA 1XHFA 4XOIA 1M5TA 1OLSA 4P31A 1U2GA 4WW0A 5FHRA 2PSFA 4WFQA 1ECJA 4RA9A 5JVDB 5JH7B 4YRDA 3O74A 5E6UA 3RS5A 4FQ5A 1KMHB 4S1WA 2CC2A 5AFSA 4H1TA 4ER5A 4EHAA 5HIJA 3HFSA 4DT1A 1TMGE 2YZKA 4DANA 3IVCA 4YP7A 2WIDA 2IHTA 3IKLA 1EZ4A 1HFJA 1JBKA 1JU4A 4MGYR 3SEAA 1ZX1A 1IHUA 2JIMA 2V7VA 4KE7A 2FR8C 5EXSA 4DIOA 1EG2A 2AQ8A 1D2AA 1G60A 3GRAA 5DBFA 3O73A 1B00A 1DP4A 3DBVO 1T2VA 5TGDA 1G42A 2DWOA 4F7WA 3R3JA 2YJ3A 2IPOA 1GZ6A 1U0NA 5LYJA 4H6VA 2Q9BA 3WQHA 4ZANA 5ED0A 1UPBA 1DWQA 2F3RA 2CMGA 2OKGA 4JLSA 4R9RA 3GLGE 1M2HA 2CVOA 2WM8A 3CONA 3LGSA 3Q9UA 5HIAA 4FE7A 1YR9A 2A0KA 2N46A 2P6NA 1NP6A 1T1EA 1Z12A 4CF5A 4IZHA 4UAUA 4PC3A 3AR7A 4AJEA 3ZWAA 5K0CA 4TRMA 1KAMA 1RHKA 1KKLA 3THYA 5FXMA 1ZRNA 4TVKA 3ZCRA 3NAQA 4G86A 5DLYA 2V6FA 2ZUTA 1MOPA 2PS0A 4FONA 4HQ6A 4Z9YA 4AJIA 4ZIRA 5TPWA 4WY5A 3O3NB 3VZBA 3KETA 2FPIA 1UT6A 3G8BA 3F47A 1I33A 1WHTA 5A6SA 5E7QA 3L7BA 2ET6A 3TPFA 4PQYA 1C8KA 3P0IA 2FNAA 4MW4A 3HBFA 4W63A 2OB1A 3BSFA 2L18A 3RRBA 3RUIA 3KZNA 3UMVA 3V8EA 1NBIA 1NV8A 4NL4H 2JEYA 2PU5A 3HVHA 3KT3A 4FZ3A 2HA4A 4LOAA 1PK7A 3JWJA 2H65A 4RJKA 5JNWA 1J7KA 1VE3A 2H2HA 3A04A 3HJAA 2BH9A 4GMGA 1GZ5A 1XXHE 4WLVA 1KYYA 2XSZA 4FDAA 1N33B 1CZHA 2KW5A 5JJ5A 4PAMA 1TTTA 4FE3A 2P41A 3D43A 1JFFB 4WK6A 1YDWA 3FB1A 3T38A 1UWLA 2ZU6A 3L6BA 2I29A 3G0IA 1IDOA 4EUSA 3EH1A 1Z2DA 5JDCA 2ISQA 1CUUA 3CCFA 5EXDA 2W0MA 1JQAA 3NV7A 5D00A 3ZIUA 4B4KA 2H7CA 1BEZA 1RJFA 2VVTA 3E7PA 3GRZA 3HCRA 3KPUA 1Z2OX 4HSGA 2XAAA 4MPJA 4EECA 5JMTA 2OO7A 1YACA 5KVSA 1QH8B 2L69A 5AJWA 4KPGA 2R1UA 2QN6A 1Y3DE 1SC1A 2ZYDA 1D4ZA 1F6BA 1KYWA 1IHXA 4C5BA 1H5UA 4IWNA 4DIEA 3UT6A 4GP9A 5LNK1 1RRCA 4J2TA 1A1SA 1L5GB 3VYSB 1FNMA 3U56A 3K0BA 4BHTA 2H1WA 4KMOA 3I5MA 4DRXB 4WJLA 1G5IA 1MX3A 5AJXA 3K09C 3QUQA 3CMCO 1O03A 1KTIA 1UFKA 3TSWA 1GARA 4R41A 3GDOA 1UP6A 2UZ1A 4JSYA 2RGBA 5JPIA 2LV8A 2KWIA 1Z6TA 4FN4A 4W5NA 2XGOA 2AOUA 4LF4B 2IYRA 3W4IA 3SC3A 2PXXA 1GA6A 3ECCA 3F7OA 2AC4A 2BJVA 3OAAA 5BWLA 1YQUA 4B82A 4LJAA 3WTCA 4CIXA 1NRWA 3CUVA 3CY6A 3BORA 2CDBA 2KLHA 2ZTLA 5DI3B 5MFZA 3AKYA 4I50B 5EIOA 3USCS 1QX3A 2P78A 1A9XA 4KQWA 2Q7DA 4IH4A 4FHFA 3ZIAA 2J6IA 1J4AA 3FJYA 4KVAA 4XVRA 4RKFA 3UJ7A 4AKIA 1BG6A 3PYXA 2A3NA 3C85A 3CEHA 1SQ6A 1O97C 1H2XA 2R7LA 1XROA 2B5WA 1PCXA 4K6KA 5DHRA 1YU6A 3BHJA 4BYMA 2ZVPX 2E89A 4O59O 1IUKA 1YZYA 2JIRA 3JD4A 1Z22A 2X0NA 2R6ZA 4Q7LA 4YUYA 1LJLA 2CUTA 2FWJA 4GX0A 4XWWA 2GBFA 1XKLA 2XUDA 2J41A 2JHCA 1D2GA 4M7PA 3ZZUA 4C7OB 3AF0A 3HN6A 3ODPA 2CHGA 5IJXA 4UPDA 3U7RA 1EB8A 3C15C 2LCFA 4G5HA 1I7QB 1B7GO 2IZOA 4IOMA 2J85A 3JRWA 3VSDA 2YDYA 2VQEB 2YY7A 4LE1A 4NCBA 3V8MA 3WYAA 1HE1C 1LD3A 2D0IA 2HU8A 3AYXB 3CWQA 3T1VA 5KX5A 4C3OB 4D46A 1SVIA 2P1DA 2P4UA 3MJRA 4G1MB 1UMCB 4LPSA 4X91A 3TI7A 5KOJB 3IAS1 2BR4A 3RT9A 1IN6A 1Z7EA 4BNVA 1EFLA 2B8NA 2IGTA 2NADA 1QHXA 3LYLA 2BEKA 1Z6XA 3VKWA 3FGPA 5B4VA 2QEQA 4TYPA 2VYVA 1U3VA 1EVKA 1P9LA 3OT4A 2ZS8A 1Z36A 1UZAA 3H1EA 5C5EA 3WNCA 3G0HA 2QZ4A 2CJXA 2FSFA 1VSTA 1PUXA 121PA 2HIHA 3KT6A 3OX3A 1L8OA 1H66A 1YE3A 3HUTA 3RK4A 3U62A 4DV7B 2WSMA 1XL1A 1ORRA 3EIFA 4FHZA 3C3PA 4UVEA 1NWCA 5T6MA 2BRUC 2LNDA 3PFIA 1LDNA 3A6ZA 1ISHA 4DL9A 3R7WB 3UHOA 1H0RA 4BMZA 4URVR 1CUGA 4J7CA 5TARA 3I5YA 1Z2CA 3OETA 2YH2A 4RW0A 1N8NA 3ZDFA 5LMCA 1E7MA 1ZU5A 1VHQA 5DBHX 4QG3A 3BH0A 3FR8A 3ZK7A 1NI4A 5EZYF 2AOXA 3UY4A 5BUCA 1HRKA 1JYFA 1CJBA 3RK1A 4RTQA 3ZLJA 1TM2A 3KKNA 4MX8A 3Q7EA 4PC2A 4DLTA 2X5JO 2VDUE 4XB1A 4ER3A 4BBZA 5MF6A 2AE2A 2MIIA 3N8DA 2IE8A 4H17A 4I4NA 4WCDA 3S2ZA 1NVTA 2G7MC 3AFNA 5C4GB 4ZD6A 3WYEA 5BXYA 3C1OA 3D81A 4IIJB 4DM7A 1A2BA 1TIBA 1VLQA 2IOHA 5DBIA 3UQZA 5KTYA 3CJRA 1HETA 4GE3A 3ABSB 4K9RA 5DNEA 3DEJA 2D59A 4EA6A 3B3QA 3LQFA 2W42A 1KC1A 2W48A 3DULA 3VPFA 3ZWYA 3K73O 5DRTA 1TT5A 3ZHXA 4DIUA 1BEEA 1T2EA 5ALTA 4E5UA 3Q2IA 2IYWA 3QVJA 1SWWA 2D5CA 5C1IA 1ZGZA 2WDZA 2E21A 4ZN6A 5I47A 3A0RB 4A1FA 1MORA 1ZMTA 1I4TD 4G67A 1C0KA 3B1JA 4CKWB 2IX9A 3MEQA 4MP6A 2IEDA 4M89A 4Q9NA 4HNUA 5E1DA 2QE6A 4JT4A 1GSAA 3TQOA 1P31A 3KKZA 1RLUA 3AEKA 3W5JA 1ONSA 3B78A 2REQB 5G1OA 2OLKA 3LCMA 4FI3F 2W2VA 2ZBUA 1IM5A 4NCJA 1K0FA 3TZQA 2UUPA 3RHTA 4RDXA 3LVFO 1TVKB 2AFIA 4H31A 5M5BA 1Q21A 1RWVA 5BN1A 3FAKA 3Q6IA 1OU4A 2ZUCA 2NP7A 3DMGA 1EWKA 2OO5A 1MIOB 2MTBA 3ENQA 3PRJA 4J6FA 4OI4A 3IMEA 3DAGA 4YI3A 3OCXA 1U2SA 1GU0A 1Y4AE 5TQ0A 3WGGA 1QAMA 2IITA 5J58A 3D2AA 3KYJB 2X7JA 1PZGA 2B82A 1Y1QA 4MVJM 2NMVA 3MF4A 3WSWA 5AVUA 5KINB 4ILKA 3HZHA 4NULA 4CTMA 4FSXA 4DYVA 1XTZA 4ZAFA 4WOCA 3KUDA 5K6TA 1TA0A 1Z6ZA 4OQMA 4S35A 5JDIC 4QRDA 1YULA 1D6JA 2HSDA 2QTVB 3OPQA 5DOVA 5T8KC 1TX4B 3JXEA 2ZB3A 2HRQA 4WNYA 2NTEA 1E3WA 1LRJA 2X2OA 3EASA 2ZVQX 3IPRA 1ZD2P 1HDCA 4HDKB 4QHYA 4UNQA 3UHFA 5BWMA 3GPLA 1T15A 3A6HA 3VR6H 4KODA 2C1EA 3LA8A 1DJOA 1ORWA 4LF7B 5H68A 3GZNB 1P4GA 1P5HA 1R0KA 4JBIA 4AD8A 4EMSA 3IQZA 2A92A 3MGAA 4MR7A 3DMTC 3JQFC 4RSGA 4DGSA 4E2XA 3QQPA 2EZ4A 1SC4A 2YZNA 1UJMA 5BN3A 4YFVA 4AJ2A 3JTEA 2EWVA 5DWVA 4D6XA 4L74A 3QKSA 2F3PA 4J0IA 2NU8A 5K1ZA 1H2WA 3NEYA 3T5MA 2WVHA 3ESDA 1RXIA 3UJ8A 3DHVA 5HQTA 1DZ3A 3RU3A 1KZGB 3NO4A 3LM8A 1QYVA 4J4HA 5CRIA 4EJ6A 4M86A 5DULA 4IAOA 4Q1BA 3JW8A 2HCBA 2JKYA 3LPMA 2I2BA 5L51A 4U00A 1T9ZA 3QZUA 3ZCUA 1SVUA 4OI0A 4JCOA 1SPBS 4IDNA 3RLFA 4RC9A 3JVIA 1U7XA 1JFVA 1G3QA 2EP5A 3EISA 4RPCA 3OCCA 3SIXA 3DHYA 4MJLA 2NU7B 5DNUA 2QT9A 3HEMA 2FPKA 1FUYB 1HKUA 1R4NA 3DVAB 3A6GA 1DAIA 3ZIDA 5G2OA 3HKDA 2AFHB 1D0VA 3H8JA 4JUCA 3P9IA 2QD3A 1N0VC 1E77A 2OFXA 2BELA 5B3JC 3ORQA 4I4TF 4CR8A 2H9AA 2Q2OA 3OQMA 1Z33A 1QQ6A 4Q5IA 4L9WA 3EYWA 2PSHA 4N65A 2BFBA 5BQOA 4Y2QA 2BF7A 4B2LA 1BOFA 4RZHA 4WPGA 5FOQA 5ESWA 5KKCA 5IK2A 3T4UA 3NC0C 3KJGA 1KRXA 1H94A 2XZDA 1JIKA 3KD2A 5JMWA 3P97A 4RV5A 5EE9A 1FXSA 5JBQA 1VYHA 1LU9A 2JFVA 3GRFA 4A7PA 3TLBA 3PQDA 2JKVA 4HVLA 2DP4E 5JQGB 4E2YA 1NJ5A 1ZW1A 1KAGA 4P35A 3T52A 4ALJA 2YV3A 1NUSA 4RSHA 4P22A 1M2OB 1VJ0A 2A0YA 2EIXA 1XJ0A 4YRBA 3O21A 2PVCA 5HNKA 4CU5A 2IZ5A 2Y6VA 2CYAA 3W3AH 2BW0A 3G02A 2ALJA 1YBFA 2OT3B 4V1CI 5J43A 2R2GA 5FOSA 3EW9A 4X1YA 2GFIA 1K06A 1PGJA 1HDGO 5IJAA 2J5RA 4H35A 1NP3A 3KVRA 2AKEA 2PYZA 1DDGA 2RB5A 2A5DA 3VU8A 1WNTA 3CS3A 1G8MA 2ZIAA 2GUWA 2ZWVA 3DUWA 1LC0A 2QX6A 3FTPA 2ZI9A 3BFVA 3BGOS 3IC5A 4I1VA 4EABA 6LDHA 4BV8A 1AHPA 2BLLA 2P91A 4LOJA 5JJLA 1K7SN 3LP6A 4PIVA 1BXRA 1IK6A 1FTWA 3AF2A 5A7GA 2EJUA 3BTSA 1VP3A 2WAYA 3W1VA 4L3VA 4OGKA 1DLJA 4Q7EA 4IGFA 4WSOA 5DGIA 1L4EA 1HSOA 3U7IA 2X14A 3LY8A 4P80A 2IXFA 3JQBA 2LUOA 1E5TA 1IG3A 4JCCA 3RSOA 1RHJA 2A9PA 2YMLA 3K0FB 4HYTA 3QLEA 2WI8A 1PBNA 3HADA 3HKCB 1R50A 3MN1A 4KO2S 5J1TB 3SSNA 1AQIA 1UJCA 2BEVA 4F3KA 2WKSA 4KN8A 2G9QA 4OJQA 4M55A 2QLFA 4IFIA 1WUJS 3BSWA 2CL7X 4ARUA 2GEFA 4QU5A 1IU9A 1LI5A 3KXKA 3FYCA 3MSCA 4D98A 1VPEA 2XWBF 3VQTA 1M1YB 4YC7A 4DLXA 3AUSA 1AHIA 1Z4OA 4N3AA 3WRXC 2WJJA 4MJXA 1J0XO 2FPGB 1F4VA 1UIRA 4HOYA 4MVJP 2WY2D 1Y7LA 1LZLA 3PFHA 1O95D 1BX3A 1NXSA 3VH2A 3NM4A 2WD7B 2QD1A 1AOXA 2B78A 2WT4A 1A4XA 4PR0A 2PGDA 4XGIA 4ZT7A 4WBNB 2DKNA 4PCLA 4QO7A 1LSJA 5E38A 3TX6A 4DG5A 2ID9A 2WICA 1J00A 3V1MA 3FUXA 2GWRA 3JYLA 4NHOA 4DR3B 3HYRA 1K6MA 4OPMA 4XTCS 3QPAA 1T2DA 4Q9DA 4TUYA 2WFMA 1YS1X 4ZVKA 3LK6A 1YK1A 3HEBA 4KR2A 5AH0A 4DSTA 2VJLA 2RK6A 1UMKA 1A71A 1VGQA 2JGEA 1LA2A 1I2BA 4AI6A 1TPYA 2I7DA 2ZR0A 4PYQA 3IQDB 3UWKA 4CRWB 3O91A 3Q88A 3CB4A 3IBTA 3LDAA 1UKAA 2I7VA 5TIIA 2ZJAA 3DFKA 3PIRA 2WP0A 3LUDA 1QSGA 2JCBA 3IR6A 4X1OA 3PLAE 2VNJA 3LW8A 3VJLA 5LOVF 1P75A 4ZVTA 4HNVA 4D9IA 1L2TA 1CY2A 2PUFA 4MRMA 1FIUA 4IILA 1E20A 5E7MA 3UMGA 5KDDA 1MQSA 4L8FA 4QG7A 2JZCA 1V2HE 3WB0A 2BR5A 4J8PA 3FNQA 2GBLC 1H05A 3GAAA 3V7FA 1Z88A 4G3XA 4GO1A 3LWNA 1LGYA 1V4NA 2WKQA 5IUJC 3TW4A 4QJ5A 4PX3A 1W2WB 3RYCB 3OHSX 1Q83A 1XK6A 1TO2E 2D5IA 4LE2A 3U37A 2NVUB 4FXOA 3OTGA 5JPCA 2B3DA 3K31A 1F2TB 4R3UC 4TQAA 4RBNA 5F1YA 5ELLA 5IF3A 3AEZA 2J1LA 1TUBA 2HZ7A 2JH3A 2XGGA 3FTDA 2AS0A 5ALZA 4CNQA 4Q4CA 1SC9A 1TIPA 2XW6A 3D3WB 4RA6B 2WUDA 3HBNA 2FSVA 3DYBA 2YHIA 4E33A 5KTNA 4JASB 1YZNA 2C2OA 2EX0A 4MLCA 1X7YB 4QJ3A 3ZDDA 3DV0A 1BNCA 4UUNA 1NUPA 1BKYA 1GDDA 4HZIA 4J0JA 4BEWA 3R9XB 2JDID 4CM1A 4DLYA 3TG8A 1Y89A 2EZ9A 3LDFA 4QXMA 2IEYA 4BFTA 1KO7A 2Q6VA 3GP3A 1E1RD 4TYMA 3ZHOA 4F96A 2JC3A 1F51E 2QTHA 1FMCA 1KHTA 3IIMA 1G59A 2UYHA 3GLHA 5EYPB 2CHFA 3QVLA 3PNMA 4YRSA 2JGAA 4XRRA 3LX5A 5HUHA 3C43A 1RM5A 1W76A 2OCLA 2WFAA 4J1QA 5CA1A 1GG2A 1VC2A 2IZ0A 3AV3A 3RRJA 4RVFA 1MC1A 2Z5FA 1LVUA 3PUWA 4OJNA 4Y9RA 3KQNA 1OLSB 1P1CA 4FJ2A 2GJSA 4RA9B 2Z4RA 1DC6A 3AY7A 5K3BA 4J03A 4XCXA 1P1RA 1TYEB 2IYVA 1T35A 5CIWA 3KAQA 4HWRA 2N0SA 2RE8A 3TZKA 1F8XA 3JYOA 4A15A 4DT1B 3K70C 1S3FA 1U0SY 1QPGA 2H07A 1ESZA 1SKBA 1WNFA 1FX0B 5I9NA 5CXUA 1FE8A 3B5EA 4FLFA 4TKZA 4J7XA 3DDUA 4M9UA 5LZ4A 1UDAA 2PA3A 4NZZA 1R5BA 1D2CA 4FGZA 2IHBA 2OP0A 4LISA 5FNVA 5IUKC 1MC5A 3TBFA 3DBIA 3R41A 4COKA 5BVHA 5C4IA 2CFCA 1PZNA 3AB3A 5AVKA 4YEDA 2D1QA 1V5IA 1IY9A 2HX1A 4FNAA 1JJBA 4RS4A 4Z0TA 1PEDA 2ZRIA 1L1FA 4D5EA 1KF0A 4MP8A 3WGOA 2HF2A 1P5JA 3RM3A 2IPNA 4U8HA 4JYBA 1UZMA 4MRVA 4KBYA 4OGLA 3A9WA 2OV8A 4UHEA 4EELA 2G9RA 3BZUA 3THYB 2EERA 1NW7A 3HJFA 5BWNA 1ZRSA 3DCYA 3DXZA 3CUEF 4Q7MB 1SXJA 3L02A 5GADl 4DQVA 3EC7A 1GYPA 5EJ5A 4A6PA 4YP5A 3TCNA 2B36A 2P4SA 3FKQA 3SQXA 1RRKA 4M54A 1VCNA 1V9CA 1PFKA 2PCJA 3IP5A 3N2ZB 1NR1A 2VH5R 1A2OA 2FPIB 4K8RB 3WLRA 1EZ1A 1KDOA 2DFDA 1DAHA 4WI1A 4BX3A 1PFGA 1ZGJA 3MGKA 2YYSA 3M6IA 2VJOA 4H1HA 1YDHA 2HJVA 1H2ZA 2JAXA 2AR0A 4MIKA 2JFBA 5BV0A 5CA1F 5EHGA 3RJMA 4C21A 4DM3A 4N49A 2II6A 4ER6A 3LUCA 5JATA 3AR9A 5THKA 2JEZA 3AFHA 3KJFA 4URHA 1C8VB 2Z9BA 4I2VA 3X1JA 3DOIA 4JUDX 4L22A 3U1VA 1XMQB 1AK2A 2QR3A 3NORA 2JIOA 1V0JA 3GXOA 3M89A 4PZCA 5C1PA 3EBPA 4IF4A 4IOKA 5B58T 1ZPDA 3LC1O 5LMZA 1DRVA 1NAHA 2FEWB 3RS2A 3LQ2A 4IYRA 1GAEO 5DHPA 3ZV7A 4EVSA 1TU3A 3NLLA 4PQFA 3VDRA 4HNTA 3SF8A 5LZ2A 3DE0X 1BDMA 3SJUA 4B2IA 2XCSB 1Y82A 2R60A 1X7ZA 3G8DA 2H1HA 1GU1A 3VU9A 4C30A 1GUYA 3E27A 4HTFA 1UP7A 3DO5A 3N2LA 1A82A 3N5KA 4F85A 3VR3A 4NS1A 1R8QA 3E1GA 1J8MF 4UHFA 1SULA 1FRZA 5IVDA 1QHFA 2JIDA 2PMCA 4QXAA 3BRQA 3S2FA 3PUJA 5EIAA 4KYVA 1TD1A 4TN1A 3HV0A 2Y9MB 3W4JA 3OOEA 3ZI4A 3NHRA 2VHQA 2BI7A 2DFKB 2XECA 2ZJBA 2Y1EA 1JHRA 4FK8A 5IM4A 1NFQA 1ZVJA 4FM9A 2YVKA 2UZ1B 3RB8A 5IXSA 3AR2A 5K3DA 2XZOA 1K4KA 1P1HA 1BS9A 4EY6A 1FS6A 2AOUB 2AG1A 2ZI6A 3CEPB 3I9FA 3NTQA 4FCWA 1G8FA 4N0PA 5AMXA 3TEMA 2X76A 4Q16A 4BMXA 2JH8A 4IY1A 3H5TA 3PT9A 1XA3A 1Z9BA 3ME5A 2OZLA 2XB2A 1QQTA 5B30A 3NVKI 1EGQA 4W1QA 4TM8A 3UAWA 1XJWA 4G4JA 4M9RA 2JFYA 3KXDA 1N0HA 2IOQA 1ZXBA 1VL8A 1XQ9A 3M8KA 4KR7A 3OUTA 4AK9A 1NKVA 3R7FA 4YMVA 1P44A 4TMYA 2C0PA 1RM3A 2O5RA 2ZB7A 5E8JA 4XWOA 3SP1A 1EFAA 3SQNA 4C3ZA 1U8XX 4TQGA 2C8VA 1K0UA 2P2GA 1XVLA 1NX6A 1ZJ5A 2NYVA 1NZJA 3WQSB 2VUHB 4UHBA 2G1UA 3F6YA 1O89A 1RKQA 1Y34E 1NIPA 2J07A 2C5LA 1OIXA 5DN6D 2SBTA 3DLCA 1U8AA 3EE6A 3FTQA 2CVZA 2WIJA 3PNLA 4I5FA 2DHDA 2VYNA 1J8DA 3AHHA 1JKFA 3EEQA 2GN1A 2ZUFA 1J2TA 1VI5A 3B5JA 1ECBA 5SZJA 2Y9PB 3E8MA 4J29A 1K89A 5TSDA 4NV0A 1VL1A 4BMCA 5BYKA 5FOTA 3WMWA 5T64A 4FN5A 4AN1A 4PYOA 4ZTZB 4KPYA 1U2DC 3NX4A 1FYDA 5B12A 5KTTA 2REBA 4QJBA 5A3RA 3KWMA 1OE0A 3LUKA 3B8EA 4KQXA 1B8NA 4LMAA 5EHQA 1MPXA 3WO0A 1X7XA 3GQBB 3IR7A 4I2NA 1ZVMA 4FOOA 1SR8A 5BSTA 5LZ7A 5BSRA 4DIFA 2I99A 1TF5A 1DBSA 2WMNB 2Q9CA 2E87A 1UBKS 1JR4A 1Q0TA 1CJMA 2VFAA 5I9SA 1VG8A 5IYZF 4KO1S 3DLBA 2DPGA 2Z2ZA 3CKYA 3PXDA 1FB5A 5EIXA 3LO5A 1OYWA 3R7SA 4I9HA 5FBVB 3P52A 5D87A 4OU4A 4FGUA 3AZQA 4HATA 2WHPA 4CGZA 4Y2PA 1W75A 2IYAA 2O2ZA 3R9KA 5B57C 3WMEA 3JQ6A 4CKXA 4U7FA 3NOQA 3RAFC 3HDVA 4N5LA 3FVVA 4F21A 5BUZA 2F59A 5LWQA 4FFWA 3BYZA 3RV3A 4O4IA 1FRNA 2FFAA 3TR5A 4JA2A 2VXBA 1HQCA 2BPOA 4JSRA 3TB6A 3O8LA 3ZWPA 5M7EA 3M6AA 5F9HA 3EPHA 4JV5B 1U7UA 1IZZA 2Y93A 4XPIA 1P9RA 1VE5A 3R3WA 3RSGA 1MIHA 2CW5A 2ZBGA 5AXDA 1EEXB 4K03A 3GPBA 1CJUC 3PQFA 4I1PA 5BWCA 1AY0A 3U4CA 2VF8A 3B82A 1SUAA 1L7MA 1LSSA 4K9LA 2WAXA 5J9FA 3JWIA 2XDQA 5JAQA 3M2PA 4AZ0A 5K8TA 1PHPA 1XEWX 1ZUIA 1ZQ9A 3AB7A 1Y5RA 3GLTA 1FSGA 3EUAA 3FI0A 1K98A 3GH1A 4OJYA 4RF2A 4Q6BA 5TVKA 3RJ9A 5JI3E 1X70A 5HF9A 3L1KA 3P0FA 4WESA 4YACA 1NMQA 1ZNQO 2AFHE 2X42A 2FSIA 4QXPA 2P5SA 2HWXA 1UXHA 4YCDA 1WETA 2D1TA 2BONA 3P0RA 5T5QA 5KOIA 4QYMA 2WJ4A 3BULA 4IXNA 3OA2A 4QUKA 3WMXA 2O0KA 3DFZA 1MO4A 3FLAA 4G5OA 1GVHA 3GBVA 5JJCA 2CF6A 4GHWA 3FLMA 1NASA 4EA7A 10MHA 3W9SA 1U5CA 1X13A 3WBFA 2CXNA 2C0QA 3EODA 1BCRA 3L82B 2G63A 1BQ3A 2EIHA 4NPAA 1TT5B 3A1NA 4WOKA 5IP5A 1I14A 5BSMA 3PQEA 5JLAA 2CGEA 5CK5A 3WJ2A 4NZPA 5HMMA 1VPDA 3MSXA 3PL1A 1EDBA 1LFAA 4QFDA 1EDDA 3A27A 1M83A 2HLDA 2ON6A 3IVMA 2BF4A 4CHGA 7ADHA 3DFIA 4JYPA 4KIUA 1UANA 3KZCA 2DLDA 4WBXC 1E3EA 5CA0F 2RGWA 1KDVA 3L7NA 3KPYA 4C0XA 5HPYB 4BVKA 4DAEA 4D8WA 3K0CC 4R8VA 1KU0A 4XH9B 2FXVA 3AEKB 5JBNA 1IYZA 2DT5A 3IPCA 5I8ZA 4S2EA 1SIBE 4DJTA 4I1OA 1OXTA 2BJHA 2HBRA 4JBXA 1TUGA 2OHOA 3FDXA 2AFIB 3HLTA 3GCWA 4WTOA 5D3QA 5F64A 3V33A 1HZJA 1MUUA 2WR8A 4Y6OA 1PR0A 3ITKA 1HTBA 2I8AA 2JASA 2GOYA 5CD1A 4RK5A 5CB4B 2Z5GA 5GJVC 4CMEA 1JHYA 3I23A 1Y5IA 3KQWA 5TQ0B 1C7QA 1LPOA 4TV8A 4DLNA 3U4MA 1QYXA 1PW5A 3I2HA 4TVOA 1C80A 2WEKA 3DE3X 3DHNA 4ZTBA 3GEEA 4AL4A 1BN7A 4B7UA 5AVWA 3SVTA 3L4EA 3HSSA 3DM5A 4JMLA 1Y8CA 3VGPA 1UC9A 2ZJ0A 3EG5A 3C6QA 4BL5A 1CNFA 2F7SA 3IULA 1OOEA 2FW1A 1RAIA 2YZ7A 3MRTA 4NBUA 4CIDA 5DHQA 5L9AA 2D54A 1E3WB 1QK3A 4RFLA 5E6RA 1W0JD 3KQYA 1DT3A 4JGGA 4BTLA 4HHEA 1USIA 1DCTA 4JLJA 4JGIA 5FB3A 4KSBA 2G70A 2G09A 4UCXA 1C3XA 4RTSA 4MR7B 4HDAA 2GEJA 4BJ5A 2DSTA 2HT6A 1NVUQ 4BCBA 1IPFA 1MAUA 4IYJA 3I9V1 5BN3B 1R6AA 2BYTA 4QVGA 1YD7A 2I6UA 1W36B 3QKSB 1N3IA 2OQRA 1Z38A 5LUAA 3RUAA 1XI2A 2C7VA 2NU8B 4WKPA 3M5DA 1DCKA 4ARZA 1CV2A 3OMXA 4KE8A 5IBCA 2B7BA 4L6AA 5I7FA 4B17A 2PGIA 2DX7A 1X0VA 1CD5A 3MGBA 4MINA 3IKMB 4OQLA 2NO9A 3FTEA 4KZPA 3O1LA 4ALMA 2X2EA 4D4KA 1GCOA 3HA2A 3TEFA 2A14A 3DEFA 5EJ6A 4AROA 3AINA 3FOBA 4YXFA 5B36A 3F8TA 1QGAA 3UGTA 1XA4A 3Q3JB 4LVUA 4EPYA 2D0DA 4W9RA 1R4NB 3ETCA 1DI0A 4IZ6A 5EIFA 4YRIA 2FZ4A 2PXCA 1P29A 1L5RA 1RZRD 3GWGA 2FWMX 1E1NA 2BCJQ 1G2IA 2EJBA 2ZCVA 2ZETA 1EXMA 5C32A 5DYYA 1ZFNA 5B7NA 3RVNA 3U4HA 1N2SA 2C7PA 1E9CA 2VF2A 1Y80A 4FZRA 2WTBA 1IWPB 4MQ6A 2BC9A 4AKTA 1P7PA 1YL6A 3IKVA 4JJ8A 3VKHA 1BXGB 1KBOA 1CX9B 2JJYA 3CWZA 2ORED 2FQQA 3DJFA 1BFKA 3MUOA 4AECA 3F1LA 3R40A 1T0JB 2XWJI 3E84A 5TS2A 3O90A 3ZWCA 5I7HA 1XJ5A 3ZG6A 3C4VA 3HVRA 2BEWA 1E4OA 3I92A 4D8YA 3NPAA 4BASA 1UT5A 2PH3A 3PR1A 2O1EA 4C4RA 4ITUA 4HMPA 3RVRA 2VHYA 4CLOA 1ZGAA 2GARA 5ENZA 4WMLA 3L0DA 4MQFB 4MUNA 4OF4A 5LFAA 1LS1A 3ZE6A 1B3RA 3NASA 4BC1A 1C7IA 4DIMA 3ZXUB 1W94A 2DB3A 3ZNPA 1GL3A 4DS3A 3MJVA 3C3YA 1KI7A 4BU0A 1UXOA 4EW1A 1IVNA 2IYXA 1SU4A 3IJ5A 4NV1A 1XMIA 4LW8A 2OYSA 2YWEA 4OAQA 4UMVA 3RRZA 2R00A 2VDOB 4MWDA 4KACA 1EFTA 5L45A 3I0ZA 3PPIA 4DLPA 3NHBA 4U2EA 3S2UA 1USUA 3N28A 4ZVLA 5CP8A 5I45A 1CUDA 1B74A 3HXKA 3HNRA 1EPUA 1SBNE 1CXZA 4JYCA 1P6XA 2BBSA 4JHLA 1XD8A 3FSJX 4JWTA 4LJ8A 4BAGA 1CF4A 4YAEA 1RZUA 2UUOA 3K9BA 3JR3A 1BXRB 4UVDA 3ONNA 2IY9A 4OHWA 2ZRLA 5AW3A 1VRWA 3FPCA 4E15A 2X8BA 3CNLA 4YP0A 3SIRA 4UOEA 1RE1A 2HA7A 2YBDA 1H2BA 2RHWA 1AHHA 4UM9D 2O4CA 2WT8A 4XB6B 5I3ZA 3R7DA 1HL3A 3GJ4A 3G2NA 9MHTA 3ND6A 3MBKA 3SF0A 1Q0QA 2C29D 1UKEA 1EJBA 1U8CB 2XVAA 4I81A 4JP8A 1SBZA 3I73A 1MVLA 3N8GA 1IONA 2OCXA 4RORA 1B26A 1W9HA 1WSAA 2E4YA 2PGNA 2QL9A 3K0EA 4KKVA 5AKYA 4LAFA 1SK9A 2ZB8A 4JIMA 1PYOA 1Y4SA 3EZLA 2GNAA 3HR8A 3KSMA 3M2TA 4RVHA 4BYGA 4YALA 3WGZA 4CODB 2Z04A 4U5QA 3S5UA 2CXXA 2FYTA 1D9ZA 3H9UA 4LXIA 5A2QA 2BGLA 3OX1A 2C88A 2WYUA 4Q3AA 1L5MA 5K9ZA 4HMQA 5JO9A 1DU4A 2XUFA 5IG2A 2OGWA 4JR2A 2TECE 2YJNA 1JVNA 3ZN2A 2G83A 1B76A 1D0SA 2QTLA 2HADA 1CUEA 4KX5A 4M1WA 2BM1A 2VCHA 4QULA 4TUYB 5AM3A 5HVNA 1UQTA 4IHJA 3PUHA 4HAVA 1RLTA 1T36A 5JSQA 3CGGA 2E5FA 1FNNA 4Q3EA 1D4FA 4N5NA 4LQLA 1R8YA 4MS3B 2WG0A 1SG0A 1KQPA 4NV3A 4RVSA 1K6JA 1KDPA 1X8LA 3NT2A 4B4OA 5CT6A 2XRZA 1W0KA 3KSRA 5FBQB 1NRJB 3QEAZ 2NQ2C 1V5FA 4AJPA 1X7DA 2FG6C 4BQQA 4X5OA 2FEXA 3S2SA 3PICA 1PS0A 3CN7A 4Q1VA 5HFNA 3U0BA 5AHXA 2HHHB 3LUPA 2P9HA 3OZCA 4P7KA 3GO4A 2IPAB 1OKKD 1T0IA 3KQQA 3AHCA 3L01A 2VCEA 1PJLA 3L8ZA 4OKSA 2HFJA 2B94A 5FV4A 1IFXA 1W4BA 1Q1ZA 4D9FA 1QFJA 1YB4A 1L5NA 3T4EA 3PA6A 5KOHA 2GPWA 2I9PA 3I30X 2APJA 1FYVA 5C1BA 3SKVA 1Q14A 3JQQA 2AD5A 3O4IA 4UULA 1VPWA 1B4DA 1L8AA 2XT0A 1DRWA 5ED4A 4ALLA 3QP9A 2D6FA 3WRYA 1QG6A 2AR9A 2DKOA 5ECGC 2FFJA 3TRIA 1C9YA 2RHGB 1HEYA 2XITA 3AHGA 2IC5A 3NTRA 3GNTA 1Y8QB 2I2CA 1Z7GA 1HQKA 3IKTA 1QP4A 3FPKA 4CN9A 1KA9H 4PHHA 1M2EA 4A0QA 2Z3ZA 1TUBB 3N7AA 1LWOA 3TCKA 1ZOSA 4TKUA 2NG1A 4Z2AA 1TYCA 2OGSA 3BH6A 3PXCX 4OQDA 1J49A 1IC6A 4RPKA 1NULA 2YHIB 3TOSA 2XNSA 4JJEA 2BFPA 2PRIA 3IEIA 4IUBS 1SRQA 3PC3A 4WE3A 5HBRA 3WWCA 1GNTA 4OHMA 2G36A 2YJ5A 3PQ8A 4J0CA 5IM5A 4L8WB 4Q93A 1LDGA 4HAZA 5ULLA 3PRHA 3NTXA 2C20A 3N6RA 3ESYA 1N77A 3KJEA 1Y3CE 2I6QA 5CYOA 3WLFA 1PJ2A 1XZDA 1JT2A 3A2LA 3GUUA 2GHRA 3PE4A 3GLHB 1E18A 1U99A 1FSFA 3SFZA 1QCZA 1BQEA 1E64A 2HNKA 1BDIA 3CW9A 3LWZA 2ZFUA 4QJIA 5JR3A 4CW7A 2QIOA 3I34X 5EQTA 1Z5ZA 3IEKA 3PDWA 2R1ZA 5FBWB 3V3KA 1ZBQA 4OM8A 2NOAA 2PKQO 2YQ4A 4G63A 5IJZA 3U44B 1JR3A 3E53A 4MYCA 1OBOA 2FW0A 2Y1XA 3LCVB 2V0NA 1AX9A 3OESA 1SK8A 4Q4AA 1ID1A 1UBSB 1WXFA 5AUNB 4HK4A 2VHWA 2QPTA 2I2AA 3LQYA 2VBGA 2GETA 1M1UA 4JBGA 2FPSA 5IANA 4W5OA 3V8QA 3Q3CA 1J2RA 4XCVA 5KYYA 3ETDA 1E9AA 2QVCA 3GW8A 5FL7D 5BVHB 3KXLA 2I4OA 2G7ZA 4F3NA 2OZEA 3JZMA 1VL0A 2V3VA 3MBOA 2ECFA 2QD4A 4D4HA 2WUWE 4XOUA 4WVFA 4R83A 1GCUA 3SJ7A 1XN1A 3ON5A 3VZPA 2OGTA 4MW2A 3ZDRA 5KSZA 2XNKA 3O2QB 2CB0A 1HLPA 1ZHHA 2B37A 2CMFA 3CURA 4RH3A 3HA7A 1KQ3A 2CEAA 4KQ2A 5LA6F 1SXJB 1WUIS 4OLAA 2R4QA 2GYYA 1XG5A 3C8HA 3T9FA 2AYXA 5BW5A 2FG7C 4JLDA 2UVPA 4M0DA 3DMHA 4RIEA 4TV9F 1T2UA 3CMMA 3R7AA 3QK7A 3OH8A 4LHXA 4DA9A 5JAMA 2C3OA 2PLNA 1VJRA 1JHOA 1Q95A 2JGMA 3EQ2A 3I1IA 5DWDA 5G4KA 2XVZA 1MAHA 2X13A 2XYVA 1UBMS 3BXZA 4OHRA 1B2RA 4DLSA 2ZGVA 2GYWA 2N47A 1QMPA 2JAWA 5H81A 4TTRA 5CDSA 1KRHA 1LXCA 2XI4A 1V8FA 4F11A 3LZDA 4KAJA 2J9XB 1Z4NA 4FSDA 2YJTD 5JJBA 4UMFA 4JJZA 2AJTA 4Q01A 7GPBA 4URWR 4MZDA 4O4HF 5HWSA 4G9BA 3T5PA 1PYGA 1J22A 1DARA 3LIIA 2ETXA 2XUJA 1MVNA 2XMBA 2VPXA 1Y6FA 4RL6A 1JAHA 4S1VA 1HR0B 5BW4A 3ZHBA 4YV7A 4TTTS 2CMDA 2FN4A 3SKXA 5AI6A 3SF8B 2IS1A 4G4SO 3K72B 4RV9A 3WK7A 1BVUA 2DYKA 2IUTA 1XJCA 3K94A 2D2XA 1Q3HA 1ENOA 3N0XA 4N7MA 4EPTA 1AKMA 4ONEA 3U6KA 2VXOA 1XMJA 3MGCA 4KGXA 3Q0TA 5EIBC 2D2EA 3BSYA 3EF3A 5BQPA 3VU9B 3ZW9A 1A8IA 3MT7A 3JPWA 1OW3B 2XYPA 5LYYA 1RC0A 4WLUA 2YIDA 3C5HA 1Q74A 4OBWA 3PE3A 1PT6A 4QASA 2CXRA 4MYSA 5LWHA 3GFPA 3KUUA 4AS2A 1PAUA 1BHJA 2JH9A 2Y0CA 3SQDA 4RWZA 1UDXA 4F4UA 1D4OA 4HPJB 1ZD8A 3AT1A 2J4CA 4JLKA 2EG9A 4WJKB 1P3Y1 4KFRA 4EAQA 1OZFA 5HHTA 1X7WA 1X38A 2BFAA 5ALHA 3N6XA 2QRPA 4O5OA 3PYLA 4HH4A 1K1EA 4LKRA 6AT1A 1ISFA 2AG8A 2NPIA 3CPEA 3CUYA 4OQNA 4ITRC 4PFJA 2OOKA 5CVVA 1W1IA 3RC3A 3UJPA 4ZGGA 4L72A 2DRIA 4WN3A 4TZ6A 1IXZA 2RGYA 3V7UA 2RGEA 4QYWA 3RCBA 1PHRA 4KYUA 4UCQA 2XCTB 3GELA 1TK3A 5DOZA 4MPTA 1NXWA 1L7AA 4BNUA 1WBBA 3DOUA 2XTAA 5H59A 2C9ZA 2EC5A 3E0QA 4X6YA 2R87A 3WK5A 1V4BA 5GOTA 2Q2VA 1T6YA 1S8NA 1LBEA 3DDHA 3N2KA 2Q4DA 3O6VA 4DNQA 3BD6A 2BBWA 1Q1QA 2AFIE 1UOQA 1E63A 4BNNA 1TZ2A 2BKEA 5HZHA 3L07A 3WB2A 1J9EA 1WU7A 2B4AA 1OBCA 3DDOA 4ZAWA 1KI8A 4Q19A 1VJ1A 4ZOLA 1KNQA 5TY0A 2JNWA 3A14A 4HVAA 2Q3EA 2ZJ1A 4EMBA 3ESXA 1QC5A 3LRXA 3OF2A 5DYIA 3T7AA 5B1SA 4XGRA 1X6VA 3ABQB 1QVZA 3CJTA 1JAZA 1WEKA 4I1SA 4KK4A 2I4NA 2UZAA 5CLFA 3FYUA 4YCCA 1JEQA 2OVFA 2P5YA 2Q5OA 4YFYA 1PZMA 5NULA 4RY2A 4LI0A 3CBQA 1L5HB 2ZYRA 3DNMA 3FVQA 1X7XB 2BSAA 3HFGA 1KZ9A 1YDEA 3M4ZA 4HEJA 3ZCXA 2IH4A 2MJLA 3FMFA 5F76A 5B64A 4CEJA 3VDMA 1XALA 4CKBB 2PO7A 3OBBA 3ZBPA 4G1VA 4LV6A 1J2EA 1U28A 1DHTA 2J9GA 2HI0A 3Q5DA 1KSFX 3HFRA 3I3SR 1PI3A 3NHZA 4JLBA 3R75A 3WOVA 2BHSA 2ZM5A 2DG2A 3FB4A 4BB5A 2XBUA 2A30A 3EFHA 5ALXA 4E31A 5AVVA 2OVBA 5LBTA 1Z74A 4EDHA 1O0CA 1XP8A 2I2WA 3V8BA 1Z15A 2YNMC 4LNUA 2ZI4A 3WAKA 1RAGA 1WB9A 3UUGA 4AKGA 2FK7A 1WCYA 4LDJA 4NE7A 2EWWA 2GHTA 5DNWA 1PGQA 1PNOA 2FRVA 1SKUA 4HZUA 2QTGA 2ZPAA 2GR9A 5H70A 4URYR 2CV1A 2NXEA 3C7CB 3ILVA 2WM2A 3H2JA 4BP8A 4MW5A 1YB7A 3QFHA 4O0LA 1V96A 2X4LA 4HEQA 4Y1EA 4QGSA 1G1AA 4JOBA 3NT5A 4QU0A 5AOBA 2O2EA 2Q29A 4NNOA 4QA9A 4UMDA 1QTIA 3GWZA 4JOSA 2HF9A 2OMEA 3M83A 5E4YA 3LPAA 3FNFA 4LZZA 2XDQB 1WEHA 2AEJA 4AZ0B 1CR6A 3L84A 2QRNA 2VWGA 2ZIEA 4FHDA 4N7BA 5JS8A 5CDYA 4N4AA 4B6JA 3BIJA 3AM1A 1BMFD 4NMXB 1Q11A 4IEFB 4WZAA 4JEIA 4CZ2A 1BX1A 1FL9A 3KR9A 2EFEB 4BMOB 3ZVMA 4RM3A 4ZJPA 5IULC 2IDJA 3GCZA 3T7SA 3VAZA 3ZEIA 3QVOA 6Q21A 3FPBA 1R2QA 1UDBA 2H8KA 3JZDA 4XQ0A 4BPRA 1QJ4A 4P83A 3W7VA 1NDUA 1Y0BA 4NICA 4ZQGA 3NH9A 1S96A 3D7LA 4MB2A 1BCRB 3KSDO 5CVDA 4Z9AA 2Q3DA 5J5AA 4URXR 4UFOA 4I14A 4YJ3A 3UF0A 4QEDA 3F9CA 2D0PB 4V03A 3TH5A 4X3PA 1DIBA 4DGQA 1HDYA 3LXMA 4YHHB 2WOJA 2VA9A 3GI1A 1N5IA 3GIWA 4H18A 5CFZA 1WABA 5FWDA 5B2FA 3VUFA 4ARSA 3CZAA 1RNLA 1JYSA 1SIWA 5IU6A 4JVLA 4E3WA 2Z0MA 4NU5A 2J3JA 2XKAA 3CO0S 4X44A 3MOSA 2H1OA 1NZDA 1PT7A 4KPEC 5ICMA 2XXAB 3HVKA 1CFJA 1Y1TA 1YZGA 3A58B 4RWEA 3RAJA 3BF8A 3SYLA 4A0FA 2HWKA 4XSGA 3V2IA 4G5YA 4P58A 1TK2A 2AQHA 4RLHA 4AJHA 3AXSA 3E9RA 1TRKA 1QX4A 4YRQA 4YWHA 3ZGVA 1PWHA 1QGUA 1SCJA 5KTSA 1TGYA 2GK7A 3FHCB 1I0ZA 2PZGA 2UZ4A 5BUSA 3AF5A 4DNXA 1LW6E 3TSCA 3DMYA 5IVIA 3W6PA 1Z6AA 2RH9B 3F6EX 4GXNA 4MMYB 1FLDA 4EHBA 4FC7A 3RQSA 5KJ6A 1S4MA 2VWPA 8ATCA 3OI7A 4TV8B 4F9TA 4JP5A 1RU3A 2EDAA 2ZYAA 3A4VA 3PGMA 4IXDA 3AOEC 4BP1A 4RTKA 3BMOA 1VL5A 4UU8A 1IRXA 2C5BA 3D7RA 3E0XA 4XASA 3UEOA 5ILGA 5JZVA 5L6LB 1W35A 1WMSA 4WASA 1N2XA 3A1FA 3MLEA 1DZIA 2A9OA 1G21B 2B1QA 3V1LA 1B43A 3W8DA 5B7QA 4UZEA 1K8RA 1JIQA 2D1FA 4K6GA 3LBNA 1LLCA 1S7CA 4YRZA 2RHJA 3DC7A 4B7ZA 1C4XA 2QVGA 2XMRA 4GI2A 5HOEA 4FXPA 3ML1A 2GERA 2JB9A 5BV1A 2QTZA 4BO6A 4MLZA 1KSHA 4EG7A 2AN9A 3Q7SA 3PFBA 3EGWA 1ACJA 1TC2A 1L5WA 1PJQA 2O2SA 4F45A 2IX3A 4W7HA 1FJ2A 2X23A 4C1NA 1QIEA 4YP1A 1ODFA 1W5EA 2W37A 1R6BX 1VE9A 3IA7A 4PZYA 1V26A 2OAP1 3U4GA 5TQ2A 1EX1A 3L79A 5DSZA 1TTQB 2W90A 2AX4A 1MG0A 3A70A 3N2GA 3WLTA 2IYTA 4QX6A 3RYHA 2BZGA 3CVWA 3MWDB 1AKTA 1YJBA 1A8HA 1EVYA 3MTEA 4II7A 1Z0JA 2M98A 2OXRA 4JGBA 4UD6A 2WU3A 4CMKA 2IYOA 2C58A 5BV2P 1NBMA 2BV3A 2I6SA 3IUJA 3ZWNA 3EGXB 1HNNA 3D8HA 3DZJA 2ILVA 1BHQ1 3PDIA 2Q41A 3OZEA 3G1TA 4P7BA 5LXTF 1L5OA 1V9LA 3TQTA 1ZGBA 5ALYA 1KZYC 3FCUB 2BMDA 1NV9A 4QYIA 4RZ2A 1N3LA 1UINA 1KJQA 1QE0A 2B4YA 2ZWAA 3OZUA 3HWX1 4GMXA 3T7KA 3URKA 3E03A 1P18A 4EBFA 2BGRA 4AF7A 1EFPA 4TKLA 4QGBA 3G9ZA 5L3QA 1H2AS 3AIOA 1V5GA 4LQDA 3WYFA 1J2JA 2IZ1A 5CG2A 3ER9A 1P6UA 1VB5A 1FQWA 4TMXA 1MNAA 3PEEA 1Q7RA 2Q0XA 1Q1BA 4HGYA 1UAAA 2G1AA 2CNLA 2W98A 3TNLA 4BB0A 1R8XA 1XAGA 1BVRA 5TT1A 2J5XA 5FR2A 2NGRA 3I04A 1PZEA 3M9WA 5DIZA 3Q40A 4TWAA 5J4LA 3LA6A 1JKJB 2VJMA 2VPTA 3P20A 4UFPA 5FX2A 5AXCA 4BWYA 2F17A 3BWEA 3ESZA 3NIFB 2PX2A 3OEEA 4MS1B 1X9HA 1VA4A 5ALSA 4M36A 2XVXA 1ZICA 4MRRA 4OHVA 1NW6A 2VPQA 1XAHA 3BHIA 1GPKA 4NAVA 4NR0A 3RTEA 5E9WA 4M21A 4FWIB 5FUYA 3SBOA 3FD8A 4IZIA 4CLOB 2WK1A 2VHEA 2H5IA 5E2AA 1MV5A 5E0KB 3VNQA 2H4FA 3WS7A 4BJ6A 5I7OA 5K3OA 5KAMA 5D5QA 4LMRA 4ENQA 1TRHA 5TLSA 1BZYA 4M22A 3SJZA 3WICA 1B8UA 2YV4A 1QCCA 2F1JA 2QDKA 3TLEA 2Q4OA 1HXHA 2PBZA 3KAPA 5FTKA 2XOKD 3UHPA 1EXWA 3ZNQA 4P5PA 5AXAA 3WL8A 4QRHA 3SEQA 4F92B 5I8WA 1BFUA 1Y7PA 1AIPA 3HDGA 3PGLA 4LTDA 5L7YA 4Z53A 1F9EA 3HYTA 3EPPA 4B6QA 4Z4QA 1KP2A 4F2PA 4XUDA 2X8AA 5AK6A 2TMDA 5C8YA 2DFPA 2QUHA 1QZZA 2O8DA 1KORA 2AEMA 2G76A 1BTOA 5BV8A 2OE2A 2P90A 2F3UA 2CDNA 5EHZA 3VGJA 3HCAA 4Q3NA 2L2QA 2NT4A 3VPGA 4QUDA 1DAGA 1P0FA 1QE3A 3G2OA 2ZWOA 4G0MA 1OUMA 2YZGA 2GZSA 3PRKE 4BJ1A 1O7JA 1DQNA 1UT8A 1ACLA 4EKEA 1X42A 2AK3A 1YHYA 2HRZA 2PX0A 2YY6A 3PP8A 4HAWA 1D2HA 3B13B 4OBXA 3ZHRA 1ML4A 2W6QA 3V1YA 2TMKA 4HEA6 3QYFA 3G9UA 3NDJA 2EF1A 5EWMA 3E2PA 3RT7A 5CH5A 4EFLA 3MINA 2IHZA 1QO7A 2J0VA 4M98A 1SXQA 4TSFA 1P0PA 1UMDB 3DFMA 5ITVA 2GCPA 3KSBC 3TM5A 3FZYA 3LUHA 2PX5A 1E1QD 2ZPUA 4JJ4A 2O0LA 1DGQA 3D02A 1IZ0A 3A9CA 1RXVA 3KJIA 2HBQA 3PHJA 3HDHA 4MEBA 1S8OA 1GTJ1 4XIGS 5JRZA 3F6BX 3DWFA 4HX9A 4C07A 3MJEA 5DI9A 1GSHA 3JAMA 1I94B 2LTAA 5ITWA 3MOGA 5DPMA 1L7XA 2WUVA 4K9SA 1I24A 1T5SA 3NTVA 3UJCA 1XNGA 1I01A 1NOJA 2Z2KA 1RBYA 1KK0A 1PKEA 5DZSA 1WZCA 3QIVA 2EKBA 4MUFA 4OB8A 3P2IA 4ZI7A 1HDOA 1SCUA 4B8ZA 4IHJB 3QQ5A 1T36B 4F4FA 4F2WA 2QSJA 3QVXA 4F6LA 2V97A 1JWLA 1CYEA 3UANA 2SCUA 3HKBA 4R9VA 2X9QA 4E2WA 5J4VA 5KQRA 1TYBE 3BFKA 3BTUA 4UOQA 4Z1OA 3LPDA 4MARA 1ZXLA 4NIMA 3ROZA 4K7JA 4NFSA 3THOA 1RJEA 2FFBA 3VV3A 5IASA 2H2GA 1NFFA 1KAQA 3H1GA 3HYNA 4AJNA 1Q0LA 2E48A 4AP6A 4YCLA 3E9ZA 2JLUA 1FSSA 2J09A 3PTLA 3V7NA 5K6AA 1YFLA 2OO5C 4MGZR 3N70A 4XFJA 2Q6OA 3TW0A 1ZOLA 4TTAA 4LZNA 2CVFA 4M4SA 4JI6B 1HDIA 1XF1A 2BOVA 2HZBA 2X1VA 4X94A 3PUIA 3EZYA 3K6SA 2BDUA 4O25A 4F4IA 2D3TA 1UBNA 1E2EA 1SXHA 1Z28A 3P2KA 4FOLA 1CUVA 1ECPA 5KOHB 2R8EA 1KJ8A 5D3MB 2XADA 4L15A 1H4SA 1ISPA 1U0GA 4DKJA 1Z56C 3CUWA 3KOWA 1DC4A 1H1TA 1JIIA 3H8WA 1Z0UA 2VSNA 3OFND 4F06A 4MQMA 3C6BA 3DEKA 5JCOA 3EVEA 1GQSA 3OC6A 4BFUA 2UYCA 3W05A 1U8ZA 1ECCA 2F3TA 3I28A 4N6NA 1Q15A 4LOIA 4XPZA 4BPBA 4C0HA 4MGIR 1YDFA 3ZWBA 3L4BA 4X71A 1NOKA 3I1JA 2V8OA 5EMNA 4IO1A 2H9IA 4CIVA 2G77B 4GE0A 3UJDA 3VO9A 1OGIA 3LL4A 1QLHA 2PE5A 3CPJB 4MCJA 4PNHA 5JW6A 1A8SA 3EIEA 2Q45A 4FCTA 1XZAA 3TBHA 1AM4D 1OT5A 1OFUA 2Q9AA 2QPOA 3G9XA 3OCUA 4NBLA 3ISTA 1YZVA 3UPTA 1G8SA 2PL3A 4HRXA 2RAFA 1VJTA 2DH6A 4NKRA 5IEBA 5I7WA 1R12A 5I7RA 1NUHA 2GCIA 1SHLA 2Q5LA 3JZFA 4MCAA 5DMXA 3D4PA 3KQSA 5INTA 4KO4S 3WDMA 4IVQA 3NDPA 3I4FA 4FILA 4HYEA 2CJPA 3NM5A 1UMBB 1JEYA 2XMDA 2EAUA 1DO0A 5IBPA 3WO1A 1O5OA 3T3MB 4E1BA 3U4QA 3RSHA 4C3UA 1KAEA 3ZDEA 3RV4A 4E6PA 3JQ9C 4LHVA 2HPAA 2WAOA 5JPDA 3KOXA 2P2NA 3DKKA 3TIFA 3BRCA 4RK6A 4P36A 1APBA 1P2DA 4C7VA 1VSVA 4PO1A 1F17A 2PX3A 3IURA 1JDTA 4F5DA 1Z82A 1DIHA 5DN9A 3BD8A 1Q2XA 2RGRA 1AGNA 3GLVA 4PYKA 1UKCA 2C9BA 1U1EA 2CNNA 2PD3A 2M1XA 4JA0A 1P17A 4R5HA 3RDPA 3OUUA 2JD1A 4JQZA </