1LVBA

Catalytically inactive tobacco etch virus protease complexed with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
PRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATALYTIC DOMAIN OF THE NUCLEAR INCLUSION PROTEIN A (NIA)
publication title Structural basis for the substrate specificity of tobacco etch virus protease.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein
total genus 48
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvbA01
1Y3WA 1E0FD 1DXWA 1A46H 1O3FA 1EATA 1VITH 1TBRH 3S7HB 3WY8A 1LVBA 2TGAA 4FUBA 2SNWA 2TPIZ 1S6FA 3ZZBA 4WH8A 2A0QB 1UMAH 4K3JA 2A45B 1EKBB 1XUJA 4MQAA 2OBQA 1KXCA 1CU1A 2FOAA 2XBWA 1L0ZA 1C5NH 2ZFSA 3C27B 3OYPA 1DOJA 1G3BA 2R3YA 5A8XA 1F0RA 3QZQA 1OWIA 1CO7E 2J94A 1UO6A 1PYTD 2FPZA 4B71A 1FV9A 1PQAA 3W95A 1W3CA 3A89A 1LVOA 4UD9H 1RGQA 1IQFA 2NU3E 3I77A 4ESTE 1VJ9U 4Q7ZA 2VIDA 1C1NA 1YPMH 3RXLA 2OTVA 4M7GA 7KMEH 1NT1A 2RA0A 3RXJA 1GI1A 1BBRK 2BOHB 2Z3DA 3P6ZB 5E2PA 1T7CA 2ZF0H 1A0JA 5I25A 2P3UB 1H9IE 4JYVH 1TX8A 1NROH 2VU8E 2THFB 3KQEA 1K2I1 2RCEA 3I78A 2D26C 3TJNA 1TMTH 2RDLA 2ZFQH 1GJDB 5DP5A 3K6ZA 4X2WA 2K1QA 1PPCE 2OINA 1O5EH 1AKSA 4FUFA 4XBCA 3UOPA 5DP9A 2A5IA 4HI3A 1UVPA 1H9HE 4KELA 1LVYA 2VIVA 4NWKA 1TIOA 4AZ2B 5CMXH 1V3XA 4B73A 4D7FA 5JB9S 3BIVH 2BD8A 1Z71A 4FUGA 1GMDF 1F5RA 1DE7H 1LQEA 1Y8TA 3MI4A 2BXUH 3U9AH 1EAIA 4WXVA 3FFGA 2WYJA 1E37B 3UWIA 2PV9B 5A09A 2PUXB 1NRQH 1FZZA 1A4WH 4U30A 1YLCA 3M7TA 2Z7FE 1V2QT 3VFEA 1IQMA 1GHVH 1K1LA 3ZZ7A 1F2SE 1G2MA 3O8BA 2LPRA 3H7OA 2BD3A 2BVSH 1ETSH 2AGEX 3F9FA 3SUGA 4CBOA 1Y3UA 1A61H 2AMDA 1V2NT 3MMGA 3KQCA 1ZLRA 4GHQA 5TCCA 1P2KA 1UK4A 1A3EH 1SLUB 2P94A 3ZVBA 1HB0B 3RMLH 3MU4A 3QTVH 3QLPH 6ESTA 1AI8H 1OP2A 1ACBE 1L2EA 1UK2A 2VVUA 4BAQB 2KAIA 2BLOA 1CE5A 3SNAA 1AUJA 5EQSA 5CE1A 2AGGX 3QGNB 1HXFH 2GGVB 3P8FA 1FN8A 2PKSC 5FXLA 5AF9H 7GCHG 3Q76A 1MAYA 3M5NA 5ESBA 3Q77A 2Z3EA 2ZZUH 4XSKU 4A6LA 2FLRH 2H9EH 1ZGVA 3GCTF 1CT2E 1BB0B 1NRSH 4ISNA 1TGSZ 3SV9A 2ZQ2A 1GDQA 2FEQH 2J2UA 3E91A 3ODFA 3GCTG 3M37A 8GCHG 4JK6A 1Z8GA 4H4FA 3PWBA 4LZ4B 1TPSA 2BZ6H 2STBE 3NPSA 3SOSA 2GVFA 4E06H 1C2HA 1T8MA 3B8JA 1EPTA 1B0FA 1AMHA 4DCDA 3SV6A 2FI4E 1PPZA 6GCHG 1SQOA 2AMQA 3GDVA 2XW9A 1SQTA 5C1UA 1SGIB 3I29A 1GVZA 2ULLA 4X8VH 2ZPRA 3TLOA 1C2IA 1O35A 1GG6C 5GDSH 3DFLA 1YYY1 3GY8A 1DWEH 3FANA 4GPGA 4E7NA 1GG6B 4ABDA 3Q00A 3KNXA 1BHXB 1O3PB 3LDXH 1P06A 4X1RU 1U6QA 1OWDA 5EOKA 2XNIA 2C90B 3AAVA 3VB5A 4NA8A 3A82A 3TH4H 2ZO3H 1AB9C 2BD7A 5JBCS 2BB4A 3A84A 4X8SH 2BMGB 2CF9H 2TRMA 1AB9B 1IAUA 2A4OA 1HAVB 3SJIA 1NU9A 3SNBA 3U1IB 2GCHF 4TYDA 1J16A 4FVBA 1DLKB 4X6MA 4GCHG 3K9XB 1HAYB 1E34B 3TU7H 2Z9IA 3A80A 1FNIA 1Y59T 4E7RG 4FUJA 1Q3XA 4QT8C 2B8OH 2ZTYA 3HK6B 2ZQ1A 4HGCA 4R0IA 5LPRA 2YNBA 1GCDA 1LPGB 2AS9A 3RLYH 5JYIA 1O5FH 2XYAA 1FXYA 2FI3E 1ESAA 2VGCC 2XC0A 1FIZA 1O3JA 1O34A 1RTKA 1P2NA 4XE4A 1VITF 1C5XB 3LPRA 2ESTE 1SGEE 2VGCB 3BG8A 4FUHA 5HGGA 1TNHA 1S0RA 4ZROA 4FU7A 1HAOH 1QTFA 1UTOA 4DJZB 1SFIA 1Y5AT 2ZP0H 4BAMB 1BMAA 1O2OA 1JIMA 4CH2B 1W7XH 3PMHB 1PQ7A 4WJG2 1BQYA 1IQHA 3T28A 1VCWA 3BTTE 2C8WB 1K22H 2ANYA 4KP0A 1SOTA 1YCPK 1MU8B 4CH8B 1EOJA 9LPRA 2VWMA 1AU8A 2BOKA 1FY5A 1XUKA 3RDZA 4YOJA 5C5NA 4U01A 2BD4A 3TJOA 1S0QA 4OS6A 4AORA 3ATLA 3L3TA 1C1QA 4AFUA 1T31A 2JH6D 1WQVH 1GL1A 1CBWC 2AEIH 1ZRBA 4D76A 4Y6DA 4JMYA 4NFFA 1QJ7B 2QN5T 3FZDA 3K65B 1JMOH 1LPKB 1FY4A 3BEFB 3M5MA 1C5RA 1GJ4H 2BYAX 4Y79A 3P17H 5A2MH 4K8BA 3SUFA 1IOEA 1T8NA 2BTCE 1O2LA 5E2OA 3KGPA 4IS5A 4Y8ZA 2FOFA 3RMNH 4AB9A 1XVOA 2J4IA 4WF8A 4A1VA 4H6TA 2A2QH 2R2WU 4NSVA 1O3NA 3TIUA 4D9RA 1P3EA 1GWAA 3OY5U 1XUFA 1C2KA 4Y10E 5T6FA 4INKA 1MTSA 1H8IH 1E38B 4H42U 1QCPA 1SBWA 3GCHC 2A32A 2SGDE 3C1KA 1C5OH 1IQLA 4GHTA 5DPAA 1MMJN 4AGKA 1N1LA 3GCHB 1NC6A 1WTHD 1FDPA 5AFZH 1ABJH 3SUDA 1GMHG 4YO9A 2G5NA 1L1JA 4KGAA 2QXIA 4CREA 2BDGA 2FI5E 3UPEA 4HTCH 3GCOA 1O2MA 1LHGH 2VIPA 3KF2A 1EUFA 3LC5A 1AWHB 1EAWA 1F5KU 4ASHA 1K1OA 2RA3A 1C5YB 1O2JA 1D3QB 4B76A 3SV7A 3UOUA 2C8XB 1QIXB 1WOFA 2R3UA 1YM0A 3LT3A 1THSH 1VR1H 1WTGH 5DGJA 2ZI2H 3GY5A 4YTAA 2VINA 1SGTA 2QC2A 1TGBA 1C5ZB 3FVFB 1OP0A 5EU8A 2GD4B 1GBTA 4MG3A 1FIWA 2ZWLH 3FP6E 4SGAE 3B23B 1C1TA 4RN6A 2Z6BD 4ZAEA 3MU5A 1HJAB 2OBOA 1C1PA 2SGFE 2ZGCA 1BRUP 1UCYK 1GBKA 1UVUH 1DUEA 6CHAC 4YT6H 4AFQA 1AQ7A 1G3CA 1BTUA 6LPRA 1FN6A 4F49A 2PGQB 1J9CH 2GCTC 1V6DA 3MTYA 2GV6A 2Z3CA 1ETTH 1GJ5H 2F83A 1BRCE 2A5AA 2BD2A 3PO1C 3SO3A 2GCTB 3SUEA 4O03A 3RC4A 3MYWA 1HJ9A 1QJ1B 4JK5A 3PO1B 1O3LA 3IG6B 3ZVDA 2V6NA 1G3EA 1PPGE 1C5QA 1RFNA 1F0TA 1YPHC 4MNVA 5DP3A 1AZ8A 2UUYA 1JWTA 3HKJB 3MNCA 1NRNH 2IPHA 3A88A 1ZHMA 1MU6B 2Y5FA 4IW4E 4LOYH 2ZDVH 4ZKOU 1ZSLA 4ZHMU 3ZYDA 3MNBA 2ODPA 2J92A 4Y71A 1YBWA 5EXMA 5SGAE 1C9TA 1SGRE 1TA6A 3RXUA 2XXLA 4TPIZ 1SHHB 3Q3YA 4XFQA 5AHGH 5BPEA 1OS8A 1V2LT 4Y76A 1AFQC 1G37A 1O3OA 1B5GH 5FAHA 3DD2H 2O8TA 2Y5HA 1W7GH 3URDA 5F03A 1G36A 1O3GA 5AFYH 2Q6GA 2XCNA 1MTWA 1S6HA 1VGCC 3RC6A 4CR9A 3ZVCA 3UQVA 3SZNA 2PR3A 1CA0C 1C1SA 4DVAU 2VH6A 1VGCB 3V3MA 1NO9H 4FUCA 2BX4A 1CA0B 2V35A 1ZYOA 1THRH 4GSOA 1GI4A 2Q6FA 2ZFTA 2EEKA 1W8BH 1FY1A 5E8EH 3NUMA 4TY6A 5TCAA 1EB2A 4E05H 1T4VH 3PV4A 3E0NB 4A1TA 4ZHAA 1N8OB 1S83A 5DP6A 3NK8A 1A3BH 1IQNA 3MOCA 2BLVA 5EQRA 1H9LB 2BVXH 2Y82A 3V0XA 3KQBA 1MD7A 1D3DB 1ELDE 1DWCH 1BRBE 2H6MA 2P59A 4XBDA 4XOJA 1OOKB 1GDUA 2GZ8A 2QCYA 3A7ZA 1CHOF 2OQUA 4BAHB 5FPYA 2OUAA 4NSYA 1YLDA 2NU0E 3U8TH 1O5BB 1GJBB 1YC0A 3RXFA 2WPMS 1D9IA 8ESTE 1CGIE 2AERH 2V0BA 3ELAH 2C4FH 4I31A 1AVWA 2FS9A 2SGAA 2EC9H 4ABIA 3QGJA 3GOVB 1P2IA 5GJ4B 2R9PA 4ZH8A 3LU9B 1KDQB 3A7WA 2P8OC 1NTPA 1FQ3A 2UUFB 4BXSA 3QO6A 1DICA 2VVCA 3EDXB 1GJAB 3BF6H 3MU0A 1C2FA 2P8OB 4YOGA 1V2VT 2A5KA 1DY9A 4DURA 1O2SA 3S7KB 1MCVA 1W0ZU 2TIOA 4X6PA 4XDEA 3RXHA 3UNQA 3MWIU 1C5UA 1O2IA 5J4QA 3PWCA 1KY9A 1P57B 3AVZA 2FOMB 3D65E 1S81A 1S84A 3ZVAA 3RXEA 1QL9A 5C1YA 1DS2E 4ISOA 5FX6A 1SQAA 4B2BA 2P93A 3MNXA 4I7YH 3EA8A 2WV5A 4RKOB 2XWBI 1GCTB 2ZU4A 5H4IB 1O3IA 1P2JA 1ELTA 1QBVH 2P95A 1MKXH 3P70B 2A7CA 1QA0A 2I6QA 2J95A 1P2QA 2O8UA 4J2YB 4WH6A 4XBBA 3RXQA 1SGQE 3R3GB 4OS1A 2DE8A 3TNTA 1TOMH 1YPGH 3AAUA 1ZMJA 2VIQA 4LK4A 4MPXA 1JRTA 1WCZA 2BDYA 5FBIA 2P16A 3OSYA 2CN0H 1CT0E 1ANEA 2AGIX 1VJAU 1ELFA 1TNGA 1AVGH 2D1JA 1OWEA 1J15A 1MTUA 2YOLA 2Y81A 1XKAC 1XXFA 2Z9JA 1Y5BT 1BUIA 1KLIH 1INCA 5L30H 1O2YA 1GBFA 3TGJE 2FX4A 1NM6A 5E0JA 1C1RA 1EP6A 1AE5A 1GMDG 1O3CA 1KXDA 3O8RA 2ZCLP 3RC5A 1P09A 4JCNA 4AOQA 3P8NA 5F8XA 1HIAB 1O5AB 3STIA 1NFYA 3UQOA 2UWLA 1ZMLA 3GDUA 5LPEA 1XUGA 1TAWA 2WYGA 1DPOA 2AYWA 3FAOA 3F6UH 2ZHDA 1FAKH 1GHAF 1TONA 2GZ9A 3EE0B 2B5TB 4CRBA 1HLTH 4DW2U 2WINI 3TJVA 1C2EA 2DE9A 2GDEH 3BTQE 5EODA 3SU0A 3VPKA 2ZDNA 4NWLA 3GY2A 4FU9A 3TK6A 1HAVA 5F8ZA 1VCPA 1SMFE 1H8DH 1OPHB 2ZA5A 3SNCA 1ESTA 2ANMH 3M36A 5JDUB 1DXPA 3QWCH 2OC7A 4BAOB 2NWNA 2AMPA 3BTKE 4I8LA 1CT4E 3PROA 5FX5A 2PLXA 1MBMA 5TJXA 1O2VA 4X2XA 5EXLA 1QBNA 3HGPA 1QGFA 1OYQA 5JBTA 4BANB 5GXPA 1DDJA 3T5FH 2BLWA 3V12A 1BMMH 1OWJA 3A85A 1E35B 4INLA 3MH4A 4O3TA 3W94A 4UDWH 1ZGIA 3SU6A 4SGBE 3H7TA 3RXKA 3M3VA 1QB1A 1OWHA 1A1RA 2ZU5A 1GGDB 2BQ7B 1EQ9A 2JH0D 3RXRA 3O8CA 1EAUA 1SPJA 2V3HH 1P11E 2CF8H 2G51A 1HBTH 1MTVA 3QN7A 5LPFA 1ZSJA 2G8TA 1QQ4A 1NFXA 1THPB 5A0BA 2FOCA 3BG4C 1C9PA 1DWDH 3RXBA 1O3DA 2WPLS 2FYRA 1RD3B 1TBQH 4ABEA 5JPMH 2Y7ZA 1O2XA 3A7YA 3BG4B 2ZFFH 1TPPA 3NWUA 1BBRE 4FUEA 1QFKH 1ANBA 2BDCA 3HATH 1FAXA 1O39A 2R0LA 2F3CE 1Z1IA 5DK1A 3M35A 4BAKB 2ODYB 2HRVA 1K28D 2D2DA 1C5LH 3OX7U 2FTMA 1CQQA 2QGRA 4Q80A 3MFJA 3A87A 5J4SA 3MHWU 1HRTH 1WQSA 2PFEA 1MQ5A 2TBSA 3ENSB 2Y7XA 2BDIA 3BTFE 4B2CA 4UONA 2OC0A 4GLYA 2ALVA 1LKBA 1ID5H 1BTPA 4NZQA 2BQWB 2C3SA 2FMJA 1RXPA 3V7TA 3PMAB 4K8YA 1GI8B 2W7UA 2QA9E 4MNXA 3ZZ8A 4CRAA 1FI8A 3BTEE 2HALA 1V2TT 5EG4A 1O2KA 1D6WA 1UTJA 1GBBA 1YP9A 2GCHG 4JZEH 1BTZA 1K9OE 1ELVA 2F9NA 3RXMA 1OP8A 1H4WA 1O36A 3PMJA 1SFQB 2BDBA 1KXBA 2QF0A 3ZVFA 4A92A 2PW8H 5FCRA 1GHXH 1KIGH 2ZC9H 4CRGA 2A7JA 2KAIB 5EW2H 1RTLA 1FONA 1O3BA 3SU2A 2C8YB 1EZUC 5GPIB 4KTSA 1PPFE 4ZKSU 3E3TA 1JXPA 1QB9A 1C5SA 1FJSA 2FOEA 3NCLA 2ZGBH 3ZZ4A 5DP4A 2A1DB 2OQ5A 1TE0A 2GMTC 1O2ZA 4FUDA 1YPJH 3S9CA 1BHXF 1OXGA 4FU8A 1Z8JB 2ILNA 1VITG 3BIUH 1FUJA 2GMTB 1O2WA 2HVXA 1TPOA 2CGAA 3PM3A 4Q7XA 1TA2A 4B74A 1FLEE 2HWLB 1MKWK 4NFEA 2DUCA 4JZFH 3BEUA 1DVAH 1IQGA 1L1GA 2BM2A 1DWBH 2BDHA 4ISIH 5B6OA 3FZZA 7ESTE 1MTNC 3ZV8A 4X1NU 4Y0YE 1YCPM 4X8TH 3RXSA 1MTNB 4K1EA 4BNRA 1H1BA 2FWWA 4JYUH 1UHBB 4I33A 3M7UA 4X2YA 1ETRH 4JZ1A 4LXBH 2PKAA 1AUTC 3LOXA 1KLJH 1GHBF 2ZDLA 1EX3A 3SGAE 3BV9B 5JB8S 2CHAB 2XCFA 1DANH 2WPIS 3MH6A 3LJJA 2NU1E 3TVJB 2BY7X 2W3IA 3RMMH 1BJVA 4AN7A 1EP5A 1O32A 5EW1H 3GISB 4H6SB 3E8LA 3MH5A 1V2RT 1E36B 3PLKA 4IC6A 4J1YA 1F0UA 1V2KT 2FYQA 4KTCA 5JBAS 3F9HA 2EA3A 2EI7A 1M9UA 3RU4E 2F9OA 1B0EA 3HK3B 3SU3A 3EGKH 2FDAA 4Z0KA 3DFJA 3ZZ5A 4AB8A 3IWMA 1O2NA 1W13U 3SBKA 4DG4A 4B1TA 3SW2B 4Y11E 3BEIB 1Q2WA 2Y5GA 2SGEE 2O8MA 4I8GA 1ZR0A 1OKXA 3SNEA 2VIOA 3LJOA 1SGPE 4YM9A 4UFGH 4YOIA 3TPIZ 1D3TB 1ZPZA 1C1WH 3TGIE 2ZDMA 5C3NA 3S0NA 4Q7YA 2FXRA 1O2QA 1Z7KA 4NIWA 1TRMA 1ELEE 2D8WA 4JYTA 4K2YA 4ZMAH 1GMCF 1XX9A 5GWZA 1NS3A 3F68H 2SFAA 2PSXA 3LIWA 1SGYE 4ZXYH 1V2WT 2FO9A 2FOHA 1OSSA 1KXAA 3LGUA 1GMCG 2ZTXA 1LVMA 5DKMA 3SU1A 1C5PA 2JETC 4BXWA 5A0AE 2HPPH 3O8DA 3M3TA 5T3HA 2ZU2A 2PWXA 3CP7A 2ZFRH 1TALA 2JETB 2CMYA 4I8HA 2F9BH 4DY7B 1GI5A 4IMZA 2Y6TA 5DJ7A 2Q6DA 2OP9A 1SSXA 2ANWA 2FX6A 4B75A 3A8DA 1BMLA 5CHAC 3GDSA 2XBYA 1HJAC 2ANKH 4RKJB 1KXEA 2G00A 5CHAB 2BQ6B 3AASA 1AFEH 2G4UA 3MU8A 4UFEH 4NA7A 2AIPA 2FOBA 3LGWA 1MBQA 1PPEE 2W3KA 3E90B 1TMUH 4NCYA 3MO6A 1FY8E 2GV7A 1LHCH 4A1XA 1RS0A 2WPKS 4HZHA 3T25A 2IOTA 3U1JB 2AFQB 3SV8A 2VJ1A 4D9QA 3KQDA 2HGTH 4B2AA 2J34A 1O2HA 4UE7H 2GZ7A 2CXVA 1O38A 4WMEA 1O3AA 5L6NH 2C93B 1C5TA 2G5VA 1O0DH 4KKDA 4ZKNU 2G52A 1LHDH 1IHSH 2ZGJA 5DP7A 5C2ZA 5IYTA 4IN1A 2GT7A 1TPAE 4Q2KA 4VGCB 2A31A 5C67A 3LGYA 3A8CA 1TX6A 2H2ZA 1KXFA 1IQEA 1TFXA 3OY6U 1O5CB 1MZDA 2W7SA 3U98H 5L2ZH 1YPLH 2EI6A 4WXIA 3T26A 3URCA 1KDQA 3RXOA 1HAXB 1CSOE 1GBJA 3MO3A 4NIYA 3VXEH 4CRFA 3RXVA 1SGDE 1L4ZA 1BTHH 1MH0A 1AHTH 1HAGE 3PYHA 1VCQA 9ESTA 1O2PA 5DP8A 1C5MD 1NRRH 3T62A 2TGDA 1SHYA 2V3OH 4ZUHA 1DFPA 1WU1A 1GI6A 2EI8A 4ISHH 3NKKA 4BTUB 2J9NA 3UREA 4OGXA 1CVWH 2R0KA 1J17T 4A5TS 3RP2A 2QXJA 2J38A 1UVTH 1BBRH 3LKWA 3TH3H 3A7TA 1BTXA 1O2RA 1Z6JH 1SC8U 1EASA 1P8VC 1NFUA 3GY4A 5F6MA 4D8NA 1T32A 3VB7A 3SHAH 3PTNA 2BY8X 2FS8A 4CR5A 2OC1A 2Z94A 1GJ6A 5FPSA 1WBGB 1F5LA 1N8OC 1DITH 4MTBA 4MPWA 3ATMA 2A4GA 3PTBA 1MD8A 1O31A 1O2UA 1XMNB 3N7OA 4NIXA 1ZJKA 4DGJA 1V2ST 1J8AA 2FM2A 1O5GH 4HFPB 4JZIA 2YNAA 2BHGA 2LNCA 1NZQH 5FBEA 2HLCA 1FPHH 3TNSA 4ABFA 2ZGHA 1Z6EA 3UFAA 3A7VA 5K7RA 1D6RA 1W0YH 3QX5H 3DHKH 5GCHF 1V2UT 4YESB 1P01A 2XTTB 1IQJA 4IGDA 8LPRA 3JZ2B 1GVLA 2VNTA 4X0WU 3SJ8A 3P8GA 3QUMP 2ZDKA 3CS0A 4NZLA 4I8JA 1HIAA 1BJUA 4OS7A 2ZU1A 1CHOG 1TYNA 4MPVA 5JBBS 3TK9A 1L4DA 5LH8A 1UTMA 2Q1JA 2ZGXH 3RM0H 4AFZA 1K1IA 2ZU3A 3LGTA 5GIBA 1UCYE 3LC3A 3LGVA 3RXTA 2GDDA 3ZVGA 1GBAA 2SNVA 3A81A 4AYVB 5DO4H 3L6PA 4BTTB 1EJAA 4CRCA 3T2NA 5LGOA 4FUIA 4BTIB 4IBLH 1SR5C 1ELGA 1X7AC 4WY3A 4Y0ZE 1GJ8B 1MQ6A 2F91A 3VB4A 1QRWA 1O3EA 4AG1A 3VB6A 1O2TA 1LDTT 4MPUA 1AO5A 1O3MA 3V13A 1C2LA 1XUHA 4X8UH 1GCTC 1NU7B 1WUNH 5IDKA 1HNEE 2OCVB 2OD3B 1GI7B 3P92A 3BTWE 1O30A 1O3KA 3M5OA 4WVPE 3R0FA 1GJ9B 3P8OA 4GAWA 3UNSA 3Q3XA 1MAXA 2CV3A 3F9GA 3UWJH 2FOGA 3JZ1B 1S82A 1P2OA 3SU5A 4IC5A 1D4PB 1WAYB 1MUEB 3NZIA 3SNDA 1BCUH 4DIIH 2B0FA 2B7DH 1F92A 1YKTA 3DUXH 1L1NA 4NA9H 1ZTJA 2A4QA 2P3TB 4U32A 2H5DA 1S85A 1QB6A 2XWAA 1BITA 1MCTA 4UFDH 3ZV9A 1EXFA 1QR3E 1TLDA 1NN6A 1CGJE 1P9SA 4AGJA 4IMQA 4CHAC 1YF4A 4O97A 1PFXC 1A5HA 3SN8A 3RXAA 3PLBA 2NU4E 1TGNA 1C4U2 1W10U 4CHAB 1LKAA 2QY0B 3H5CB 1QHRB 2BDAA 5AVDA 2GT8A 1XM1A 3P95A 1TQ7B 1AVXA 3M5LA 5EPYA 1T4UH 1DX5M 1O5DH 3BSQA 1ELCA 3FP7E 1J14A 1ELAA 4GUXA 1ESBA 1YPKH 3F1SB 5L2YH 3UNRA 1Q31A 5FPTA 1FPCH 1A0LA 3QTOH 1FMGA 1K1PA 3M61U 3D62A 3MO9A 3SU4A 3G01A 4THNH 1HFDA 1TRNA 1JOUB 1Z1JA 2WV4A 3RXDA 1BMNH 2PGBB 1G32B 1W12U 1G30B 1P04A 1GHAG 3E0PB 1HPGA 3CENA 3SI4H 3B9FH 4FVDA 1C5VA 1IQKA 2ZPSA 4TPYA 1NPMA 4KTUA 1D3PB 1P0SH 2WUBA 4ABGA 1DUAA 4Z6AH 5PTPA 1FY3A 1G2LA 2CJIA 4U2WA 2ZHQH 3Q3KA 1T8LA 1W11U 2GKVE 4K60A 1PYTC 4OGYA 1T8OA 1Y3VA 1GBCA 1V2PT 3KCGH 1EAXA 2ZKSA 2RG3A 1QA7A 2JKHA 4D7GA 3A8BA 4UFFH 7GCHF 1XVMA 4AG2A 3EA9A 3OTJE 4I32A 3SJKA 3SJOA 1GGDC 4X1PU 3EQ0H 1P2MA 5EGMA 3OU0A 4Y7BA 3U8RH 2O8LA 1UTPA 1EJNA 4K69A 1QURH 1SG8B 1ZHRA 1IQIA 2PKSB 3BTME 3GYMA 1JIRA 3VEQB 1AZZA 2QF3A 4K1TA 5ETXA 5ABWA 1Y3XA 5HM9A 2FIRH 3A7XA 1MKXK 1F7ZA 8GCHF 2XC5A 1LCYA 1K1NA 2FTLE 5FHTA 5E0GA 1YCPH 2WPHS 1EOLA 1MKWH 4YLUA 1AKSB 4MLFB 1NY22 1P12E 1PQ8A 1ARCA 1GBDA 2GTBA 3E1XB 5BRRE 3RU4D 5EQQA 1HUTH 1C4V2 6GCHF 3SHCH 1TRYA 3SJ9A 3U8OH 1P05A 2ZDAH 2G4TA 2IJOB 1K1JA 2R2MB 4TWWA 2HOBA 2VIWA 2ZNKH 1UHBA 1EZQA 3S9BA 3ATKA 1KSNA 2Z9KA 1EZSC 2G55A 7LPRA 4I8KA 2STAE 2VWOA 1V2MT 1RIWC 2BXTH 3M3SA 3BN9A 1Y5UT 1BT7A 3ESTA 2ODQA 5FCKA 3AW1A 1RIWB 1SGFA 3FP8E 3GCNA 1CHGA 2VWNA 4F4OC 1C1OA 3SGQE 4GCHF 3F9EA 1OYTH 2Y80A 3S69A 4AYYB 1LTOA 1UK3A 1HXEH 1ZTLA 3UUZA 2ZG0H 3AW0A 3NXPA 5A8ZA 1KTTB 1V2OT 2IN2A 2VB0A 4UEHH 2JH5D 2UWPA 1GBHA 3GY3A 1GBIA 3MNSA 3RMOH 4ABBA 1QRXA 3QK1A 3UIRA 1ELBA 2B9LA 1TNLA 1LMWB 2TGPZ 8KME2 1GVKB 1BA8B 4NIVA 3UR9A 4NGAH 5HYOA 1KTSB 4MVNA 1PPHE 1GL0E 1WYKA 3SORA 1SLWB 1DSTA 2UUKB 2ALPA 2PUQH 4RSPA 3UTUH 2OLGA 3RM2H 5E0HA 5ESTE 2H1UA 1TNIA 1HAPH 4R8TB 1OWKA 1O2GH 1AWFH 4ZKRU 4MNYA 1AD8H 1GPZA 3DA9B 1ZRKA 1EPTC 3BTHE 2H9HA 1UTLM 3ZZ9A 1HJ8A 1XKBC 2A2XH 3RXGA 1EPTB 2PHBA 1EB1H 1QY6A 3GY6A 2VVVA 4YZUA 1TX7A 3M7QA 2Z9LA 2BZAA 1P02A 1RJXB 2H9TH 2XBXA 2ZTZA 2HNTC 1ORFA 2CHAC 4INHA 3TH2H 3KL6A 1BTYA 2ZCKP 1P3CA 1HGTH 1SB1H 4K5ZA 3E6PH 1CA8B 3D23A 1QBOA 2FZZA 1SLVB 1JRSA 3EAJA 1UCYH 3GY7A 3RU4T 1O37A 1TNJA 3T27A 5C1XA 1GHBG 1C2DA 1S5SA 4X6NA 2C8ZB 3RXIA 1P03A 3VGCC 4GVUA 3GYLB 2WPJS 1HDTH 1ZZZA 1W2KH 3A86A 4MNWA 5T6DA 4WWYA 1GJ7B 1V2JT 1NRPH 1QL8A 3VGCB 1GI0A 1F0SA 1PQ5A 3LH3A 3QZRA 1TABE 3LH1A 2UUJB 4TWYA 3SI3H 1UTQA 5HMAA 1CBWB 1TMBH 2ZECA 3ZZ3A 1BOQA 2SGQE 2XC4A 2QV1A 3LONA 1QNJA 4MDSA 5EPNA 4Y8XA 1SI5H 4AX9H 1TNKA 3GICB 1C5WB 1G9IE 2AH4X 2A7HA 1LO6A 1GHWH 1KYNA 1TWXB 3BTGE 3ZZ6A 1TB6H 4LZ1H 3L33A 1OX1A 5T6GA 2W5EA 4OS2A 3KEEA 2HNTE 3K2UA 1HV7A 1HAZB 1GBLA 1SGCA 1GI9B 1ZPCA 2O8WA 1GBMA 1ZPBA 2A4RA 1DM4B 1IHTH 3D49H 2ZIQH 3ZZCA 3UR6A 1DY8A 3TITA 1AIXH 3TJUA 2PSYA 1ZTKA 3RLWH 1BIOA 1B7XB 2BY6X 2TGTA 4X1QU 4IN2A 2NU2E 1GMHF 2WUCA 3BTDE 1SOZA 1RRKA 2HNTF 2QAAA 1Z8RA 1HAIH 2F9PA 1PPBH 2AIQA 3SQEE 3A83A 3ZYEA 1C1UH 1QQUA 2OXSA 2M5TA 5C5OA 1HYLA 3RXPA 1P10A 1WV7H 3ATIA 1ZOMA 4ISLA 4TY7A 1TBZH 4ZHLU 1C1VH 1O33A 4JZDH 4X2VA 5C20A 3IITA 4CRDA 1QL7A 1EJMA 1GDNA 2XRCA 4AFSA 1LHFH 3SQHE 4DOQA 1P9UA 1ZHPA 1GHZA 1SGFG 1UJ1A 1EZXC 3KN2A 1C2JA 3TGKE 2BD5A 3HGNA 1A7SA 3K6YA 3KHVA 3RXCA 3ZVEA 1SGNE 2BY9X 1ANCA 4O9VA 1XUIA 2BX3A 2FODA 1K21H 5EXNA 2O9QA 3PLPA 3PB1E 2PKAB 4WMFA 4A7IB 4O3UA 1QJ6B 3VXFH 2F9UA 1AN1E 4OS4A 2ZEBA 3ZZAA 2G81E 3MU1A 3TK5A 1C1MA 1UTKA 2I6SA 1LQDB 4ABAA 1UTNA 1DLEA 3SV2H 1RTFB 5HXFA 4VGCC 4ABJA 1UVOA 1NESE 2FLBH 1SL3A 3CS7A 6CHAB 1JBUH 3S9AA 4DT7B 3STJA 1XXDA 3MH7A 1UVSH 1TQ0B 4X1SU 5HM2A 5K0HA 1W14U 1YPEH 3EYDA 1WSSH 1G3DA 2PTNA 1DT2A 1LPZB 1VZQH 3VB3A 3PMBB 1CGHA 1GJCB 2GX4A 1C2MA 2BD9A 4YT7H 2VWLA 3LGIA 5DG6A 2BVRH 3UY9A 4Y8YA 1C4Y2 2ZHWH 4OS5A 3EA7A 3ODDA 4YLQH 1AGJA 1BDAA 1GI3A 1PJPA 1GBEA 2OC8A 2QXGA 3T29A 1LHEH 1A5GH 2W26A 2ASUB 3ATWA 1AE8H 4Y7AA 1N6YA 5G4BA 1A5IA 1GHYH 3RUOA 1ZMNA 1KLTA 2PTCE 1ABIH 1NFWA 3U69H 5A8YA 1DSUA 1A0HB 1TOCB 1AFQB 2QYIA 2ZHEH 1Y3YA 2ZHFH 2FESH 1BZXE 1ZJDA 1SVPA 2P3FH 1Z8IB 2ZPQA 3A8AA 4ZXXH 1ARBA 4NG9H 4DIHH 1O3HA 1YGCH 1YPHE 5A0CA 2BLQA 2QIQA 2ZCHP 1TGTA 3ITIA 4PROA 1ZSKA 2QXHA 3KIDU 1C2GA 2Z9GA 1QRZA 2H5CA 4X6OA 3E16B 2HPQH 3DT0H 2FP7B 1HCGA 2SGPE 2F9VA 1MZAA 4BOHA 2XBVA 1BRAA 5F8TA 1AY6H 1BTWA 4WMDA 1GI2A 3QDZB 3HPTB 1HAHH 5GCHG 4CBNA 1TGCA 1SLXB 3HKIB 4ABHA 4K1SA 1ANDA 1K1MA 2UWOA 2GP9B 2VH0A 3ZZDA 1N6XA 4FXGH 3SGBE 2ZFPH 2BY5X 5I46H 1A2CH
chains in the Genus database with same CATH superfamily
1Y3WA 1E0FD 1DXWA 1A46H 1O3FA 1EATA 1VITH 1TBRH 3S7HB 3WY8A 2WPDD 1LVBA 2TGAA 4FUBA 2SNWA 2TPIZ 1S6FA 3ZZBA 4WH8A 2A0QB 3DSOA 2JJ1D 1UMAH 3FO8D 4K3JA 2A45B 1EKBB 1XUJA 2QF4A 4MQAA 2OBQA 1KXCA 1CU1A 2FOAA 2XBWA 1L0ZA 1C5NH 2ZFSA 3C27B 3OYPA 1DOJA 1G3BA 2R3YA 5A8XA 1F0RA 3QZQA 1OWIA 1CO7E 2J94A 1UO6A 1PYTD 2FPZA 4B71A 1FV9A 1PQAA 3W95A 1W3CA 3A89A 1LVOA 3F0OA 4UD9H 1RGQA 3OE7D 1IQFA 2NU3E 3I77A 4ESTE 1VJ9U 4Q7ZA 2VIDA 1C1NA 1YPMH 3RXLA 2OTVA 4M7GA 7KMEH 1NT1A 2RA0A 3RXJA 1GI1A 1BBRK 2BOHB 2Z3DA 3P6ZB 2OK5A 5E2PA 1T7CA 2ZF0H 1A0JA 5I25A 2P3UB 1H9IE 4JYVH 1TX8A 1NROH 2VU8E 2THFB 3KQEA 1K2I1 2RCEA 3I78A 2D26C 3TJNA 1TMTH 2RDLA 2ZFQH 1GJDB 5DP5A 3K6ZA 4X2WA 2K1QA 1PPCE 2OINA 1O5EH 1AKSA 4FUFA 4XBCA 3UOPA 5DP9A 2A5IA 4HI3A 1UVPA 1H9HE 4KELA 1LVYA 2VIVA 4NWKA 1TIOA 3EE7A 5CMXH 1V3XA 4AZ2B 4B73A 4D7FA 3MQKC 5JB9S 3BIVH 2BD8A 1Z71A 4FUGA 1GMDF 4RT1A 1F5RA 1DE7H 1LQEA 1Y8TA 3MI4A 2BXUH 3U9AH 1EAIA 4WXVA 3FFGA 2WYJA 2QF5A 2HLDD 1E37B 3UWIA 2PV9B 5A09A 2PUXB 1NRQH 1FZZA 1A4WH 4U30A 1BMFD 1YLCA 3M7TA 2Z7FE 1V2QT 3VFEA 1IQMA 1GHVH 1K1LA 3ZZ7A 2LELA 1F2SE 1G2MA 3O8BA 2LPRA 3H7OA 2BD3A 2BVSH 1ETSH 2AGEX 3F9FA 3SUGA 4CBOA 1Y3UA 1A61H 2AMDA 4ZCNA 1V2NT 3MMGA 3KQCA 1ZLRA 4GHQA 5TCCA 1P2KA 1UK4A 1A3EH 1SLUB 2P94A 3ZVBA 1HB0B 3RMLH 3MU4A 3QTVH 3QLPH 6ESTA 1AI8H 1OP2A 1ACBE 1L2EA 1UK2A 2VVUA 4BAQB 2KAIA 2BLOA 1CE5A 3SNAA 1AUJA 5EQSA 5CE1A 2AGGX 3QGNB 1HXFH 2GGVB 3P8FA 1FN8A 2PKSC 5FXLA 5AF9H 7GCHG 3Q76A 4DT4A 1SQRA 2F4LA 2QE7D 1MAYA 2WV9A 3M5NA 5ESBA 3Q77A 2Z3EA 2ZZUH 4XSKU 4A6LA 2FLRH 2H9EH 1ZGVA 3GCTF 1CT2E 1BB0B 1NRSH 2YMSC 4ISNA 1SKYE 1TGSZ 3SV9A 2ZQ2A 1GDQA 2FEQH 2J2UA 2YMSB 3E91A 3ODFA 3GCTG 3M37A 8GCHG 4JK6A 3DCLA 1Z8GA 4H4FA 3PWBA 4LZ4B 1TPSA 2BZ6H 2STBE 3NPSA 3SOSA 2GVFA 4E06H 1C2HA 1T8MA 3B8JA 1EPTA 1B0FA 1AMHA 4DCDA 3SV6A 2FI4E 1PPZA 6GCHG 1SQOA 2AMQA 3GDVA 2XW9A 1SQTA 5C1UA 1SGIB 3I29A 1GVZA 2ULLA 4X8VH 2ZPRA 3TLOA 1C2IA 1O35A 2J98B 1GG6C 5GDSH 3DFLA 1YYY1 3GY8A 1DWEH 3FANA 4GPGA 4E7NA 1GG6B 4ABDA 3Q00A 3KNXA 1BHXB 5F53A 4ACAA 1O3PB 3LDXH 1P06A 4X1RU 1U6QA 1OWDA 5EOKA 2XNIA 2C90B 3AAVA 3VB5A 4NA8A 3A82A 3TH4H 2ZO3H 1AB9C 2BD7A 5JBCS 2BB4A 3A84A 4X8SH 2BMGB 2CF9H 5GNDA 2TRMA 1AB9B 1IAUA 2A4OA 1HAVB 3SJIA 1NU9A 3SNBA 3U1IB 2GCHF 4TYDA 1J16A 4FVBA 1DLKB 4X6MA 4GCHG 3K9XB 1HAYB 1E34B 3TU7H 2Z9IA 3A80A 1FNIA 1Y59T 4E7RG 4FUJA 1Q3XA 4QT8C 2B8OH 2ZTYA 3HK6B 2IPQX 2ZQ1A 4HGCA 4R0IA 5LPRA 2YNBA 1GCDA 1LPGB 2AS9A 3RLYH 5JYIA 1O5FH 4FETA 2XYAA 1FXYA 2FI3E 1ESAA 2VGCC 2XC0A 1FIZA 1O3JA 1O34A 1RTKA 1P2NA 4XE4A 1VITF 1C5XB 3LPRA 2ESTE 1SGEE 2VGCB 3BG8A 4FUHA 5HGGA 1TNHA 1S0RA 4ZROA 4FU7A 1HAOH 1QTFA 1UTOA 4DJZB 1SFIA 1Y5AT 2ZP0H 4BAMB 1BMAA 1O2OA 1JIMA 4CH2B 1W7XH 3PMHB 1PQ7A 4WJG2 1BQYA 1IQHA 5HKKD 3T28A 1VCWA 3BTTE 2C8WB 1K22H 2ANYA 4KP0A 1SOTA 1YCPK 1MU8B 4CH8B 1EOJA 9LPRA 2VWMA 1AU8A 2BOKA 1FY5A 1XUKA 3RDZA 4YOJA 5C5NA 4U01A 2BD4A 3TJOA 1S0QA 4OS6A 4AORA 1COWD 3ATLA 3L3TA 1C1QA 4AFUA 1T31A 2JH6D 1WQVH 1GL1A 1CBWC 2AEIH 1ZRBA 4D76A 4Y6DA 4JMYA 4NFFA 4Q63A 1QJ7B 2QN5T 3FZDA 3K65B 1JMOH 1LPKB 1FY4A 3BEFB 3M5MA 1C5RA 1GJ4H 5T1VA 2BYAX 4Y79A 3P17H 5A2MH 4K8BA 3SUFA 1IOEA 1T8NA 2BTCE 1O2LA 5E2OA 3OTPA 3KGPA 4IS5A 4Y8ZA 2FOFA 2KR7A 3RMNH 4AB9A 1XVOA 2J4IA 4WF8A 4A1VA 4H6TA 2A2QH 2R2WU 4NSVA 1O3NA 3TIUA 4D9RA 1P3EA 1GWAA 3OY5U 1XUFA 5CDFE 1C2KA 4Y10E 5T6FA 4INKA 1MTSA 1H8IH 1E38B 4H42U 1QCPA 1SBWA 3GCHC 2A32A 2SGDE 3C1KA 1C5OH 1IQLA 4GHTA 5DPAA 1MMJN 4AGKA 1N1LA 3GCHB 1NC6A 1WTHD 1FDPA 5AFZH 1ABJH 3SUDA 1GMHG 4YO9A 2G5NA 1L1JA 4KGAA 2QXIA 4CREA 2BDGA 2FI5E 3UPEA 4HTCH 3GCOA 1O2MA 1LHGH 2VIPA 3KF2A 1EUFA 3LC5A 1AWHB 1EAWA 1F5KU 4ASHA 1K1OA 2RA3A 1C5YB 1O2JA 1D3QB 4B76A 3SV7A 3UOUA 2C8XB 1QIXB 1WOFA 2R3UA 1YM0A 3LT3A 1THSH 1VR1H 1WTGH 5DGJA 2ZI2H 3GY5A 4YTAA 2VINA 1SGTA 2QC2A 1TGBA 1C5ZB 3FVFB 2JJ2D 1OP0A 5EU8A 2GD4B 1GBTA 4MG3A 1FIWA 2ZWLH 3FP6E 3OEED 3B23B 4SGAE 2KFWA 1C1TA 4RN6A 2Z6BD 4ZAEA 3MU5A 1HJAB 2OBOA 1C1PA 2SGFE 2ZGCA 1BRUP 1UCYK 1GBKA 1UVUH 1DUEA 6CHAC 4YT6H 2IJD1 4AFQA 1AQ7A 1G3CA 1BTUA 6LPRA 1FN6A 4F49A 2PGQB 1J9CH 2GCTC 1V6DA 3MTYA 2GV6A 2Z3CA 1ETTH 1GJ5H 2F83A 1BRCE 2A5AA 2BD2A 3PO1C 3SO3A 3F2FA 2GCTB 3SUEA 4O03A 3RC4A 3MYWA 1HJ9A 1QJ1B 4JK5A 3PO1B 1O3LA 3IG6B 3ZVDA 2V6NA 1G3EA 1PPGE 1C5QA 1RFNA 1F0TA 1YPHC 4MNVA 5DP3A 1AZ8A 2UUYA 5EJ1A 1JWTA 3HKJB 3MNCA 1NRNH 2IPHA 3A88A 1ZHMA 1MU6B 2Y5FA 4IW4E 4LOYH 2ZDVH 4ZKOU 1ZSLA 4ZHMU 3ZYDA 3MNBA 2ODPA 2J92A 4Y71A 1YBWA 5EXMA 5SGAE 1C9TA 1SGRE 1TA6A 3RXUA 2XXLA 4TPIZ 1SHHB 3Q3YA 4XFQA 5AHGH 5BPEA 1OS8A 1V2LT 4Y76A 1AFQC 1G37A 1O3OA 1B5GH 5FAHA 3DD2H 2O8TA 2Y5HA 1W7GH 3URDA 5F03A 1G36A 1O3GA 5AFYH 2Q6GA 2XCNA 1MTWA 1S6HA 1VGCC 3RC6A 4CR9A 3ZVCA 3UQVA 3SZNA 2PR3A 1CA0C 1C1SA 4DVAU 2VH6A 1VGCB 3V3MA 1NO9H 4FUCA 2BX4A 1CA0B 2V35A 1ZYOA 4B6EA 1THRH 1KMHB 4GSOA 1GI4A 2Q6FA 2ZFTA 1YY3A 2EEKA 1W8BH 1FY1A 5E8EH 3NUMA 4TY6A 5TCAA 1EB2A 4E05H 1T4VH 3PV4A 3E0NB 4A1TA 4ZHAA 1N8OB 1S83A 5DP6A 3NK8A 1A3BH 1IQNA 3MOCA 2BLVA 5EQRA 1H9LB 2BVXH 2Y82A 3V0XA 3KQBA 2KCPA 1MD7A 1D3DB 1ELDE 1DWCH 1BRBE 2H6MA 2P59A 4XBDA 4XOJA 1OOKB 1GDUA 2GZ8A 2QCYA 3A7ZA 1CHOF 2OQUA 4BAHB 5FPYA 2OUAA 4NSYA 1YLDA 2NU0E 3U8TH 1O5BB 1GJBB 1YC0A 2JIZD 3RXFA 2WPMS 1D9IA 8ESTE 1CGIE 2AERH 2V0BA 3ELAH 2C4FH 4I31A 1AVWA 2FS9A 2SGAA 2EC9H 4ABIA 3QGJA 3GOVB 1P2IA 5GJ4B 2R9PA 4ZH8A 3LU9B 1KDQB 3A7WA 2P8OC 1NTPA 1FQ3A 2UUFB 4BXSA 2KZ4A 3QO6A 1DICA 2VVCA 3EDXB 1GJAB 3BF6H 3MU0A 1C2FA 2P8OB 4YOGA 1V2VT 2A5KA 1DY9A 4DURA 1O2SA 3S7KB 1MCVA 1W0ZU 2TIOA 4X6PA 4XDEA 3RXHA 3UNQA 3MWIU 1C5UA 1O2IA 5J4QA 3PWCA 1KY9A 1P57B 3AVZA 2FOMB 3D65E 1S81A 1S84A 3ZVAA 3RXEA 3F2GA 1QL9A 5C1YA 1DS2E 4ISOA 5FX6A 1SQAA 4B2BA 2P93A 3MNXA 4I7YH 3EA8A 2WV5A 4RKOB 3U28C 2XWBI 1GCTB 2ZU4A 5H4IB 1O3IA 1P2JA 1ELTA 2XOKD 1QBVH 2P95A 1MKXH 3P70B 2A7CA 1QA0A 2I6QA 2J95A 1P2QA 2O8UA 4J2YB 4WH6A 4XBBA 3RXQA 1SGQE 3R3GB 4OS1A 2DE8A 3TNTA 1TOMH 1YPGH 3AAUA 4P00A 1ZMJA 2VIQA 4LK4A 4MPXA 1JRTA 1VKYA 1WCZA 2BDYA 5FBIA 2P16A 3OSYA 2CN0H 1CT0E 2YMSD 3FOAA 1ANEA 2AGIX 2XNDD 1VJAU 1ELFA 1TNGA 1AVGH 2D1JA 4HG6A 1OWEA 1J15A 1MTUA 2YOLA 2Y81A 1XKAC 1XXFA 2Z9JA 1Y5BT 1BUIA 1KLIH 1INCA 5L30H 1O2YA 1GBFA 3TGJE 2FX4A 1NM6A 5E0JA 1C1RA 1EP6A 1AE5A 1GMDG 1O3CA 1KXDA 3O8RA 3F3BA 2ZCLP 3RC5A 1P09A 4JCNA 4AOQA 3P8NA 5F8XA 2GJGA 1HIAB 1O5AB 3STIA 1NFYA 3UQOA 2UWLA 1ZMLA 3GDUA 5LPEA 1XUGA 1TAWA 2WYGA 1DPOA 2AYWA 3FAOA 3F6UH 2WZQA 2ZHDA 1FAKH 1GHAF 1TONA 2GZ9A 2LP6A 2B5TB 3EE0B 4CRBA 1QZ8A 1HLTH 4DW2U 2WINI 3TJVA 1C2EA 2DE9A 2GDEH 3BTQE 5EODA 3SU0A 3VPKA 2ZDNA 4NWLA 3GY2A 4FU9A 3TK6A 1HAVA 5F8ZA 1VCPA 1SMFE 1H8DH 1OPHB 2ZA5A 2HVYB 3SNCA 1ESTA 2ANMH 3N7DA 3M36A 5JDUB 1DXPA 3QWCH 2OC7A 4BAOB 2NWNA 2AMPA 3BTKE 4I8LA 1CT4E 3NRLA 3PROA 5FX5A 2PLXA 2AHME 1MBMA 3OEHD 5TJXA 1O2VA 4X2XA 5EXLA 1QBNA 3HGPA 1QGFA 2RDEA 1OYQA 5JBTA 4BANB 5GXPA 1DDJA 3T5FH 2BLWA 3V12A 3WWFA 1BMMH 1OWJA 4I86A 3A85A 1E35B 4INLA 3MH4A 4O3TA 3W94A 4UDWH 1ZGIA 3SU6A 4SGBE 4Z1MD 3H7TA 3RXKA 3M3VA 1QB1A 1OWHA 4Q4LA 1A1RA 2ZU5A 1GGDB 2KCAA 2BQ7B 1EQ9A 2JH0D 2KCYA 3RXRA 3O8CA 1EAUA 1SPJA 2V3HH 1P11E 2CF8H 2G51A 1HBTH 1MTVA 3QN7A 5LPFA 1ZSJA 2G8TA 1QQ4A 1NFXA 1THPB 5A0BA 2FOCA 3BG4C 1C9PA 1DWDH 3RXBA 1O3DA 2WPLS 2FYRA 1RD3B 1TBQH 4ABEA 5JPMH 2Y7ZA 1O2XA 3A7YA 3BG4B 2ZFFH 1TPPA 2K0QA 3NWUA 1BBRE 4FUEA 2L74A 1QFKH 1ANBA 2BDCA 3HATH 1FAXA 1O39A 2R0LA 2F3CE 1Z1IA 2KCOA 2L6OA 5DK1A 3M35A 1NBME 4BAKB 3GS9A 1OHHD 2HRVA 2ODYB 1K28D 2D2DA 1C5LH 3OX7U 2FTMA 1CQQA 2QGRA 4Q80A 3MFJA 3A87A 4TSFD 5J4SA 3MHWU 1HRTH 1WQSA 2PFEA 1MQ5A 2TBSA 3ENSB 2Y7XA 2BDIA 3BTFE 4B2CA 4UONA 2OC0A 4GLYA 2ALVA 1LKBA 1ID5H 1BTPA 4NZQA 2BQWB 2C3SA 2FMJA 1RXPA 3V7TA 3PMAB 4K8YA 1GI8B 2W7UA 2QA9E 4MNXA 3ZZ8A 4CRAA 1FI8A 3BTEE 2HALA 1V2TT 5EG4A 1O2KA 1D6WA 1UTJA 1GBBA 1YP9A 2GCHG 4JZEH 2V7QD 1BTZA 1K9OE 1ELVA 2F9NA 3RXMA 1OP8A 1H4WA 1O36A 3PMJA 1SFQB 2BDBA 1KXBA 2QF0A 3ZVFA 4A92A 2PW8H 5FCRA 5DSFA 4RT0A 1GHXH 1KIGH 2ZC9H 4ACBA 2A7JA 4CRGA 2KAIB 5EW2H 1RTLA 1FONA 1O3BA 3F0PA 2C8YB 3SU2A 1EZUC 5GPIB 4KTSA 1PPFE 4ZKSU 3E3TA 1JXPA 1QB9A 1C5SA 1FJSA 2FOEA 3NCLA 2ZGBH 3ZZ4A 5DP4A 2A1DB 2OQ5A 1TE0A 2GMTC 1O2ZA 4FUDA 1YPJH 3S9CA 1BHXF 1OXGA 4FU8A 1Z8JB 2ILNA 1VITG 3BIUH 1FUJA 2GMTB 1O2WA 1MABB 2HVXA 1TPOA 2CGAA 3PM3A 4Q7XA 1TA2A 4B74A 1FLEE 4XRNA 2HWLB 1MKWK 4NFEA 2DUCA 4JZFH 3BEUA 1DVAH 1IQGA 1L1GA 2BM2A 1DWBH 2BDHA 4ISIH 4RI0A 5B6OA 3FZZA 7ESTE 5B6LA 1MTNC 1WXRA 3ZV8A 4X1NU 4Y0YE 1YCPM 4X8TH 3RXSA 1MTNB 4K1EA 4BNRA 1H1BA 2FWWA 4JYUH 1UHBB 4I33A 3M7UA 3SZEA 4X2YA 1ETRH 4JZ1A 4LXBH 2PKAA 1AUTC 3LOXA 1KLJH 1GHBF 2ZDLA 1EX3A 3SGAE 3BV9B 5C0TA 2KM0A 5JB8S 2CHAB 2XCFA 1DANH 2WPIS 3MH6A 3LJJA 2NU1E 3TVJB 2BY7X 2W3IA 3RMMH 1BJVA 4AN7A 1EP5A 1O32A 5EW1H 3GISB 4H6SB 3E8LA 3MH5A 1V2RT 1E36B 3PLKA 4IC6A 4J1YA 1F0UA 1V2KT 2FYQA 4KTCA 5JBAS 3F9HA 2EA3A 2EI7A 1M9UA 3RU4E 2F9OA 1B0EA 3HK3B 3SU3A 3EGKH 2FDAA 4Z0KA 3DFJA 3ZZ5A 4AB8A 3IWMA 1O2NA 1W13U 3SBKA 4DG4A 4B1TA 3SW2B 4Y11E 3BEIB 1Q2WA 2W6JD 2Y5GA 2SGEE 2O8MA 4I8GA 1ZR0A 1OKXA 3SNEA 2VIOA 3LJOA 3N7EA 1SGPE 3KYGA 4YM9A 4UFGH 4YOIA 3TPIZ 1D3TB 1ZPZA 1C1WH 3TGIE 2ZDMA 3FKSD 5C3NA 3S0NA 4Q7YA 2FXRA 5KECA 1O2QA 1Z7KA 4NIWA 1TRMA 1ELEE 2D8WA 4JYTA 4K2YA 4ZMAH 1GMCF 1XX9A 3CNRA 5GWZA 1NS3A 3F68H 2SFAA 2PSXA 3LIWA 1SGYE 4ZXYH 1V2WT 2FO9A 2FOHA 1OSSA 1KXAA 2J97A 3LGUA 1GMCG 2ZTXA 1LVMA 5DKMA 3SU1A 1C5PA 2JETC 4BXWA 5A0AE 2HPPH 3O8DA 3M3TA 5T3HA 2ZU2A 2PWXA 3CP7A 2ZFRH 1TALA 2JETB 2CMYA 3H09A 5C17A 4I8HA 2F9BH 4DY7B 1GI5A 4IMZA 2Y6TA 5DJ7A 2Q6DA 2OP9A 1SSXA 2ANWA 2FX6A 4B75A 3A8DA 1BMLA 5CHAC 3GDSA 2XBYA 1HJAC 2ANKH 4RKJB 1KXEA 2G00A 5CHAB 2BQ6B 3AASA 1AFEH 2G4UA 3MU8A 4UFEH 4NA7A 2AIPA 2FOBA 3LGWA 1MBQA 1PPEE 2W3KA 3E90B 1TMUH 4NCYA 3MO6A 1FY8E 2GV7A 1LHCH 4A1XA 1RS0A 2WPKS 4HZHA 3T25A 2IOTA 3U1JB 2AFQB 5FL7D 3SV8A 2VJ1A 4D9QA 3KQDA 2HGTH 3F2HA 4B2AA 2J34A 1O2HA 4UE7H 2GZ7A 2CXVA 1O38A 4WMEA 1O3AA 5L6NH 2C93B 1C5TA 2G5VA 1O0DH 4KKDA 4ZKNU 2G52A 1LHDH 1IHSH 2ZGJA 5DP7A 5C2ZA 5IYTA 4IN1A 2GT7A 1TPAE 4Q2KA 4VGCB 2A31A 5C67A 3LGYA 3A8CA 1TX6A 2H2ZA 1KXFA 1IQEA 1TFXA 3OY6U 1O5CB 1MZDA 2W7SA 3U98H 5L2ZH 1YPLH 4ASUD 2EI6A 4WXIA 3T26A 3URCA 1KDQA 3RXOA 1HAXB 1CSOE 1GBJA 3MO3A 4NIYA 3VXEH 4CRFA 3RXVA 1E1QD 1SGDE 1L4ZA 1BTHH 1MH0A 1AHTH 1HAGE 3PYHA 1VCQA 9ESTA 1O2PA 5DP8A 1C5MD 1NRRH 3T62A 2TGDA 1SHYA 2V3OH 4ZUHA 1DFPA 1WU1A 1GI6A 2EI8A 4ISHH 3NKKA 4BTUB 2J9NA 3UREA 4OGXA 1CVWH 2R0KA 1J17T 4A5TS 3RP2A 2QXJA 2J38A 1UVTH 1BBRH 3LKWA 3TH3H 3A7TA 1K0HA 1BTXA 1O2RA 1Z6JH 1SC8U 1EASA 1P8VC 1NFUA 3GY4A 5F6MA 1UW7A 4D8NA 1T32A 3VB7A 3SHAH 3PTNA 2BY8X 2FS8A 2KX4A 4CR5A 2OC1A 2Z94A 1GJ6A 5FPSA 1WBGB 1F5LA 1N8OC 1DITH 4MTBA 4MPWA 2K8IA 3ATMA 2A4GA 3PTBA 1MD8A 1O31A 1O2UA 1XMNB 3N7OA 4NIXA 1ZJKA 4DGJA 1V2ST 1J8AA 2FM2A 1O5GH 4HFPB 4JZIA 2YNAA 2BHGA 2LNCA 1NZQH 5FBEA 2HLCA 1FPHH 3TNSA 4ABFA 2ZGHA 1Z6EA 3UFAA 3A7VA 5K7RA 1D6RA 2JDID 1W0YH 3QX5H 3DHKH 5GCHF 1V2UT 4YESB 1P01A 2XTTB 1IQJA 4IGDA 8LPRA 3JZ2B 1GVLA 2VNTA 4X0WU 3SJ8A 3P8GA 3DSGA 3QUMP 2ZDKA 3CS0A 4NZLA 4I8JA 1HIAA 1BJUA 4OS7A 2ZU1A 1CHOG 1TYNA 4MPVA 5JBBS 3TK9A 1L4DA 5LH8A 1UTMA 2Q1JA 2ZGXH 3RM0H 4AFZA 1K1IA 2ZU3A 3LGTA 5GIBA 1UCYE 3LC3A 3LGVA 3RXTA 2GDDA 3ZVGA 1GBAA 2SNVA 3A81A 4AYVB 5DO4H 1FX0B 3L6PA 4BTTB 1EJAA 4CRCA 3T2NA 5LGOA 4FUIA 4BTIB 4IBLH 1SR5C 1ELGA 1X7AC 4WY3A 4Y0ZE 1GJ8B 1MQ6A 2F91A 3VB4A 1QRWA 1O3EA 4AG1A 3VB6A 1O2TA 1LDTT 4MPUA 1AO5A 1O3MA 3V13A 1C2LA 5EJLA 1XUHA 2PP6A 4X8UH 1GCTC 1NU7B 1WUNH 5IDKA 1HNEE 2OCVB 2CK3D 2OD3B 1GI7B 3P92A 3BTWE 1O30A 1O3KA 1E79D 3M5OA 4WVPE 3R0FA 1GJ9B 3P8OA 4GAWA 3UAIC 3UNSA 3Q3XA 1MAXA 2CV3A 3F9GA 3UWJH 2FOGA 3JZ1B 1NBMD 1S82A 1P2OA 3SU5A 4IC5A 1D4PB 1WAYB 1MUEB 3NZIA 3SNDA 1BCUH 3UB0A 4DIIH 2B0FA 2B7DH 1F92A 2EQNA 3PV2A 1YKTA 3DUXH 1L1NA 4NA9H 1ZTJA 2A4QA 2P3TB 4U32A 2H5DA 1S85A 1QB6A 2XWAA 1BITA 1MCTA 4UFDH 3ZV9A 1EXFA 1QR3E 1TLDA 1NN6A 1CGJE 1P9SA 4AGJA 4IMQA 4CHAC 1YF4A 4O97A 1PFXC 1A5HA 3SN8A 3RXAA 3AK5A 3PLBA 2WHXA 2NU4E 1TGNA 1C4U2 1W10U 4CHAB 1LKAA 2QY0B 3H5CB 1QHRB 2BDAA 2J98A 5AVDA 2GT8A 1XM1A 3P95A 5DN6D 1TQ7B 3KYFA 1AVXA 5CHBA 3M5LA 5EPYA 1T4UH 1DX5M 1O5DH 3BSQA 1ELCA 3FP7E 1J14A 1ELAA 4GUXA 1ESBA 1YPKH 3F1SB 5L2YH 3UNRA 1Q31A 5FPTA 1FPCH 1A0LA 3QTOH 1FMGA 1K1PA 3M61U 3D62A 3MO9A 3SU4A 3G01A 4THNH 1HFDA 1TRNA 1JOUB 1Z1JA 2WV4A 3RXDA 1BMNH 2PGBB 1G32B 1W12U 1G30B 1P04A 1WDIA 1GHAG 3E0PB 1HPGA 3CENA 3SI4H 3B9FH 4FVDA 1C5VA 1IQKA 2ZPSA 4TPYA 1NPMA 4KTUA 1D3PB 1P0SH 2WUBA 5HIYA 4ABGA 1DUAA 4Z6AH 5PTPA 1FY3A 1G2LA 2CJIA 4U2WA 2ZHQH 3Q3KA 1T8LA 1W11U 2GKVE 4K60A 1PYTC 4OGYA 3DSPA 1T8OA 1Y3VA 1GBCA 1V2PT 3KCGH 1EAXA 2ZKSA 2RG3A 1QA7A 2JKHA 4D7GA 1W0KD 3A8BA 4UFFH 7GCHF 1XVMA 4AG2A 4FOUC 3EA9A 3OTJE 4I32A 3SJKA 3SJOA 1GGDC 4X1PU 3EQ0H 1P2MA 5EGMA 3OU0A 4Y7BA 3U8RH 2O8LA 1UTPA 1EJNA 4K69A 1QURH 1SG8B 1ZHRA 4XD7D 1IQIA 2PKSB 3BTME 3GYMA 1JIRA 3VEQB 1AZZA 2QF3A 4K1TA 5ETXA 5ABWA 1Y3XA 5HM9A 2FIRH 3A7XA 1MKXK 1F7ZA 8GCHF 2XC5A 1LCYA 1K1NA 2FTLE 5FHTA 5E0GA 1YCPH 2WPHS 1EOLA 1MKWH 4YLUA 1AKSB 4MLFB 1NY22 2RFKC 1P12E 1PQ8A 1ARCA 1GBDA 2GTBA 3E1XB 5BRRE 3RU4D 5EQQA 1HUTH 1C4V2 6GCHF 3SHCH 1TRYA 3SJ9A 3U8OH 1P05A 2ZDAH 2G4TA 2IJOB 1K1JA 2R2MB 4TWWA 2HOBA 2VIWA 4M9FA 2ZNKH 1UHBA 1EZQA 5IK2D 3S9BA 3ATKA 3WW7A 1KSNA 2Z9KA 1EZSC 2G55A 7LPRA 3OFND 4I8KA 2STAE 2VWOA 5C0UA 1V2MT 1RIWC 2BXTH 3M3SA 3BN9A 1Y5UT 1BT7A 3ESTA 2ODQA 5FCKA 3AW1A 1RIWB 1SGFA 3FP8E 3GCNA 1CHGA 2VWNA 4F4OC 1C1OA 3SGQE 1YWUA 4GCHF 3F9EA 1OYTH 2Y80A 5KEDA 3S69A 4AYYB 1LTOA 1UK3A 1HXEH 1ZTLA 3UUZA 2ZG0H 3AW0A 3NXPA 5A8ZA 1KTTB 1V2OT 2IN2A 2VB0A 2W6ID 4UEHH 2JH5D 2UWPA 1GBHA 3GY3A 1GBIA 3MNSA 2M2AA 3RMOH 4ABBA 1QRXA 3QK1A 3UIRA 1ELBA 2B9LA 1TNLA 1LMWB 2TGPZ 8KME2 1GVKB 1BA8B 4NIVA 3UR9A 4NGAH 5HYOA 1KTSB 4MVNA 1PPHE 1GL0E 1WYKA 3SORA 1SLWB 1DSTA 2UUKB 2ALPA 2PUQH 4RSPA 3UTUH 2OLGA 3RM2H 5E0HA 5ESTE 2H1UA 1TNIA 1HAPH 4R8TB 1OWKA 1O2GH 4YXWD 1AWFH 4ZKRU 4MNYA 3SYJA 1AD8H 3PRBA 1GPZA 3PV5A 3DA9B 1ZRKA 1EPTC 3BTHE 2H9HA 1UTLM 3ZZ9A 1HJ8A 1XKBC 2A2XH 3RXGA 1EPTB 2PHBA 1EB1H 1QY6A 3GY6A 2VVVA 4YZUA 1TX7A 3M7QA 2Z9LA 2BZAA 1P02A 1RJXB 2H9TH 2XBXA 2ZTZA 2HNTC 3VG8A 1ORFA 2CHAC 4INHA 4OM9A 3TH2H 3KL6A 1BTYA 2ZCKP 1P3CA 1HGTH 1SB1H 4K5ZA 3E6PH 1CA8B 3D23A 1QBOA 2FZZA 1SLVB 1JRSA 3EAJA 1UCYH 3GY7A 3RU4T 1O37A 1TNJA 3T27A 5C1XA 1GHBG 1C2DA 1S5SA 4X6NA 2C8ZB 3RXIA 1P03A 3VGCC 4GVUA 3GYLB 2WPJS 1HDTH 1ZZZA 1W2KH 3A86A 4MNWA 5T6DA 4WWYA 1GJ7B 1V2JT 1NRPH 1QL8A 3VGCB 1GI0A 1F0SA 1PQ5A 3LH3A 3QZRA 1TABE 3LH1A 2UUJB 4TWYA 3SI3H 1UTQA 5HMAA 1CBWB 1TMBH 2ZECA 3ZZ3A 1BOQA 2SGQE 2XC4A 2QV1A 5C94A 3LONA 1QNJA 4MDSA 5EPNA 4Y8XA 1SI5H 4AX9H 1TNKA 1E1RD 3GICB 1C5WB 1G9IE 4F48B 2AH4X 2A7HA 1LO6A 1GHWH 1KYNA 1TWXB 3BTGE 3ZZ6A 1TB6H 4LZ1H 3L33A 1OX1A 5T6GA 2W5EA 4OS2A 3KEEA 2HNTE 3K2UA 1HV7A 1HAZB 1GBLA 1SGCA 1GI9B 1ZPCA 2O8WA 1GBMA 1ZPBA 2A4RA 1DM4B 1IHTH 3D49H 2ZIQH 3ZZCA 3UR6A 1DY8A 3TITA 1AIXH 3TJUA 2PSYA 2F43B 1ZTKA 3RLWH 1BIOA 1B7XB 2BY6X 2TGTA 4X1QU 4IN2A 2NU2E 3KQ5A 1GMHF 2WUCA 3BTDE 1SOZA 1RRKA 2HNTF 2QAAA 1Z8RA 3PRDA 1HAIH 2F9PA 1PPBH 2AIQA 3ZIAD 3SQEE 3A83A 3ZYEA 1C1UH 1QQUA 2OXSA 2M5TA 5C5OA 1HYLA 3RXPA 1P10A 1WV7H 3ATIA 1ZOMA 4ISLA 4TY7A 1TBZH 4ZHLU 1C1VH 1O33A 4JZDH 4X2VA 5C20A 3IITA 4CRDA 4B6FA 1QL7A 1EJMA 1GDNA 2XRCA 4AFSA 1LHFH 3SQHE 4DOQA 1P9UA 1ZHPA 1GHZA 1SGFG 1UJ1A 1EZXC 3KN2A 1C2JA 3TGKE 2BD5A 3HGNA 1A7SA 3K6YA 3KHVA 3RXCA 3ZVEA 2V3MA 1SGNE 2BY9X 1ANCA 4O9VA 1XUIA 2BX3A 2FODA 1K21H 4TT3D 2O9QA 5EXNA 3PLPA 4F55A 3PB1E 2PKAB 4WMFA 4A7IB 4O3UA 1QJ6B 3VXFH 2F9UA 1AN1E 4OS4A 5KGOA 2ZEBA 3ZZAA 2G81E 3MU1A 3TK5A 5EIYA 1C1MA 1UTKA 2I6SA 1LQDB 4ABAA 1UTNA 1DLEA 3SV2H 1RTFB 5HXFA 4VGCC 4ABJA 1UVOA 1NESE 2FLBH 1SL3A 3CS7A 6CHAB 2J5UA 1JBUH 3S9AA 4DT7B 3STJA 1XXDA 3MH7A 1UVSH 1TQ0B 1W0JD 4X1SU 5HM2A 5K0HA 3WWBA 1W14U 1YPEH 3EYDA 1WSSH 1G3DA 2PTNA 1DT2A 1LPZB 1VZQH 3VB3A 2WSSD 3PMBB 1CGHA 1GJCB 2GX4A 1C2MA 2BD9A 4YT7H 2VWLA 1EFRD 3LGIA 5DG6A 3W1EA 2BVRH 3UY9A 4Y8YA 1C4Y2 2ZHWH 4OS5A 3EA7A 3ODDA 5HIZA 2VBCA 4YLQH 3OAAD 5EJZA 1AGJA 1BDAA 1GI3A 1PJPA 1GBEA 2OC8A 2QXGA 3T29A 1LHEH 1A5GH 2W26A 2ASUB 3ATWA 1AE8H 4Y7AA 1N6YA 5G4BA 1A5IA 1GHYH 3RUOA 1ZMNA 1KLTA 2PTCE 1ABIH 1NFWA 3U69H 5A8YA 1DSUA 1H8ED 1A0HB 1S6LA 1TOCB 1AFQB 4AC9A 2QYIA 2ZHEH 1Y3YA 2ZHFH 2FESH 1BZXE 1ZJDA 1SVPA 2P3FH 1Z8IB 2ZPQA 3A8AA 4ZXXH 1ARBA 4NG9H 4DIHH 1O3HA 1YGCH 1YPHE 5A0CA 2BLQA 2QIQA 2ZCHP 1TGTA 3ITIA 4PROA 1ZSKA 2QXHA 3KIDU 1C2GA 1H8HD 2Z9GA 1QRZA 2H5CA 4X6OA 3E16B 2HPQH 3DT0H 2FP7B 1HCGA 2SGPE 2F9VA 1MZAA 4BOHA 2XBVA 1BRAA 5F8TA 1AY6H 1BTWA 3FN8A 4P02A 4WMDA 1GI2A 3QDZB 3HPTB 1HAHH 2EY4C 5GCHG 4CBNA 1TGCA 1SLXB 3HKIB 3N99A 4K1SA 4ABHA 1ANDA 1K1MA 2UWOA 1YLNA 2GP9B 2VH0A 3ZZDA 1N6XA 4FXGH 3SGBE 2ZFPH 2BY5X 5I46H 1A2CH
chains in the Genus database with same CATH topology
1Y3WA 1E0FD 1DXWA 1A46H 1O3FA 1EATA 1VITH 1TBRH 3S7HB 3WY8A 1LVBA 2TGAA 4FUBA 2SNWA 2TPIZ 1S6FA 3ZZBA 4WH8A 2A0QB 1UMAH 4K3JA 2A45B 1EKBB 1XUJA 4MQAA 2OBQA 1KXCA 1CU1A 2FOAA 2XBWA 1L0ZA 1C5NH 2ZFSA 3C27B 3OYPA 1DOJA 1G3BA 2R3YA 5A8XA 1F0RA 3QZQA 1OWIA 1CO7E 2J94A 1UO6A 1PYTD 2FPZA 4B71A 1FV9A 1PQAA 3W95A 1W3CA 3A89A 1LVOA 4UD9H 1RGQA 1IQFA 2NU3E 3I77A 4ESTE 1VJ9U 4Q7ZA 2VIDA 1C1NA 1YPMH 3RXLA 2OTVA 4M7GA 7KMEH 1NT1A 2RA0A 3RXJA 1GI1A 1BBRK 2BOHB 2Z3DA 3P6ZB 5E2PA 1T7CA 2ZF0H 1A0JA 5I25A 2P3UB 1H9IE 4JYVH 1TX8A 1NROH 2VU8E 2THFB 3KQEA 1K2I1 2RCEA 3I78A 2D26C 3TJNA 1TMTH 2RDLA 2ZFQH 1GJDB 5DP5A 3K6ZA 4X2WA 2K1QA 1PPCE 2OINA 1O5EH 1AKSA 4FUFA 4XBCA 3UOPA 5DP9A 2A5IA 4HI3A 1UVPA 1H9HE 4KELA 1LVYA 2VIVA 4NWKA 1TIOA 4AZ2B 5CMXH 1V3XA 4B73A 4D7FA 5JB9S 3BIVH 2BD8A 1Z71A 4FUGA 1GMDF 1F5RA 1DE7H 1LQEA 1Y8TA 3MI4A 2BXUH 3U9AH 1EAIA 4WXVA 3FFGA 2WYJA 1E37B 3UWIA 2PV9B 5A09A 2PUXB 1NRQH 1FZZA 1A4WH 4U30A 1YLCA 3M7TA 2Z7FE 1V2QT 3VFEA 1IQMA 1GHVH 1K1LA 3ZZ7A 1F2SE 1G2MA 3O8BA 2LPRA 3H7OA 2BD3A 2BVSH 1ETSH 2AGEX 3F9FA 3SUGA 4CBOA 1Y3UA 1A61H 2AMDA 1V2NT 3MMGA 3KQCA 1ZLRA 4GHQA 5TCCA 1P2KA 1UK4A 1A3EH 1SLUB 2P94A 3ZVBA 1HB0B 3RMLH 3MU4A 3QTVH 3QLPH 6ESTA 1AI8H 1OP2A 1ACBE 1L2EA 1UK2A 2VVUA 4BAQB 2KAIA 2BLOA 1CE5A 3SNAA 1AUJA 5EQSA 5CE1A 2AGGX 3QGNB 1HXFH 2GGVB 3P8FA 1FN8A 2PKSC 5FXLA 5AF9H 7GCHG 3Q76A 1MAYA 3M5NA 5ESBA 3Q77A 2Z3EA 2ZZUH 4XSKU 4A6LA 2FLRH 2H9EH 1ZGVA 3GCTF 1CT2E 1BB0B 1NRSH 4ISNA 1TGSZ 3SV9A 2ZQ2A 1GDQA 2FEQH 2J2UA 3E91A 3ODFA 3GCTG 3M37A 8GCHG 4JK6A 1Z8GA 4H4FA 3PWBA 4LZ4B 1TPSA 2BZ6H 2STBE 3NPSA 3SOSA 2GVFA 4E06H 1C2HA 1T8MA 3B8JA 1EPTA 1B0FA 1AMHA 4DCDA 3SV6A 2FI4E 1PPZA 6GCHG 1SQOA 2AMQA 3GDVA 2XW9A 1SQTA 5C1UA 1SGIB 3I29A 1GVZA 2ULLA 4X8VH 2ZPRA 3TLOA 1C2IA 1O35A 1GG6C 5GDSH 3DFLA 1YYY1 3GY8A 1DWEH 3FANA 4GPGA 4E7NA 1GG6B 4ABDA 3Q00A 3KNXA 1BHXB 1O3PB 3LDXH 1P06A 4X1RU 1U6QA 1OWDA 5EOKA 2XNIA 2C90B 3AAVA 3VB5A 4NA8A 3A82A 3TH4H 2ZO3H 1AB9C 2BD7A 5JBCS 2BB4A 3A84A 4X8SH 2BMGB 2CF9H 2TRMA 1AB9B 1IAUA 2A4OA 1HAVB 3SJIA 1NU9A 3SNBA 3U1IB 2GCHF 4TYDA 1J16A 4FVBA 1DLKB 4X6MA 4GCHG 3K9XB 1HAYB 1E34B 3TU7H 2Z9IA 3A80A 1FNIA 1Y59T 4E7RG 4FUJA 1Q3XA 4QT8C 2B8OH 2ZTYA 3HK6B 2ZQ1A 4HGCA 4R0IA 5LPRA 2YNBA 1GCDA 1LPGB 2AS9A 3RLYH 5JYIA 1O5FH 2XYAA 1FXYA 2FI3E 1ESAA 2VGCC 2XC0A 1FIZA 1O3JA 1O34A 1RTKA 1P2NA 4XE4A 1VITF 1C5XB 3LPRA 2ESTE 1SGEE 2VGCB 3BG8A 4FUHA 5HGGA 1TNHA 1S0RA 4ZROA 4FU7A 1HAOH 1QTFA 1UTOA 4DJZB 1SFIA 1Y5AT 2ZP0H 4BAMB 1BMAA 1O2OA 1JIMA 4CH2B 1W7XH 3PMHB 1PQ7A 4WJG2 1BQYA 1IQHA 3T28A 1VCWA 3BTTE 2C8WB 1K22H 2ANYA 4KP0A 1SOTA 1YCPK 1MU8B 4CH8B 1EOJA 9LPRA 2VWMA 1AU8A 2BOKA 1FY5A 1XUKA 3RDZA 4YOJA 5C5NA 4U01A 2BD4A 3TJOA 1S0QA 4OS6A 4AORA 3ATLA 3L3TA 1C1QA 4AFUA 1T31A 2JH6D 1WQVH 1GL1A 1CBWC 2AEIH 1ZRBA 4D76A 4Y6DA 4JMYA 4NFFA 1QJ7B 2QN5T 3FZDA 3K65B 1JMOH 1LPKB 1FY4A 3BEFB 3M5MA 1C5RA 1GJ4H 2BYAX 4Y79A 3P17H 5A2MH 4K8BA 3SUFA 1IOEA 1T8NA 2BTCE 1O2LA 5E2OA 3KGPA 4IS5A 4Y8ZA 2FOFA 3RMNH 4AB9A 1XVOA 2J4IA 4WF8A 4A1VA 4H6TA 2A2QH 2R2WU 4NSVA 1O3NA 3TIUA 4D9RA 1P3EA 1GWAA 3OY5U 1XUFA 1C2KA 4Y10E 5T6FA 4INKA 1MTSA 1H8IH 1E38B 4H42U 1QCPA 1SBWA 3GCHC 2A32A 2SGDE 3C1KA 1C5OH 1IQLA 4GHTA 5DPAA 1MMJN 4AGKA 1N1LA 3GCHB 1NC6A 1WTHD 1FDPA 5AFZH 1ABJH 3SUDA 1GMHG 4YO9A 2G5NA 1L1JA 4KGAA 2QXIA 4CREA 2BDGA 2FI5E 3UPEA 4HTCH 3GCOA 1O2MA 1LHGH 2VIPA 3KF2A 1EUFA 3LC5A 1AWHB 1EAWA 1F5KU 4ASHA 1K1OA 2RA3A 1C5YB 1O2JA 1D3QB 4B76A 3SV7A 3UOUA 2C8XB 1QIXB 1WOFA 2R3UA 1YM0A 3LT3A 1THSH 1VR1H 1WTGH 5DGJA 2ZI2H 3GY5A 4YTAA 2VINA 1SGTA 2QC2A 1TGBA 1C5ZB 3FVFB 1OP0A 5EU8A 2GD4B 1GBTA 4MG3A 1FIWA 2ZWLH 3FP6E 4SGAE 3B23B 1C1TA 4RN6A 2Z6BD 4ZAEA 3MU5A 1HJAB 2OBOA 1C1PA 2SGFE 2ZGCA 1BRUP 1UCYK 1GBKA 1UVUH 1DUEA 6CHAC 4YT6H 4AFQA 1AQ7A 1G3CA 1BTUA 6LPRA 1FN6A 4F49A 2PGQB 1J9CH 2GCTC 1V6DA 3MTYA 2GV6A 2Z3CA 1ETTH 1GJ5H 2F83A 1BRCE 2A5AA 2BD2A 3PO1C 3SO3A 2GCTB 3SUEA 4O03A 3RC4A 3MYWA 1HJ9A 1QJ1B 4JK5A 3PO1B 1O3LA 3IG6B 3ZVDA 2V6NA 1G3EA 1PPGE 1C5QA 1RFNA 1F0TA 1YPHC 4MNVA 5DP3A 1AZ8A 2UUYA 1JWTA 3HKJB 3MNCA 1NRNH 2IPHA 3A88A 1ZHMA 1MU6B 2Y5FA 4IW4E 4LOYH 2ZDVH 4ZKOU 1ZSLA 4ZHMU 3ZYDA 3MNBA 2ODPA 2J92A 4Y71A 1YBWA 5EXMA 5SGAE 1C9TA 1SGRE 1TA6A 3RXUA 2XXLA 4TPIZ 1SHHB 3Q3YA 4XFQA 5AHGH 5BPEA 1OS8A 1V2LT 4Y76A 1AFQC 1G37A 1O3OA 1B5GH 5FAHA 3DD2H 2O8TA 2Y5HA 1W7GH 3URDA 5F03A 1G36A 1O3GA 5AFYH 2Q6GA 2XCNA 1MTWA 1S6HA 1VGCC 3RC6A 4CR9A 3ZVCA 3UQVA 3SZNA 2PR3A 1CA0C 1C1SA 4DVAU 2VH6A 1VGCB 3V3MA 1NO9H 4FUCA 2BX4A 1CA0B 2V35A 1ZYOA 1THRH 4GSOA 1GI4A 2Q6FA 2ZFTA 2EEKA 1W8BH 1FY1A 5E8EH 3NUMA 4TY6A 5TCAA 1EB2A 4E05H 1T4VH 3PV4A 3E0NB 4A1TA 4ZHAA 1N8OB 1S83A 5DP6A 3NK8A 1A3BH 1IQNA 3MOCA 2BLVA 5EQRA 1H9LB 2BVXH 2Y82A 3V0XA 3KQBA 1MD7A 1D3DB 1ELDE 1DWCH 1BRBE 2H6MA 2P59A 4XBDA 4XOJA 1OOKB 1GDUA 2GZ8A 2QCYA 3A7ZA 1CHOF 2OQUA 4BAHB 5FPYA 2OUAA 4NSYA 1YLDA 2NU0E 3U8TH 1O5BB 1GJBB 1YC0A 3RXFA 2WPMS 1D9IA 8ESTE 1CGIE 2AERH 2V0BA 3ELAH 2C4FH 4I31A 1AVWA 2FS9A 2SGAA 2EC9H 4ABIA 3QGJA 3GOVB 1P2IA 5GJ4B 2R9PA 4ZH8A 3LU9B 1KDQB 3A7WA 2P8OC 1NTPA 1FQ3A 2UUFB 4BXSA 3QO6A 1DICA 2VVCA 3EDXB 1GJAB 3BF6H 3MU0A 1C2FA 2P8OB 4YOGA 1V2VT 2A5KA 1DY9A 4DURA 1O2SA 3S7KB 1MCVA 1W0ZU 2TIOA 4X6PA 4XDEA 3RXHA 3UNQA 3MWIU 1C5UA 1O2IA 5J4QA 3PWCA 1KY9A 1P57B 3AVZA 2FOMB 3D65E 1S81A 1S84A 3ZVAA 3RXEA 1QL9A 5C1YA 1DS2E 4ISOA 5FX6A 1SQAA 4B2BA 2P93A 3MNXA 4I7YH 3EA8A 2WV5A 4RKOB 2XWBI 1GCTB 2ZU4A 5H4IB 1O3IA 1P2JA 1ELTA 1QBVH 2P95A 1MKXH 3P70B 2A7CA 1QA0A 2I6QA 2J95A 1P2QA 2O8UA 4J2YB 4WH6A 4XBBA 3RXQA 1SGQE 3R3GB 4OS1A 2DE8A 3TNTA 1TOMH 1YPGH 3AAUA 1ZMJA 2VIQA 4LK4A 4MPXA 1JRTA 1WCZA 2BDYA 5FBIA 2P16A 3OSYA 2CN0H 1CT0E 1ANEA 2AGIX 1VJAU 1ELFA 1TNGA 1AVGH 2D1JA 1OWEA 1J15A 1MTUA 2YOLA 2Y81A 1XKAC 1XXFA 2Z9JA 1Y5BT 1BUIA 1KLIH 1INCA 5L30H 1O2YA 1GBFA 3TGJE 2FX4A 1NM6A 5E0JA 1C1RA 1EP6A 1AE5A 1GMDG 1O3CA 1KXDA 3O8RA 2ZCLP 3RC5A 1P09A 4JCNA 4AOQA 3P8NA 5F8XA 1HIAB 1O5AB 3STIA 1NFYA 3UQOA 2UWLA 1ZMLA 3GDUA 5LPEA 1XUGA 1TAWA 2WYGA 1DPOA 2AYWA 3FAOA 3F6UH 2ZHDA 1FAKH 1GHAF 1TONA 2GZ9A 3EE0B 2B5TB 4CRBA 1HLTH 4DW2U 2WINI 3TJVA 1C2EA 2DE9A 2GDEH 3BTQE 5EODA 3SU0A 3VPKA 2ZDNA 4NWLA 3GY2A 4FU9A 3TK6A 1HAVA 5F8ZA 1VCPA 1SMFE 1H8DH 1OPHB 2ZA5A 3SNCA 1ESTA 2ANMH 3M36A 5JDUB 1DXPA 3QWCH 2OC7A 4BAOB 2NWNA 2AMPA 3BTKE 4I8LA 1CT4E 3PROA 5FX5A 2PLXA 1MBMA 5TJXA 1O2VA 4X2XA 5EXLA 1QBNA 3HGPA 1QGFA 1OYQA 5JBTA 4BANB 5GXPA 1DDJA 3T5FH 2BLWA 3V12A 1BMMH 1OWJA 3A85A 1E35B 4INLA 3MH4A 4O3TA 3W94A 4UDWH 1ZGIA 3SU6A 4SGBE 3H7TA 3RXKA 3M3VA 1QB1A 1OWHA 1A1RA 2ZU5A 1GGDB 2BQ7B 1EQ9A 2JH0D 3RXRA 3O8CA 1EAUA 1SPJA 2V3HH 1P11E 2CF8H 2G51A 1HBTH 1MTVA 3QN7A 5LPFA 1ZSJA 2G8TA 1QQ4A 1NFXA 1THPB 5A0BA 2FOCA 3BG4C 1C9PA 1DWDH 3RXBA 1O3DA 2WPLS 2FYRA 1RD3B 1TBQH 4ABEA 5JPMH 2Y7ZA 1O2XA 3A7YA 3BG4B 2ZFFH 1TPPA 3NWUA 1BBRE 4FUEA 1QFKH 1ANBA 2BDCA 3HATH 1FAXA 1O39A 2R0LA 2F3CE 1Z1IA 5DK1A 3M35A 4BAKB 2ODYB 2HRVA 1K28D 2D2DA 1C5LH 3OX7U 2FTMA 1CQQA 2QGRA 4Q80A 3MFJA 3A87A 5J4SA 3MHWU 1HRTH 1WQSA 2PFEA 1MQ5A 2TBSA 3ENSB 2Y7XA 2BDIA 3BTFE 4B2CA 4UONA 2OC0A 4GLYA 2ALVA 1LKBA 1ID5H 1BTPA 4NZQA 2BQWB 2C3SA 2FMJA 1RXPA 3V7TA 3PMAB 4K8YA 1GI8B 2W7UA 2QA9E 4MNXA 3ZZ8A 4CRAA 1FI8A 3BTEE 2HALA 1V2TT 5EG4A 1O2KA 1D6WA 1UTJA 1GBBA 1YP9A 2GCHG 4JZEH 1BTZA 1K9OE 1ELVA 2F9NA 3RXMA 1OP8A 1H4WA 1O36A 3PMJA 1SFQB 2BDBA 1KXBA 2QF0A 3ZVFA 4A92A 2PW8H 5FCRA 1GHXH 1KIGH 2ZC9H 4CRGA 2A7JA 2KAIB 5EW2H 1RTLA 1FONA 1O3BA 3SU2A 2C8YB 1EZUC 5GPIB 4KTSA 1PPFE 4ZKSU 3E3TA 1JXPA 1QB9A 1C5SA 1FJSA 2FOEA 3NCLA 2ZGBH 3ZZ4A 5DP4A 2A1DB 2OQ5A 1TE0A 2GMTC 1O2ZA 4FUDA 1YPJH 3S9CA 1BHXF 1OXGA 4FU8A 1Z8JB 2ILNA 1VITG 3BIUH 1FUJA 2GMTB 1O2WA 2HVXA 1TPOA 2CGAA 3PM3A 4Q7XA 1TA2A 4B74A 1FLEE 2HWLB 1MKWK 4NFEA 2DUCA 4JZFH 3BEUA 1DVAH 1IQGA 1L1GA 2BM2A 1DWBH 2BDHA 4ISIH 5B6OA 3FZZA 7ESTE 1MTNC 3ZV8A 4X1NU 4Y0YE 1YCPM 4X8TH 3RXSA 1MTNB 4K1EA 4BNRA 1H1BA 2FWWA 4JYUH 1UHBB 4I33A 3M7UA 4X2YA 1ETRH 4JZ1A 4LXBH 2PKAA