1LV8A

Crystal structure of calf spleen purine nucleoside phosphorylase in a new space group with full trimer in the asymmetric unit
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
282
structure length
265
Chain Sequence
NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of calf spleen purine nucleoside phosphorylase with two full trimers in the asymmetric unit: important implications for the mechanism of catalysis
pubmed doi rcsb
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 80
structure length 265
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2002-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lv8A00
1LV8A 5CXSA 2QTTA 4MCHA 2Q7OE 4DABA 1VFNA 4F1WA 1V4NA 4TS9A 3OOHA 2P4SA 3KUKA 5B7QA 4L6IA 1TGYA 2I8AA 4TTIA 1T8RA 1K9SA 4D9HA 4F2PA 4YO8A 4LZWA 4QARA 4WKOA 4M3NA 3KVYA 5F73A 2AI2A 4L5YA 1RSZA 1OTYA 4KN5A 1ZL2A 4DAEA 3ONVA 4DAOA 4ECEA 5ETJA 3KU4A 2QSUA 5FAKA 1RXCA 4U2KA 3OOEA 3DJFA 1OV6A 4R2WA 1JDVA 4I2VA 4LKRA 1PR4A 2ON6A 3O4VA 3BSFA 1V2HE 2I4TA 4WKBA 3D1VA 4D98A 1Z5OA 1ODJA 3P0FA 4LDNA 4IP0A 4DA7A 1JPVA 5CYGA 1V45E 2OECA 1ODLA 5F78A 5CCEA 3FAZA 4TTJA 3KVRA 5F77A 2GUWA 1PWYE 1M73E 1U1FA 1PR6A 1A9TA 1U1CA 1QE5A 3FUCA 1SD1A 4GKAA 1A9SA 3LA8A 5JPCA 3NM4A 1RR6A 1T8SA 2QDKA 3NM6B 1OVGA 3OPVA 2A0XA 1U1DA 2PGAA 2OC4A 4H1TA 4TTAA 1OU4A 1PR2A 1Z5PA 1SQ6A 4OY3A 2B94A 1ZOSA 2BSXA 3IOMA 4G8JA 4F3KA 5B7NA 2HWUA 3UAXA 3OCCA 4L5CA 4D8VA 2IQ5A 4X24A 3KHSA 1JP7A 4EARA 1V48A 3BL6A 4WKCA 3K8QA 4TXLA 1N3IA 3ENZA 1Y6RA 3O6VA 1Y6QA 1ODIA 4L5AA 1Y1TA 1A9QA 1PK9A 3FNQA 4DARA 4D8YA 4DA0A 1TD1A 1Z38A 4JOSA 3E9RA 5CYFA 5F7JA 4BMYA 1PR1A 4TXHA 4MCIA 3GGSA 1V3QE 3OF3A 1Q1GA 4BN0A 1PKEA 1LVUA 3FOWA 5K1ZA 3FWPA 1OUMA 2A0WA 1Z36A 1PBNA 2QTGA 1RCTE 4NY1A 1B8OA 4TYMA 1LX7A 1Y1SA 3MMSA 3TL6A 3LBAA 4QEZA 4TXNA 5B7PA 5F7OA 1Z5NA 2OXFA 1NW4A 4G41A 4JWTA 4P54A 1RXUA 1T8YA 4LNAA 4BMZA 1OTXA 1JDSA 4OF4A 5IU6A 1K27A 5I3CA 4UC0A 4OGKA 3UAZA 2HN9A 3OZDA 4DANA 3IEXA 1JDTA 1SD2A 5F76A 1T0UA 1A9OA 3K8OE 4D8XA 4GMHA 1JDZA 3C74A 4R2XA 2RJ3A 3INYA 3PNPA 5DK6A 3DDOA 1CB0A 1A9PA 4BMXA 1Z35A 3KVVA 3QPBA 3SCZA 1G2OA 4MARA 4QASA 1A9RA 5EFOA 1YQQA 1NC3A 4TS3A 2QPLA 3PHBE 4DA6A 1Y1QA 5B7GA 3UAYA 5CCDA 1YBFA 3NM5A 4LNHA 3GB9A 3UAVA 4F2WA 1Z37A 1Z39A 1JE0A 4WKPA 1I80A 4RJ2A 4QATA 1RFGE 1ODKA 1U1GA 4QFBA 5KB3A 1B8NA 5EPUA 1JE1A 4M7WA 1K3FA 3NBQA 3MB8A 3LGSA 1PW7A 1TGVA 5F7XA 1T8WA 1PF7E 4QAQA 1RXSA 1Z33A 1YR3A 3DP9A 5EUBA 5IFKA 2H8GA 1JYSA 1Z34A 1WTAA 4GLJA 1U1EA 4WKNA 3OZEA 4DA8A 4PNPA 3T94A 1JDUA 3U40A 5C80A 3E9ZA 2AI1A 1PK7A 1PR5A 3F8WA 4K6OA 3PNSA 1ULAA 2A8YA 1A69A 1TCUA 1CG6A 2OC9A 5CXQA 3EMVA 3FB1A 1Y1RA 4YJKA 4TXMA 3P0EA 4GLFA 4E1VA 1ULBA 4OEHA 1RXYA 4NS1A 3DPSA 4FFSA 2HSWA 3UT6A 2AI3A 4M1EA 4YNBA 3E0QA 4TXJA 2HRDA 1RT9A 3DF9A 4L0MA 4R31A 4PR3A 3EEIA 2XRFA 4F3CA 1VHWA 1YQUA 2ISCA 1V41E 3ODGA 1SJ9A 1XE3A 1YRYE 1FXUA 4JP5A 1PR0A 3UAWA 1C3XA 1VHJA 1VMKA 4OGLA 1RYZA 2AC7A 4OJTA 2A0YA 3BGSA 1NC1A 4EB8A 5F7ZA 1TCVA 3EUEA 1ECPA 3OZCA 3OZBA 4YMLA 4NSNA 3PHCA 3BJEA 3EUFA 4G89A
chains in the Genus database with same CATH superfamily
1QJCA 4L2IA 1T0PA 2JJ2A 1PQUA 4GBJA 1ZK3A 2Q0HA 4CFYA 1ZMRA 2ODQA 2I2XB 2SCUA 2LCFA 2BVNA 2ORYA 5DLQC 5CVDA 5BN4B 4Q4AA 3OQHA 4GYJA 1GLVA 2ZYHA 3AEKB 2H00A 5DYGA 1WZIA 4UEOA 4YXWD 2Q7XA 1Z7EA 4IMJB 1I30A 3G7UA 3ZK8A 1P4HA 4LN1A 1L5SA 5FOVA 1C7RA 3AV0B 5J4VA 1U8XX 1GAQA 3L82B 1SIWA 3A6ZA 2WJYA 4Y1GA 4C0HA 2EYQA 1O7JA 2RH4A 3T4EA 4KWEA 1QHSA 1U3WA 5T41A 4B6SA 4JI2B 1JXOA 1WW2A 3TXYA 3CKMA 1W8IA 3C1UA 4EA7A 2ZBVA 1RYYA 2XBLA 3K0CA 2ZVPX 2QPAA 1RSZA 2G72A 1L5ZA 1E9CA 2EWWA 2WP0A 3C41J 1FK8A 1HQYE 3I9LA 1QV7A 3KSZO 4WZBE 1HLGA 3TZ6A 5J4KA 4I1VA 5JQWA 1FMJA 3F6PA 3ZS9A 3LKZA 4B1FA 1N2HA 1W581 3MT7A 4MUIA 4YRJA 2VQDA 1NP6A 2F3SA 1FFCA 3JATA 4K9PA 3ZE7A 2QRZA 2B1GA 2GN8A 5IDQA 5DTQA 2PFSA 2QMHA 2YH2A 1XI2A 1QLJA 3AKEA 1PDVA 2GYYA 3H1BA 4M53A 3BN3A 3FE2A 3IAXA 4MTLA 4XZ3A 4J3NA 3DJYA 4E14A 1YZKA 2QMYA 3NTQA 2HMSA 4NBRA 3ZGNA 4JLOA 3QF4A 1U9ZA 2WJ4A 5ECDA 5K0GA 4Z0NA 1Y34E 4GQBA 4I0WB 2J9FA 3UB4A 3VR5D 4F8EA 5LKAA 1HGXA 4CCSA 3CEJA 1IVYA 1NMEA 1E5TA 3O90A 4PRKA 4ESEA 1IHDA 4OA5A 4XVHA 1WXEA 1EFKA 1UJ2A 3WXBA 3HVUA 1DUVG 2EV9A 2I7XA 4F9FA 4ZOLF 4CCWA 2OCIA 1GN9A 1XZGA 2AC4A 5JSFA 4G0WA 3IR6A 2CEKA 4IP0A 2CF5A 3VTFA 3P9RA 4E15A 2VOJA 2ZUCA 3VKVA 2GVZC 2RMKA 2ZUVA 1E18A 1R4NB 4D0NA 5DBHX 1A2OA 4G9BA 1T9CA 3KVNA 1D6MA 2NNWB 4UCFA 3RB8A 3RW9A 5LIPA 2BDEA 2FPPB 5KNDD 2BFWA 4DDWA 5B6JA 4L3WA 3D0RA 1KO1A 3PPWA 3ONDA 2NYUA 3LU1A 3LZDA 3QJ5A 5D3MA 1NUHA 2Z09A 5HUQA 3P5SA 2DVMA 3IPAA 1HT3A 4FSXA 1HOXA 3LVBA 4QVIA 2Y1WA 4AO6A 1CLUA 2RHMA 3FKSA 4GKAA 1KY4A 3NALA 1ETUA 1QFXA 2ZFUA 1IN8A 4KMOA 5ESRA 1FRNA 2FI1A 3T9CA 1L6IA 3TTXA 4K3UA 3WLAA 4E5YA 7AT1A 4HOYA 3K9QO 5WRFA 2FG5A 1EX6A 1HPLA 5D5QA 4BMVA 3IPLA 4A8HA 3QXHA 4I3GA 2GILA 1WUYA 1D1QA 4BO3A 4OAQA 3LM8A 4DLVA 1VYTA 3U7HB 4G1CA 1GIAA 4L76A 1SU7A 1E9FA 1OU4A 1Z17A 2I7VA 1H3NA 2NU6B 5BR8B 5I6DA 5IMSA 3JAWA 2BSXA 2HU2A 2WUGA 1F2TA 4FFVA 3B2QA 4EKIA 2OSBA 2CL6X 3STWA 4AY4A 2UYHA 1U90A 3DBVO 3TMKA 1F2DA 1WPXA 4UZFA 4EM6A 2OGSA 4LXUA 5BYKA 2R62A 3F9IA 4CM4B 2J0SA 3V4OA 2X8LA 2WWVD 2J4CA 4I4TA 1L7OA 3WWYA 3ZBQA 5EG5A 4JR2A 5T6MA 2NVWA 1SOUA 1NHWA 2HEGA 1H1LB 1XEXB 3VR4A 5IDXA 4CMEC 3L7YA 5LPNA 4HVCA 1U2EA 4Z2AA 5LM3A 3FYTA 2K87A 4GT1A 1JLSA 3LXXA 4NCBA 4YP6A 1JVNA 3QBEA 1J4AA 2NSLA 4GECA 2WT9A 4PHHA 2BGIA 1VB5A 1MJGA 1J5PA 4F60A 4PYRA 1OTHA 2P3OA 2I03A 3ELUA 4GUDA 4TV8F 3KZOA 4YBRA 2REQA 5LP6C 4DKJA 1JHXA 1IFXA 1JR3E 3JXEA 3IPYA 3R4VA 2GS9A 3BB1A 4ETWA 2VNIA 5DKFA 5K99A 3KJXA 1XCMA 3LCJA 4OXQA 1XFDA 1O03A 3GXBA 2RD2A 1SRRA 3PGLA 1FQKA 4OLJA 1U0NA 4S24A 1AGPA 3COZA 3PX3A 2IHNA 4FYIA 1H2YA 4BO2A 3AJEA 4C0WA 1EQ2A 3CZMA 1UJ6A 3WWOA 4B48A 1HMYA 3ZHBA 3GGSA 3LGAA 2ZQ5A 4D6YA 3KB6A 4B3MB 3IQZA 1P74A 1J8MF 4LYAA 1E1DA 3IFSA 5JARA 4N82A 4P36A 4RE6A 3KYIB 4Z4EA 1AT1A 2GCGA 4R98A 1U6JA 4K7JA 5DZSA 4JOBA 5BNWA 1X8KA 4YDQA 5EESA 2E2WA 3N87A 2VUUA 3W3AH 2C8KA 1AY0A 1EVLA 1T3HA 3GMSA 3ONEA 4Y7DA 4WADA 1P7WA 2E21A 5J2UA 1Z36A 4UNQA 1DKUA 1XMSA 2QTGA 1TZBA 4URXR 3QTBA 1ZA1A 3AO0B 1U9JA 4RSRA 4O4LB 4WCDA 1HC7A 3EDYA 2C9MA 4MVXA 3QVKA 2ECKA 1M74A 1YR2A 4O2AA 5JNWA 1MJHA 1Q5PA 4JI5B 3VKWA 2XB2A 4JBGA 2IEYA 1LZKA 5JCJA 1VMEA 3MMSA 4AG6A 4ARAA 1EM8B 2FUKA 2OA0A 5C2JB 2XBMA 2C2GA 3LDUA 4EEKA 1HSZA 1VYVA 1OAAA 1QKJA 2FR8A 1CEQA 3GRAA 4DJDC 2X7XA 1VGVA 3IE2A 1V37A 1W85B 2OORA 2Q0QA 2WD7A 2R6AA 3N07A 1VL8A 2EFEB 4F4FA 1GGFA 2WF9A 4JLVA 4Q1FA 5EIOA 3RPEA 3EGVA 1I94B 3QFFA 1V8FA 4LHSA 1WZEA 2NXWA 1NR5A 4URYR 3V4RA 2FSFA 3BBLA 1X7XA 2AOVA 4QVKA 1E9EA 4C05A 2XVXA 3I3OA 4F5DA 3BAZA 2OV3A 3BQNB 4RW0A 4ZOEA 4HN9A 3QOYA 2QK4A 4PGGA 2JLZA 4QGAA 4ZQCB 4C87A 1JDSA 4B4VA 3UWDA 1DQRA 2YICA 2NN3C 1XTVA 3NT4A 3F0TA 4LMRA 3VV3A 3ZJ4A 2P30A 2P3LA 2EGUA 3AF6A 3GVPA 2WMNB 4F9GA 5IU6A 2ZWOA 2FMTA 2HZ7A 3OSZA 4UMVA 3QKUA 1CIVA 2ZITA 4BVKA 2H4WA 1KSFX 2Q21A 1NOKA 4JJ8A 2ZSIA 3DEFA 1ADFA 2YFHA 4MHOA 2C0PA 2CMDA 5KPDA 5ALTA 1IEVA 4JXXA 1D2RA 1J8FA 2O1XA 3ETLA 1AQNA 3V6MA 1M1NA 2FY8A 1VPWA 2ADMA 1Z12A 3D6NB 4XJTA 4ZPJA 1Z26A 5LDHA 2J85A 5LJIA 3F6CA 4CKCB 2WJJA 1GL3A 2CMKA 3P1JA 5LMZA 4YLYA 4LOAA 2B5WA 2JGFA 5TQ0B 4Z6KA 1ZGGA 3IJ5A 1M2OA 4PO8A 4D3XA 2BKAA 2YWJA 5CDSA 1TKCA 5I8PA 1SHJA 4O33A 4J6FA 4E7PA 5FV7A 3B82A 4EF5A 1W25A 4G0YA 4XDZA 2RG7A 5EXTA 3RNOA 2AX3A 3MJRA 1GPYA 2YXBA 4R2XA 5DLPA 1MJFA 1JQJC 5A3QA 1PVVA 5FJJA 2P0YA 5ANRB 2XCOA 3CRZA 3TR5A 3G59A 2X0FA 3TZKA 2GEBA 3V1MA 4CEJA 5IXYA 3T1NA 5JRDS 1LQUA 2IUSA 1Q3TA 2XE8A 1KP3A 3FTFA 4BLTA 2D6FA 2I91A 5EHIA 1TFUA 1G1MA 3TIIA 1K08A 3TE7A 7GPBA 4AS1A 5K0CA 4BV8A 2PUGA 2F1JA 4RHTA 1ZUIA 3LD9A 1V5GA 3TLCA 4MRAA 4TT3D 2JIQA 4BJ3A 4AF6A 5KQMA 1Y1QA 1LDYA 5BNIA 2YJ5A 3PKJA 4F3CA 2BUCA 5CCDA 3JTMA 2W00A 4FZJA 4UARA 2PA0A 4DDVA 2AE1A 3NM5A 3KV3O 1H3FA 2PSEA 3I9NA 2BFDA 1VLQA 2QMOA 3A9VA 3LVRE 4X95A 3VPCA 4K9NA 2QRGA 2V7XA 2V7BA 2FR0A 2GJAA 3EMKA 4MQUA 3Q12A 4HRXA 4DV5B 2P5TB 4MRMA 4KMRA 3SMVA 1SC9A 2W83A 4J9VA 5L3QB 1Z5GA 3RIYA 3IPCA 1OAOC 2BMVA 3U5TA 3BMCB 4I8DA 3ZV6A 2PU5A 2RE8A 2VK2A 1NBWB 3NATA 3FZNA 1ODKA 1VYUA 1GGVA 3GLFB 1N9GA 4IYJA 3PXDA 4BIIA 4KXQA 4JJFA 4W5HA 3W9YA 2PQ6A 5KB3A 4MH0R 1FSFA 1BC5A 3P45A 1E0AA 3NDJA 4PQGA 4V0QA 2VPPA 6PFKA 4M7WA 3F5FA 3FWYA 3OD1A 3GELA 3D7RA 3K1TA 4N1AA 4AO7A 4OMFG 2B4QA 4EGCB 4F6CA 5IYZB 4BLQA 2QZJA 1LI7A 2RHTA 3DEKA 3O3CA 4ILEA 4Y67A 1MLDA 5LA6B 1ZJYA 3N2EA 4MW9A 3L93A 1AKWA 1L1QA 3PFBA 5KOHA 1RM0A 2VBCA 3UOAB 1HG0A 2G5TA 4RVHA 5TGZA 3BILA 4BZWA 2HGSA 2I6UA 3KWMA 3DL2A 4X9XA 5C0OE 4IHKA 3F96A 1VJCA 3KU1A 2A1TS 3H9UA 2AOXA 1FMLA 3W3AA 1BKSB 2EWVA 2NZ2A 4KMMA 4P4LA 4GBGA 4EWLA 2X8BA 5BSGA 2DUUA 3JQQA 5J9FA 4N6GA 4DJ5X 4JHXA 4RTRA 4EMUA 3UTDA 2HXSA 1CQZA 2FU5C 2OM2A 4JLUA 3K70C 2F55A 1NVKA 2Q8NA 2VYVA 2HK6A 4UOQA 3GDHA 3HHPA 2PS3A 4GEKA 3A2MA 4U1RA 4EUEA 4X66B 1DXYA 2LWIA 3PK0A 2DRIA 3DMTA 5HJ5A 4AKGA 1H9AA 1SBTA 3WK8A 1UDWA 1UZAA 2JIRA 4LK3A 4GL4A 2UYGA 3MJSA 5KNBA 3GIWA 2O8DA 3WRYC 1GEEA 1XA0A 5IARA 4E2XA 4KRFA 2FSHA 2XDYA 4B6EA 5KJEA 3F8WA 4QTUB 3X1XA 1G7TA 3ANLA 1II0A 4XFDA 2ZZNA 4NYJR 3Q3GE 1A9XB 1A3CA 1KJJA 3ID6C 3L8GA 3ND9A 3ORRA 1GTZA 1NVUQ 2DUWA 4L0QA 3DOFA 1W2HA 4BGUA 2DBZA 2PQMA 2AMFA 2GPYA 1NVBA 2X9QA 4RPKA 2AG0A 3BEOA 3L8CA 2HYDA 4YDHB 5GV7A 1VE6A 3ELDA 4LC0A 1RWKA 3TOVA 3OLVA 1OA0A 4CKEA 1MAVA 1CG6A 4IXMA 3PICA 3U6BA 2WNIA 4PAMA 1L1EA 1VG1A 1WSDA 4DY4A 1H0HA 4ZHQB 2YKGA 1FW8A 4IUBS 1POWA 2P5UA 1VSVA 4A4DA 2C2ZA 3VO2A 5JFOA 2G09A 2W8ZA 4RTPA 4BVLA 4HQFA 3T9BA 5LA6F 1J39A 3WG9A 4L6AA 2UZAA 3BHMA 1TJYA 3IELA 3UCEA 5IJXA 1NQ5A 3CQ9A 4JI0B 4GOXA 1EGVB 4MDYA 4HUTA 1XLTA 2C0CA 2PTGA 4R01A 3OTGA 2XF2A 2IS6A 4HYTA 1I3MA 4WZBB 2RGNC 3M49A 2BFCA 4QOJA 4JI1B 3RROA 4A16A 2IEIA 4PC1A 4DDHA 4DGSA 4DL9A 1EEXB 4AQ7A 2J4FA 3BKWA 3L7AA 4QYXA 5G4LA 5SYMA 2R5FA 5JCJD 2XXAB 4BO4A 4TTSA 2D7JA 5CJJA 3CCBA 4YDSA 1RM5A 3UJ8A 4C01A 4FLFA 2AOUA 1YGYA 2I2WA 2ODBA 3EAGA 2I65A 3IP6A 3JALB 3RWBA 3SR3A 4MMYB 4B0PA 1XMIA 1K75A 3EXIA 4Z9AA 1DT5A 3C8MA 2HCBA 4FBLA 1QRTA 4ZCLA 1Q2XA 1ESEA 1QQ6A 1UWKA 2J0UA 3LHFA 2YDYA 5TT1A 4INZA 1Z4MA 3PKIA 4MS1B 3UK2A 1CVLA 3GZJA 5HQTA 2NX2A 3V9PA 3NOVA 4UREA 4DJTA 1N2BA 2C9DA 2CVZA 4G26A 4XB2A 5FQOA 4ZI2A 5I7WA 5IM4A 1JECA 5B2EA 3ETCA 4ZCPA 2C8JA 4QBTA 2HPHA 1PO7A 1ZK0A 4NZMA 4JL5A 4YRLA 3T52A 1M0WA 4HYQA 4KODA 1OROA 1NVTA 2C5HA 4PS1A 4JQYA 3WWCA 2I4NA 1THMA 4RADA 1RRPA 2CVFA 3IT2A 2MSEB 2QIOA 4PYMA 2QSJA 5SY9A 2ZSJA 4G07A 4JOCA 3UJPA 5DNUA 3O95A 2I8CA 4OHFA 1ULUA 1KYQA 3IV7A 2IYUA 4I5EA 4N12A 1L2TA 2OHJA 1QG6A 5CD1A 2Z8YM 1POXA 1ZIOA 1FYXA 2HF9A 2PX0A 3CH6A 3PHGA 4M6WB 1IBRA 3U09A 1ZIPA 3SR0A 4FFPA 4QSHA 4LJ8A 2Z6AA 1WUTA 3RC9A 4XQ9A 3EGXB 1TYZA 5HUJA 5IS2A 5FFMA 2JIZA 2MSWA 3O2SB 4LVOA 5GZ6A 2C5EA 5IHPA 2PHZA 2YC2C 3EXAA 1JBEA 4Y6PA 4KUEA 1J90A 1TA0A 1DC8A 3TFWA 1YJXA 4BFCA 3C5WP 4RVNA 3FX2A 2HIAA 2I3ZA 5A4JA 5KU1A 2VH5R 5BVHA 5KYNA 4P86A 3P19A 3UY4A 4RZUA 4MV7A 3A3OA 2Q4RA 1E98A 3KC2A 1TVKA 4C3UA 2TMGA 2VYQA 3QH4A 3VH4A 1E9RA 1H5UA 4FW9A 5JSZA 2QGNA 4OUDA 5JDIA 3CX8A 1TMGE 2ZIEA 1PR3A 2PRKA 3NW9A 1XVLA 2HRRA 2OBMA 3MF4A 3TVTA 1E4VA 1E2BA 3KZ1E 3R3YA 3LY8A 2BDUA 2NTJA 3C8HA 3PFFA 1ZH6A 3U3ZA 5AKEA 1K6MA 2AI2A 1KYVA 2YHUA 2PIDA 4YIKA 4HC4A 2HDNB 4NRDA 1D03A 1KMIY 1OT5A 3M5PA 5FI0B 2WJ3A 1RXWA 4XM1A 1J2TA 1F2VA 2V98A 3AFGA 3GLHE 1YHYA 5BW5A 1T5OA 1EB8A 1L4MA 2H0RA 1WHSA 2CZCA 3HFJA 1NONA 2QU8A 4G0ZA 4G1MB 3RYCA 1PG0A 1U0HC 1ZJ4A 3D7LA 3KAKA 3O9ZA 4MO9A 2GHQA 4M1MA 4TUYA 4UHHA 3FOFC 3LT2A 3VR2D 1RXCA 3DM9B 3HXMA 1YA6A 1MW8X 4C2TA 4IJ6A 4IXDA 1NBAA 1O97C 3FHTA 4OXNA 4OKSA 3EEQA 3NJ4A 1I7NA 3V2IA 2G4VA 1U0JA 3AL3A 2LV8A 3CR8A 3HN6A 1ESMA 1XTZA 4X00A 1PS0A 1W46A 1Z3IX 2FPPA 2G8NA 4JLPA 3U6KA 2JD0A 2X3FA 3FKQA 1VE7A 4NI5A 5K8TA 3ECSA 2IZOA 4FIZA 1FFBA 1A7KA 4EO7A 3SVZA 2YHBA 4GLBA 5C51B 1E6EA 1IC6A 3GD7A 2KHZA 2UZ1B 4H3KB 1OX4A 1UFKA 1S1MA 1NVMB 4W1RA 3Q8MA 1RE1A 4CL8A 3CT4A 1ISFA 1QBGA 2H4FA 3DNMA 4LDNA 3VZSA 2HPZA 4AECA 3GGJA 1FX0B 2O7QA 1S8NA 4JL8A 4DA7A 2PGJA 4ZVRA 3CR7A 4ENWA 1SU8A 1J09A 2C1XA 2IGTA 1C7EA 2E0IA 3SSNA 3ZWKA 2VNKA 1CRLA 3QG1A 5EEGA 3KQUA 2WDZA 3PNOA 4NDZA 4WRRA 4CL0A 4EUHA 2Q49A 5IZ4A 3QV2A 1E6CA 2AUNA 3DL4A 5LQSA 3I2IA 1KEPA 1O8CA 1R0WA 3LZCA 4NG4A 2DM6A 3HSSA 4HNTA 3JD2A 1X38A 5G41A 5LZ5A 4QVGA 3JAWB 2HU8A 5TDHA 2CLDX 3ZVLA 1SOWA 4YXFA 4FHDA 2LBPA 4IIBA 2Z5VA 1QE5A 2W7TA 5HZKA 1TM3E 3FUCA 4BP9A 1I4LD 3I1YA 2W2LA 1QTNA 1T5TA 1JAHA 2DCUA 3ILHA 3ZS8A 5HM8A 5JPCA 5KTNA 1SKBA 3NM4A 2FDCA 3DCJA 2VC2B 4OCZA 5GJBA 3OEWA 1JR2A 1GG8A 2QDKA 1E0SA 1MO3A 2B0CA 3GLSA 2P2DA 3IURA 1C8KA 1CB7A 4PCAA 4DY6A 2AN3A 2A0XA 2H17A 1QX3A 4O0MA 5DOZA 4V1CB 4B3CA 6NULA 2HHCA 2OKGA 2H1OA 4W8OA 4BNYA 1USGA 2G0NA 4BNNA 4CLRA 5ADUS 3TAUA 3H5LA 4ZTZB 1HDCA 4XGQA 4BV9A 5T4EA 1A2BA 3G5LA 3WLRA 3U0BA 2V6FA 2IVZA 3R24A 2QRVA 2Y6VA 1D04A 3W5AA 3UIEA 4IDOA 3CLSD 4LNUB 2GHTA 4MCAA 3TXXA 2RGYA 4YCBA 5ALDA 1PGOA 2WIBA 3FM9A 3SXUA 1JHAA 1H65A 1F60A 1NLZA 1Q3KA 1QBKC 3KZKA 4G65A 1YWGO 4JY7A 3U4MA 3Q6MA 5FBKA 4AJ2A 4JB0A 3K09C 2WLTA 2P9GA 3VDRA 3ZKWA 1YRQA 5K05A 5KJ6A 1FZQA 1OB2A 4MI9A 3VI4B 2JFVA 4KPUB 4O2LA 1KDYA 3SNHA 1R4MA 3ITDA 4DOMA 5JSUA 3KZXA 4LEIA 4JLKA 4LMPA 2BFMA 4Q9LA 4LFCB 4EYEA 4JGBA 5KYUA 3L40A 4HAOA 2R86A 3MGBA 5D7NA 4F12A 3HADA 3TZQA 1FC0A 4UQLA 3DWEX 1T91A 4FHCA 4F9TA 1X7ZB 5BMVA 1C1DB 4DARA 1G17A 2ID7A 1D0VA 2RK4A 4HAYA 3IIEA 2Q3HA 3T9AA 4HAWA 4W5OA 1QZ3A 4ID9A 1N5KA 4PZPA 3WJAA 4URVR 1OR8A 3A4NA 1BFKA 3EGCA 1CRWG 3JQ6A 3E8MA 4Q5IA 3Q0IA 1GZHB 4D1YA 1SR8A 5JBQA 4DLZA 2BZGA 2A1UA 3E2PA 4UXHA 16PKA 2IPMA 4V3CA 3D6UA 1K5HA 2QZ9A 5FADA 4KO8A 2VJMB 4F5YA 4LXGA 2X8JB 1L4UA 5EQJB 4HVLA 4M9SA 2GPWA 1FL9A 3H11A 4W8HA 1QGYA 3V00A 3I6BA 1W85A 2ENUA 4IZOA 4YT8A 5JDCC 5JD6A 3RJ5A 5K4GA 1E96A 4MKZA 2XY4A 4HWRA 3V1KA 3SQMA 3D7MA 3EAFA 4DN6A 3N70A 1HTBA 2IPOA 4D25A 4OP3A 3ZLTA 3ST7A 3HYNA 4G01B 5DCUA 3TO5A 5HK9A 1S2OA 2XRMA 1XDGA 2H2AA 1GGKA 2OWDA 2ZYDA 5HQJA 5KX5A 2GJ4A 4DMMA 2EX4A 2OMKA 2ASEA 3E9EA 1YZUA 1WBJB 3UT5B 1DO2A 1YZGA 3BM5A 2X5OA 3KD3A 3IP9A 4LBVA 3WYDA 4XIIA 4H17A 2SBTA 3MNFA 4MV1A 3W8DA 3ROQA 3QFRA 4AZ3B 5K0FA 2IF0A 4KHZA 1UQRA 1FSZA 4HPXB 2QTBA 4AURA 5LYJF 3PXCX 4Z2YA 2G1UA 2X7JA 1KAEA 2EFYA 1XCPA 1HT0A 4GM4A 4AU1A 2I2AA 4LFBB 3CJTA 2YWFA 1JG2A 3AIIA 3N58A 4TLBA 4TWZA 5F5XA 3W7VA 1ZISA 4LRWA 3H8SA 3FZEA 2FUCA 1RCUA 1OI7A 3QMMA 4IXWA 3AF2A 5JNVA 2H4ZA 3SI7A 4CMJA 1HEIA 3T4UA 1GJRA 1WEHA 3LXMA 5EGNA 5BSVA 4RD6A 3DTYA 4F4UA 4WJKB 2JANA 3OIUA 2W0MA 2I6TA 3EPKA 5IAOA 1E4YA 1MDBA 5HGJA 4CCAA 3T3DA 4OGKA 3E9MA 3ED5A 5BP7A 3WFZA 4E3WA 3U7IA 4MIKA 1XMQB 5KYXB 3QVSA 3OZDA 4A15A 4MSUA 3MJFA 4WA7A 4B32A 4E94A 3QVGB 2ZI6A 9ABPA 4PYLA 3TGLA 3A0RB 2NYRA 4IWYA 3THRA 1YCGA 5J43A 3K2EA 2C99A 1DOHA 4YACA 1VI5A 4O0LA 1F3OA 3VYUB 3EPPA 4EUFA 1UPUA 3K8OE 3TJMA 2W2NA 3ER6A 2Z2XA 3EXHB 4NJEB 2NSJA 4RPGA 1YUMA 1WULS 4O4JA 4EMBA 1OFVA 4BNTA 1YBHA 3IGFA 1BX3A 3KE8A 5CBPB 3NUQA 4EJMA 4LHZA 5BQ3A 1KMHA 3O1IC 4R1SA 4A2QA 5JAPA 3WADA 1YQWA 5TXGA 4YX9A 5CW2A 1KVSA 2LUOA 2QYHA 2Z9CA 2QD5A 4MV4A 4XEHA 4N48A 4ZD6A 3KFVA 2OAP1 3COJA 2L82A 3MINB 2OZEA 2BTQB 2XIQA 4N5MA 1JFVA 5CYOA 4MWBA 1RCFA 5JXIA 3IAS6 1H3EA 1GPDG 3Q3IA 1TRHA 3SAJA 2P9ZA 1W2WB 4EO4A 4F5WA 2ST1A 2Q6OA 2WF7A 1YMUA 3FYUA 3H87A 3A6LA 4PN3A 1GTL1 2JHAA 3F5DA 5ABPA 3B89A 1GUDA 1IMOA 1B6TA 1OCEA 1YRWA 2G9ZA 1JQKA 2MINB 1EESA 1JG7A 1SA0B 5B1IA 3WHLA 3H13A 4EELA 1CSEE 2QMZA 5B1SA 3SQDA 2VAXA 4S12A 3HMQA 2ZKIA 3T5BA 3V1LA 3DAFA 3CEPB 1D1TA 3I04A 2P27A 4Z5XA 3G8DA 1N57A 4B7XA 4C04A 2VQEB 4UW9A 2BFNA 3GVHA 3IKTA 3ORYA 3FPEA 3ADPA 3BZWA 4X45A 2BEKA 3I62A 2PR7A 4XPIA 1ISJA 1P18A 1XRJA 5EZQA 5FTLA 4MW5A 4F1JA 1JKJB 2WFMA 2DCMA 1Z47A 4O4HB 5FHRA 5GM2A 4QAJA 4EHHA 1W36C 4XIFA 3KPUA 4OBBA 1X7HA 4MHTA 4LJLA 3GMTA 1B8VA 1GUBA 5EZYA 4PY2A 2DFNA 2QLJA 5E3JA 4R8SA 1JE1A 5JPIA 1RZRD 3PRKE 4NZPA 3EH1A 4JN6B 4TLDA 1EVZA 3X1JA 4IXTA 5A05A 3TBFA 3K31A 5DCWA 1OASA 2A92A 2FSVA 2WKRA 1FDWA 3PSHA 1JBKA 2D2VA 5ALQA 3Q7QA 4P83A 1OC2A 4J7AA 4REQB 1CJKC 1WNTA 1E3MA 5HKKD 3ETJA 2HIHA 2VUHB 2A84A 5B37A 4F38A 1Q7GA 3H8WA 1NN1A 5L3ZA 5IF3A 5K03A 4CKZA 2ODPA 3KT8A 4HAXA 1C9YA 4E32A 4F97A 3RUIA 1IU9A 2XB4A 1OXMA 3TJZA 4CF4A 5IDWA 2ZE8A 4IH1A 3SJAA 1XDWA 2IF2A 4AS3A 3VYVA 4YJDA 4NMHA 1FE8A 1X1AA 4RY0A 1F0NA 4RLHA 3V8VA 1LS1A 1E2UA 3NT5A 3IDAA 4CKEB 2O5VA 3DLTA 1G7CA 1E66A 1ZNWA 1T2EA 3SJZA 2Y0EA 1S0UA 3GZ4A 4D9EA 4LC9A 3FDXA 4S04A 2AYXA 4Z0PA 4YJGA 4MINA 2PRZA 3K9NA 2WIFA 3RI3A 1JZTA 1YCHA 2JDID 3GRKA 3QXGA 4XYMA 1UEIA 1B0UA 2AN9A 3ICOA 4YCMA 1XB2A 3AM4A 4OFZA 2Z57A 3HFGA 3WGNA 4P7FA 4MQMA 1PJRA 3AOEC 2IY7A 5U4QA 1OWNA 2JLCA 4TS4A 3RRJA 3F2IA 3GF4A 3OPYB 3QPCA 3P32A 2QYTA 1SVUA 3DEHA 2FP4A 5AI0A 5AI6A 2GZ2A 4L78A 3OOJA 1XRNA 1F4VA 1YVEI 3RUHA 3CBGA 2Q3FA 2F2TA 2MWMA 1RW4A 2EFGA 1KBOA 3DFIA 2ODNA 2W37A 3W6UA 5FYDA 4HGZA 1SUPA 2B1IA 5HBRA 4KITB 4IHAA 1WF3A 2OUKA 3MTIA 3FCYA 3V4SA 1ODTC 2DSTA 2FGKA 4AP5A 2WUDA 3K96A 4U63A 5JBIA 5AJWA 5EXXA 1LPOA 1RXYA 2IOYA 3E3NA 1DSSG 1SVLA 2YY6A 3CZ9A 3HP7A 3ILSA 1P1RA 4FGZA 3PT5A 2QTAA 3D4IA 4HH0A 2HJ9A 1Q7BA 3IT3A 3K1JA 5EI5A 4OI0A 1II8B 3GG2A 3GLFE 5KYVA 4P31A 2JJMA 4GGOA 3SYTA 1YKGA 5H0IA 3V80A 3QFCA 4UFNA 4X65B 3K0KA 3UHAA 3SS7X 4YALA 3ICCA 4BN4A 2H0QA 5LD2C 2DEUA 2H5EA 3IVCA 2FR8C 1JPUA 3CIOA 1GNVA 3LTEA 1JPNA 2PZJA 4U6SA 1G8JA 3M34A 3QWFA 5E0OA 1LH0A 2C3MA 4N01A 3L7DA 3BVPA 2G25A 1VHWA 1N33B 4JYAB 4YJ3A 4ATNA 1R0LA 1YQUA 2CLSA 3KPYA 1BE8A 1CUVA 5DN6D 1K89A 1GTG1 1C0LA 1DC5A 3NVDA 1EE1A 4KRXA 4X6UA 1RJEA 3ZW8A 3WA7A 2I3BA 4B83A 1M2FA 3AFIA 3TD2A 1AQIA 4UNRA 4XRGA 1YE8A 3C6YA 2LXNA 4RX1A 3D6AA 2ZYIA 3UAWA 4DLNA 5KMGA 3G89A 4ER3A 1VHJA 1AKNA 3KB8A 1GVHA 4QXAA 4R7TA 1RYZA 3RSHA 2W22A 1XKLA 1N1MA 2ZIZA 5AK3A 4BOYA 1EFVA 1DV1A 2WYWA 1YBAA 5J23A 2Q1UA 3VYTB 2A0YA 1M6VA 4PSUA 5EINA 1HE2A 3U48A 1I2BA 3STXA 1TCVA 4MUGA 4DC0A 4H6XA 3USES 4COKA 1RC0A 2RB5A 3TDMA 2ZB3A 2FSIA 3AEYA 3CPEA 3DHWC 1Z25A 1AUPA 4OJMX 3W2TA 2ALJA 3P94A 4M8LA 1VKOA 4RWEA 5A9TA 1XZLA 2JARA 4B45A 1KYTA 3FPGA 1AKMA 5AVKA 4JITA 1RI1A 3FSEA 3SYNA 3OQIB 4UXJA 2G88A 2XADA 1R2QA 1RJ9B 1YI1A 3JQDA 2IYSA 2G67A 3L0IB 8ATCA 2R6DA 2FEOA 4QZVA 3NBKA 4ALMA 1QX4A 1DU4A 3P0HA 3MS7A 2V4UA 3DE0X 2VXOA 3VR6D 3CX6A 2CYBA 2EEZA 5AICA 2CVQA 4KFUA 3UB3A 4QJBA 4BNIA 2IUYA 2PSJA 2N1BA 4R9NA 4ER7A 3BQ9A 1U5BB 3O0TA 1U81A 2ZJOA 1QRAA 2H06A 3UWOA 4Q3CA 5KDLA 4EX6A 2I8AA 1T2UA 2DPYA 3IBFA 4K2AA 4PEVA 4YJHB 2FLWA 3TEFA 2R6JA 2GLTA 3ET5A 3F98A 3HUDA 4ITRC 3VNSA 3ZDZB 4D9HA 3LZ6A 3PNVA 3A6GA 4TV9F 2BHNA 4FE4A 2DBYA 2RCNA 3S8EA 2W6OA 4QYTA 2JFWA 5B2FA 2OCGA 3ZWQA 4OPMA 5FUYA 1IRIA 4GOJA 3V34A 2G1KA 4IJWA 4G5RA 2J7KA 4BY9E 4CBVA 3SLGA 4DF3A 4BRSA 4OYHA 4XWOA 1IZ0A 2G71A 2JFPA 5FKJA 3ZZNA 5FR2A 5IBRA 1ZEJA 2FNAA 3TLKA 4KOAA 5TPWA 3HBAA 3JWGA 4MW0A 1THZA 4EBFA 4F45A 3G3EA 3A4LA 5FYQA 1VPDA 2EARA 2NADA 3ZHSA 2W4QA 4JDUA 3KZNA 3BBPA 4F6RA 3DJFA 4PX3A 5CLLA 2GEFA 5HJEA 3N6RA 2YWBA 2IYPA 3IAM6 1IPEA 4GKVA 2NYAA 5BN5B 3RC7A 1QFYA 4PANA 2A0KA 2QX7A 1YDFA 5ALHA 1TZMA 3TPCA 1HRKA 1CQJA 4RZXA 3WB0A 4J0CA 1U0EA 4YQFA 3V1UA 3E27A 1XNJA 4EL5A 3BHJA 4KDRA 1SU6A 2C2KA 2FPKA 3FZQA 3IKVA 1ZVVA 4S1NA 2BMDA 2LR0A 3A36A 3UBTA 4IF4A 4Z8YA 1TMKA 1EGMB 3B7GA 4CL2A 3G0DA 1NVEA 4G4JA 1RLOA 2JFZA 2I66A 3ZYZA 3BJIC 5IZCA 1GV1A 2NYVA 2FPSA 1YZNA 1E8MA 2C8VA 5FOQA 3NONA 3AIMA 3EMDA 2GSWA 2X0JA 1YVDA 3FJ1A 4X20A 3UHOA 4MWEA 3KVRA 1G2QA 2H1IA 2BFPA 4V1CA 5AHWA 3N2ZB 1WMDA 5DSXA 3ZEAA 1TKAA 4OX9B 4PN7A 5HCIA 1F8GA 1BOFA 4KPGA 1V95A 1JLKA 4YJFB 3ZU5A 4C21A 4DM7A 1R8YA 5I7SA 4RPIA 1AMNA 1UK6A 1GL9B 3B3QA 4MVJD 2LIVA 1XNQB 1X14A 4HWKA 3RM3A 3DW3X 1EDDA 5JD5A 1T4CA 4R9RA 3ONWA 3TL2A 1OE0A 1I5RA 3ZU3A 1YAHA 2I7DA 5BWLA 4D0SA 2DWUA 5H02A 2QXTA 1BRMA 1JUDA 1T8SA 2A5LA 3M9LA 4HEA6 1CT9A 3VU8A 5GONA 3DE3X 5D6OA 3WA6A 4BO5A 1ZHOA 3BE4A 3X1KA 1TZCA 2WDPA 1RWPA 3ZKWB 2FW9A 3OPVA 3WGKA 4IEEA 2P9EA 3PXGA 1J0XO 1T6NA 1E1YA 1WVGA 1MX3A 2WG0A 2YJ6A 2YY5A 1Q0QA 3FGNA 1ZA2A 2G0AA 3HO8A 4J2OA 4LXXA 5KWJA 1KZ4A 5LLDA 1A4RA 1CEXA 2V0NA 2XJ4A 2YZ7A 4IHJF 2KJQA 2VDPB 2EX1A 2GN1A 2CW5A 4K1XA 4UKDA 4MUYA 1O9HA 2D2FA 2W43A 4OQYA 1JG4A 4BP3A 1XRRA 1G64A 4LHVA 4OSEA 1QFSA 1XJ0A 1MB3A 1X87A 3BUSA 3LLSA 4L8YA 1SVWA 1E3LA 4CYMA 4DHEA 4FINA 4CMIA 1ZICA 2FSVC 3ZIAA 1W29A 3ZJVA 2RDMA 1Z4OA 1QVZA 2OCPA 3R0ZA 4RNDB 4OLAA 1GAWA 4Q05A 3HCDA 2WZBA 1R16A 1XZMA 1G20E 3FTEA 2RJOA 4UTNA 2DERA 4DRXA 3RK4A 4EQ6B 1F6WA 5LMNB 4TMZA 2FAXA 2JGEA 3UOWA 4BV3A 3NCHA 5JAMA 4U0KA 4CIDA 2Z8YA 5K51A 1Z2CA 3M6LA 1GM5A 2XQJA 3W2GA 2ZAYA 3N28A 5IEJA 4DR1B 5HP4A 1S9HA 2Z30A 1PT7A 3B2EA 1I2AA 2C4TA 1ITZA 5DPMA 3MCAA 1W6UA 2Q27A 3OEED 3PFGA 3T3EA 2IEGA 5CLGA 1DAEA 2QG6A 4I99A 4X6XA 1XEWX 2JBWA 3DMFA 4YAEA 4FNMA 5JXJA 2X1LA 3DEYX 1UPAA 3NHMA 4TXHA 3SC4A 5ARBA 5MN6A 2GM9A 3DEIA 5A5FA 4V24A 5DIFA 1HX7A 2CBZA 3AINA 3BWMA 5F2EA 1UFOA 1PQWA 2HM7A 3K0EA 4BP8A 3CWQA 2GPJA 1RHJA 2FZGA 1L7DA 2CHFA 1H8HA 1JIVA 1LK5A 1R1DA 3MTEA 3O26A 1HKHA 4JWKA 2PZEA 4KGVA 1SFRA 1CYDA 4Z4QA 4IO0A 3PD1A 2YRFA 2GN4A 3MD9A 5C7LO 3HA7A 1XDBA 3RU3A 4C5AA 1N2OA 2CLLB 1UMDB 4B6RA 4AN0A 1IONA 3ILXA 4RK4A 1N5LA 1CV2A 1UAGA 3VSEA 4PIVA 1KETA 5JJBA 4EF6A 3CLUC 1YU9A 3H0KA 1PDWA 1O8BA 1G5FA 1L4FA 2HTFA 5DGXA 1PL7A 4F72A 3QGMA 3A04A 3N8IA 2VP9A 3HYCA 4W9MC 4HATA 3JWJA 3U3OA 1N6RA 2IYRA 1CR1A 1CQXA 2BFEA 1KK0A 3BXPA 1EWRA 3I6ZA 4P5DA 4YXWA 3GLIA 1JQBA 4LFAB 2IZ0A 3B8EA 3GLTA 1X1CA 5THKA 1CDEA 4DCCA 2JLYA 4Y3UA 4ENRA 5COAA 4P32A 4US1R 4GI5A 2QPOA 2IWHA 1WB6A 1DKQA 3TQOA 3VYWA 3LLCA 4FX5A 1G9SA 2D1YA 2XT6A 5DLDA 2UXBB 2QZSA 1RJFA 4PNEA 2BM9A 5HGXA 2JK1A 2MYNA 3FGOA 1S3GA 2GZ1A 4G36A 2IH4A 2ZT8A 1SCJA 4IIEA 3WO0A 1J6UA 1JQ3A 3JSAA 4MPDA 4LTNA 3AR5A 2C9CA 4LJYA 5HDBB 5FQNA 5CDFA 1K6XA 1GFIA 3UCXA 2FFJA 3QA3E 3EVGA 4Y18A 3KKZA 4UC0A 1AHIA 2JLVA 5CAEB 2YWEA 3IAEA 4Q7QA 1A88A 3IUNA 4YROA 3V6LA 3NS7A 221PA 1I7LA 1E4EA 1VJTA 2QRMA 2XQIA 2ZDHA 3I42A 4JUIA 2PL9A 1KYZA 5AUPB 1TYEB 4J91A 1F8XA 4HDRA 2I9KA 2FH5B 3R7NA 1N0UA 3G2QA 2IW3A 3L9WA 3W4KA 1IBCA 1LF0A 2GD1O 2P8JA 4QREA 4QXPA 1WA5A 2HSJA 5A3JA 2WUEA 4WY8A 1ONPA 4Q3DA 2BUAA 3QVWA 2ONYA 1BN7A 4MRNA 4QXMA 3PFKA 1EYZA 2NV0A 4EPVA 3EVAA 3HYRA 3HXQA 3T0GA 3PLRA 1JTFA 3NANA 4P3NA 4A92A 4ER6A 3G2MA 2GBLA 3EC2A 1VL5A 3PV0A 4TRRA 3THWA 1WMFA 2ZJFA 3DVSX 4RHEA 1H4TA 2AK2A 3FCSB 3OCZA 4M22A 4WQMA 5CLFA 3DKKA 5E7QA 1NF8A 1G2IA 1TU0A 1ZSYA 1FXWF 1H8EA 2M2IA 2B20A 2NVUA 1MPTA 1MQ8B 4HF7A 4ZP1A 1RRFA 1Y6ZA 2JFQA 3JQFC 3FKSD 4L8WB 1E1CA 1TQ8A 2GN9A 4CZ2A 4RCVA 2E85A 3TSZA 3N3AC 4EA6A 5H1YA 1MCZA 1NJ1A 1PIWA 2AR7A 3F9RA 5A2QA 1Z8DA 3OA2A 1UBMS 2DBVO 2O19A 1M83A 1P91A 2QD2A 3A70A 3OPMA 4MWCA 1X6VA 3LBFA 4M1YA 4Y0VA 5C7IO 5K8JB 3R7FA 1X92A 2VZ8A 5H4HA 3UICA 5HS4A 3RFCA 3LV8A 1LA2A 3GNQA 2ZCUA 4W1SA 3OEYA 4FNAA 4U7GA 1LZLA 4TV8B 1YTLA 5HYVA 5L40A 2P8SA 1E2FA 5G3YA 1B16A 4EG3A 1U3TA 2JCBA 2WW8A 3DXXA 5AW5A 2N42A 3FROA 5CM2Z 4P22A 2GZSA 2CE7A 3RVKA 1V35A 2BY4A 4CCYB 1OH8A 2RGRA 1XYGA 2BR4A 2XNKA 3ZIUA 2YC4C 3H16A 4NCNA 4U9HS 3PUXA 1T0BA 4Q4HB 2RHGB 4LMBA 1M2VB 2ONJA 1YULA 1O6ZA 1AKTA 1FPQA 3CWCA 2BH9A 2Y2UA 3H42B 4O2RA 4FHEA 3HEAA 4OV6B 3VPHA 2Z3WA 1ZRSA 1SOAA 1VG8A 2JGRA 3QKIA 2DZDA 5F35A 1IY2A 2HRQA 4RF4A 1WPRA 4B9AA 2C61A 4BNDA 3FPJA 2BMAA 3LQQA 3PS9A 4FDUA 3SKYA 2OXRA 1L7NA 2QTZA 3AGPA 4NENA 2QTFA 4GW3A 1FU8A 5DO9A 1JSRA 1GQQA 4PTYA 4OIFA 4YJGB 5J58A 2OAQ1 4EFLA 3I2HA 2XUFA 2YHAA 1FRVA 3GV0A 4QOSA 2CVPA 1Z33A 5MF6A 1OYYA 1T9ZA 3QPDA 4KJZA 4I1OA 4GL2A 4F21A 4B4OA 4LJAA 3NNDA 1PT6A 2GWHA 4EI9A 2NUAB 1XAJA 4O02B 4YT5A 4XUDA 1EIZA 1SHUX 2C5BA 1GU0A 4M7RA 5I7FA 4TZ6A 5CNIA 4IUDS 1T6BY 2H18A 4ZDWA 3V97A 2HWKA 5GGXA 4AY2A 3QP9A 5L4SA 1XMXA 1D4ZA 1DCKA 5D84A 3HFRA 5FWXB 2CZGA 1F38A 3T3PB 5IJZA 1RBMA 3V48A 1E64A 4P2GA 1PFKA 3MMNA 4NOKA 2OE2A 2OHHA 3OIYA 2XUAA 1EX1A 4PIPA 4QBKA 4X5OA 1HZZA 1V8ZA 3SK0A 1J0EA 3P4YA 3E4DA 1IUNA 3EZ6A 2FOXA 2OCYC 3OOWA 1YMVA 4B33A 4BUZA 4YMWA 1FP7A 3QUTA 2G04A 3M1LA 1SKYB 4FGUA 3GJ4A 4WFIA 1ZI8A 3ED1A 4QDXA 6Q21A 1W5SA 5JS6A 3AWIA 1QP7A 1TYBE 2H29A 3T7TA 5BSHA 2I1LA 1IG3A 3SQWA 2WIAA 3QX7A 3U4IA 4V1CI 2NZYA 4DDUA 5E4FA 1YKSA 2OGTA 5DHPA 4TL6A 2LP4Y 4GWGA 2P9JA 3BTVA 1KMNA 1MENA 3QWBA 4N49A 1EE9A 1KAQA 4QOIA 5IJ9A 1FFXA 1WUHS 2DG2A 1CZNA 2QRQA 4M8KA 3OE4A 1LQTA 1DWUA 2W2LD 5AM4A 2QAIA 5CFOA 4EJFA 3EOAI 5C3MA 3AHFA 2IXBA 1ORRA 1UJNA 1EHCA 4ITUA 3KE9A 4NU6A 2ZDGA 1RWQA 5A7GA 4LGMA 4BTLA 2GRAA 5KVAA 3PQFA 1SUWA 3GZNA 3HCRA 4XYBA 1O95D 1PP4A 2PRSA 2HBQA 4AZ0B 4ZA2A 4FCWA 4ZAVA 4BMDA 2VCYA 3BFKA 4ES6A 1SXIA 2DQKA 3JVDA 1TK9A 3ZE9A 3GMIA 2EKBA 3SC2A 2FW7A 2VH2A 1EZ4A 1XFAA 3B51X 3MIZA 1R18A 3PEEA 3A3PA 1KIFA 2FJPA 2VP6A 3Q85A 3VX3A 4IO1A 1FLAA 2WAMA 2H57A 4NCXA 3CLRC 3I1FA 1KKUA 3WMXA 2H2IA 1KVTA 1ZBDA 2FCRA 1ICIA 4RO0A 4MO2A 2WWYA 3CE9A 4BL5A 5DCYA 4RL4A 1YB7A 3IOEA 2FWPA 1Y63A 2C57A 2HA0A 2OESA 3D8RA 4NAHA 3IB6A 4RA9B 4WY5A 3RFXA 3TQSA 4PBTA 2ZOSA 2QUKA 4LRYA 2HMUA 1PL6A 4WVLA 2QE7D 2ISCA 1NBMD 3G8BA 4MQEA 5HF5A 2DB3A 1GGEA 5CB0A 4F4DA 3PHIA 1A97A 1CY0A 3LDFA 2XRZA 1PWHA 1T3SA 1V4VA 2ZIUB 4HS4A 3JQGB 4JCOA 5MN5A 1IN4A 2QUAA 4D74A 1YSCA 1WW8A 4RPLA 1TU3A 1USUA 1XQ9A 4KAAA 4PTLA 3RT7A 4B46A 2YV5A 2R66A 1TQ2A 3AHHA 2ATIA 2IHKA 3OETA 4WD3A 5DYTA 3I5AA 6ABPA 3F4LA 1W73A 1MB4A 1ZVJA 4PSAA 2EP8A 2VUTA 4A0QA 4JI7B 1WDMA 3OJOA 3MUOA 2D0OB 2VQSA 4ND6A 1WMBA 2CFOA 2QLFA 4AMGA 1JFFA 1HFEL 2XNSA 1GKUB 2DUMA 2Y77A 3QELB 4X1OA 5DDIP 5DSTA 3ES9A 2B2XA 5BPFA 4ALIA 4B82A 3VAZA 3CB4A 2A5YB 4XXHA 4YO7A 2DR2A 1BX0A 1IAQA 5ERYA 1KE1A 5B58C 5EJAA 3O5AA 5LXTF 1P9NA 3ZXSA 1Y8RA 2BE9A 4MI3A 2WTEA 3E5HA 1SCNE 4D3SA 4UATA 4L8FA 3PI7A 3HBLA 5DI9A 3THOA 1BX1A 2IKSA 1NMXA 3THYA 1AHHA 2PBLA 4WSOA 2PSDA 5JLAA 4OHKA 3O4IA 4R2IA 3MRVA 3C6XA 3MWDA 4GI7A 3RHFA 1V4NA 3P96A 1DTSA 3E2IA 4WCFB 4EB3A 2WA1A 4A6EA 1KFJB 4D3YA 3Q40A 5JS8A 5DGHA 1NY6A 4BO1A 2BW0A 5AH0A 3W5SA 1LSUA 1H1LA 4MRVA 3DTVD 2GAIA 1BXRB 1ZNXA 3PX2A 4KWHA 5AK5A 1JG3A 1TADA 1HDGO 4JLMA 1NXXA 2OOSA 2YIJA 3BJRA 3JZFA 4U4AA 5EWJB 3RGWS 1HO3A 1FXSA 4H7EA 4BLVA 1TQ4A 2JH3A 3ZWWA 5AJYA 1XJWA 4L5YA 1FX1A 4HT3B 2VLIA 2RBEA 2AG8A 1Z7WA 2RARA 5D7BA 2D5AA 4WLOA 4MMXB 4DUGD 4RTQA 1P1KA 1THGA 3SOZA 5LYJB 1P45A 1T5DX 5IYZF 1CUGA 3ZDBA 1ZD1A 5FAKA 1TIPA 1KDZA 3SR4A 3VVMA 1FRQA 4IKPA 1GPAA 7REQA 4C22A 5LNK6 1A76A 4W1QA 3N0TA 2OV4A 2KPOA 3OIDA 4NJMB 3B85A 1VE3A 2QJRA 5ESXA 1DRVA 5GJVC 4Q3AA 3ZCQA 1QGAA 4M1KA 3KYBA 4UBOA 3GEMA 3CS3A 4LKRA 4PG4A 2WWHA 3MILA 4V0OA 421PA 5THQA 1QFMA 2FFBA 3KR9A 2FMIA 3AF0A 3LX4A 5JMPA 1V2HE 5KWIA 3PF9A 3T34A 3TL3A 5IVHA 4HFRA 2CJFA 4N3BA 3W5JA 1X2EA 4LGCA 3NVAA 4DV1B 1CEYA 2PMDA 1IPHA 1I2MA 1YL7A 1K3UB 3RTBA 4X1IB 1T9BA 3SEQA 2V9ZA 1D0SA 2R00A 4TYYA 3V2GA 1HE5A 1SCQA 2H16A 3PDIB 1GDTA 3WAJA 1M9NA 1JR4A 1QHXA 1T5BA 2OM6A 3FRJA 1XDZA 5A02A 4II7A 5F78A 1KJQA 3DYBA 3MIIA 4ZI7B 5L8VA 2H85A 1NM5A 3Q41A 2X0RA 2OBFA 1ADBA 3AUSA 2PGOA 1T9HA 3T1QA 2GPNA 3CPJB 7YASA 1XRSB 4ARBA 5L6LB 1A8QA 1MAAA 1F2TB 4KX5A 2G9RA 3OX1A 5JWHA 2X14A 4JBNA 2F3TA 2ZTUA 3TSAA 1CVIA 2LPMA 4B2PA 5JQGF 4KW7A 1G19A 4X7PA 5K0SA 1E9BA 3NPAA 4UTVA 2DOKA 2WM8A 1G9TA 1PX0A 4W63A 2VF4X 3S99A 5HA5A 1Q50A 4KQGA 3PI6A 4ZKEA 2CKDA 3P2IA 3ZV4A 1P4JA 1SOMA 4GD3Q 3EX7C 4X60A 2Z9BA 3QK7A 5DBEX 4Z4CA 4QBIA 1AV7A 3IRVA 3LXRA 4B5KA 1P2BA 1PGPA 2CHGA 3MC1A 1XTBA 4H1TA 4L2IB 3WAKA 2XMPA 4FD2A 1PFVA 3LWBA 5AK6A 3UA4A 5C37A 5CFRA 2J3IA 3KEOA 2B94A 1G6Q1 3K4QA 2HO5A 3DWFA 1D2HA 1DV2A 1E1RD 3K4HA 1GPJA 1DX6A 2V6BA 2ZRCA 5A03A 2EKZA 4MS4B 2RKOA 5ALXA 5A3SA 4OQXA 2HPAA 2A4MA 2AJDA 1JYEA 1X74A 3HM2A 4QQFA 1M8KA 2QG4A 5B5SA 1UC8A 3R0IA 2COKA 2DTXA 4JJIA 1OHHD 2H3EA 4G2NA 4X24A 1S2GA 3GGGA 3IAM1 3PR2B 4QUDA 2XUPA 4BASA 3VVLA 1JWBB 4IZHA 2Z5FA 1V48A 5IH7A 4E2YA 3R75A 2KB0A 4D5GA 4WJLA 5HIJA 2FQ1A 2ZUSA 3A1NA 4HX5A 5CH8A 3KOWA 3WKEA 5HOEA 1BWSA 3IOCA 4TMTA 2XMRA 2GKGA 2W2XA 2VP4A 3B2NA 1P0FA 2A3RA 3D8SA 3HJAA 1DBVO 2XQGA 3MOSA 1JT2A 4GH5A 3RBAA 1J0BA 5DNDA 1WM1A 4R8RA 4CM7A 1A8IA 2K7FA 3ZDDA 3QWIA 3CH4B 3QQ5A 4N8EA 4C4OA 4K9RA 1NTOA 4YAGA 4OA8A 1C2TA 4Q3NA 4PPYA 3I32A 5ER9A 1P29A 1ZGBA 3HHEA 4F4IA 4CEJB 1SEPA 4E46A 3WC4A 3DDHA 3VSDA 4YRMA 4ZDKA 4LCBA 1PS8A 1YHZA 4QBHA 3SF8A 3URKA 3VC1A 4ETIA 1OLOA 3DHYA 4DLSA 1PR1A 1Z5UA 3C5EA 3EXFA 2J5KA 3EXEA 3HJBA 3VXKA 4HDAA 3KSBC 3L4KA 1H6BA 2ONCA 2BN4A 3QF4B 4GR9A 2GZMA 4OGWA 1GNTA 2P77A 3BREA 4MQFA 4PLGA 1T9DA 5FLYA 4D4LA 1Z0UA 2B4YA 4XQGA 9MHTA 1FQWA 3VR4H 2B8EA 4MUBA 3Q3EA 1NVVQ 5J3JA 3IB3A 4P93A 5EHZA 5ENDA 5HX7A 3BK2A 3QMWA 3UAOA 1CC1S 1QNLA 3RKRA 2PV0A 3VNQA 1GRRA 3NBMA 1Q74A 2NU7A 4GIBA 4LWQA 3AHGA 4YP0A 5ADHA 4DCJA 5CFNA 3HKCA 1XBTA 2XI4A 4GYKA 1UOQA 2ZB7A 1PQ4A 1QF7A 3HGTA 4RS4A 3S2EA 4D9CA 3KQTA 3F46A 1ILEA 4ZQGA 1RCTE 3NZEA 3INRA 1FS5A 1BNCA 2YWXA 5E6UB 4R8VA 2AN1A 2POQX 3OZRA 4G37A 5CRIA 1QRDA 4YR7A 1NU8A 5H9VA 1KI7A 4CV3A 3EBOA 3QHAA 4JYBA 1TB4A 1PNRA 3T3MB 2IV3A 2OL4A 3W77A 4M21A 5JS1A 3QMVA 3L7KA 2FPGB 4ENVA 2I1QA 4YMHA 4HNRA 4KH1A 5D3MB 5HE8A 2VHYA 3ELBA 1SRQA 3DZDA 1UBFA 3ZZ0A 5H3LA 3G0BA 1UBGA 4EB6B 1OAKA 2COEA 1GGNA 1KBQA 1QS0B 1W0JA 2QEQA 2ZJ1A 4DV3B 1EK2A 1XCGB 1QH0A 5CT8A 5EPEA 2IYYA 4GP7A 1U04A 4RABA 1EXVA 3QPUA 1GU7A 3AI3A 3DGFC 4EO9A 3NWBA 4RQUA 4FKMA 4I4CA 2JKVA 3FPBA 1TPYA 2H2DA 2BFFA 3EQ2A 4DLYA 1UEJA 5FBZA 3D8HA 5CH3A 3DE7X 1KI2A 2V55B 4ZAFA 4ZWNA 4B4DA 1X8JA 1ND5A 1P7PA 5HKLA 2PJDA 1LPSA 4W9RA 3HLYA 3IX7A 3KTDA 1QHYA 1D4AA 3L7IA 2Y1CA 1JSZA 4PZDA 2TYSB 5CIQA 2BDTA 1LI5A 1OGJA 2XUKA 1SXPA 4CM4A 3HZHA 3ZH9B 5J4HA 3HO6A 4P4SA 1W35A 2XB6A 5TMBA 4OI1A 4ZT4A 2X6QA 2FFAA 2GDZA 1CZOA 2CHUA 4J0EA 3PC8A 1WCV1 2PKXA 4RACA 2O0KA 4RV4A 2O8FA 2OBNA 1N6PA 5CW1A 4LXHA 1LB1B 3SY8A 1I51A 3EZ2A 3EF0A 1GCOA 1YI8A 3HKBA 3R3JA 1MA3A 5E6RB 3RVNA 1SN7A 1MAWA 4FYPA 1YIAA 1LNSA 2Q1SA 4XYGA 5FFFA 3ROEA 3VC7A 2RJ3A 3WIBA 4UULA 1FJHA 2AEJA 2PAFA 2RHRA 1ZJJA 1M54A 3K1ZA 3RYTC 1PWXA 1EWKA 1UPXA 3BDVA 3AMVA 1ZCZA 5DW0A 1CE8A 3OZIA 2JGLA 2ONKA 4KXMA 4WOBA 4B31A 2OG2A 4D80A 3OO0A 3VI3B 1F7VA 2XAAA 1ZYUA 4RS3A 4W7HA 3ZHOA 1OFGA 5SICE 4CDNA 1KERA 2AZMA 4KAFA 3TOCA 4CCYA 1BGVA 2NUPA 2CUNA 1VIVA 3QPBA 1TCCA 1V1JA 4CM8A 3D8NA 4Q4HA 3M89A 3T3NA 3WKBA 2YVKA 3V55A 2UZ0A 3ERCA 3HDJA 1IZYA 4BAUA 2GDJA 5M7EA 3COVA 4C7MA 1NKTA 4BNXA 5KJFA 4GKKB 1ZITA 4JOQA 4F2GA 3TOZA 1NJ6A 4EI2A 3JCZA 4P3YA 1I01A 4Y98A 1NXSA 2YASA 1M6YA 4A6XA 1YCDA 3HSYA 3GO4A 3ABQB 4CDMA 4WDQA 1VPVA 4L3VA 5EIHA 3SZGA 4HAIA 4IDGA 2QT0A 3L79A 2IHBA 1JE0A 4ECAA 5AVTA 3R9IA 3DZFA 4B4WA 4D9IA 1EI9A 4PZYA 4NNJA 5AVOA 4F7WA 3REGA 2CUZA 3SGLA 3O8OB 2J3DA 3SQXA 4RD2A 1ACMA 2YZ2A 1B3BA 2YBDA 1W93A 2REOA 4V0MA 4P5EA 3Q2OA 1PEAA 2XV1A 3DBRB 2AK3A 3UJ7A 5K0BA 3CVUA 5C5DA 1AHPA 4QYSA 3JD0A 3RT9A 1UZMA 4UUMA 6CHYA 3LPLA 3KJGA 4WE3A 2OHFA 2X77A 2VDOB 1NBMA 2R8OA 4NU8X 4Y2YA 5A4IS 2WZCA 5AVWA 1FTSA 2NO9A 3A1VA 3W6PA 5H59A 1QZZA 1U2RA 1XJCA 2ZIAA 5HF9A 2YNMC 1YQXA 1LWNA 3BEDA 3C3AA 3DDNA 3RSFA 5IZCC 4LYGA 3LQYA 3GUHA 4AQYB 1E2KA 1SU4A 1T8WA 2O2SA 2XWQA 3K0SA 1UFRA 1FDTA 3NC0C 3O4JA 3T7EA 1QR2A 2QWXA 2FHSA 3IV6A 4H6PA 4G5QA 4O3FA 1ZP6A 1ZXLA 3LDGA 4D44A 4I3HA 4UNIA 3LHKA 2PFGA 2I6QA 4OG2A 4Y1RA 4IOJA 2NVBA 4ENSA 5CNKA 3EWNA 1L6RA 1F2UB 1V4BA 1L4EA 2EKQA 1HFJA 5JDIC 1DCMA 1O94A 1R6VA 3OZEA 4NULA 4BCDA 2JIBA 1QR6A 1GN8A 3UGJA 1RWNA 3VGJA 1NW6A 4JSTA 4ZHQA 2PNJA 3I5UA 3VPDA 1ADJA 5JMOA 3L1JA 3BCSA 3E1SA 3JS5A 1VBFA 3T5AA 1IE3A 2ASVA 4RLQA 2RGGA 2ZYWX 3LDHA 4IHJA 1Z2DA 4ZXFA 3VM6A 3R44A 2PWPA 4RTKA 4B2LA 1KDRA 2IYVA 4BMSA 3KDSE 1UANA 3TQCA 3ZDYB 3CNLA 3S4YA 5A4AA 3I1IA 4HL6A 1GXSA 3GNSA 5FPPA 4KLZA 1URPA 1WCYA 1C30A 1OFHA 1TCUA 4C2BA 1H8ED 2CL7X 2FXVA 3MGKA 4WNAA 1PNOA 1ZKMA 5LQUA 1VA4A 2H9IA 1BIFA 1UM9A 4JJ4A 1K0UA 3FR7A 2H2WA 5EUCA 4KSYA 3UQYS 2FN9A 1TKBA 5IVPA 1NZFA 1I1QB 3A4TA 2IA5A 2IU4A 3G0IA 3KQSA 3W0LB 4CKBA 4WECA 3UTCA 1MFZA 2RK3A 1A7JA 2C4NA 3Q88A 5E4TA 4E88A 3PA6A 2Z2ZA 1E0DA 2CXXA 3TRDA 2XTJA 2R6CA 3EY9A 1JJBA 2R5NA 1C3EA 4DUGA 1GITA 4YLGA 4YWJA 4P92A 3URMA 5EJFA 5JD4A 1Z6ZA 4MK4A 4Q15A 1WMSA 1KIAA 1PZFA 1T26A 1XVAA 2R2AA 2X1MA 3PE3A 1I3NA 1C14A 1YBMA 3MTGA 4I4NA 3KEFA 5AVSA 4OTZA 4PW0A 3D1LA 3D5EA 3WZLA 4S0ZA 2HRDA 4ZVOA 1FUKA 3S29A 1OC4A 2OWEA 4E1BA 3GLGE 1SXJD 3FWNA 4G1FA 3A9CA 2QTHA 3MN1A 4CEHA 3IDZA 1BEUB 2AOWA 1K8ZB 2UUOA 3T9FA 4W5RA 3ITKA 4K9DA 4B87A 2P2ZA 2PU7A 1YDMA 1JFFB 4E5MA 5FOUA 4B09A 5EE9A 4N6OA 1K7FB 1M1XB 1JWLA 4HN4B 4PG6A 2PVSA 1WQ1R 4QDJA 4OQPA 3ZWNA 3HP1A 3S8YA 1YZLA 3AW9A 2W90A 1HF3A 4ODIA 5LBTA 3F1LA 4DV6B 3FHLA 1Y8RB 3M70A 1ODSA 4PQYA 4JEMA 5HBGA 2ZRIA 3D3EA 3S3TA 4B9EA 4BBAA 3QUCA 4NXNB 4HRVA 1B00A 1K4MA 1P80A 3A9UA 4XLZA 4G25A 2CCJA 2WWXA 3DNFA 4WXHA 5IXJA 5FOTA 2GZ3A 2ZTMA 3UFXA 3I09A 4BKQA 4JR0A 1NC1A 5AFSA 3OKAA 5D3ZA 4ZANA 4QDZA 2Z2YA 4MKIA 1K8XB 2BJHA 3D3JA 4JEHA 4KUGA 4Z49A 1EUZA 1RRVA 3GMDA 2GNAA 2YWCA 4ZZ2A 4KNYA 5B53A 1BFUA 1VG0B 3LBIA 3OUZA 4JB3A 4Q66C 4KIGA 5GVSA 1E9DA 2FMFA 4KO4S 4R5MA 2D5LA 1G291 3EUFA 2EKDA 1T2CA 1W47A 4G89A 4OB6A 2B8JA 1IUKA 5K6AA 1EP1B 1AKUA 5CFPA 2FPLA 2QW8A 2ZI5A 2X2FA 1UDCA 3CCCA 2IFTA 1P4SA 3Q5EA 3QW4B 4KOEC 5JLJA 5KTPA 3M4YA 3EVTA 3OCWA 4UASA 4EDHA 3D6VA 3QXXA 1CS0A 1USVA 4AICA 2CWWA 3NFYA 3NEAA 2A4KA 1H5QA 1LW6E 1RQ2A 4MLCA 4D2IA 5IK2D 3FMVA 4HVTA 3W3ZB 3KUKA 1SCBA 3PGMA 5JAZA 3GT0A 4LXYA 3O21A 4XD7A 3JR3A 3KRTA 4TUYB 5IG2A 5D1HA 5MGBA 3HGQA 2HBRA 2XSZA 1BMTA 3KVOA 1JJAA 5K2OA 3BSYA 3DOUA 3ADCA 3CX4A 4LIPD 3RSZA 4YUYA 4LQCA 1Z5VA 4IBOA 1TUBB 3WB9A 1WBBA 1SB9A 2A5GA 1E79A 2BI8A 3DMPA 3OX2A 1HE4A 4TSRA 4D8WA 5F73A 1E3IA 2WUFA 1Z82A 1AH2A 1PLKA 1Y4UA 4HQ0A 4FE3A 3ESXA 4GPTA 4JSRA 4O29A 2QR2A 4OBWA 3JZMA 1CYEA 1S2DA 3WNVA 3E23A 1XQYA 5CD9A 3PIDA 4FOPA 4GWKA 1KI6B 121PA 2D7CA 2JJ2D 2O7RA 2WKQA 3CSSA 5BR1A 4UJ5A 1THTA 4NFLA 8ADHA 1FRZA 2YRWA 1KJYA 3DV0A 5FUWA 4FJ1A 4UHBA 3N5CA 4A27A 4HO1X 4DNPA 2QNBA 2XTMA 1MGPA 2FG6C 4RZHA 1DAOA 2VPYA 1N8KA 3S7ZA 4EHJA 3I4LA 1WXWA 1Y3HA 1FS4A 4KIFA 3SEAA 4Z4FA 4R7GA 3V7UA 4ZYUA 1JDVA 5J47A 2F62A 4OMDA 1F14A 3BULA 3GAAA 1OXXK 4IPTA 1C7JA 4ERNA 2H4XA 5DTRA 2NO7A 3C1OA 3GEHA 3V4FA 2VJAA 4DR2B 1GYPA 1QGUB 3UNXA 1CY8A 3AY6A 3B1XA 1RBZA 3JQPA 1P62B 5EJMA 3D1VA 1ATZA 3IERA 1L4HA 3WDLA 3UPUA 1VBNA 3B36A 1Z7GA 1LBTA 4D0LB 3FPFA 1Y37A 3C48A 3C3CA 1E3JA 4ISCA 4KLNA 1UQUA 1L8QA 1BAPA 2R1ZA 4GG1A 2QLLA 2QXUA 1DKOA 2O2DA 4M55A 4YEDA 2YZGA 2CNKA 3GYGA 3PQDA 3PNBA 3FAZA 1ZH4A 3MQ4A 4LF7B 1VXRA 2EZ4A 3DPIA 4WESB 3ZU6A 2C2XA 2SKCA 2GUWA 1UK9A 3LS2A 3C24A 1BJRE 4K0RA 1QIFA 1ZUNB 2D54A 2JIDA 2X0KA 3TQQA 4CLRB 1HDIA 2VEOA 1KEUA 1CTQA 4WL0A 1IDOA 2O2ZA 4EGAA 4O08A 4AIRA 4B6FA 3R1IA 1FW6A 2JCYA 3CRNA 3BD8A 1SVSA 1O77A 2H92A 3OZTA 5KTOA 1SBQA 4C3VA 3B6JA 4IOMA 1HWYA 1BS2A 1QO7A 5DBIA 5AM5A 3LK6A 3UJDA 4B75A 5BXYA 3HV0A 4Y6RA 4F4CA 4LXIA 1YU6A 4MQBA 3SSAA 3TUJC 1QDUA 4KJXA 4LCEA 4P5PA 4FS3A 1E58A 4PLZA 1Q12A 2CBXA 1SBYA 4LTMA 4AY5A 4F46A 1OVGA 3VH3A 4BCCA 2VTVA 4GBED 2HWXA 2OC4A 3PNYA 1YR1A 4B4UA 1C1YA 1SC1A 1DEKA 1W0CA 1Y3CE 3WOHA 4OXKA 5JC8A 3O91A 4UCWA 3MBKA 1B15A 4J6EA 4QUJA 3PPVA 5FCDA 3TKLA 4AT1A 4C4XA 4E1AA 4EYQA 4ESVA 1A9ZA 2CDNA 1NTRA 3ECAA 3SHFA 1PZEA 1U2DA 1X19A 1TUIA 1G21B 3RVSA 2AQKA 3DULA 4M9UA 1ZMXA 5HOQA 5B7NA 2HU5A 2Y1DA 3PXEA 3OUUA 3AUUA 5FI3A 1TAHA 3FB4A 2GERA 3SWWA 3KEGA 5TY0A 4U2GA 4EG4A 5P21A 2Z6VA 3NXSA 1IG0A 1P61B 3QVLA 4I50A 3L1HA 5IKEA 4QTXA 1BCSB 3A4MA 4WN9A 2IZ5A 1GZDA 2RG1A 4HEJA 4FOTA 4WKCA 1X1RA 1V6SA 3P9IA 5AXAA 3T3GA 5LXTA 3EVBA 3BGWA 4GMGA 1EFAA 4XCQA 4JKYA 1TIKA 3QKRB 4HB3A 4LXQA 3P2YA 3PUZA 4NMMA 4UEKA 10MHA 2PUEA 3P27A 3QIVA 3UVEA 5K0ZA 1D1SA 1M2WA 4KR2A 3X2EA 4X1KA 2C7PA 3NBXX 5TQ2A 3ZJTA 2AZDA 3FNQA 4XW2A 3CXRA 3VPBA 2GCOB 1QIKA 4FCVA 2YMMA 4D4MA 5JW6A 4PWZA 3CLTC 1Z38A 3QW2A 2HSDA 5LR6A 3G1UA 5F7JA 2C4MA 3TM4A 5B55A 2P68A 2BM8A 3A37A 4IYRA 4TMKA 1W1WA 2AWNA 2GCPA 2FW6A 1N2JA 2JD2A 1XKXA 4LGVA 4ON9A 3VV2A 3F3SA 4P4GA 3L9XA 2JH8A 1U6KA 2PZBA 3V7FA 1S4QA 2VJQA 2XKAA 5KX5B 2AUTA 3PDUA 3PKZA 3KQLA 2O6HA 4M1QA 2GK7A 3RFFA 1XVTA 1Y1LA 1Q7EA 3K8YA 4TM7A 5I45A 2O8EA 1P7YA 3VU1A 5LIRA 4H7FA 2Z8XA 2QBYB 2DSNA 4CR7A 2XYVA 4E31A 1X3SA 5JVDB 3SPXA 3WNBA 1ONOA 2FEMA 4MYRA 4HADA 2GEJA 4NABA 3WMFA 3CNBA 1V6CA 4MVWA 4DCVA 4P0PB 2ZT5A 3BXXA 2PUAA 4KNVA 4MEJA 4RD1A 1PGQA 5C1DA 3IP3A 2QTVB 4H7HA 5D5HA 1JKJA 4EEXA 4NY1A 1ZSNA 3EARA 5IK2A 4UE2A 2Z04A 1LX7A 3ICQB 2OILA 1JTVA 4HMPA 1M7HA 1O94C 1D2AA 3H0CA 1CIJA 1QPGA 2PWAA 2NZVG 1BXZA 1JA9A 1C0PA 5JASA 5EWLA 3RQIA 3UUEA 5TGTA 3GLQA 1MAUA 2A1TR 1OJ7A 2B5VA 5EWMB 2JKYA 2VJNA 5FP0A 1EK5A 4NESA 1AE1A 2IYWA 4MDFA 1XN4A 1KSJA 1WJGA 3SLRA 1NJ8A 1Q1AA 4JWTA 2C3PA 1DEAA 4I9HA 4NOMA 3ZD7A 3GEGA 1E2LA 4N7BA 3UJAA 2OZLB 5SZIA 2WYHA 1JPJA 2C7VA 2QUZA 4NYMR 5E6SA 1SG0A 2CJPA 3VR0A 4E11A 3ZD6A 3B1FA 3TQIA 3MAGA 1E3DA 4LNAA 3U44A 2JRCA 1I36A 1YZQA 2QD4A 2O8FB 1U65A 2PN1A 5F2OA 3HCOA 3Q8XB 3U3RA 1E1RA 4M0PA 4NK5A 1EQAA 3KPWA 5IAKA 3T5CA 4FX2A 4D0GA 1D7AA 2QZ4A 4YREA 1UMCA 2Z1DA 1VBKA 1E2PA 1Z29A 4LMAA 1Q1EA 1QCYA 5E6RA 4R84A 1F1BA 2MMGA 1JAIA 3WP0A 4WWHA 1G66A 1CS4C 1DDIA 2XE6A 3C87A 4FYMA 3IBYA 4DIMA 1RJDA 4LNUA 2N3ZA 13PKA 4A8JB 3GJXC 1H6DA 2EC5A 3E2MA 4XQEA 1GL6A 1X8XA 3UMBA 5LDDC 4B73A 2CFRA 3LY5A 2V3WA 2QE7A 1JIJA 3RCBA 3A9SA 2OGZA 5F76A 5FA8A 3AR4A 4ZT2A 1OLSA 2VJBA 3VO8A 1QIJA 3ZE8A 3C3BA 1NBOA 4PLHA 2MSNA 1RYMA 4LZZA 3LO8A 3W6NA 1IAVA 3R76A 1KC3A 4Z53A 4CQMB 3QLUC 5KYUB 2JG3A 2MR5A 2R7LA 4GRAA 4RIEA 1VCOA 2O5CA 4IDEA 1NDQA 3FYSA 4Y2GA 4EGJA 2AHRA 5A5VA 1UJCA 4QLBA 1Y7IA 1JKFA 1SBCA 1KP2A 3R0JA 1HK7A 1A9PA 2JCSA 4PGMA 4ZOBA 2XD9A 1GYRA 1WXIA 1Z4IA 4IQ0A 2IC5A 3LHIA 4JUFA 4I2NA 9LDTA 4AMBA 5AVRA 4QTYA 1V6AA 1G2OA 2B9VA 3F5MA 3FYDA 3LNTA 4GNKA 4FS8A 1OXTA 1NP7A 4UZEA 5IAJA 1SCIA 2AXNA 5ELMA 1LC3A 4BFTA 1Y9EA 1MKYA 5EMJA 4DRZA 1A9RA 2DHQA 4O5OA 1RQPA 5C4MA 5FO1A 1RMTA 1AX9A 1NYQA 3P9SA 2Q1WA 4CN9A 4DC1A 3TOXA 4YRRA 4A2PA 2XZDA 3EA4A 3PIRA 5E1BA 3TLEA 2CKMA 1PWEA 4J1QA 4EW6A 2EJTA 3H97A 4B6JA 4BLRA 2X0IA 3CUUA 2LTAA 1OF1A 2NPOA 4HQRA 2D8AA 2XWSA 1Z39A 2JJYA 3AHEA 1J24A 2WILA 1WVIA 3BGDA 4RZSA 5IXSA 4Y9UA 4IUCS 1GUFA 2IU3A 3QVTA 5CVTA 3K30A 5KYWA 3GJSA 1SXJA 4HXFB 3U7GA 1XDSA 4MUAA 4GKBA 3EDOA 3W1VA 4AC9A 2CYAA 1HL3A 3LLVA 5AI5A 5NLLA 4B3FX 2HMYB 5HXAA 1S3SA 3O8QB 2ZIWB 4Y1RB 4NJOA 4M0DA 3BX1A 5IBPA 2O3JA 2E5WA 1H2RS 2DPXA 2J6CA 3B78A 5CX1A 4AJNA 1UBSB 1U4NA 2IYLD 3P5BA 1ZXXA 3EC7A 3L0OA 3KAQA 1TE2A 2B1QA 2O4UX 1Z0FA 2WF5A 1OOEA 3OZAA 3R3XA 4MV3A 4F0JA 5LWHA 2FZEA 1UPBA 5EMLA 1W0KA 2PJRA 1PF7E 5CR9A 4IHJB 5E7JA 2OKCA 1W9HA 3HA2A 3L6RA 1LGYA 1NY5A 3O2QB 4XLTA 4MW2A 4D56A 3FKJA 5AESA 5JJLA 4XJVA 1K86A 2XGOA 4K5QA 4MJ3A 2UYOA 1MXFA 5KKAA 3USZA 3ZWDA 4BNLA 3O8RA 4RK5A 4NOLA 4H6VA 2OB2A 4AZWA 1V1RB 3I45A 4BJ5A 1Y3AA 2VR1A 3EAQA 4WKNA 2RHHA 4WNAB 3WQSB 4BAZA 5J5VA 3HB9A 3PSAA 3N7TA 3AH8A 2HJSA 3K92A 1TDJA 1YT5A 2WD9A 2OFPA 4K9SA 4JBLA 4U2BA 5GVRA 2P9TA 3EHEA 4QJ5A 3F7MA 4J0QA 4W1PA 2XYPA 1C7QA 3G1WA 2L19A 4HUJA 2V59A 4CNQA 1SHKA 3FCXA 5JADA 3NORA 1IXZA 4GX0A 1P72A 1KDOA 1I6WA 4OHOA 4PCLA 5CLIA 1N2CB 3PUIA 3DO8A 1I1OA 2ZUUA 5DGCA 5E1OA 5BV8A 3ADDA 721PA 5ESDA 1G5RA 3AIKA 4F2HA 3WGGA 4L95C 1VP9A 3E48A 3ENNA 3IC5A 3KTAB 3QEAZ 1EWQA 1NF3A 3C3XA 1BW9B 1C1XA 1VSTA 4H3VA 2OCKA 4RH1A 5JJCA 4OX9Y 1CZRA 2OV6A 4YCCA 2JGKA 3FIUA 4NOJA 3ZU4A 5ADWA 5EJ9A 4ND7A 3CF2A 4QBFA 5J1TB 3Q2IA 2ATCA 1JVBA 1KMHB 4CR6A 1UDRA 3EYAA 2YZMA 4C6HA 4MITA 4RA6A 4FOLA 1SPBS 1Z8HA 4N3AA 4RQTA 1M8GA 4JVNA 2ADOA 3G9ZA 3GJ7A 4QO7A 3RKUA 1J1ZA 4S35A 5FA5A 1XZ8A 4PAGA 1YR7A 1RAIA 1LDEA 4MVJI 2BTQA 4YJ2B 1ZCFA 4BTVA 1XTIA 3JD4A 3F4KA 4TWJA 4Y9TA 5EKTA 3U7QA 3INNA 5F3RA 1BMQA 2CXQA 1A5TA 2WPDA 2AN4A 3JATB 3L06A 3BMXA 2IX3A 4RTLA 2NUBA 4UEWA 1GPKA 5C8YB 1IB6A 2QG9A 4M87A 4Q7MB 2FRXA 4NS4A 2AG6A 2I2CA 2XA9A 1IQ0A 3LUKA 3NWEA 3EVFA 3VJMA 4Q4JB 1MU0A 1XZQA 4KE7A 1MBZA 1VKNA 4FFSA 4DNFA 2Q6TA 2VDVE 1AMOA 1ORVA 2VPZA 3DZJA 2Y1GA 4YGXB 3WWEA 3QEJA 2R9VA 1XZFA 3L7NA 1US8B 3HWX1 3QHPA 4KK3A 4A23A 3SHQA 3F9CA 5AVVA 1V1MA 4AYTA 2GBLC 2O1WA 4IX9A 3M6FA 3K9HA 2BKEA 4RMJA 3EEIA 1T3LA 2XRFA 3ZI0A 4A3SA 4G09A 1B93A 5AJVB 3SD7A 5FL7D 2MMCA 2I0FA 4YMVA 4EH1A 1X77A 1TJPB 1KAMA 4F92B 1JHVA 1RZRA 3DOJA 4FTWA 3IRUA 1OX6A 3CGWA 1ZWLA 1SJ9A 3CFYA 3IJEB 2YDXA 3KT3A 4M0UA 3FOCA 4G84A 1UFVA 3KR1A 3SG0A 4II3A 4KN9S 4LA4A 2FUNB 1JVSA 3ASZA 3BTSA 3MJCA 2OGUA 4JJ7A 4KXWA 4QDOA 4TMVA 3HDHA 5D51S 3U1TA 1UWVA 1DG1G 2JLAA 3OQIA 1MO2A 2JAXA 1VMKA 1DAMA 1VKJA 2FHPA 1OIVA 3CUTA 1SMKA 4NDAA 4YUZA 2P6RA 3OIWA 4W9NC 4TGLA 4DYHA 4X1YB 1ZH8A 2E3JA 3C3EA 5EE3A 5AQEA 1EVYA 1DAPA 4MB0A 4ZIRB 1YFZA 1ZWKA 2Y0CA 3DE4X 4H9GA 4RKWA 3ZZMA 1NW7A 3EUEA 3LO5A 4BZZA 1GYQA 5FI1B 4BWFB 1NYLA 2YXDA 4C3ZA 1QP8A 3L02A 2V3VA 4LWOA 1GD1O 2GEUA 1F48A 2YQZA 3H4IA 1VI6A 1UEXC 1FF9A 2XEXA 3HU3A 4WPGA 3R7LA 1VL1A 3IKMB 4IVNA 1D2CA 1L7MA 1TCAA 2XJ9A 3H2ZA 1N5MA 1TUBA 5IRCD 1OW3B 3SKXA 3CLSC 3OJLA 1LV8A 2ZPTX 3AFNA 4WEQA 1M3SA 4KH0A 1JQDA 2Q7OE 3S6JA 2CK3A 1KMQA 4J9UE 4U7DA 1A7AA 2ZI3A 2CXNA 2FJUA 3B6EA 4S0XA 1QRSA 3H1FA 4YFYA 4C76A 5C35A 3C5CA 1LCIA 2QGFA 4Y2TA 3U3JA 4MAAA 3UHJA 3P4XA 4OJNA 3PR1A 2CVHA 3V33A 1UC5B 4EHDA 2CJYA 1P7ZA 1X2BA 2QL7A 2XIJA 4O2AF 4PZLA 4C7OA 4B3GA 3ISTA 4IW3B 1Q0HA 1TGYA 3B9PA 4MGIR 4IIJF