1LVBA

Catalytically inactive tobacco etch virus protease complexed with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
b'PRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQAGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMSKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATALYTIC DOMAIN OF THE NUCLEAR INCLUSION PROTEIN A (NIA)
publication title Structural basis for the substrate specificity of tobacco etch virus protease.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein
total genus 48
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvbA01
2XBYA 2XRCA 1G3DA 3GY2A 2H1UA 3ZZ4A 1YKTA 3MU8A 1YPEH 1SVPA 4Y76A 1CT2E 1TNJA 5EXLA 2PGBB 1HAVA 3A82A 1F0TA 1AO5A 1YPLH 2GZ9A 4UFDH 5H4IB 5JBBS 4AB8A 1KDQB 1EJMA 3AAVA 4UD9H 3GY6A 3W94A 2YNBA 2BDAA 2XNIA 1QJ1B 3ZZDA 1ZSLA 4MLFB 1D3TB 4CRBA 2ZU3A 4YLQH 3RXAA 2BDHA 4Q80A 1QB6A 2EI7A 2PSYA 2C8YB 1H9LB 2B9LA 2FOHA 1IQLA 2BLVA 2ZEBA 1C1QA 2V0BA 3RXMA 4GVUA 2F9OA 3LPRA 3TH4H 1PPFE 5E0HA 3TGKE 2V35A 1O5FH 1MUEB 1KTSB 1O2TA 1LCYA 3VB3A 4XBDA 1O5EH 3I29A 2Y80A 2GMTC 2OQUA 1U6QA 2OXSA 2Q1JA 1C9TA 1CBWC 4E7NA 2F9NA 4CRGA 3AW0A 3E0PB 1YF4A 1ZJDA 4ZHAA 4AG2A 1LDTT 1YM0A 2BVRH 1AUJA 3EDXB 3SU2A 4D9QA 1OXGA 3A85A 4MG3A 1BBRE 3IWMA 1FN8A 2SGAA 3MFJA 4Y8YA 2C4FH 2RA3A 1P2NA 2J9NA 2H2ZA 1AUTC 3SI3H 5JB9S 1SR5C 2PWXA 3K9XB 3RXUA 5K7RA 1VJ9U 1YYY1 2VJ1A 4INKA 3TJVA 3UPEA 1GI3A 3T2NA 3PMAB 1DFPA 1P02A 3ZVFA 3SO3A 1NS3A 3Q3XA 3CS7A 3RC5A 1C2FA 4B1TA 1NFXA 4ABBA 1O2YA 2F9PA 3UOPA 1ACBE 4A6LA 3M7QA 1DUEA 3EAJA 1FY5A 4OGYA 1NC6A 3BTQE 1SGDE 1BTZA 1EP6A 1DVAH 2Z3EA 4H42U 2YNAA 1LQEA 1YCPH 3U9AH 4BXSA 1DE7H 1IQHA 2H9TH 1XVMA 3MNCA 1S6HA 4TYDA 4AYVB 2JETB 3LGYA 5HM9A 1KLTA 3F6UH 1GHAG 2UUFB 2J92A 4I8GA 1XM1A 1S82A 2C3SA 2AMPA 2FO9A 5FX5A 3ODDA 4X2XA 2A7CA 1L4DA 1UTOA 1GG6C 5C3NA 4X8TH 1GI7B 3S9CA 3TK5A 5AFZH 1FIZA 3SUEA 1FY8E 3SGAE 3BTHE 1SGQE 1UVSH 4DW2U 1O3EA 4TY7A 3FP8E 3MO9A 4K69A 1GI0A 1GJ5H 5DP4A 1DWBH 3SU0A 5AVDA 1HLTH 1DS2E 1MCTA 2F9UA 2Z9KA 1GHVH 1QTFA 5EQSA 1LKAA 1V2NT 3MH7A 1MBMA 2P3TB 3T26A 4R0IA 8GCHF 3SU6A 1W0YH 2GCHG 3QZQA 1EAXA 4NFEA 1VZQH 4NWKA 2P16A 1C2EA 3GCTG 1V2VT 4HTCH 2FOBA 2ZZUH 1W12U 2VIOA 2FEQH 3P8FA 1FQ3A 3SU5A 2FYRA 4ABFA 2WPMS 1A7SA 3PYHA 1VGCB 3KNXA 1LVOA 1QL7A 2TGAA 1KXCA 1MTSA 1P8VC 1TPOA 3QX5H 2AFQB 1EPTC 3SV6A 4QT8C 3P95A 1O3NA 1GI2A 2W26A 1TNGA 4ZKRU 1D4PB 1P2QA 2C8XB 1O2IA 1SPJA 4CRDA 5AHGH 1O2UA 2UWLA 4Y7AA 3D23A 4FUCA 3QN7A 4SGAE 4CBOA 2R9PA 1GHWH 1TNLA 1W3CA 2SNVA 1SQAA 2FI4E 3BTTE 4AN7A 4ZMAH 2ZQ2A 1MTNB 1V2KT 2PFEA 1ESAA 5FXLA 3GDVA 2PGQB 3B9FH 3KCGH 1TPSA 3M5OA 3ZZ6A 1BRCE 4Z6AH 4Q7YA 7GCHG 1TBZH 1TNIA 2O8LA 1L1NA 1AKSB 1SGNE 3A8AA 1VITH 3RP2A 1O3HA 1K1OA 1O2PA 1GMHF 1V2MT 1BT7A 1P2JA 2VWOA 4XE4A 1K21H 1JBUH 2O8MA 2PUQH 4DCDA 1TA6A 1ELDE 2ANYA 5AFYH 1YPGH 3KQDA 8ESTE 2GP9B 3RMNH 1PPHE 3G01A 3E6PH 2XC5A 3P70B 5JB8S 2UUKB 3MI4A 2B0FA 2SGFE 3PO1C 3SU3A 1GHBG 2R2MB 3VGCC 2HRVA 2IOTA 1TALA 3UY9A 2FOCA 1EB2A 4YTAA 2BZ6H 1JIMA 2BVXH 1BCUH 1RD3B 2A5KA 1HGTH 3UR9A 1GI5A 2VIPA 1A1RA 9ESTA 1IQFA 1TNHA 3QZRA 1OWDA 5C5NA 2ALPA 3SI4H 3LU9B 3ZVBA 3UOUA 5K0HA 1OWEA 3RLYH 1ORFA 1ZGVA 1NROH 1SLUB 5A8YA 1TGSZ 2Q6FA 3K6YA 2ZI2H 1NESE 1GHYH 1MD8A 1FXYA 3NZIA 1H8DH 2GT8A 1EOJA 1GGDC 2BXTH 1O31A 2XC0A 3LH1A 1O2QA 2AMQA 4AX9H 3ZVEA 1EZQA 1HCGA 4WXIA 4B2AA 1VITG 1SGEE 3MH4A 3E1XB 1GBHA 4UONA 1O2WA 2RCEA 1BJVA 3P6ZB 2A4GA 3CENA 3LC5A 1GVZA 4MQAA 1O37A 1NFWA 2BMGB 4F4OC 4B2CA 4IN2A 3SJKA 1Q3XA 4CRFA 1ANEA 2FOGA 5DJ7A 2FI3E 3TK6A 3VPKA 2Z3CA 3RXQA 4O3UA 1K1IA 5L2ZH 1D3DB 2QAAA 3LOXA 2NU2E 4GSOA 5J4QA 1IQNA 1PFXC 4WVPE 4BAOB 1ELAA 5T6GA 3DFJA 1BTUA 3SV9A 1Z8IB 3FVFB 4Q7ZA 1IQGA 3A7TA 4GPGA 2SGEE 4NSYA 2GDDA 2JH5D 3UQOA 4FUFA 2ZHFH 2CGAA 1LKBA 3KIDU 1ESTA 2VIDA 3SN8A 1ZTJA 3PLBA 4RSPA 1O2HA 6CHAB 2BQWB 4OS2A 1S83A 5CHAC 5E0JA 1G3BA 1GDQA 1S6FA 4MTBA 2G5NA 4CR9A 1GHXH 3M5MA 1HJAC 1O2ZA 2G4TA 1AB9B 4LK4A 4CRCA 4MVNA 2WPIS 4FUHA 2VIQA 1AE5A 2GZ8A 1O34A 4CREA 4O3TA 2XBXA 2QY0B 1TMTH 1P2IA 3EQ0H 1YCPM 5IDKA 3S7KB 1QL9A 1EASA 1ETSH 1V2LT 3BG4B 3VB7A 1HRTH 1TRYA 1XUHA 3BTWE 4XBBA 1GBJA 3GICB 3ATLA 1F0RA 2G52A 4JYTA 3Q3KA 3KN2A 3ATWA 4ABDA 3BIVH 2QCYA 3I77A 3T27A 5TCAA 4IC5A 4ABAA 1PYTC 4CRAA 1F0SA 3S9AA 4K1EA 4B71A 1O3PB 2BDGA 4XOJA 1P57B 2CF9H 1XUGA 1P05A 3QLPH 1GBDA 1WUNH 1GBTA 2ZPRA 4U32A 4I8HA 4Q7XA 4ZKNU 1A5GH 3M3SA 4JK5A 1IQIA 3ATMA 5IYTA 1IQKA 7ESTE 4AYYB 1BDAA 1Z8RA 4BAQB 2ILNA 1HIAB 1HAVB 4NG9H 1AVGH 4XSKU 3M61U 2VWMA 1LO6A 1GJ8B 1EB1H 3VB4A 3A87A 1DX5M 2AGGX 2FOEA 1D9IA 3SNAA 2ZFSA 1L1GA 3IG6B 1L0ZA 2OP9A 3A8CA 3M5LA 4TY6A 3SU4A 1GJBB 1ELTA 3ZVDA 4WMEA 2BZAA 1GI1A 1BHXF 4B75A 4DGJA 3SQHE 1OWIA 3DUXH 1LHCH 1C1RA 1C5QA 3L3TA 4X2YA 1O3FA 1HAGE 3W95A 2QXIA 6ESTA 4I33A 1UK2A 1KXDA 1TNKA 2ODYB 5C1YA 1HUTH 3LGIA 1C1SA 5EOKA 4JZIA 1Y3UA 1OP0A 4TPIZ 3BEIB 1CGHA 1B0FA 1HDTH 2ZCKP 4BNRA 1Z8JB 1EP5A 2ZGBH 3Q00A 1SGTA 1ZGIA 1TA2A 1ZMLA 1TOMH 2QA9E 1C9PA 1BITA 1ZYOA 1C1OA 1WQSA 4AGJA 1Q2WA 1AMHA 4WXVA 1A0LA 1HFDA 1O2OA 3ENSB 2UWPA 2ULLA 2FM2A 3Q77A 3VB6A 1J17T 5EW1H 3GY4A 1E0FD 2J38A 1AIXH 1A3EH 2PKAA 4YOJA 2EC9H 5BPEA 4YM9A 4CHAC 1JRTA 1NPMA 3D65E 2WPHS 3SOSA 1TX6A 2BDCA 3PLKA 1UTQA 1Y5UT 4JYUH 4A1TA 2ZGJA 4DG4A 2P8OB 1NRRH 1UMAH 3PMHB 1A0HB 1KY9A 3QTVH 3EE0B 1MKWK 4D7GA 2R0KA 1CA8B 2J94A 3A86A 4X1RU 1QBVH 3OYPA 2B8OH 3MO3A 3Q3YA 3ZZ9A 1GMHG 1AZ8A 2FWWA 1LVYA 2ZNKH 2H6MA 4YLUA 1ELCA 2Q6DA 2TPIZ 5FPTA 4AGKA 3F9HA 4GLYA 2B5TB 2XC4A 5ESBA 2QF0A 3S9BA 4JZFH 4WMDA 1FZZA 1O2JA 2BLQA 1UVTH 4KTCA 1N6XA 4NZLA 5BRRE 1ZRBA 4INHA 3QO6A 1WCZA 2QYIA 1AI8H 2PTCE 3UIRA 2BYAX 3RXSA 1YC0A 3BEFB 2ANMH 1KXEA 1GI8B 1BBRK 1HIAA 2ZDKA 4RN6A 3U8RH 3E91A 1KSNA 3SNBA 5A0BA 2ZC9H 1FY3A 2CJIA 1A5IA 1HBTH 2ANKH 2CN0H 1SGYE 1TGCA 1GCTB 3GDUA 5C1XA 4MPUA 1BJUA 1G2MA 4AFZA 2QXHA 4GAWA 3OY6U 1P09A 4KKDA 1MZAA 1HXEH 1QCPA 1WSSH 1QR3E 3T5FH 4IMQA 1C5VA 4ZXXH 4ABIA 1EPTA 1JRSA 1GI4A 1W7XH 1S5SA 4MNVA 1AQ7A 3BTKE 5EGMA 4O97A 3SQEE 2CHAB 3V3MA 2BX3A 1J16A 2AERH 4U2WA 1QGFA 3GYLB 3NXPA 3KQBA 3NWUA 3TNTA 1BMNH 2AMDA 2ANWA 5CHAB 3JZ1B 1MMJN 3UNQA 2VGCB 2A2QH 1C5SA 1GJ4H 2ZGCA 1AWHB 2HOBA 1BOQA 3LGVA 1YLDA 1DICA 1GJAB 1G3CA 1DWDH 3T28A 2XBWA 1A5HA 2BLWA 3MHWU 5C20A 4J2YB 4DVAU 1V2WT 2UUYA 1K9OE 1J15A 1A4WH 7KMEH 2EEKA 1AD8H 1QFKH 2I6SA 1GVKB 4NIVA 1YPMH 1OKXA 1WTGH 4UEHH 1TAWA 4K60A 5JBCS 5C1UA 3PMJA 3PROA 4FUGA 5G4BA 4IW4E 1UHBA 4OS1A 3S0NA 5A2MH 4NA8A 1BB0B 1ZPCA 3BF6H 3QTOH 3ZV9A 4UDWH 1S81A 2P3FH 1UTPA 1XUFA 1D6WA 1HNEE 2OINA 1HPGA 1QURH 4ZH8A 2ZHDA 2WPLS 3N7OA 1GBBA 2FMJA 2PW8H 1G36A 3NCLA 1GI6A 3A80A 4NSVA 3FFGA 2G5VA 3GCHB 3P17H 1XXFA 1C1WH 3HKJB 2QF3A 2WPJS 1LHEH 1FJSA 3NUMA 1RGQA 1FIWA 3RXEA 3BTEE 6LPRA 4FUIA 2PHBA 1QQUA 5CMXH 1MQ5A 2NWNA 1N8OB 4X1PU 1O3OA 3B8JA 2GCTB 5F03A 1O5CB 1EAWA 5GDSH 1ELFA 4BANB 5TCCA 1K1MA 1C1PA 1CQQA 1SLVB 2ZP0H 4Y8ZA 1FI8A 1MKXK 2C90B 2SFAA 1SFQB 2BVSH 7LPRA 1E36B 2G81E 1RTKA 2VU8E 1C4V2 4DURA 1XUIA 2VVCA 2XCFA 4JZ1A 4HFPB 1TFXA 3RXTA 3UTUH 2H9EH 1DWEH 4K5ZA 1V6DA 1UK4A 1PPBH 4ESTE 1DLEA 5EPNA 1TRMA 4BTIB 1ZMJA 4VGCC 5FAHA 4Y0ZE 1O2MA 2ZDNA 1RXPA 4B73A 1P2KA 1T8NA 1FNIA 1HYLA 2GZ7A 3GY8A 3LT3A 3O8BA 4X6OA 2BD5A 4LZ4B 1JXPA 3A7WA 1XXDA 4AFSA 1CT4E 1Z1IA 1MU6B 2GTBA 3STJA 2KAIB 3MOCA 4K1SA 2NU1E 3GY3A 2WUBA 2BY9X 4CHAB 3PTNA 1C5WB 3UWIA 2ZFFH 2ZHEH 2FOMB 3GCOA 3LC3A 1OWHA 1GBMA 1TWXB 1O32A 2J34A 2PSXA 4D9RA 5L30H 1WV7H 1FY4A 3E3TA 5JPMH 4DOQA 1E38B 4ZKOU 2ODPA 1SGCA 5DP9A 4B74A 3QUMP 3RU4E 2WV5A 2EI6A 4PROA 4A1VA 5L2YH 1GBCA 3S7HB 5I46H 1OWKA 1KLIH 3TIUA 3FANA 1OYTH 1T8MA 5LPRA 3T25A 3DT0H 3SJOA 1B7XB 1UTLM 4FUDA 1AFQB 2GVFA 2OQ5A 2O8WA 3O8CA 1OX1A 1O38A 4K2YA 1O3BA 3CP7A 1F92A 2NU4E 3EYDA 2BY8X 1C1VH 2GKVE 1SG8B 5T6FA 3VXFH 3K6ZA 3TH2H 3M37A 4GUXA 2FPZA 3UFAA 1TMUH 3NPSA 1D3QB 3IITA 3FP7E 1TABE 3TITA 3U69H 1BTWA 2OLGA 3BEUA 3PB1E 3ZZBA 4WH6A 1P12E 4KTUA 3AW1A 3KQEA 1OS8A 3EA8A 3P8NA 4A92A 1GHZA 1BRAA 3D62A 3SNCA 3OTJE 5ABWA 2DE9A 1CA0C 2BD2A 2Y6TA 5FBEA 3RXPA 1WAYB 1ETTH 1LPZB 1GL0E 1SLXB 3URCA 3HPTB 1PJPA 4GCHF 1QJ6B 3LIWA 5EQRA 5LGOA 1QJ7B 2Q6GA 1YCPK 2D2DA 1AWFH 4JK6A 1WBGB 3E90B 2ZDAH 3MNBA 1O2VA 3OY5U 3PM3A 1UCYH 1ZSJA 1NFYA 1ZZZA 4D76A 2BTCE 1HAXB 3B23B 5LH8A 3OSYA 3RC4A 1MZDA 1CHGA 2A31A 1DXWA 5HGGA 4OS7A 1AZZA 1ZHPA 5F6MA 4WY3A 1GMDG 1ZJKA 5GXPA 3RXRA 2BD7A 2CXVA 1C1UH 1C5LH 3KL6A 2GMTB 2Y7ZA 1TYNA 1GL1A 2PTNA 1CBWB 3UREA 2HVXA 2TGTA 2C8ZB 3SJ8A 4MNXA 1P9SA 4H6TA 2F91A 1UTJA 2F9VA 2ESTE 3TLOA 2H9HA 1WYKA 2J2UA 4O9VA 2PR3A 3LONA 1UTMA 1O2RA 2XWBI 4YZUA 3KQCA 4LXBH 3RXIA 1IHTH 1Z1JA 4SGBE 2OBQA 3HK3B 3PWBA 1C2IA 1AE8H 1O5AB 2PV9B 4ABGA 1LHGH 2HGTH 3RXVA 4OS5A 1S0QA 3DD2H 4ISNA 4NWLA 4ABJA 2JKHA 2KAIA 1DPOA 2PKAB 3URDA 4B76A 2OTVA 2TGDA 1YPJH 3E0NB 1FV9A 1C1TA 1V2PT 2ZKSA 4ISHH 5FPYA 4X6MA 2K1QA 3DA9B 1OOKB 4OS4A 5L6NH 1KIGH 1C5PA 1GJDB 1C2MA 4Y11E 2Z9GA 4I8LA 2ZFTA 4K1TA 2RA0A 3SU1A 2BX4A 2H5DA 3LKWA 2AH4X 1GWAA 3FAOA 9LPRA 1FY1A 1EJNA 3H7TA 2BXUH 5F8XA 1O2LA 3GOVB 1CT0E 3U98H 4OGXA 2BD9A 1CGIE 5T6DA 1WTHD 1BA8B 2Y5GA 5DP8A 4IGDA 1GG6B 2OC7A 3PV4A 1YP9A 5J4SA 2FLRH 5FX6A 1O3MA 3OX7U 1LPGB 1P06A 2ZU1A 1YPHC 4I7YH 1GBAA 1P0SH 1LPKB 2FIRH 3MU5A 4E05H 1LHDH 4YOIA 5TJXA 3TH3H 1DWCH 1EOLA 1RJXB 1SGRE 2CMYA 2ZU5A 4D7FA 2AIPA 1F2SE 2DE8A 1P2OA 1SGFG 2RG3A 1F7ZA 1OPHB 2D26C 2Z9IA 1VCWA 2TBSA 1C1NA 1Z7KA 2FS8A 5GPIB 1QRWA 4BOHA 4ZROA 1W7GH 1TBQH 1NTPA 1TGBA 1SBWA 2PLXA 3SUDA 2GD4B 1NU7B 1P11E 1DDJA 4X0WU 2JETC 1AHTH 5JBAS 1J14A 2EA3A 2JH0D 3UR6A 2ASUB 1J9CH 1K1NA 3ATKA 3SW2B 1PPEE 2ALVA 1NRQH 3DHKH 1CVWH 1O2NA 1Z71A 4FXGH 2ZO3H 4YESB 1TX7A 3MWIU 2ZA5A 1P3CA 1EPTB 2FI5E 4TWWA 1V3XA 2EI8A 2IN2A 3SJIA 2G55A 5JYIA 1ZTLA 1ZMNA 4DJZB 3KF2A 4UFFH 1BRUP 1O5DH 1XX9A 1F0UA 3HKIB 5DK1A 1SOZA 2AGIX 3LGWA 1V2JT 3A7XA 5CE1A 5DGJA 4A1XA 3A88A 4Q2KA 2Z9LA 4FVBA 4NIWA 4ZHLU 2BD4A 4GHTA 3RXLA 4BTTB 3TPIZ 1QBOA 2ZGXH 1G32B 5JBTA 1P3EA 4R8TB 2O8UA 3PMBB 5GCHF 3MU4A 1SC8U 3ZV8A 5DP6A 5E2OA 1QB1A 4FUBA 2PKSC 1FUJA 1CO7E 1DSUA 2R0LA 2VWNA 2NU0E 2A0QB 1TPPA 3M7TA 1G9IE 1PYTD 3NKKA 5FBIA 1ZPBA 1VCPA 2FYQA 3MU1A 3LJOA 3VEQB 3BTFE 1LVBA 2FXRA 1UHBB 3V0XA 5AF9H 1IQEA 2WUCA 3PO1B 2Z3DA 1F5RA 1O2XA 4X6PA 2BLOA 2GX4A 1A0JA 3MNXA 3VGCB 5PTPA 4FU8A 2P95A 3SHAH 1ARBA 3TK9A 3TGIE 2VIVA 3TU7H 1UCYE 1QA0A 3ZVGA 2UUJB 3V12A 3QGJA 1C5ZB 1N6YA 1MTNC 1SGPE 1PPZA 3EA7A 4NCYA 1FONA 2OC0A 1C1MA 3SV8A 1CSOE 3KHVA 1JMOH 1F5LA 4FUJA 1PQ7A 3P8GA 2ZU4A 5C67A 1EAIA 4CH8B 3ESTA 1QY6A 3EGKH 1TQ7B 2OBOA 1MAXA 2LPRA 3L6PA 8KME2 1GGDB 1SQOA 2BY5X 1TBRH 2W7UA 1C5UA 2IJOB 1BMLA 2BD3A 1W8BH 1NRNH 1TE0A 2RDLA 1GMDF 1YPKH 4BAHB 2FX6A 1C2LA 1A61H 2AYWA 2BHGA 4XFQA 3U1JB 2VNTA 3SORA 3A81A 4H6SB 1GDNA 2OD3B 3M3VA 4ZAEA 1H8IH 1K28D 1YPHE 3HGPA 4MPVA 3P92A 2SGQE 3U8TH 1C5RA 5EPYA 4AORA 1FDPA 3LGUA 1W10U 4GCHG 2VINA 1EJAA 1AY6H 1P9UA 2Y81A 2XBVA 3HK6B 3RXJA 2I6QA 1ZHRA 3SUFA 2ZFQH 2HWLB 1S85A 2JH6D 1HV7A 4GHQA 2IPHA 1FPHH 2ZECA 5GJ4B 1HAOH 4NFFA 1EX3A 1D6RA 1Y3XA 1KTTB 1MAYA 2XCNA 1T31A 1Y5BT 5E2PA 4HI3A 4X8SH 2ZHQH 1J8AA 1MTWA 1TONA 2HLCA 3GISB 1O33A 1MCVA 1SHHB 3TJOA 2VB0A 1HJAB 2BDBA 5C2ZA 5DG6A 1EZXC 3SNEA 1B0EA 1PPGE 4ABHA 1O3IA 1YBWA 2ZDLA 1SI5H 2A4QA 1KXBA 4TWYA 1ELEE 2C8WB 3RM2H 4IN1A 1N1LA 2M5TA 1EXFA 1JIRA 3T29A 1BMAA 1QA7A 3I78A 4YT6H 1W0ZU 4RKJB 4IBLH 4WF8A 1QB9A 1C5XB 2OUAA 2FODA 3SGQE 1UO6A 2ZGHA 5DP5A 1L4ZA 4YOGA 2A5IA 2GV7A 4KGAA 2G00A 1H1BA 2H5CA 4YT7H 3SHCH 1QIXB 1GJ7B 3T62A 2BB4A 4BXWA 2A32A 5E0GA 1C2KA 3HGNA 1INCA 1DY8A 1MD7A 3MTYA 2P94A 5EODA 1C5MD 1E35B 3M5NA 1KXFA 1CHOF 1NZQH 2QXJA 2VVVA 2W3IA 1LHFH 1DSTA 2Y7XA 4IMZA 1AFEH 1F5KU 1UVOA 1MH0A 1O3KA 3RMOH 1E34B 3SNDA 6CHAC 3SV2H 2D8WA 4AOQA 1HAZB 1RTLA 3RUOA 1C2HA 1XUJA 4BTUB 3C1KA 4X6NA 4HGCA 4Y7BA 1O39A 3Q76A 4NIYA 1AB9C 1LVMA 1SSXA 4YO9A 1GCDA 1SL3A 3UNRA 2GGVB 1ABIH 1QNJA 3FP6E 1Z6JH 1HAYB 3UWJH 1KXAA 2QN5T 2HPPH 1C5YB 1V2ST 3F68H 1O3DA 2PUXB 3A8DA 5LPFA 1VR1H 3ODFA 1TOCB 3NK8A 3RU4D 4AG1A 3A7VA 1ZHMA 5A0AE 2WYJA 5GWZA 3BG4C 4NIXA 3TVJB 4KTSA 1ZRKA 3K2UA 2HNTE 1AVWA 4MNYA 4MPXA 1C4Y2 2G4UA 2XYAA 2BD8A 1UVPA 1Y3WA 3RMLH 4O03A 1DT2A 1QQ4A 3RMMH 2F3CE 1PPCE 2Z7FE 1HJ9A 4A7IB 1C2DA 2LNCA 1ELBA 3MU0A 4JZDH 4DT7B 1M9UA 3AVZA 2FOAA 2VH0A 1KLJH 1RS0A 1HJ8A 2AIQA 1TIOA 4ASHA 2BY7X 1O30A 2HALA 1KDQA 5DO4H 3ZZAA 2HPQH 1JOUB 3QDZB 1O2SA 1QRZA 3RDZA 2PKSB 1EATA 1TGNA 5DP3A 4WWYA 1O2GH 5DKMA 3RLWH 1C4U2 1O0DH 1T8LA 1P03A 2ZF0H 2WYGA 1AGJA 5HMAA 1PQ5A 2ZG0H 1V2OT 2ZFRH 1GPZA 4Y6DA 2B7DH 1IQJA 2FOFA 3H7OA 1YLCA 2Y82A 3BTME 2Y5FA 1D3PB 4X8UH 2OC8A 4KELA 3VXEH 3E8LA 2F9BH 1L1JA 2DUCA 3BN9A 3S69A 3VB5A 3RXOA 2TGPZ 3WY8A 3SUGA 3ZZCA 3RXCA 2BM2A 5GCHG 4H4FA 1FPCH 1SGFA 3PTBA 1BZXE 1GBKA 1K22H 2STBE 1WOFA 5A09A 1LTOA 1NO9H 1FLEE 2SGPE 1BUIA 1TMBH 1W2KH 4FU7A 1Y3VA 1VJAU 2ZQ1A 3M35A 5FHTA 1T7CA 1O3JA 2FDAA 1TB6H 1K1PA 3FZZA 3RC6A 1IAUA 4MDSA 4Y71A 5EQQA 3R0FA 3GYMA 3VFEA 5A8ZA 4K8BA 4X1SU 3BV9B 1BTYA 3PWCA 4D8NA 6GCHG 1SLWB 1PQ8A 4DIHH 1DITH 2ZIQH 4JCNA 3L33A 4ABEA 2HNTF 1CE5A 5HM2A 2XWAA 1NM6A 3UUZA 3ZZ5A 1ANCA 1RIWC 1GMCF 4BAMB 3V13A 1P04A 2WINI 1DUAA 2P8OC 3LJJA 1FMGA 1SOTA 2G51A 1A46H 3TNSA 3M7UA 3A84A 4CR5A 1GDUA 4FUEA 3BTDE 3BIUH 1MTUA 3QK1A 3ZZ3A 2Z9JA 1NU9A 4LZ1H 3QWCH 2SGDE 4U30A 1H9IE 2O8TA 4X2WA 1ETRH 3QGNB 5A0CA 1Y59T 4FU9A 1MBQA 2A5AA 4INLA 3HATH 1S84A 1C2JA 1G30B 1TLDA 2NU3E 3C27B 3OU0A 3U1IB 2VWLA 1AU8A 1OWJA 2FP7B 4JZEH 1SQTA 4WMFA 1FN6A 4OS6A 1O3AA 2OCVB 1Q31A 2V3OH 3F9FA 1MQ6A 4XBCA 3STIA 1TRNA 4XDEA 2J4IA 2W3KA 1VCQA 3AAUA 2ZFPH 1GBLA 1TQ0B 1ZOMA 3SBKA 3A89A 3LGTA 4ZKSU 1W11U 2ZU2A 5EU8A 1EKBB 2W7SA 1ZPZA 1C5TA 1GCTC 3UQVA 1Y3YA 2GT7A 1LQDB 3E16B 4UFEH 3ZZ8A 1EAUA 1O3LA 1THPB 1K1JA 1DY9A 3ZZ7A 1EZUC 1OSSA 1ANDA 2P3UB 3MH5A 1MKWH 1OYQA 2FZZA 1QHRB 1O3GA 2A1DB 3A7ZA 4JMYA 4NA7A 3ZVAA 3MYWA 4NZQA 1G2LA 3MMGA 1P10A 2R2WU 1S0RA 4A5TS 2CHAC 3D49H 4F49A 4THNH 4AB9A 5I25A 3ITIA 5HYOA 1SFIA 1NN6A 2R3YA 5FCKA 1BQYA 3F9EA 3U8OH 1JWTA 3H5CB 1P2MA 3MH6A 4AFUA 3R3GB 2A45B 1Y5AT 2VGCC 2FS9A 3ZYDA 1ABJH 1T32A 2Y5HA 2OC1A 1W14U 5T3HA 1G37A 2QV1A 4AFQA 3GY7A 4FVDA 2FX4A 4U01A 4DY7B 1UJ1A 2QGRA 4E06H 1AKSA 2FESH 1GHAF 2Z94A 2BQ6B 3EA9A 4MPWA 2V6NA 1RFNA 1CHOG 2THFB 4ZXYH 2Z6BD 1CGJE 1OP2A 1O5BB 2GV6A 1GVLA 4IC6A 5C5OA 4Y0YE 3RU4T 1X7AC 1HXFH 1BBRH 1O3CA 3F9GA 5JDUB 2XW9A 1NY22 2YOLA 2CV3A 1BHXB 4WJG2 2A4RA 3ELAH 2VVUA 2R3UA 2C93B 3BG8A 4ISLA 1ELGA 2FLBH 3TJUA 1T4UH 3F1SB 5A8XA 2O9QA 5EG4A 2ZCHP 4M7GA 2V3HH 1HAHH 3SV7A 1EZSC 1ANBA 1HAIH 1DM4B 2TIOA 1NT1A 1XUKA 2ZTZA 3RXHA 1UTNA 1Z6EA 1EUFA 3K65B 3LH3A 4MNWA 3SZNA 4Y8XA 4TPYA 1K1LA 4K8YA 2FTLE 3JZ2B 1V2UT 4VGCB 2GCHF 3RXFA 2CF8H 1GJ9B 1LMWB 1YGCH 5DP7A 2SNWA 1QL8A 2ODQA 4E7RG 1BTHH 1UTKA 3RXKA 3GCTF 1IHSH 1FAKH 3GCHC 3TJNA 5SGAE 1SMFE 3KEEA 1A3BH 3A8BA 4NGAH 3RXDA 1ESBA 3M3TA 2FTMA 4I31A 1K2I1 4WH8A 1BTPA 5F8TA 5DPAA 1SHYA 1C5OH 5GIBA 3SJ9A 3KGPA 5HXFA 4JYVH 1IOEA 1N8OC 3MO6A 1DANH 3A83A 1MU8B 1QBNA 1THSH 4UFGH 2GCTC 1TGTA 2BOKA 1UCYK 1G3EA 1Y8TA 2WV4A 4J1YA 4KP0A 1C2GA 1TPAE 2ZTXA 3ZVCA 1H4WA 2UWOA 2WPKS 1O5GH 1MTVA 8GCHG 3V7TA 4NA9H 2AS9A 1T8OA 2XTTB 4ZHMU 1HB0B 2QC2A 2A7JA 1Z8GA 3M36A 3O8DA 4LOYH 3RXBA 1GBFA 1NFUA 5EXNA 1KYNA 3LDXH 1BIOA 1IQMA 3BTGE 3O8RA 5F8ZA 1UVUH 1WU1A 3DFLA 4CBNA 1DLKB 2W5EA 7GCHF 1DOJA 1TX8A 2BOHB 1XKAC 1VGCC 1O36A 3RXGA 1FAXA 3GDSA 3PLPA 2A2XH 2BQ7B 1THRH 4I32A 1V2QT 2ZPQA 1XKBC 2STAE 1ZR0A 2J95A 2VH6A 5ESTE 2ZHWH 2ZWLH 6GCHF 3A7YA 5FCRA 4BAKB 1E37B 3AASA 2P59A 1SGIB 4Z0KA 1BTXA 2AEIH 4CH2B 4Y79A 2BDIA 1PQAA 3MNSA 3FZDA 3TGJE 2G8TA 1L2EA 1XVOA 1P01A 8LPRA 1T4VH 1RIWB 2VIWA 4I8JA 1CA0B 3BSQA 4HZHA 1BMMH 3P8OA 2HNTC 4K3JA 4X1NU 3UNSA 2A4OA 1ARCA 4I8KA 1V2TT 1GHBF 2GDEH 2A7HA 4ZUHA 1CU1A 2ZPSA 2ZCLP 1O35A 1SB1H 1O2KA 2QXGA 5LPEA 1OP8A 4ISIH 3ZYEA 1RTFB 3ATIA 2ZDMA 1UK3A 4IS5A 1AVXA 3RM0H 1C5NH 2XXLA 5ETXA 4ISOA 1AFQC 1GBEA 1B5GH 1W13U 2TRMA 4Y10E 2P93A 1QRXA 3CS0A 1MKXH 4B2BA 1HAPH 5EXMA 5B6OA 5E8EH 5FPSA 2D1JA 4X2VA 2F83A 1ZTKA 2BY6X 1ZSKA 1EQ9A 1RRKA 2AGEX 1GMCG 1GBIA 1NRPH 1ZLRA 5EW2H 4DIIH 4X8VH 4RKOB 3GY5A 1GJ6A 1XMNB 4X1QU 4UE7H 1BRBE 2BDYA 1ID5H 1GJCB 1NRSH 2ZDVH 1H9HE 1V2RT 4AZ2B 1DXPA 3GCNA 3SGBE 1A2CH 1VITF 1WQVH 2QIQA 2ZTYA 1ELVA 1AN1E 1GI9B
chains in the Genus database with same CATH superfamily
2XBYA 2XRCA 1G3DA 3GY2A 2H1UA 3ZZ4A 1YKTA 3MU8A 1YPEH 1SVPA 4Y76A 1CT2E 1TNJA 3WWFA 5EXLA 2PGBB 1HAVA 3A82A 1F0TA 1AO5A 1YPLH 3VG8A 2GZ9A 4UFDH 5H4IB 5JBBS 4AB8A 1KDQB 1EJMA 3AAVA 4UD9H 3GY6A 3W94A 2YNBA 2BDAA 2XNIA 1QJ1B 3ZZDA 1ZSLA 4MLFB 1D3TB 4CRBA 2ZU3A 4YLQH 3RXAA 2BDHA 4Q80A 1QB6A 2EI7A 4FETA 2PSYA 2C8YB 1H9LB 1NBME 2B9LA 2FOHA 1IQLA 2BLVA 2ZEBA 1C1QA 2V0BA 3RXMA 4GVUA 2F9OA 2YMSD 3LPRA 3TH4H 1PPFE 5E0HA 3TGKE 2V35A 1O5FH 1MUEB 1KTSB 1O2TA 1LCYA 3VB3A 4XBDA 1O5EH 3I29A 2Y80A 2GMTC 2OQUA 1U6QA 2OXSA 2Q1JA 1C9TA 1CBWC 4E7NA 2F9NA 4CRGA 3AW0A 4DT4A 3E0PB 1YF4A 1ZJDA 4ZHAA 4AG2A 1LDTT 1YM0A 2BVRH 1AUJA 3EDXB 3SU2A 4D9QA 1OXGA 3A85A 4MG3A 1BBRE 3IWMA 1FN8A 2SGAA 3MFJA 4Y8YA 2C4FH 2RA3A 1P2NA 2J9NA 2H2ZA 1AUTC 3SI3H 5JB9S 1SR5C 2PWXA 3K9XB 3RXUA 5K7RA 1VJ9U 1YYY1 2JDID 2VJ1A 4INKA 3TJVA 3UPEA 1GI3A 3T2NA 3PMAB 1DFPA 1P02A 3ZVFA 3SO3A 1NS3A 3Q3XA 3CS7A 3RC5A 1C2FA 4B1TA 1NFXA 4ABBA 1O2YA 2F9PA 3KQ5A 3UOPA 1ACBE 4A6LA 3M7QA 1DUEA 3EAJA 1FY5A 4OGYA 1NC6A 3BTQE 1SGDE 1BTZA 1EP6A 3PV5A 1DVAH 2Z3EA 4H42U 3F0OA 2YNAA 1LQEA 1YCPH 3U9AH 4BXSA 1DE7H 1IQHA 2H9TH 1XVMA 3MNCA 1S6HA 4TYDA 4AYVB 2JETB 3LGYA 5HM9A 1KLTA 2W6JD 3F6UH 1GHAG 2UUFB 2J92A 4I8GA 1XM1A 1S82A 2C3SA 2AMPA 2FO9A 5FX5A 3ODDA 4X2XA 2A7CA 1L4DA 1UTOA 1GG6C 5C3NA 4X8TH 1GI7B 3S9CA 3TK5A 5AFZH 1FIZA 3SUEA 1FY8E 3SGAE 3BTHE 1SGQE 1UVSH 4DW2U 1O3EA 4TY7A 3FP8E 3AK5A 3MO9A 4K69A 1GI0A 1GJ5H 5DP4A 1DWBH 3PV2A 3SU0A 5AVDA 1HLTH 1DS2E 1YY3A 1MCTA 2F9UA 2Z9KA 1GHVH 1QTFA 5EQSA 3OEED 1LKAA 1V2NT 3MH7A 1MBMA 2P3TB 3T26A 4R0IA 8GCHF 3SU6A 1W0YH 2GCHG 4M9FA 3QZQA 1EAXA 4NFEA 1VZQH 4NWKA 2P16A 1C2EA 3FN8A 3GCTG 1V2VT 4HTCH 2FOBA 2ZZUH 1W12U 2VIOA 2FEQH 3P8FA 1FQ3A 3SU5A 2FYRA 4ABFA 4AC9A 2WPMS 1A7SA 3PYHA 1VGCB 3KNXA 1LVOA 1QL7A 2TGAA 4FOUC 1KXCA 1MTSA 1P8VC 1TPOA 3QX5H 2JJ2D 2AFQB 1EPTC 5FL7D 3SV6A 4QT8C 3P95A 1O3NA 1GI2A 2W26A 1TNGA 4ZKRU 1D4PB 1P2QA 2C8XB 1O2IA 1SPJA 4CRDA 5AHGH 1O2UA 2LELA 2UWLA 4Y7AA 3D23A 4FUCA 3QN7A 2YMSB 4SGAE 2R9PA 4CBOA 1GHWH 1TNLA 1W3CA 1YWUA 2SNVA 1SQAA 2FI4E 3BTTE 3F3BA 4AN7A 4ZMAH 2ZQ2A 1MTNB 1V2KT 2PFEA 1ESAA 5FXLA 3GDVA 2PGQB 3B9FH 3KCGH 1TPSA 3M5OA 3ZZ6A 1BRCE 4Z6AH 4Q7YA 7GCHG 1TBZH 1TNIA 2O8LA 1L1NA 1AKSB 1SGNE 2J98B 3A8AA 1VITH 3RP2A 1O3HA 2QF5A 1K1OA 1O2PA 1GMHF 1E1RD 1V2MT 1BT7A 1P2JA 2VWOA 4XE4A 1K21H 1JBUH 2O8MA 2PUQH 4DCDA 1TA6A 1ELDE 2ANYA 5AFYH 1YPGH 1SKYE 3KQDA 8ESTE 2GP9B 3RMNH 1PPHE 3G01A 2VBCA 3E6PH 5EJLA 2XC5A 3P70B 5JB8S 2UUKB 3MI4A 2B0FA 3KYFA 2SGFE 3PO1C 3SU3A 1GHBG 2R2MB 3VGCC 2HRVA 2IOTA 1TALA 3UY9A 2FOCA 1EB2A 4YTAA 2BZ6H 2XNDD 1JIMA 2BVXH 5CDFE 1BCUH 1RD3B 2A5KA 1HGTH 3UR9A 1GI5A 2VIPA 1A1RA 9ESTA 1IQFA 1TNHA 3QZRA 1OWDA 5C5NA 2ALPA 3SI4H 3LU9B 3ZVBA 3UOUA 5K0HA 1OWEA 3RLYH 1ORFA 1ZGVA 1NROH 1SLUB 5A8YA 1TGSZ 2Q6FA 4XRNA 3K6YA 2ZI2H 1NESE 1GHYH 1MD8A 1FXYA 3NZIA 1H8DH 2GT8A 1EOJA 1GGDC 2BXTH 1O31A 2XC0A 3LH1A 1O2QA 2AMQA 4Q63A 4AX9H 3ZVEA 1EZQA 1HCGA 2RFKC 4WXIA 4B2AA 1VITG 1SGEE 3MH4A 3E1XB 1GBHA 2HVYB 4UONA 1O2WA 2RCEA 1BJVA 3P6ZB 2A4GA 3CENA 5HIYA 3LC5A 1GVZA 4MQAA 1O37A 1NFWA 2BMGB 4F4OC 4B2CA 4IN2A 3SJKA 1Q3XA 4CRFA 1ANEA 2FOGA 5DJ7A 2FI3E 3TK6A 3VPKA 2Z3CA 3RXQA 2IPQX 4O3UA 1K1IA 5L2ZH 1D3DB 1COWD 2QAAA 3LOXA 2NU2E 4GSOA 5J4QA 1IQNA 3PRDA 1PFXC 4WVPE 4BAOB 1ELAA 5T6GA 3DFJA 1BTUA 3SV9A 1Z8IB 3FVFB 4Q7ZA 1IQGA 3A7TA 4GPGA 2SGEE 4NSYA 2GDDA 2JH5D 3OTPA 3UQOA 4FUFA 2ZHFH 2CGAA 1LKBA 3KIDU 1ESTA 2VIDA 3SN8A 1ZTJA 3PLBA 4RSPA 3SYJA 1O2HA 6CHAB 2BQWB 4OS2A 1S83A 5CHAC 5E0JA 1G3BA 1GDQA 1S6FA 4MTBA 2L6OA 2G5NA 4CR9A 1GHXH 3M5MA 1HJAC 1O2ZA 2G4TA 1AB9B 4LK4A 3UAIC 4CRCA 1VKYA 4MVNA 2WPIS 4FUHA 2VIQA 1QZ8A 2J98A 1AE5A 2GZ8A 1O34A 4CREA 4O3TA 2XBXA 2QY0B 1TMTH 1P2IA 3EQ0H 1YCPM 5IDKA 3S7KB 1QL9A 1EASA 1ETSH 1V2LT 3BG4B 3VB7A 1HRTH 1TRYA 1XUHA 3BTWE 4XBBA 1GBJA 3GICB 3ATLA 1F0RA 2G52A 4JYTA 3Q3KA 3KN2A 3ATWA 4ABDA 3BIVH 2QCYA 3I77A 3T27A 5TCAA 4IC5A 4ABAA 2GJGA 1PYTC 4CRAA 1F0SA 2J97A 3S9AA 4K1EA 4B71A 1O3PB 2BDGA 4XOJA 1P57B 2CF9H 1XUGA 1P05A 3QLPH 1GBDA 1WUNH 1GBTA 2ZPRA 4U32A 4I8HA 4Q7XA 4ZKNU 1A5GH 3M3SA 4JK5A 1IQIA 3ATMA 5IYTA 1IQKA 7ESTE 4AYYB 1BDAA 1Z8RA 4BAQB 2ILNA 1HIAB 1HAVB 4NG9H 1AVGH 4XSKU 2KR7A 2VWMA 1LO6A 1GJ8B 1EB1H 3M61U 3VB4A 1BMFD 3A87A 1DX5M 2AGGX 2FOEA 1D9IA 3SNAA 2ZFSA 1L1GA 3IG6B 1L0ZA 2OP9A 3A8CA 3M5LA 4TY6A 3SU4A 1GJBB 1ELTA 3ZVDA 5C0UA 5C0TA 4WMEA 2L74A 2BZAA 1GI1A 1BHXF 4B75A 4DGJA 3SQHE 1OWIA 3DUXH 1LHCH 1C1RA 1C5QA 3L3TA 4X2YA 1O3FA 3GS9A 1HAGE 3W95A 2QXIA 6ESTA 4I33A 1UK2A 1KXDA 1TNKA 2ODYB 5C1YA 1HUTH 3LGIA 1C1SA 5EOKA 4JZIA 1Y3UA 1OP0A 4TPIZ 4HG6A 3BEIB 1CGHA 1B0FA 1HDTH 2ZCKP 4BNRA 1Z8JB 1EP5A 2ZGBH 3Q00A 1SGTA 1ZGIA 1TA2A 1ZMLA 1TOMH 2QA9E 1C9PA 1BITA 1ZYOA 1C1OA 1WQSA 4AGJA 1Q2WA 1AMHA 4WXVA 1A0LA 1HFDA 1O2OA 3ENSB 2UWPA 2ULLA 2FM2A 3Q77A 3VB6A 1J17T 5EW1H 3GY4A 1E0FD 2J38A 1AIXH 2QE7D 1A3EH 2PKAA 4YOJA 2EC9H 5BPEA 4YM9A 4CHAC 1JRTA 1NPMA 3D65E 2WPHS 3SOSA 1TX6A 2BDCA 3PLKA 1UTQA 1Y5UT 4JYUH 4A1TA 2ZGJA 4DG4A 2P8OB 1NRRH 1UMAH 3PMHB 1NBMD 1A0HB 1KY9A 3QTVH 3EE0B 1MKWK 2OK5A 4D7GA 2R0KA 1CA8B 2J94A 3A86A 4RT1A 4X1RU 1QBVH 3OYPA 5IK2D 2B8OH 3MO3A 3Q3YA 3ZZ9A 1GMHG 1AZ8A 3N7EA 2FWWA 2QF4A 1LVYA 2ZNKH 2H6MA 4YLUA 1ELCA 2Q6DA 2TPIZ 5FPTA 4AGKA 3F9HA 4ASUD 4GLYA 2B5TB 2XC4A 5ESBA 2QF0A 3S9BA 4JZFH 4WMDA 1FZZA 1O2JA 2BLQA 1UVTH 4KTCA 1N6XA 4NZLA 5BRRE 1ZRBA 4INHA 3QO6A 1WCZA 2QYIA 1AI8H 2PTCE 3UIRA 2BYAX 3RXSA 1YC0A 3BEFB 2ANMH 3F0PA 1KXEA 1GI8B 1BBRK 1HIAA 3MQKC 2ZDKA 4RN6A 3U8RH 3E91A 1KSNA 3SNBA 5A0BA 2ZC9H 1FY3A 2CJIA 1A5IA 1HBTH 2ANKH 2CN0H 1SGYE 1TGCA 1GCTB 3GDUA 5C1XA 4MPUA 1BJUA 1G2MA 4AFZA 2QXHA 4GAWA 3OY6U 1P09A 4KKDA 1MZAA 1HXEH 1QCPA 1WSSH 1QR3E 3T5FH 4IMQA 1C5VA 4ZXXH 4ABIA 1EPTA 1JRSA 1GI4A 1W7XH 1S5SA 4MNVA 1AQ7A 3BTKE 5EGMA 4O97A 3SQEE 2CHAB 3V3MA 2BX3A 1J16A 2AERH 4U2WA 1QGFA 3GYLB 3NXPA 3KQBA 3NWUA 3TNTA 1BMNH 2AMDA 2ANWA 5CHAB 3JZ1B 1MMJN 3UNQA 2VGCB 2A2QH 1C5SA 1GJ4H 2ZGCA 1AWHB 2HOBA 1BOQA 3LGVA 1YLDA 1DICA 1GJAB 1G3CA 1DWDH 3T28A 2XBWA 1A5HA 2BLWA 3MHWU 5C20A 4J2YB 5EJZA 4DVAU 1V2WT 2UUYA 1K9OE 1J15A 1A4WH 7KMEH 2EEKA 4B6FA 1AD8H 1QFKH 2I6SA 1GVKB 1KMHB 4NIVA 1YPMH 1OKXA 4ZCNA 1WTGH 4UEHH 1TAWA 2M2AA 4K60A 5JBCS 5C1UA 3PMJA 3PROA 5C94A 4FUGA 5G4BA 4IW4E 1UHBA 4OS1A 3S0NA 5A2MH 4NA8A 1BB0B 1ZPCA 3BF6H 2K8IA 3QTOH 3ZV9A 4UDWH 1S81A 2P3FH 1UTPA 1XUFA 1D6WA 1HNEE 2OINA 1HPGA 1QURH 4ZH8A 2ZHDA 2WPLS 3N7OA 1GBBA 2FMJA 2PW8H 1G36A 3NCLA 3FO8D 1GI6A 3A80A 4NSVA 3FFGA 2G5VA 3GCHB 3P17H 3PRBA 1XXFA 1C1WH 3HKJB 2QF3A 2WPJS 1LHEH 1FJSA 3NUMA 1RGQA 1FIWA 3RXEA 3BTEE 6LPRA 4FUIA 2PHBA 1QQUA 5CMXH 5C17A 1MQ5A 2NWNA 1N8OB 4X1PU 5F53A 1O3OA 3B8JA 2GCTB 5F03A 1O5CB 1EAWA 5GDSH 1ELFA 4BANB 5TCCA 1K1MA 1C1PA 1CQQA 1SLVB 2ZP0H 4Y8ZA 1FI8A 1MKXK 2C90B 2SFAA 1SFQB 2BVSH 7LPRA 1E36B 2G81E 1RTKA 2VU8E 1C4V2 4DURA 1XUIA 2VVCA 2XCFA 4JZ1A 4HFPB 1TFXA 3RXTA 3UTUH 2H9EH 1DWEH 4Z1MD 4K5ZA 1V6DA 1UK4A 1PPBH 4ESTE 1DLEA 5EPNA 1TRMA 4BTIB 1ZMJA 4VGCC 5FAHA 4Y0ZE 1O2MA 2ZDNA 1RXPA 4B73A 1P2KA 1T8NA 1FNIA 1HYLA 2GZ7A 3GY8A 3LT3A 3O8BA 4X6OA 2BD5A 4LZ4B 1JXPA 3A7WA 1XXDA 4AFSA 1CT4E 3H09A 1Z1IA 1MU6B 2GTBA 3STJA 2KAIB 3MOCA 4K1SA 2NU1E 3GY3A 2WUBA 2BY9X 3N99A 3PTNA 4CHAB 1C5WB 3UWIA 2ZFFH 2ZHEH 2FOMB 2V7QD 3GCOA 2LP6A 3LC3A 1OWHA 1GBMA 1TWXB 1O32A 2J34A 2PSXA 4D9RA 5L30H 1WV7H 1FY4A 3E3TA 2HLDD 5JPMH 4DOQA 1E38B 2JIZD 4ZKOU 2ODPA 1SGCA 5DP9A 4B74A 3QUMP 3RU4E 2WV5A 2EI6A 4PROA 4A1VA 4ACBA 5L2YH 1GBCA 3S7HB 5I46H 1OWKA 1KLIH 3TIUA 3FANA 1H8HD 1OYTH 1T8MA 5LPRA 3T25A 3DT0H 3SJOA 1B7XB 1UTLM 4FUDA 1AFQB 2GVFA 2OQ5A 2O8WA 3O8CA 1OX1A 1O38A 4K2YA 1O3BA 3CP7A 1F92A 2NU4E 3EYDA 2BY8X 1C1VH 2GKVE 1SG8B 5T6FA 3VXFH 3K6ZA 3TH2H 3M37A 4GUXA 2FPZA 3UFAA 1TMUH 3NPSA 1D3QB 3IITA 3FP7E 1TABE 3TITA 3U69H 5KGOA 1BTWA 2OLGA 3BEUA 3PB1E 3ZZBA 4WH6A 1P12E 4KTUA 3AW1A 3KQEA 1OS8A 3EA8A 3P8NA 4A92A 1GHZA 1BRAA 3D62A 3SNCA 3OTJE 3F2GA 1K0HA 5ABWA 2DE9A 1CA0C 2BD2A 2Y6TA 5FBEA 3RXPA 1WAYB 1ETTH 1LPZB 1GL0E 1SLXB 3URCA 3HPTB 1PJPA 2KFWA 4GCHF 1QJ6B 3LIWA 3OEHD 5EQRA 5LGOA 1QJ7B 2Q6GA 1MABB 1YCPK 2D2DA 1AWFH 4JK6A 1WBGB 3E90B 2ZDAH 3MNBA 1O2VA 3OY5U 3PM3A 1UCYH 1ZSJA 1NFYA 1ZZZA 4D76A 2BTCE 1HAXB 3B23B 5LH8A 3OSYA 3RC4A 1MZDA 1CHGA 2A31A 1DXWA 5HGGA 4OS7A 1AZZA 1ZHPA 5F6MA 4WY3A 1GMDG 1ZJKA 5GXPA 3RXRA 2BD7A 2CXVA 1C1UH 1C5LH 3KL6A 2GMTB 2Y7ZA 1TYNA 1GL1A 2PTNA 1CBWB 3UREA 2HVXA 5GNDA 2TGTA 2C8ZB 3SJ8A 4MNXA 1P9SA 4H6TA 2AHME 2F91A 1UTJA 2F9VA 4P02A 2ESTE 3TLOA 4Q4LA 2H9HA 1WYKA 2J2UA 1E1QD 4O9VA 2PR3A 3LONA 1UTMA 1O2RA 2XWBI 4YZUA 3SZEA 3KQCA 4LXBH 3RXIA 1IHTH 1Z1JA 4SGBE 2OBQA 3HK3B 3PWBA 1C2IA 1AE8H 1O5AB 2PV9B 4ABGA 1LHGH 2HGTH 2KX4A 3RXVA 4OS5A 1S0QA 3DD2H 4ISNA 4NWLA 4ABJA 2JKHA 2KAIA 1DPOA 2PKAB 3URDA 2EY4C 4B76A 2OTVA 2TGDA 1YPJH 2KCYA 3E0NB 1FV9A 1C1TA 1V2PT 2ZKSA 4ISHH 5FPYA 4X6MA 2K1QA 3DA9B 1OOKB 4OS4A 5L6NH 1KIGH 1C5PA 1GJDB 1C2MA 4Y11E 2Z9GA 4I8LA 1FX0B 2ZFTA 2RA0A 4K1TA 3SU1A 3DSPA 3KYGA 2BX4A 2H5DA 3LKWA 2AH4X 1GWAA 3FAOA 4F48B 9LPRA 1FY1A 1EJNA 3H7TA 2BXUH 2V3MA 5F8XA 1O2LA 3F2FA 1CT0E 3GOVB 3U98H 4OGXA 2BD9A 1CGIE 5T6DA 1WTHD 1BA8B 2Y5GA 5DP8A 4IGDA 1GG6B 2OC7A 3PV4A 1YP9A 5J4SA 2FLRH 5FX6A 1O3MA 3OX7U 1LPGB 1P06A 2ZU1A 1YPHC 4I7YH 1GBAA 1P0SH 1LPKB 2FIRH 3MU5A 4E05H 1LHDH 4YOIA 5TJXA 3TH3H 1DWCH 1EOLA 1RJXB 1SGRE 2CMYA 2ZU5A 4D7FA 2AIPA 1F2SE 2DE8A 1P2OA 1SGFG 2RG3A 1F7ZA 1OPHB 2D26C 2Z9IA 1VCWA 2TBSA 1C1NA 1Z7KA 2FS8A 5GPIB 3UB0A 1QRWA 4BOHA 4ZROA 1W7GH 1TBQH 1NTPA 1TGBA 1SBWA 2PLXA 3SUDA 2GD4B 1NU7B 1P11E 1DDJA 4X0WU 3DCLA 2JETC 1AHTH 5JBAS 1J14A 2EA3A 2JH0D 3UR6A 2ASUB 1J9CH 1K1NA 3ATKA 3SW2B 1PPEE 2ALVA 1NRQH 3DHKH 1CVWH 1O2NA 1Z71A 4FXGH 2ZO3H 4YESB 1TX7A 3MWIU 2ZA5A 1P3CA 1EPTB 2FI5E 4TWWA 1V3XA 3FOAA 2EI8A 2IN2A 3SJIA 2G55A 5JYIA 1ZTLA 1ZMNA 4DJZB 3KF2A 4UFFH 2W6ID 1BRUP 1O5DH 1XX9A 1F0UA 3HKIB 5DK1A 1SOZA 2AGIX 3LGWA 1V2JT 3A7XA 5CE1A 5DGJA 4A1XA 3A88A 4Q2KA 2Z9LA 4FVBA 4NIWA 4XD7D 2BD4A 4ZHLU 4GHTA 3RXLA 4BTTB 3TPIZ 1QBOA 4TT3D 2ZGXH 1G32B 5JBTA 1SQRA 1P3EA 5KECA 4R8TB 2O8UA 3PMBB 5GCHF 3MU4A 1SC8U 3ZV8A 5DP6A 5E2OA 1QB1A 4FUBA 2PKSC 1FUJA 1CO7E 1DSUA 2R0LA 4B6EA 2VWNA 2NU0E 2A0QB 1TPPA 3M7TA 1G9IE 1PYTD 3NKKA 5FBIA 1ZPBA 1VCPA 2FYQA 3MU1A 4F55A 3LJOA 3VEQB 3BTFE 5HKKD 1LVBA 2FXRA 1UHBB 3V0XA 5AF9H 1IQEA 2WUCA 3PO1B 2Z3DA 1F5RA 1O2XA 4X6PA 2BLOA 2GX4A 1A0JA 3MNXA 3VGCB 5PTPA 4FU8A 2P95A 3SHAH 1ARBA 3TK9A 3TGIE 2VIVA 3TU7H 1UCYE 1QA0A 3ZVGA 2UUJB 5T1VA 3V12A 3QGJA 3W1EA 1C5ZB 1N6YA 1MTNC 1SGPE 1PPZA 3EA7A 4NCYA 1FONA 2OC0A 1C1MA 3SV8A 1CSOE 3KHVA 1JMOH 1F5LA 4FUJA 2WV9A 1PQ7A 3P8GA 2ZU4A 5C67A 1EAIA 4CH8B 3ESTA 1QY6A 3EGKH 1TQ7B 2OBOA 1MAXA 2LPRA 3L6PA 8KME2 1GGDB 1SQOA 2BY5X 1TBRH 2W7UA 1C5UA 2IJOB 1BMLA 2BD3A 1W8BH 1NRNH 1TE0A 2RDLA 1GMDF 1YPKH 4BAHB 2FX6A 1C2LA 1A61H 2AYWA 2BHGA 4XFQA 3U1JB 2VNTA 3SORA 3A81A 4H6SB 1GDNA 2OD3B 3M3VA 4ZAEA 1H8IH 1K28D 1YPHE 1YLNA 3HGPA 4MPVA 3P92A 2SGQE 3U8TH 1C5RA 2EQNA 5EPYA 4AORA 1FDPA 3LGUA 1W10U 4GCHG 2VINA 1EJAA 1AY6H 2IJD1 1P9UA 2Y81A 2XBVA 3HK6B 3RXJA 2I6QA 1ZHRA 3SUFA 2ZFQH 2HWLB 1S85A 2JH6D 1HV7A 4GHQA 2IPHA 1FPHH 2ZECA 5GJ4B 1HAOH 4NFFA 1EX3A 1D6RA 1Y3XA 1KTTB 1MAYA 2XCNA 1T31A 1Y5BT 5E2PA 4HI3A 4X8SH 2ZHQH 1J8AA 1MTWA 1TONA 2HLCA 3GISB 1O33A 1MCVA 1SHHB 3TJOA 2VB0A 1HJAB 2BDBA 5C2ZA 5DG6A 1EZXC 3SNEA 1B0EA 1PPGE 4ABHA 1O3IA 1YBWA 2ZDLA 1SI5H 2A4QA 1KXBA 4TWYA 1ELEE 2C8WB 3RM2H 4IN1A 1N1LA 2M5TA 1EXFA 1JIRA 3T29A 1BMAA 1QA7A 3I78A 4YT6H 1W0ZU 4RKJB 4IBLH 4WF8A 1QB9A 1C5XB 2OUAA 2FODA 3SGQE 1UO6A 2ZGHA 5DP5A 1L4ZA 4YOGA 2A5IA 2GV7A 4KGAA 2G00A 1H1BA 2H5CA 4YT7H 3SHCH 1QIXB 1GJ7B 3T62A 2BB4A 4BXWA 2A32A 5E0GA 1C2KA 3HGNA 1INCA 1DY8A 1MD7A 3MTYA 2P94A 5EODA 1C5MD 1E35B 3M5NA 1KXFA 1CHOF 1NZQH 2QXJA 2VVVA 2W3IA 1LHFH 1DSTA 2Y7XA 4IMZA 1AFEH 1F5KU 1UVOA 1MH0A 1O3KA 3RMOH 1E34B 3SNDA 6CHAC 3SV2H 2D8WA 4AOQA 1HAZB 1RTLA 3RUOA 1C2HA 1XUJA 4BTUB 3C1KA 4X6NA 4HGCA 4Y7BA 1O39A 3Q76A 4NIYA 1AB9C 1LVMA 2KZ4A 1SSXA 2WZQA 4YO9A 1GCDA 1SL3A 3UNRA 2GGVB 1ABIH 1QNJA 3FP6E 1Z6JH 2WSSD 1HAYB 3UWJH 1KXAA 2QN5T 2HPPH 1C5YB 1V2ST 3F68H 3OFND 1W0JD 1EFRD 1O3DA 2PUXB 3A8DA 5LPFA 1VR1H 3ODFA 1TOCB 3NK8A 3RU4D 4AG1A 3A7VA 1ZHMA 5A0AE 2WYJA 5GWZA 3BG4C 4NIXA 3TVJB 4KTSA 1ZRKA 3K2UA 2HNTE 1AVWA 4MNYA 4I86A 4MPXA 1C4Y2 2G4UA 2XYAA 2BD8A 1UVPA 1Y3WA 3RMLH 5CHBA 4O03A 1DT2A 1QQ4A 3RMMH 3DSOA 2F3CE 1PPCE 2Z7FE 1HJ9A 4A7IB 1C2DA 2LNCA 1ELBA 3MU0A 5EJ1A 4JZDH 4DT7B 1M9UA 3AVZA 2FOAA 2VH0A 3N7DA 1KLJH 1RS0A 1HJ8A 2KM0A 2AIQA 1TIOA 4ASHA 2BY7X 1O30A 3DSGA 2HALA 1KDQA 5DO4H 3ZZAA 2HPQH 1JOUB 3QDZB 1O2SA 1QRZA 3RDZA 2PKSB 1EATA 1TGNA 5DP3A 4WWYA 1O2GH 2KCPA 5DKMA 3RLWH 1C4U2 5B6LA 2K0QA 1O0DH 1T8LA 1P03A 2ZF0H 2WYGA 1AGJA 5HMAA 1PQ5A 2ZG0H 1V2OT 2ZFRH 1GPZA 4Y6DA 2B7DH 1IQJA 2FOFA 4P00A 3H7OA 1YLCA 2Y82A 3BTME 2Y5FA 1D3PB 4X8UH 2OC8A 4KELA 3VXEH 3E8LA 2F9BH 1L1JA 2F4LA 2DUCA 3BN9A 4RI0A 3S69A 3VB5A 3RXOA 2TGPZ 3WY8A 3SUGA 3ZZCA 3RXCA 2BM2A 5GCHG 4H4FA 1FPCH 1SGFA 3PTBA 1BZXE 1GBKA 1K22H 2STBE 1WOFA 5A09A 1LTOA 1NO9H 1FLEE 2SGPE 1BUIA 2F43B 1TMBH 1W2KH 4FU7A 1Y3VA 1VJAU 2ZQ1A 3M35A 5FHTA 1WDIA 1T7CA 1O3JA 2FDAA 2RDEA 1TB6H 1K1PA 3FZZA 3RC6A 1IAUA 4MDSA 4Y71A 5EQQA 3R0FA 3GYMA 3VFEA 5A8ZA 4K8BA 4X1SU 3BV9B 1BTYA 3PWCA 4D8NA 3WW7A 6GCHG 1SLWB 1PQ8A 4DIHH 1DITH 2ZIQH 4JCNA 3L33A 4ABEA 2HNTF 1CE5A 5HM2A 2XWAA 1NM6A 3UUZA 3ZZ5A 1ANCA 1RIWC 1GMCF 4BAMB 3V13A 1P04A 2WINI 1DUAA 2P8OC 3LJJA 1FMGA 1SOTA 2G51A 1A46H 3TNSA 3M7UA 3A84A 4CR5A 1GDUA 4FUEA 3BTDE 3BIUH 1MTUA 3QK1A 3ZZ3A 2Z9JA 1NU9A 4LZ1H 3QWCH 1E79D 2WHXA 2SGDE 4U30A 1H9IE 2O8TA 4X2WA 1ETRH 4OM9A 3QGNB 5A0CA 1Y59T 4FU9A 1MBQA 2A5AA 4INLA 3HATH 1S84A 1C2JA 1G30B 1TLDA 2NU3E 5DN6D 3C27B 3OU0A 3U1IB 2VWLA 1AU8A 1OWJA 2FP7B 1W0KD 4JZEH 1SQTA 4WMFA 1FN6A 4OS6A 1O3AA 2OCVB 1Q31A 2V3OH 3F9FA 1MQ6A 4XBCA 3STIA 1TRNA 4XDEA 2J4IA 2W3KA 1VCQA 3AAUA 2ZFPH 1GBLA 1TQ0B 1ZOMA 3SBKA 2XOKD 3CNRA 3A89A 1UW7A 3LGTA 4ZKSU 1W11U 2ZU2A 5EU8A 1EKBB 2W7SA 1ZPZA 1C5TA 1GCTC 3UQVA 1Y3YA 2GT7A 1LQDB 3E16B 4UFEH 3ZZ8A 2KCAA 1EAUA 1O3LA 1THPB 1K1JA 1DY9A 3ZZ7A 1EZUC 1OSSA 1ANDA 2P3UB 3MH5A 1MKWH 1OYQA 2FZZA 1QHRB 1O3GA 2A1DB 3A7ZA 4JMYA 4NA7A 4TSFD 3ZVAA 2J5UA 3MYWA 4NZQA 1G2LA 3MMGA 1P10A 2R2WU 1S0RA 4A5TS 2CHAC 3D49H 4F49A 4THNH 4AB9A 5I25A 3ITIA 5HYOA 1SFIA 1NN6A 2R3YA 5FCKA 1BQYA 3F9EA 3U8OH 1JWTA 3H5CB 1P2MA 3MH6A 4AFUA 3R3GB 2A45B 1Y5AT 2VGCC 2FS9A 3ZYDA 1ABJH 1T32A 2Y5HA 2OC1A 1W14U 5T3HA 1G37A 2QV1A 4AFQA 3GY7A 4FVDA 2FX4A 4U01A 4DY7B 1UJ1A 1S6LA 2QGRA 5DSFA 4E06H 1AKSA 2FESH 1GHAF 2Z94A 2BQ6B 3EA9A 4MPWA 2V6NA 1RFNA 1CHOG 2THFB 4ZXYH 2Z6BD 1CGJE 1OP2A 1O5BB 2GV6A 1GVLA 4IC6A 5C5OA 4Y0YE 3RU4T 1X7AC 1HXFH 1BBRH 1O3CA 3F9GA 5JDUB 2XW9A 1NY22 2YOLA 2CV3A 1BHXB 4WJG2 2A4RA 3ELAH 2VVUA 2R3UA 2C93B 3BG8A 4ISLA 1ELGA 2FLBH 3TJUA 1T4UH 3F1SB 5A8XA 3F2HA 2O9QA 5EG4A 2ZCHP 4M7GA 2V3HH 1HAHH 3SV7A 1EZSC 1ANBA 1HAIH 1DM4B 2TIOA 1NT1A 1XUKA 3EE7A 2ZTZA 3RXHA 1UTNA 1Z6EA 1EUFA 3K65B 3LH3A 4MNWA 3SZNA 4Y8XA 4TPYA 1K1LA 4K8YA 3U28C 2FTLE 1WXRA 3JZ2B 1V2UT 4VGCB 2GCHF 3FKSD 3RXFA 2CF8H 1GJ9B 5KEDA 1LMWB 1YGCH 5DP7A 2SNWA 1QL8A 2ODQA 4E7RG 1BTHH 1UTKA 3RXKA 3GCTF 1IHSH 1FAKH 3GCHC 3TJNA 5SGAE 1SMFE 2JJ1D 3KEEA 1A3BH 4YXWD 3A8BA 4NGAH 3RXDA 1ESBA 3M3TA 2FTMA 4I31A 1K2I1 4WH8A 1BTPA 5F8TA 5DPAA 1SHYA 1C5OH 5GIBA 3SJ9A 3KGPA 5HXFA 4JYVH 1IOEA 1N8OC 3MO6A 1DANH 3A83A 1MU8B 1QBNA 1THSH 4UFGH 2GCTC 1TGTA 2BOKA 1UCYK 1G3EA 1Y8TA 2WV4A 4J1YA 4KP0A 1C2GA 1TPAE 2ZTXA 3ZVCA 1H4WA 2UWOA 2WPKS 1O5GH 1MTVA 8GCHG 3OE7D 3V7TA 4NA9H 2AS9A 1T8OA 2XTTB 4ZHMU 1HB0B 2QC2A 2A7JA 1Z8GA 3M36A 3O8DA 4LOYH 3RXBA 1GBFA 1NFUA 5EXNA 1KYNA 3LDXH 1BIOA 1IQMA 3BTGE 3O8RA 5F8ZA 1UVUH 1WU1A 3DFLA 4CBNA 1DLKB 2W5EA 7GCHF 1DOJA 1TX8A 2BOHB 1XKAC 1VGCC 1O36A 3RXGA 4ACAA 1FAXA 3GDSA 2PP6A 3PLPA 2A2XH 2BQ7B 1THRH 4I32A 1V2QT 2ZPQA 1XKBC 4RT0A 3NRLA 2STAE 1ZR0A 2J95A 2VH6A 5ESTE 2ZHWH 2ZWLH 6GCHF 3A7YA 5FCRA 4BAKB 1E37B 3AASA 2P59A 1SGIB 4Z0KA 1BTXA 2AEIH 4CH2B 4Y79A 2BDIA 1PQAA 3MNSA 3FZDA 3TGJE 2YMSC 2G8TA 1L2EA 1XVOA 1P01A 8LPRA 1T4VH 1RIWB 2VIWA 4I8JA 1CA0B 1H8ED 3BSQA 4HZHA 5HIZA 1BMMH 3P8OA 2HNTC 4K3JA 4X1NU 3WWBA 3UNSA 2A4OA 1ARCA 2CK3D 4I8KA 1V2TT 1GHBF 2GDEH 2A7HA 4ZUHA 1CU1A 2ZPSA 2ZCLP 1O35A 1SB1H 1O2KA 2QXGA 5LPEA 1OP8A 4ISIH 3ZYEA 1RTFB 3ATIA 2ZDMA 1UK3A 4IS5A 1AVXA 3ZIAD 3RM0H 1C5NH 2XXLA 5ETXA 4ISOA 1AFQC 1GBEA 1B5GH 1W13U 2TRMA 4Y10E 2P93A 2KCOA 1QRXA 3CS0A 1MKXH 3OAAD 4B2BA 1HAPH 5EXMA 5B6OA 5E8EH 5FPSA 2D1JA 4X2VA 2F83A 1ZTKA 2BY6X 1ZSKA 1EQ9A 1RRKA 2AGEX 1GMCG 1GBIA 1NRPH 1ZLRA 5EW2H 4DIIH 4X8VH 4RKOB 3GY5A 1GJ6A 1XMNB 4X1QU 2WPDD 4UE7H 1BRBE 2BDYA 1ID5H 1GJCB 1NRSH 2ZDVH 1H9HE 1V2RT 4AZ2B 1OHHD 1DXPA 3GCNA 3SGBE 1A2CH 5EIYA 1VITF 1WQVH 2QIQA 2ZTYA 1ELVA 1AN1E 1GI9B
chains in the Genus database with same CATH topology
2XBYA 2XRCA 1G3DA 3GY2A 2H1UA 3ZZ4A 1YKTA 3MU8A 1YPEH 1SVPA 4Y76A 1CT2E 1TNJA 5EXLA 2PGBB 1HAVA 3A82A 1F0TA 1AO5A 1YPLH 2GZ9A 4UFDH 5H4IB 5JBBS 4AB8A 1KDQB 1EJMA 3AAVA 4UD9H 3GY6A 3W94A 2YNBA 2BDAA 2XNIA 1QJ1B 3ZZDA 1ZSLA 4MLFB 1D3TB 4CRBA 2ZU3A 4YLQH 3RXAA 2BDHA 4Q80A 1QB6A 2EI7A 2PSYA 2C8YB 1H9LB 2B9LA 2FOHA 1IQLA 2BLVA 2ZEBA 1C1QA 2V0BA 3RXMA 4GVUA 2F9OA 3LPRA 3TH4H 1PPFE 5E0HA 3TGKE 2V35A 1O5FH 1MUEB 1KTSB 1O2TA 1LCYA 3VB3A 4XBDA 1O5EH 3I29A 2Y80A 2GMTC 2OQUA 1U6QA 2OXSA 2Q1JA 1C9TA 1CBWC 4E7NA 2F9NA 4CRGA 3AW0A 3E0PB 1YF4A 1ZJDA 4ZHAA 4AG2A 1LDTT 1YM0A 2BVRH 1AUJA 3EDXB 3SU2A 4D9QA 1OXGA 3A85A 4MG3A 1BBRE 3IWMA 1FN8A 2SGAA 3MFJA 4Y8YA 2C4FH 2RA3A 1P2NA 2J9NA 2H2ZA 1AUTC 3SI3H 5JB9S 1SR5C 2PWXA 3K9XB 3RXUA 5K7RA 1VJ9U 1YYY1 2VJ1A 4INKA 3TJVA 3UPEA 1GI3A 3T2NA 3PMAB 1DFPA 1P02A 3ZVFA 3SO3A 1NS3A 3Q3XA 3CS7A 3RC5A 1C2FA 4B1TA 1NFXA 4ABBA 1O2YA 2F9PA 3UOPA 1ACBE 4A6LA 3M7QA 1DUEA 3EAJA 1FY5A 4OGYA 1NC6A 3BTQE 1SGDE 1BTZA 1EP6A 1DVAH 2Z3EA 4H42U 2YNAA 1LQEA 1YCPH 3U9AH 4BXSA 1DE7H 1IQHA 2H9TH 1XVMA 3MNCA 1S6HA 4TYDA 4AYVB 2JETB 3LGYA 5HM9A 1KLTA 3F6UH 1GHAG 2UUFB 2J92A 4I8GA 1XM1A 1S82A 2C3SA 2AMPA 2FO9A 5FX5A 3ODDA 4X2XA 2A7CA 1L4DA 1UTOA 1GG6C 5C3NA 4X8TH 1GI7B 3S9CA 3TK5A 5AFZH 1FIZA 3SUEA 1FY8E 3SGAE 3BTHE 1SGQE 1UVSH 4DW2U 1O3EA 4TY7A 3FP8E 3MO9A 4K69A 1GI0A 1GJ5H 5DP4A 1DWBH 3SU0A 5AVDA 1HLTH 1DS2E 1MCTA 2F9UA 2Z9KA 1GHVH 1QTFA 5EQSA 1LKAA 1V2NT 3MH7A 1MBMA 2P3TB 3T26A 4R0IA 8GCHF 3SU6A 1W0YH 2GCHG 3QZQA 1EAXA 4NFEA 1VZQH 4NWKA 2P16A 1C2EA 3GCTG 1V2VT 4HTCH 2FOBA 2ZZUH 1W12U 2VIOA 2FEQH 3P8FA 1FQ3A 3SU5A 2FYRA 4ABFA 2WPMS 1A7SA 3PYHA 1VGCB 3KNXA 1LVOA 1QL7A 2TGAA 1KXCA 1MTSA 1P8VC 1TPOA 3QX5H 2AFQB 1EPTC 3SV6A 4QT8C 3P95A 1O3NA 1GI2A 2W26A 1TNGA 4ZKRU 1D4PB 1P2QA 2C8XB 1O2IA 1SPJA 4CRDA 5AHGH 1O2UA 2UWLA 4Y7AA 3D23A 4FUCA 3QN7A 4SGAE 4CBOA 2R9PA 1GHWH 1TNLA 1W3CA 2SNVA 1SQAA 2FI4E 3BTTE 4AN7A 4ZMAH 2ZQ2A 1MTNB 1V2KT 2PFEA 1ESAA 5FXLA 3GDVA 2PGQB 3B9FH 3KCGH 1TPSA 3M5OA 3ZZ6A 1BRCE 4Z6AH 4Q7YA 7GCHG 1TBZH 1TNIA 2O8LA 1L1NA 1AKSB 1SGNE 3A8AA 1VITH 3RP2A 1O3HA 1K1OA 1O2PA 1GMHF 1V2MT 1BT7A 1P2JA 2VWOA 4XE4A 1K21H 1JBUH 2O8MA 2PUQH 4DCDA 1TA6A 1ELDE 2ANYA 5AFYH 1YPGH 3KQDA 8ESTE 2GP9B 3RMNH 1PPHE 3G01A 3E6PH 2XC5A 3P70B 5JB8S 2UUKB 3MI4A 2B0FA 2SGFE 3PO1C 3SU3A 1GHBG 2R2MB 3VGCC 2HRVA 2IOTA 1TALA 3UY9A 2FOCA 1EB2A 4YTAA 2BZ6H 1JIMA 2BVXH 1BCUH 1RD3B 2A5KA 1HGTH 3UR9A 1GI5A 2VIPA 1A1RA 9ESTA 1IQFA 1TNHA 3QZRA 1OWDA 5C5NA 2ALPA 3SI4H 3LU9B 3ZVBA 3UOUA 5K0HA 1OWEA 3RLYH 1ORFA 1ZGVA 1NROH 1SLUB 5A8YA 1TGSZ 2Q6FA 3K6YA 2ZI2H 1NESE 1GHYH 1MD8A 1FXYA 3NZIA 1H8DH 2GT8A 1EOJA 1GGDC 2BXTH 1O31A 2XC0A 3LH1A 1O2QA 2AMQA 4AX9H 3ZVEA 1EZQA 1HCGA 4WXIA 4B2AA 1VITG 1SGEE 3MH4A 3E1XB 1GBHA 4UONA 1O2WA 2RCEA 1BJVA 3P6ZB 2A4GA 3CENA 3LC5A 1GVZA 4MQAA 1O37A 1NFWA 2BMGB 4F4OC 4B2CA 4IN2A 3SJKA 1Q3XA 4CRFA 1ANEA 2FOGA 5DJ7A 2FI3E 3TK6A 3VPKA 2Z3CA 3RXQA 4O3UA 1K1IA 5L2ZH 1D3DB 2QAAA 3LOXA 2NU2E 4GSOA 5J4QA 1IQNA 1PFXC 4WVPE 4BAOB 1ELAA 5T6GA 3DFJA 1BTUA 3SV9A 1Z8IB 3FVFB 4Q7ZA 1IQGA 3A7TA 4GPGA 2SGEE 4NSYA 2GDDA 2JH5D 3UQOA 4FUFA 2ZHFH 2CGAA 1LKBA 3KIDU 1ESTA 2VIDA 3SN8A 1ZTJA 3PLBA 4RSPA 1O2HA 6CHAB 2BQWB 4OS2A 1S83A 5CHAC 5E0JA 1G3BA 1GDQA 1S6FA 4MTBA 2G5NA 4CR9A 1GHXH 3M5MA 1HJAC 1O2ZA 2G4TA 1AB9B 4LK4A 4CRCA 4MVNA 2WPIS 4FUHA 2VIQA 1AE5A 2GZ8A 1O34A 4CREA 4O3TA 2XBXA 2QY0B 1TMTH 1P2IA 3EQ0H 1YCPM 5IDKA 3S7KB 1QL9A 1EASA 1ETSH 1V2LT 3BG4B 3VB7A 1HRTH 1TRYA 1XUHA 3BTWE 4XBBA 1GBJA 3GICB 3ATLA 1F0RA 2G52A 4JYTA 3Q3KA 3KN2A 3ATWA 4ABDA 3BIVH 2QCYA 3I77A 3T27A 5TCAA 4IC5A 4ABAA 1PYTC 4CRAA 1F0SA 3S9AA 4K1EA 4B71A 1O3PB 2BDGA 4XOJA 1P57B 2CF9H 1XUGA 1P05A 3QLPH 1GBDA 1WUNH 1GBTA 2ZPRA 4U32A 4I8HA 4Q7XA 4ZKNU 1A5GH 3M3SA 4JK5A 1IQIA 3ATMA 5IYTA 1IQKA 7ESTE 4AYYB 1BDAA 1Z8RA 4BAQB 2ILNA 1HIAB 1HAVB 4NG9H 1AVGH 4XSKU 3M61U 2VWMA 1LO6A 1GJ8B 1EB1H 3VB4A 3A87A 1DX5M 2AGGX 2FOEA 1D9IA 3SNAA 2ZFSA 1L1GA 3IG6B 1L0ZA 2OP9A 3A8CA 3M5LA 4TY6A 3SU4A 1GJBB 1ELTA 3ZVDA 4WMEA 2BZAA 1GI1A 1BHXF 4B75A 4DGJA 3SQHE 1OWIA 3DUXH 1LHCH 1C1RA 1C5QA 3L3TA 4X2YA 1O3FA 1HAGE 3W95A 2QXIA 6ESTA 4I33A 1UK2A 1KXDA 1TNKA 2ODYB 5C1YA 1HUTH 3LGIA 1C1SA 5EOKA 4JZIA 1Y3UA 1OP0A 4TPIZ 3BEIB 1CGHA 1B0FA 1HDTH 2ZCKP 4BNRA 1Z8JB 1EP5A 2ZGBH 3Q00A 1SGTA 1ZGIA 1TA2A 1ZMLA 1TOMH 2QA9E 1C9PA 1BITA 1ZYOA 1C1OA 1WQSA 4AGJA 1Q2WA 1AMHA 4WXVA 1A0LA 1HFDA 1O2OA 3ENSB 2UWPA 2ULLA 2FM2A 3Q77A 3VB6A 1J17T 5EW1H 3GY4A 1E0FD 2J38A 1AIXH 1A3EH 2PKAA 4YOJA 2EC9H 5BPEA 4YM9A 4CHAC 1JRTA 1NPMA 3D65E 2WPHS 3SOSA 1TX6A 2BDCA 3PLKA 1UTQA 1Y5UT 4JYUH 4A1TA 2ZGJA 4DG4A 2P8OB 1NRRH 1UMAH 3PMHB 1A0HB 1KY9A 3QTVH 3EE0B 1MKWK 4D7GA 2R0KA 1CA8B 2J94A 3A86A 4X1RU 1QBVH 3OYPA 2B8OH 3MO3A 3Q3YA 3ZZ9A 1GMHG 1AZ8A 2FWWA 1LVYA 2ZNKH 2H6MA 4YLUA 1ELCA 2Q6DA 2TPIZ 5FPTA 4AGKA 3F9HA 4GLYA 2B5TB 2XC4A 5ESBA 2QF0A 3S9BA 4JZFH 4WMDA 1FZZA 1O2JA 2BLQA 1UVTH 4KTCA 1N6XA 4NZLA 5BRRE 1ZRBA 4INHA 3QO6A 1WCZA 2QYIA 1AI8H 2PTCE 3UIRA 2BYAX 3RXSA 1YC0A 3BEFB 2ANMH 1KXEA 1GI8B 1BBRK 1HIAA 2ZDKA 4RN6A 3U8RH 3E91A 1KSNA 3SNBA 5A0BA 2ZC9H 1FY3A 2CJIA 1A5IA 1HBTH 2ANKH 2CN0H 1SGYE 1TGCA 1GCTB 3GDUA 5C1XA 4MPUA 1BJUA 1G2MA 4AFZA 2QXHA 4GAWA 3OY6U 1P09A 4KKDA 1MZAA 1HXEH 1QCPA 1WSSH 1QR3E 3T5FH 4IMQA 1C5VA 4ZXXH 4ABIA 1EPTA 1JRSA 1GI4A 1W7XH 1S5SA 4MNVA 1AQ7A 3BTKE 5EGMA 4O97A 3SQEE 2CHAB 3V3MA 2BX3A 1J16A 2AERH 4U2WA 1QGFA 3GYLB 3NXPA 3KQBA 3NWUA 3TNTA 1BMNH 2AMDA 2ANWA 5CHAB 3JZ1B 1MMJN 3UNQA 2VGCB 2A2QH 1C5SA 1GJ4H 2ZGCA 1AWHB 2HOBA 1BOQA 3LGVA 1YLDA 1DICA 1GJAB 1G3CA 1DWDH 3T28A 2XBWA 1A5HA 2BLWA 3MHWU 5C20A 4J2YB 4DVAU 1V2WT 2UUYA 1K9OE 1J15A 1A4WH 7KMEH 2EEKA 1AD8H 1QFKH 2I6SA 1GVKB 4NIVA 1YPMH 1OKXA 1WTGH 4UEHH 1TAWA 4K60A 5JBCS 5C1UA 3PMJA 3PROA 4FUGA 5G4BA 4IW4E 1UHBA 4OS1A 3S0NA 5A2MH 4NA8A 1BB0B 1ZPCA 3BF6H 3QTOH 3ZV9A 4UDWH 1S81A 2P3FH 1UTPA 1XUFA 1D6WA 1HNEE 2OINA 1HPGA 1QURH 4ZH8A 2ZHDA 2WPLS 3N7OA 1GBBA 2FMJA 2PW8H 1G36A 3NCLA 1GI6A 3A80A 4NSVA 3FFGA 2G5VA 3GCHB 3P17H 1XXFA 1C1WH 3HKJB 2QF3A 2WPJS 1LHEH 1FJSA 3NUMA 1RGQA 1FIWA 3RXEA 3BTEE 6LPRA 4FUIA 2PHBA 1QQUA 5CMXH 1MQ5A 2NWNA 1N8OB 4X1PU 1O3OA 3B8JA 2GCTB 5F03A 1O5CB 1EAWA 5GDSH 1ELFA 4BANB 5TCCA 1K1MA 1C1PA 1CQQA 1SLVB 2ZP0H 4Y8ZA 1FI8A 1MKXK 2C90B 2SFAA 1SFQB 2BVSH 7LPRA 1E36B 2G81E 1RTKA 2VU8E 1C4V2 4DURA 1XUIA 2VVCA 2XCFA 4JZ1A 4HFPB 1TFXA 3RXTA 3UTUH 2H9EH 1DWEH 4K5ZA 1V6DA 1UK4A 1PPBH 4ESTE 1DLEA 5EPNA 1TRMA 4BTIB 1ZMJA 4VGCC 5FAHA 4Y0ZE 1O2MA 2ZDNA 1RXPA 4B73A 1P2KA 1T8NA 1FNIA 1HYLA 2GZ7A 3GY8A 3LT3A 3O8BA 4X6OA 2BD5A 4LZ4B 1JXPA 3A7WA 1XXDA 4AFSA 1CT4E 1Z1IA 1MU6B 2GTBA 3STJA 2KAIB 3MOCA 4K1SA 2NU1E 3GY3A 2WUBA 2BY9X 4CHAB 3PTNA 1C5WB 3UWIA 2ZFFH 2ZHEH 2FOMB 3GCOA 3LC3A 1OWHA 1GBMA 1TWXB 1O32A 2J34A 2PSXA 4D9RA 5L30H 1WV7H 1FY4A 3E3TA 5JPMH 4DOQA 1E38B 4ZKOU 2ODPA 1SGCA 5DP9A 4B74A 3QUMP 3RU4E 2WV5A 2EI6A 4PROA 4A1VA 5L2YH 1GBCA 3S7HB 5I46H 1OWKA 1KLIH 3TIUA 3FANA 1OYTH 1T8MA 5LPRA 3T25A 3DT0H 3SJOA 1B7XB 1UTLM 4FUDA 1AFQB 2GVFA 2OQ5A 2O8WA 3O8CA 1OX1A 1O38A 4K2YA 1O3BA 3CP7A 1F92A 2NU4E 3EYDA 2BY8X 1C1VH 2GKVE 1SG8B 5T6FA 3VXFH 3K6ZA 3TH2H 3M37A 4GUXA 2FPZA 3UFAA 1TMUH 3NPSA 1D3QB 3IITA 3FP7E 1TABE 3TITA 3U69H 1BTWA 2OLGA 3BEUA 3PB1E 3ZZBA 4WH6A 1P12E 4KTUA 3AW1A 3KQEA 1OS8A 3EA8A 3P8NA 4A92A 1GHZA 1BRAA 3D62A 3SNCA 3OTJE 5ABWA 2DE9A 1CA0C 2BD2A 2Y6TA 5FBEA 3RXPA 1WAYB 1ETTH 1LPZB 1GL0E 1SLXB 3URCA 3HPTB 1PJPA 4GCHF 1QJ6B 3LIWA 5EQRA 5LGOA 1QJ7B 2Q6GA 1YCPK 2D2DA 1AWFH 4JK6A 1WBGB 3E90B 2ZDAH 3MNBA 1O2VA 3OY5U 3PM3A 1UCYH 1ZSJA 1NFYA 1ZZZA 4D76A 2BTCE 1HAXB 3B23B 5LH8A 3OSYA 3RC4A 1MZDA 1CHGA 2A31A 1DXWA 5HGGA 4OS7A 1AZZA 1ZHPA 5F6MA 4WY3A 1GMDG 1ZJKA 5GXPA 3RXRA 2BD7A 2CXVA 1C1UH 1C5LH 3KL6A 2GMTB 2Y7ZA 1TYNA 1GL1A 2PTNA 1CBWB 3UREA 2HVXA 2TGTA 2C8ZB 3SJ8A 4MNXA 1P9SA 4H6TA 2F91A 1UTJA 2F9VA 2ESTE 3TLOA 2H9HA 1WYKA 2J2UA 4O9VA 2PR3A 3LONA 1UTMA 1O2RA 2XWBI 4YZUA 3KQCA 4LXBH 3RXIA 1IHTH 1Z1JA