1LVGA

Crystal structure of mouse guanylate kinase in complex with gmp and adp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
190
structure length
190
Chain Sequence
RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIKKAQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Structural characterization of the closed conformation of mouse guanylate kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 64
structure length 190
sequence length 190
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1lvgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lvgA02
4Z8XA 3AVOA 1YHNA 3SU8A 3ZZ0A 4JBWA 4MRNA 2O0HA 1ANKA 5FPHA 1X6VA 4GOKA 1W7AA 1FPMA 1P7CA 3MAAC 4P4UA 2GWHA 5B64A 3HP1A 2F3TA 3IUYA 4GP6A 4XWAA 1BMFD 3ZZTA 3HWSA 4KLZA 5K8TA 3R9XA 2C9OA 2G3YA 4KFUA 4EFMA 1PLKA 2EFHB 3OEHD 5EXPA 3UG6A 3CX7A 3IQWA 3KKMA 4M0LA 1SVOA 1E2QA 2ZUDA 1Z6YA 3G5UA 2AWNA 1FX0B 3AP3A 4Q9LA 4CT4B 1T5IA 2VP0A 2CHQA 2X19A 2VHQA 1CS4C 2ORIA 1MT0A 1FUKA 2GRJA 2IEYA 1VCMA 2QM8A 4QGAA 4RD4A 4C3ZA 2FPMA 4IXMA 2GESA 2ZRGA 3FFAA 4JIMA 2ORVA 1XPUA 2J5XA 4OL0A 4DDUA 5H8WA 1VCIA 2EU8A 5HCNA 3TJZA 1SXJA 1G5TA 4Y0AA 1SVWA 4ACBA 3KQKA 1R8SA 2PX0A 1RW4A 2JIZA 2PMKA 3RYTC 3I1FA 1W48A 4HZUB 2D06A 2OLJA 4JJZA 1AA9A 4M9ZA 1OFUX 2RGEA 4TLEA 5DN6A 3ASZA 3EZFA 4OYHA 1U94A 3VMFA 2V4ZA 2JLRA 1T91A 1T0JB 3PV0A 3JZMA 3DEFA 4M9SA 4QNMA 3RS3A 1AGPA 2O0JA 2WJVA 3AUYA 3O8RA 4TQUS 1ZD9A 1IOZA 5EE3A 2BMDA 1F6BA 2NPFA 2H57A 4QGGA 4BFVA 2FFQA 4NU0A 4JJKA 3KFXA 2XZOA 1NN3A 3HR8A 3WXMA 3AVXA 1NBME 2PZEA 3IBGA 5FPTA 2C9CA 1XD2A 4RSGA 3A1UA 4PHHA 3GLIB 2QM7A 3THXA 1RKBA 1XMVA 4CZ2A 2QSYA 1XB2A 3RABA 2JLYA 3EIEA 3ICEA 1CEEA 4C0JA 1F2UA 4KV9A 4JLVA 5F98A 2W6JD 3K09C 3NH9A 3CNLA 4MGZR 2GBLA 4NPHA 1I4TD 5FH9A 1M1YE 3MSXA 2X1VA 2V6IA 4PANA 5G53C 1II0A 4KODA 5BN3A 4NTZA 5L3QB 2QPTA 2YWGA 1N6OA 3K70D 2ZTSA 4NONA 3FGNA 3EXAA 1M74A 2GAOA 2VQSA 1EXMA 2VTKA 2GKSA 3CRMA 3AF0A 4HAVA 4HZIA 3MGCA 4YXWD 4Q7JB 2ZI4A 3GQBA 1E2DA 1IM2A 1TX4B 2E87A 2WVJA 3MMPA 2ECKA 2V7QA 4B6FA 1BIFA 3GLFA 3LO5A 3CO5A 4M9XA 2HDNB 3FFBA 4PQYA 1S4QA 3TNFA 4LJ7A 1R0ZA 4IFEA 5KTYA 1ZBDA 3IIKA 1NL3A 1E1RD 1L4YA 1VIYA 1E1QD 2V9PA 5LDDC 4C0KA 5K8IA 4HUQA 2OEPA 4X8MA 3FMIA 1NKTA 4KAXA 4URUR 5JWRA 1E9BA 4PO1A 3K0CA 4U02A 4TLCA 4CF7A 2C8VA 2NTYC 4IOMA 1F2TA 4OKSA 2GCOA 3IBYA 1WBDA 2GJSA 4DCUA 2GDJA 1SULA 2X2EA 4LHZA 1OB2A 2A9KA 3WNCA 1P2UA 2ZAOA 2NG1A 3VTKA 1XBTA 1NY6A 2FFHA 3L0SA 2F1IA 1QG4A 4IDQA 4ERNA 1JJ7A 2PJZA 3NWJA 4V0LA 1JAHA 1KZ7B 1S0UA 3AVPA 5J4KA 4OI2A 1RC8A 4C7OA 2G77B 1EWRA 4QHSA 2WZQA 2RKOA 1ELOA 2FA9A 3T61A 2ODBA 3SDZA 1KDPA 1XCPA 1ESNA 1E2JA 1XF9A 2F9MA 3AVTA 2H8KA 3NEYA 3VR2A 2YKGA 2ATXA 1A7JA 2QU8A 2FDCA 1NIJA 4BWYA 1OH8A 4B48A 1DG3A 2DCUA 2IXGA 5E3HA 1N6RA 3K8YA 4B2LA 2P2LA 2EWVA 2A5JA 3NC0C 1HUQA 4IKEA 3KJGA 5FTLA 2GEVA 4DDVA 4FW9A 3W3AA 1E2NA 2IS4A 5CYPA 1Z5ZA 4WIAA 4DLXA 1TNDA 2EFDB 4GL2A 2CNWA 4ASUD 3DM5A 4DSTA 3PUZA 1GP2A 4M1TA 3M1IA 2GXAA 4E22A 4KXFB 2QE7A 2DBYA 2FPLA 2IYUA 2WIAA 1N6LA 3D31A 1J70A 1S3GA 1XJCA 2GZAA 3U5ZB 1O3YA 3IIJA 1E3MA 4EQ6B 2CDNA 3SZRA 3LY5A 2KI5A 1QDEA 2KWIA 3CPJB 1Z8FA 3I62A 2YOGA 4O0MA 1ZCBA 3F5FA 1GNQA 4D25A 3SJAA 3L0PA 2EW1A 4DSOA 4LJAA 1E9RA 4KSBA 4UNPA 1KZGB 1NVVQ 4A0RA 2BM1A 4IHQA 1P75A 5IK2A 3DKPA 1ZC4A 2A78A 3TVDA 3LD9A 5AJZA 4H1UA 5AR1A 5GJCA 1S1MA 2P0EA 1QVRA 1ZUIA 1N0VC 5GADl 5CYOA 1G8PA 1QZXA 2CK3D 2XJ9A 4FMBB 4D4JA 1KI2A 4RD3A 4A0HA 1X3SA 4KFTA 4HATA 3L82B 4BZPA 3O8CA 1ZNYA 1TU4A 2IS2A 4BFZA 2ZS9A 4PC1A 1SHZA 1SKYE 2EQBA 2V8OA 3T12A 5DE3A 5DGXA 1NMZA 4Q47A 4B71A 1T0HB 5DIFA 2FX3A 2AL7A 3TE6A 4AURA 1KO8A 1SQ5A 2H5EA 1G6OA 1ZUNB 2GK6A 2EYUA 3Q85A 4L16A 3K09A 1F3OA 4HYYA 1XMIA 3T15A 3EA5A 1UKZA 1ZU4A 5JEEA 3RC8A 4DRZA 1CR4A 2JASA 2ZJZA 4DEXA 5ELXA 2VP6A 2QBYB 4PZLA 3CWZA 3VR1A 2GILA 1WP9A 3W6NA 3WRXC 5A5GA 2LKCA 2FG5A 1S9DA 2F6RA 4DCNA 2ZYVX 4AYTA 4XIGS 1RVDA 1YR9A 1CTQA 1MO4A 2JLSA 2XTNA 3B1XA 3BWDD 1E9CA 3PIRA 4JVLA 4LI0A 4U5XA 2QT1A 3UWKA 2F1JA 1NVUQ 4IOKA 4Q7LA 1G8FA 1ZYUA 4V0NA 2PBRA 4ZKDA 5IHPA 3THYB 4YQFA 1YU9A 2RGNC 4DLWA 3QVVA 2FWRA 3PUYA 1NJGA 1CKEA 4LYHA 4UNQA 4GMXA 3KTAB 4QHTA 4BLSA 2O5VA 1Q22A 4Q7MB 5BYKA 1NSTA 2O0KA 2UZ3A 4B75A 1NY5A 4NMMA 2R6AA 5KO2A 5C46F 3BH0A 1DAKA 2QROA 4TMKA 1DADA 5C4MA 3T1TA 1DS6A 4QNRA 4CEJB 2A5GA 3OESA 1E2EA 2J3EA 3MJRA 4POAA 1NMXA 1OSNA 3CNNA 3N2EA 2WJJA 3LNCA 2G0NA 2HYIC 1OPXA 2JATA 3C5HA 1AN0A 5CLQA 4MH0R 1I4DD 1PUIA 1E2KA 1SKYB 3LAWA 5CM9C 1P9NA 3QE0A 2QT0A 3CPEA 5JWHA 1TF2A 5FUVA 1Z0JA 2ZRIA 2OE2A 4P3YA 2GJKA 2G1KA 4GT1A 3A4LA 4ZKEA 1X1SA 3GD7A 2QY9A 1KIMA 3AVQA 1KO5A 3ADDA 4G1UC 2IS1A 1JNYA 1Q1QA 2ZSFA 2BV3A 1XCGB 2ZI3A 2GK7A 1XTRA 4JLNA 3PXGA 2BKUA 2ZR9A 4KI0A 1BYIA 4RFSA 2C98A 1CIPA 3IKJA 2QAGB 2IYTA 1KY2A 2ZRDA 4URYR 1YJ5A 5F9HA 1Q57A 4MRPA 3U3KA 5KU1A 2HLDD 5E95A 4MYTA 4TL9A 1TUEA 2JCSA 1TF5A 2OFOA 1MO5A 1Z28A 2YOHA 4XJXA 1VYTA 4URWR 1GRNA 2R2AA 3O47A 4KBFA 2Q3MA 2HJVA 1L4UA 3CRRA 3G82C 4RVCA 5A4JA 1T9HA 1G7RA 4C0QC 1E9SA 4URZR 5FUYA 1QHSA 4L9WA 1KI1A 4JT4A 4XSHA 1P9RA 2DFLA 4US2R 1KNXA 3DM9B 1UDXA 5JECA 2RGCA 2ZYWX 4Y0VA 2AXPA 4UKDA 3FE2A 2IWHA 2D2EA 4DLVA 2ZRFA 3OEED 4QBGB 4CEHB 1P2SA 1W0KD 2NO6A 2FEMA 2F1HA 4F4IA 2H7VA 3TW4A 4ZO4A 1U0HC 2ZJ8A 4TSFA 3CPHA 1FX0A 2OM2A 2WV9A 1II8A 2B8TA 4BFUA 4LV5B 1Q44A 3KJHA 3SQXA 1SKQA 2GEUA 1E96A 2OBNA 4HLQB 1VCNA 1OHHA 4D81A 4P31A 3LFUA 1US8B 3BJIC 1A1VA 1KNQA 3W3ZB 2FSGA 1Y63A 1IQPA 2DWQA 2OLKA 3QXCA 1OXTA 3SC3A 4TLBA 2AFHE 5TMPA 4PX9A 3QF7A 5BW8A 4TMVA 3TW8B 4M2LA 4PHTA 1P6XA 1RJ9B 2F9LA 2I3BA 3U7FB 4M9QA 3PEYA 5J4YA 3KDSE 4Z51A 2QMOA 1R2QA 3CF2A 4HZUA 3T5GA 1FMLA 4Z1MA 1R8QA 3B1ZA 4TL7A 1ZAKA 2XB2A 5FUXA 3SJBA 2XNSA 4UJ5A 3V4RA 4LCBA 1VKJA 2WJHA 1YQTA 3N2IA 2GXSA 3B5JA 1JALA 1E4VA 1OJLA 2ZE7A 3LH5A 4W7SA 4B2PA 4B3XA 3SFVA 3UMFA 3ZH9B 1HQCA 2LKDA 3WP1B 1EFHA 4LBWA 3X1XA 4EIWA 4EJSB 2IYVA 2QSZA 4KITB 3BB3A 5HZKA 1JR3E 5JRZA 2QORA 1J8YF 2NZJA 2OFXA 1RFLA 5CB6A 1CF4A 2Q9CA 4EFLA 2WWHA 1RE0A 1E79D 4FWTA 4FXPA 4CIDA 5SZJA 1MO3A 1DAIA 2GZHA 3NH6A 1XTIA 2J0UB 2OZEA 2ZUBA 4CT5A 4PSKA 5CK4A 1TTTA 4B3GA 4WA7A 1SVKA 3U44B 4Z8YA 4RZXA 2IUTA 3U3JA 5JMTA 3HYRA 3GJ0A 1OH6A 1YZNA 2FFBA 1U90A 1KI6A 2P5SA 1R0YA 1GM5A 2ZSDA 5L3QA 2QTVB 1OH5A 1NVVR 1KYIA 5TB5A 3ICQB 1W5TA 4NDZA 4TN1A 1CLUA 2RGNA 2HCBA 2TMKA 2YZ2A 3B8HA 5FPSA 3LX5A 1GUAA 1P62B 1II9A 3CLVA 3Q8XB 1VDZA 3NXSA 4QKQA 1XX6A 3PJRA 4HLCA 3WBJA 1XTKA 2J0SA 2YOFA 4V0ME 4JLOA 4IVQA 1ODFA 4TTPA 3RVBA 2XXAB 4ZDKA 2J0QA 4R98A 2A30A 5DISB 2PLFA 3ADKA 4FI3C 4JL5A 3UXMA 2R65A 4M1OA 2O52A 3IO3A 4J0QA 4TL8A 1Z83A 1SZPA 1P2VA 4TT3A 4OQNA 4TQAA 4B6EA 5L3SB 4BLPA 2KBFA 2UVQA 4Q5IA 1EX6A 1WDTA 2Z43A 1WB9A 2AR7A 2ZAMA 3JVUA 2IWRA 2XOKA 4MQBA 3SHWA 3RRYA 2PZFA 3D8BA 3QKRB 4UNRA 5CB8A 5FOUA 4QJ5A 2E1RA 3FHTA 1YKSA 4ILEA 4MRSA 2L0XA 1Q12A 1N2CE 5CIWA 1WE2A 5D3QA 3RC3A 1MH1A 4TMZA 1OFHA 4TZ0A 4S35A 4AIIA 2JJ8A 3VNVA 4EDHA 1M8PA 2XNDA 4HB4A 4ARZB 1TEXA 3I8XA 4JYCA 3IIMA 3U7GA 2EWWA 4NCHA 3B9QA 1ZINA 1YE8A 2IEZA 4GNKA 4GBMA 2W00A 1P72A 3R8CA 1C1YA 1H8EA 5IDVA 2R6CA 1YVDA 3L0IB 4PPNA 4DIDA 3K70B 4HLUC 4C0LA 1JEDA 2VSOA 2QAGC 2IK8A 3FKSD 2DFKB 3SYKA 4DLUA 4H9GA 3VHXA 3DZDA 4Q4HB 4BECA 2WSMA 1TQ4A 3RHFA 3FYHA 3ZVLA 2V3CC 2ZSAA 4EPRA 5KSYA 2UKDA 2WJYA 2OILA 1YR8A 2A5FA 4L5BA 1C4OA 2PJRA 1W4CA 1G3RA 4TYYA 3A37A 2WKPA 3I73A 1R5BA 3PQCA 3VX4A 2BC9A 2Q6TA 2MSEB 5EZ5A 4RD0A 4IFBA 2QMHA 5HE9A 3A6PC 1UJ2A 3QKUA 5FL7A 3RLFA 4RZUA 4C30A 3U3RA 4AWXA 3EPJA 3CONA 5CDFA 4C2TA 4ZPXA 3WHLA 4HUTA 3I5YA 4Q9JA 3WNBA 4DUGD 3UKDA 3EZ7A 1H65A 1FW6A 3KQLA 5HZHA 4QBIA 1GDDA 4EQ6A 4FCWA 4F7WA 2WAYA 3FHOA 5BYJA 4D2IA 4QJ3A 1R0XA 1AQUA 3BBPA 2UZIR 4RZ3A 1XEXB 3SJZA 3ZIAA 4PPGA 4R2IA 2W6IA 2OHFA 3M6AA 4KU4A 3AKYA 2IX3A 1RRGA 3I4LA 4DB2A 4DWJA 3HPQA 5FOSA 3U3OA 1Z6AA 4AY2A 4BUJA 1UKVY 4ZI3A 4DEYA 3ZQJA 2JJ2D 4PSVA 1ZM2A 4F4CA 2IF2A 4G5GA 4BFYA 2C96A 2VBCA 3BRWD 2ZRNA 3GLHB 1LS1A 2QP9X 3NDBB 2CLCX 4Q01A 2CLSA 2REXB 4HLDA 4DLZA 1GIAA 5ANRB 2REOA 3OIWA 1SGWA 3SEAA 4LHYA 3R9IA 2J7PD 3LDAA 4JLMA 3ECCA 3CH4B 3BFKA 1G291 1OXUA 3DDCA 1Z0FA 1U0JA 3LBHA 4LZZA 4OJKA 2JLZA 4D26A 3QBVA 3D7MA 4RCZA 4QBFA 1VG0B 3M4YA 3GLGE 2C99A 4LV6A 1XP8A 1GG2A 1OKKA 4GOJA 2WOJA 1CR2A 3UK6A 1SVSA 2QG6A 2B8WA 4EJSC 1OB5A 1FQKA 1KTVA 4K8OA 4LV8B 1TQ2A 4QM7A 4JKYA 6Q21A 2DWOA 1XJQA 1G9XA 2YJTD 2HV8A 3ADBA 3BD9A 3ZGXA 1XEWY 2WWIA 4D6PA 4R2HA 1UF9A 2IBMA 2BM0A 4MGIR 4XOIA 4R71A 2QBYA 1CJKC 4LJ8A 1XTSA 2NOAA 1A5TA 1KI8A 3P32A 3BAFA 4HAXA 4EPWA 2ZITA 1WA5A 1ZM7A 4TLAA 3AVVA 1QBKC 4MGYR 3QQ5A 4RY2A 5G41A 4ESHA 3TKLA 1SVIA 1GNRA 1QVAA 4NKRA 1U8ZA 2JDID 2ZYTX 1C9KA 1G5PA 2J59A 1OH7A 2Z4RA 3EPHA 4JVSB 2XSZD 1RRFA 4TYPA 4QL3A 3EZ6A 3OFND 3KTAA 2RH5A 1G3MA 1W5SA 2ZI6A 3C15C 1DARA 2RGDA 1VG9B 2NGRA 3I61A 4PPQA 3U6KA 4RKEA 2XJ4A 4B3BA 4CEJA 3NHAA 2GETA 1ZVQA 4P33A 3RDPA 1COWA 1G4AE 4JVNA 3TBKA 4Q1EA 1NVWQ 5IK2D 1D9ZA 1W4RA 3KXKA 3PENA 3WYGA 3FPAA 4WXPA 3SI7A 1W36D 3B1VA 3DHWC 2ZJOA 1PUJA 2XAUA 4PHGA 2BVNA 3UMRA 4X8OA 3W34A 4TZ6A 1FFHA 4LBYA 1Z0IA 2ZR7A 3I5XA 1DO2A 2VHTA 3B2EA 1TMKA 3U2QA 1T8TA 1Q3TA 4RJLA 4HB3A 4LHWA 1CRPA 1U9IC 4IEEA 2GF9A 3AKDA 5FOXA 3GLGB 3WYAA 4JLKA 3NKVA 1NKSA 2YINC 1JR3D 2WSSA 3T5DA 4YMUA 2WM9B 1E94E 4IW3B 2PCLA 1IY0A 2SHKA 4NBSA 4O2RA 2MMGA 4HLUA 2YYZA 1T3LA 3BH6A 4JT2A 5AUNB 5IF9A 1E2LA 2QAGA 1CJVC 2VLIA 3OF5A 4WZBE 4DLYA 5BXQC 3U4QB 2F43B 2FN4A 2IUSA 3EG5A 2OV2A 2NMVA 2XX3A 3B6EA 1Q1ZA 3K70C 3TUIC 3F0TA 1R6BX 2ZANA 3AGQA 4OHZA 3RSLA 1JB1A 5JSZB 2ZRBA 1N25A 2A7QA 4G0NA 4XD7A 3R7WB 4OQXA 3A1VA 3K53A 4X8LA 1N5JA 3W8NA 5DNYB 3L8YA 2ZR0A 1DAHA 2ZEJA 3RWOA 1NN1A 4RZ2A 4O3MA 3P4XA 1W4AA 2VSFA 3K1JA 2CL7X 3L43A 3TUZC 4PC7A 2ZM5A 3OAAA 3ND8A 1DPFA 1T5LA 3LBNA 3VR5A 3QXSA 1XMJA 4B43A 3AF2A 1E2PA 3O8DA 5A0FA 4I4LA 1IAQA 3AKCA 2YWHA 5EXTA 4IDPA 4MRVA 2VP2A 2GVDC 5KSOA 3U6BA 4TYWA 1Q3HA 4HDCA 4W5JA 1Z0KA 1D6JA 1KOFA 3PG5A 1P4SA 3SBEA 2JLVA 1IXSB 4TYNA 1UEJA 3CWQA 4A2QA 4HAZA 1OYWA 5DI9A 2LWIA 3HYTA 4PAQA 3DVLA 1US8A 3THOA 4PC2A 1E32A 1BOFA 2A2ZA 3KJEA 1KI9A 1NF3A 1GL6A 2KJQA 1D8TA 3QKSB 3VR6A 3VR4A 2YC4C 5HPYB 1H8HA 3DPUA 4LSGA 1JI0A 4WOPA 5BN5A 4GDFA 2BIFA 3VU9B 1OF1A 5AUPB 1RJ9A 2IHBA 1CU1A 3EWAA 2WWFA 3E2IA 1KSFX 4K46A 3AVUA 2HYDA 1HA3A 4L4UA 1W2GA 1D9XA 3CR8A 1FMJA 2GTPA 4Q9HA 3OIVA 4NH0A 5C1BA 4EKDA 1AZSC 3BOSA 1FTSA 5FOTA 1NLFA 4EPYA 2ZRHA 2VP9A 5CJPA 2G6BA 3GFOA 4AI6A 2ZS7A 4EJSA 1ZW6A 4ZDIA 1J7KA 1BMFA 1J2JA 1TL7C 1XZPA 5FOVA 4W9MC 2YWEA 3P1JA 1KK1A 2B7CA 4KHZA 3AP2A 4JKIA 4F4JA 4M1MA 1GKIA 2PH1A 1XDBA 1XWIA 2P6RA 2D4HA 2QP4A 2CHGA 3H0KA 2PZGA 3TQFA 1S9HA 5E7JA 3VKHA 1EGAA 4M1YA 3U44A 3OE7D 5JJKA 3NBZC 3LW8A 1KK3A 1KMHB 1GL7A 3RANA 2D7CA 3HU3A 2D2FA 4I1OA 2V6JA 1P73A 3SQWA 5KSPA 5CIQA 3Q9LA 5JZVA 2WOOA 1S2MA 3HR7A 2HXSA 3THWB 3WY9A 2ZI9A 2FF7A 2VEDA 3SNHA 3R20A 1ZJ6A 3NEJA 3I92A 2BWJA 2CE2X 3OHMA 4Q21A 3PEWA 4KYUA 1W1WA 3KKOA 1WMSA 2YC2C 1IY2A 1R4AA 2PT7A 2VSXA 3L0OA 3MLEA 4Q03A 4DKXA 2O8DA 1EFRD 1E9FA 3TSWA 2CE7A 1ONBA 2Q0HA 1SXJE 4IDNA 2OSBA 4LDJA 1FP6A 1GITA 1AKEA 1ESMA 121PA 1DOAA 2DFNA 2XTMA 2ONJA 3QXHA 4IDHA 4LYJA 2VYFA 1KO4A 1X1RA 4WVFA 5FUWA 4DDWA 5B58C 2AHOA 2DY1A 1HE1C 2NQ2C 3IPXA 4B44A 1JPNA 4OBEA 5EZ6B 1G18A 5L3SA 2ZYUX 3W8RA 2A5DA 3HJNA 4Q9KA 3VR3A 5HKKD 3C16C 2ONKA 4YMVA 4UXJA 4OK6A 3QKRA 1U9IA 4W5HA 1NMYA 4IJMA 4AC9A 4Z1MD 3ADCA 2W6JA 4DDTA 1Z0DA 2F3RA 4QXAA 1NLYA 4BEBA 4WXRA 4FCTA 4U00A 2QN6A 1W44A 4ZCLA 4X8HA 4E09A 4IDOA 2O8BB 2W83A 4DXAA 621PA 4DT1B 3KXIA 3A1WA 4IRUB 2WJIA 4ZDWA 5H1YA 3A4NA 3ZD6A 1MABB 1XD9A 3CX8A 1ZUHA 2OBMA 4Q02A 4ON9A 1UBGA 1ZP6A 2FPKA 4BASA 1GNPA 1N6PA 221PA 5E7IA 5FI1B 1JEEA 1DAFA 1L7VC 5UKDA 4Q4HA 4YXWA 1M7GA 2FU5C 1G20E 3Q7QA 2WJGA 5EE1A 3GMTA 3OZXA 1ZM3A 2GHIA 3KX2A 4DCVA 5G3YA 2KB0A 2OCYC 4Q7KA 4QJ4A 5BQ5A 2X8AA 2P6NA 2ASEA 4KCGA 1VYVA 3CRVA 2IYXA 5AJVB 421PA 1N6IA 4BPBA 3QPUA 1OFIA 1E1RA 3GEHA 2QQ0A 1U2RA 2CBZA 1E1QA 2VPPA 4Q1FA 1B0UA 3K0AB 4ZDJA 1B23P 1CXZA 5JRJA 1N6HA 2YV5A 4V0MA 4XTRA 4BLOA 1E2HA 5KNBA 1Z08A 1XD8A 4OI0A 3ZYCA 2PLRA 3BORA 2ZXUA 2ODEA 5FTNA 1FL9A 2FGKA 4M1WA 5JCPA 1KJWA 3KB1A 1X8JA 1XEXA 4M21A 4YC7A 3RRMA 3NIBA 4AYXA 1CRQA 3GJ6A 4Q1CA 2BJVA 4B74A 3CRW1 1Z2AA 3K9NA 1HY3A 1SHKA 2ZREA 3LXXA 1IN4A 2QGZA 1PVOA 2ZPTX 3RAPR 4F92B 2RHMA 1AIPA 4NCKA 1JXOA 2WICA 4QFMA 3GLHA 3TGPA 1GL9B 1KDRA 1T6NA 4MITA 1Z22A 4DLTA 1F2UB 2XITA 2QPOA 4G5OA 4GZLA 2XEXA 3QI2A 1XPOA 3LVRE 4LGMA 5FBRB 3KB2A 3ETLA 1ZIPA 4KVGA 4PAOA 1EFTA 2ZVQX 4IVRA 3C4JA 1LF5A 3A1SA 4ASUA 4D0NA 1NI3A 1H8ED 1ZD1A 1Z6TA 2HXYA 5KDOA 5KDLA 1AZTA 4LWZA 3SHFA 1IN7A 1KMQA 3MUFA 1CR0A 4HAWA 3GJ3A 1QRAA 1ZRHA 4MUAA 2PL3A 3CNOA 4FIDA 4UXIA 2LCFA 1G6HA 5G40A 2ZETA 5EE5B 2V1UA 4MKFA 3WRYC 3UMSA 2QUZA 1R0WA 1Q1EA 1X86B 4ITRC 3TMKA 3QY0A 2EFGA 4QGFA 2FZLA 2VO1A 3NBYC 1HTWA 4D0LB 4V0KA 3EX7C 1VTKA 1W0JD 2XB4A 1AS0A 4MKHA 1I2DA 2D3WA 2W58A 3K0FB 1KHTA 1O87A 1YR7A 4QBHA 1VHLA 3MWKA 4AKIA 3UIEA 1TU3A 5AJWA 3NBXX 1XCMA 1WBBA 2E9SA 2CK3A 2IYWA 2ZE8A 3CBQA 4Q1BA 4XSGA 5G3ZA 3TSOA 4BLRA 2Q21A 3EZ2A 3I8SA 2WPDD 1VIAA 3BXZA 3N70A 2CXXA 3FVQA 5GJWC 3ZIAD 2IF0A 4IOLA 3ASYA 2KBEA 5EUMA 2B7BA 5F2EA 4JSTA 2FE4A 4B33A 4I1UA 2FJUA 3NBFA 1KK0A 3KQNA 2IW3A 4MKGA 1NVXQ 2ODNA 1E9EA 4C7OB 4NE2A 2GNOA 2VP5A 3ZS9A 4OJQA 3QPVA 1QHIA 3LLMA 2O8FB 2ODWA 3IDQA 4F38A 2BKEA 3CX6A 3GLIA 2W2XA 4A6PA 4FWIB 3QF4B 4C0BA 1TAGA 4LHXA 2P6UA 2FSIA 1OE0A 2ZJBA 2G9NA 3ZLJA 1KSGA 1NN5A 2YWFA 5KYKA 3GLGA 3RS2A 3IILA 2QQEA 1UAAA 3E5HA 2AD5A 4MGKR 3HU2A 3PVSA 2JAQA 4TMTA 3VKGA 2IYQA 2B21A 2VHUA 3SBDA 3VNUA 4R7ZA 4YDSA 3S1AB 3VX3A 2OCAA 1AKYA 5J4VA 2WMOB 2F43A 3SYNA 3IQXA 2ANBA 2EVWX 2ZRPA 1L8QA 2REBA 5KHOC 3TSZA 5EUQB 1TADA 5JS8A 5B2ZA 4II7A 5JSZA 1CJTC 1UBCA 2ZJ5A 3AB3A 3R7WA 4FMCF 3H86A 2O8EB 1NRJB 1U99A 2Z4SA 4QC2A 4Q4JB 4JLBA 5P21A 1IBRA 5FBVB 1L2TA 4E5UA 2BJWA 4ZIRB 5JEDA 2OBLA 2CL0X 2WKQA 4NYJQ 3WMEA 4YLGA 2BBOA 2Z6VA 1PLJA 1EX7A 1JBKA 1KK2A 1VPLA 5TV2A 3V9PA 4BFWA 2ZVPX 4ZV4A 2OAQ1 4GSYA 2IHYA 3HPRA 1EFUA 1W36B 5F3WB 5FPYA 5CITA 5FPKA 2BEJA 2WKRA 3CH5A 3PUXA 2WMNB 1SXJD 2VF8A 2ZI7A 3B60A 4AKEA 4OK3A 4BZXA 4JS0A 4D80A 4CDGA 2JIZD 4BFSA 1UKYA 4UQOA 5DN6D 2P5TB 4GMDA 5EQTA 1FQJA 2OG2A 2QEQA 1S96A 2JGNA 4PPFA 2FNAA 4V03A 1KSHA 1NBMA 4KJZA 3I72A 1VMAA 4M8NE 4AD8A 4BRUA 1YZGA 5EJEA 1HYQA 1DBSA 5EE0A 3EPLA 4MKIA 2FMXA 1VG8A 5D3MB 3VU9A 4Z54A 1G17A 1AGRA 2HLDA 5DI3B 1RIFA 2WWXA 4GFDA 3MWJA 2QENA 4MYHA 4GPTA 2GJAA 5JWOA 4QG7A 2I1VB 4LUCA 4N0DA 4KYIB 4NCNA 3N5CA 4B35A 1DO0A 1JPJA 3PITA 4BZQA 1CBUA 1D2NA 3GJ5A 4DSUA 1BYUA 3K9GA 3AEZA 3LA6A 4PXAA 4BRWA 2O8CB 3NDPA 1WCV1 2FEOA 2Q3HA 3CF6R 4BFXA 4D4KA 1HV8A 2C9YA 2Q9AA 2CJWB 3MFYA 3RRZA 3BFVA 2QNRA 3GEEA 2OESA 5H70A 3TH5A 3B82A 4M4SA 3ZS8A 2ZU0C 5H68A 3OEEA 1UBEA 1YZLA 3LW7A 3A8TA 4PQFA 2H17A 5GJVC 2IUUA 3CB4A 3W90A 4UNSA 2BBWA 2J87A 2PT5A 5J47A 1Q0UA 5J4HA 1KMHA 3P4YA 2V7QD 3KKQA 3U60B 4JYBA 1UPTA 1LY1A 4A9AA 1HQYE 1XXHE 2VL7A 2I1QA 1CR1A 2EYQA 5KSZA 3THWA 4RFVA 3NC1C 4PQRA 3G0HA 4LX0A 2JLQA 3NHBA 4A8JB 4BLQA 5BWMA 1RYHA 5JS7A 4HAYA 2ZRAA 4LJ9A 3TRFA 4OHYA 2HUPA 3ZVNA 3RNLA 2IA5A 3SS8A 4QRHA 3GFTA 3C8UA 5IT5A 2VF7A 4G5RA 5AJYA 4U7DA 3SE0A 4GZMA 4F93B 2K5UA 3TAUA 4A92A 4D4LA 1W47A 3VKWA 3EIQA 2NO0A 2VRWA 3A4MA 3CKLA 2GJ9A 3CW2A 2J41A 3GEIA 2KE5A 1M6NA 4LYFA 3ZVRA 3PEUA 1M34E 1J8MF 3P20A 3ZVMA 4F91B 4JVMA 5F9FA 4QOSA 3VAAA 1N5KA 1UKEA 4LJ5A 4A82A 2GCNA 4G01B 4CYMA 1E79A 4TMWA 3RRNA 5JJIA 1GSIA 5LPNA 1E0AA 1BKDR 2CLDX 1MRNA 1FOEB 2BDTA 2ZJ2A 1P60A 2ZE6A 4RD1A 4HDQB 4C0AC 4HSEA 3J81k 2O8BA 2VA8A 4DT1A 4CGZA 5KDDA 1GKUB 2G88A 4A2PA 1N5LA 4JLAA 4US0R 5IRCD 1OIVA 3TK1A 4ZI2A 1MABA 2YHSA 4BE7B 5FBQB 2J46A 1FNMA 4Q4AB 2QRNA 2NO1A 3BB4A 3U7EB 2CNWD 1Q1BA 4B3DA 3WHKA 3EPKA 4NCJA 3THYA 5LD2B 1G16A 2QRZA 2QE7D 3KJIA 3AGPA 5DH9A 1XMSA 4PR0A 4BLTA 1XXHB 3AKEA 2H1LA 1YZUA 1PV4A 4DC9A 3K0SA 2GAAA 1AQYA 3B13B 4US1R 3T34A 1FNNA 3MCAA 4NZYA 1II8B 4OHWA 3PFIA 1YRAA 4NYMQ 2DHRA 2W2TA 2ZU6A 2R44A 3U61B 1DELA 2RGBA 4WZAE 3K0AA 4WZ6A 4CRWB 4LPKA 1P5ZB 4JL6A 3FMFA 5JCZA 4B3FX 1ZNWA 4YONB 4OQMA 1T8UA 3LXRA 3IO5A 4AG5A 4QHYA 1IJEA 1E2FA 1ZD8A 3X1ZA 1UFQA 1W36C 1XEFA 4RD2A 2ZUCA 5EXXA 4I81A 2ERXA 1MO6A 1E2GA 1MKYA 5SZIA 1UBFA 5FBLB 4DLRA 4JZKA 4Q9IA 1G4UR 5AK0A 1F48A 3DO6A 4OQLA 4EUNA 4JLDA 2WHXA 3FB4A 1Z47A 1DTSA 2ZJYA 4DCSA 1KI3A 2W0SA 2Q3FA 3DZ8A 5JI3E 4P4SB 3QVUA 1LV7A 1QHNA 2G83A 2X2FA 1U0LA 1JECA 5C4GB 2HEIA 2AFIE 1W46A 3MJHA 4EPVA 1G21E 3R8FA 3LBIA 3K0EA 5HTKA 2ZRKA 3BH7A 4PAMA 3LQQA 4LJ4A 4LBVA 5KNDA 1QHYA 4EPXA 2GEDA 1LS6A 4ABYA 2DR3A 3FKSA 1W49A 1KJYA 1GWNA 1XEWX 1Z06A 1M7HA 1ZC3A 3PUWA 1OYYA 3AQ4A 4KBGA 4PFSA 4AYWA 2BBSA 4D0GA 1I2MA 3LWNA 2GCPA 5BN4A 2RAPA 1IN6A 2F55A 4YMTA 2D7DA 3KUCA 4GOXA 3LVQE 2PMDA 4JSYA 4NYJR 4Q18A 1BO6A 5FTMA 2J45A 1KI6B 3T1VA 5GVSA 3W9YA 2FGJA 4JLPA 1LVGA 3H1TA 3IEUA 5TDHA 4HB2A 3Q5EA 2I4IA 2WTUA 4BFTA 1QF9A 2N1BA 1MV5A 4DUGA 5TVKA 4QGHA 2ERYA 4PTLA 4PO9A 1EG7A 4R9UC 5EXSA 2WWYA 4HDOB 4CEHA 3CZQA 4G3XA 3HU1A 3WBKA 2IXEA 3C7KA 3KQUA 3NG1A 1EESA 1VCOA 5CDFE 2AXNA 3EARA 1M7BA 4PZZA 3B78A 4O25A 3BGWA 1G7CA 1ZCAA 4PC6A 1P9WA 2OT3B 3EW9A 1BS1A 1G7TA 2GJ8A 2A5YB 3TLXA 2C78A 1AS3A 1KO7A 2HF8A 3K0FA 521PA 1OIWA 2J7KA 1GFIA 1VECA 2JJ1A 2JJ2A 3JVVA 5C2JB 3W6PA 1JR6A 3B85A 3SJCA 4Q00A 1E2IA 2AD1A 2Z83A 3MG9A 3CUEF 4Q66C 1IY1A 4A8JC 1N6NA 2ZSBA 2RB4A 2C04A 3LQRA 2QMUA 1UDWA 2XZPA 4NP6A 1OV4A 5HCIA 4M1SA 1G5RA 2R6DA 1XU4A 3RWMB 2J7PA 1R7RA 4DIEA 1DE0A 3B7GA 3A36A 2AN9A 2RGGA 3U7HB 4UJ3A 1T3SA 4M53A 2QA5A 4N0EA 2NIPA 4JL8A 2QGNA 3LV8A 1N5IA 2OUKA 4UNNA 3AP1A 1XTJA 2QPAA 4Q1AA 3MWLA 3QXXA 4QM6A 2O8FA 2C5LA 2Z5FA 3C14C 3BE4A 3PR1A 2CL6X 5GJBA 2DB3A 2FSHA 3FTQA 1Z6XA 3OEHA 3QF4A 4XWOA 2WAXA 3QSYA 1TPZA 2J0UA 1G3UA 2XZLA 5TXGA 2OO7A 5FTJA 1U98A 3LRPA 1W4BA 2ZRLA 4YMWA 2QTHA 2WWGA 4FD2A 1E6CA 2RHDA 4DLSA 1NG1A 3S1AA 4FMCB 3QG1A 4ZCIA 1E9DA 1HT2E 3DOEA 4P0TA 3QJYA 1XZQA 2JDIA 3GFPA 3SFZA 2HCJB 1T3HA 1QHHB 4CW7A 1ZM4A 4DVGA 2XSZA 1KI7A 1ZU5A 3L2OB 3OFNA 1KDTA 3ZD7A 2A3RA 3P27A 5LD2C 2O8EA 2FSFA 1GAJA 4Q4JA 3MD0A 1ETUA 5FR1A 3FHCB 4XTCS 3QIAA 4TSFD 2VHCA 4ZIRA 2W2VA 2XXAA 2MMCA 4AKGA 2BBTA 3D6TB 1KO1A 3HDTA 2EFEB 5KPJA 1GVNB 3KXLA 1FZQA 4CEIB 4H1VA 1G8HA 1ZMXA 3C5CA 1DAMA 1OHHD 2VH5R 4AG6A 1E9AA 1WXQA 1GRQA 2JEOA 1LNZA 3ZJYA 1PLLA 3F8TA 1AK2A 5B57C 2IS6A 3SN6A 3BC1A 5JFGA 5TY0A 3IGFA 4GRAA 4XH9B 1XRJA 3T1QA 2C03A 4OI1A 1AM4D 2YNMA 2BHRA 2WIBA 4EPTA 1X8KA 4HAUA 5EP1A 2MSDB 3EZ9A 4FINA 3NTUA 3REGA 4DBLC 4MDFA 3UPUA 3EWSA 1CULC 4WBSA 2ZRJA 1OFTA 1JR3A 2QTFA 4LY6A 4ARZA 3IPYA 3CRQA 3CZPA 2IYZA 1YR6A 3EAQA 1U8YA 3A58B 5D3MA 1JQLB 3W6OA 1EFCA 4IXNA 4K81B 5EP4A 4B3CA 3GJXC 1J99A 3TR0A 1G19A 4LPSA 4EAQA 1V5WA 5DI3A 5JLJA 2V55B 3EC2A 3FDIA 1OIXA 1GILA 3VFDA 2R9VA 4LJYA 2G0TA 2IXFA 1E0KA 1F60A 3RS5A 4W5WA 3VHLB 2GXQA 3H2YA 2R8RA 4MDEA 4FMDB 1A4RA 5K8UA 2JLXA 2NO7A 3FMPB 5FFMA 1M2OB 3K9LA 1A82A 2ZQ5A 3QBTA 1KKLA 1G8YA 2CCGA 2QL6A 2XTZA 4NYMR 4MRRA 4PSAA 2J1LA 2O8CA 2R62A 1N0UA 1Z07A 1AJEA 5TARA 1HE8B 1DG1G 2H18A 3DMDA 2ZE5A 3UANA 5EP3A 1MRSA 4I1VA 4BGDA 3GLFE 2CJWA 2OAP1 2QAJA 2IYRA 1NP6A 1OXSC 4NYIQ 3ZDQA 3TVTA 4Q48A 4PZYA 4L9SA 4B76A 3WNDA 3FWYA 3JZAA 1YZTA 5DSZA 4UXHA 1Q21A 1RRPA 4WW0A 5LB2A 2F7SA 1WF3A 3DKVA 2IT1A 2ATVA 1SXJB 4IOJA 3TAHA 1MOZA 1RPZA 2C95A 5M04A 1IXRC 5J40A 1Z63A 4M1KA 3C41J 2P65A 3UG7A 3IHLA 1X8LA 3X1WA 3ND9A 4JBYA 1I4LD 5KNCA 4KVAA 2HT1A 4RKFA 1HH4A 1IJFA 3E70C 3RS0A 1K5GA 2JA1A 4Q1DA 3GPLA 5K8LA 1RRCA 4A8JA 1YZQA 4C9BA 3AUXA 2CVFA 3T35A 4OI4A 1U8AA 4TT3D 3RSOA 5FR2A 3WP0A 1G3IA 1D5CA 1NJFA 3KQHA 4LBZA 5L3VA 2X77A 3OIUA 1XD2B 3WMFA 1NG9A 3R9WA 3THXB 4AKHA 2B6HA 2XOKD 1Z0AA 3T1OA 5FTKA 2AKYA 3LX8A 4B47A 3QPWA 3I32A 5FOWA 2CHVA 3KFVA 4BQSA 4B73A 3EC1A 4A15A 4TL6A 1QHXA 2OXCA 2EFCB 2QI9C 5EP2A 4CVNA 5HE8A 4I99A 1NBMD 2XNDD 4TTQA 1A2BA 1FUUA 3EA0A 3WYFA 1QHGA 2HT6A 2IL1A 1S3SA 3FMOB 4C4PA 3BB1A 2ORWA 1HURA 4M22A 2HF9A 2F1RA 3KUDA 3X1YA 1VG1A 4DB4A 5LBIA 1S1CA 2G1JA 3BIFA 2DWPA 1K5DA 4I1SA 1P3JA 2CCJA 3AVWA 4HI0E 1ZNZA 4PC3A 2RGAA 3O8BA 3PCRB 2AK2A 1U81A 1JJVA 3OE7A 4XWKA 2VP4A 3ONWA 5EE9A 1XJ0A 4N1AA 3GLFB 4XVRA 5KOYA 4Q4LA 1CP2A 2BCGY 5KPDA 1XTQA 2IYLD 4P32A 1V43A 2ZIAA 4PHFA 1TQ6A 1G7SA 2FOLA 4L8GA 4Q4AA 5C18A 2R6GA 1NLZA 2BOVA 2OXRA 1CJUC 3NVAA 5FL7D 5JJLA 2W0MA 1F5NA 1Z3IX 4HUQB 3IEVA 1KDOA 2YVUA 4LC0A 2ZROA 4BEJA 5DLQC 1KI4A 2Y8EA 4TLDA 4TQ9A 1XXHA 1NIPA 1MR3F 2FV8A 3FKQA 1F2TB 2GCOB 1E99A 1EFRA 4KLNA 5SZHB 1TQDA 3QUSA 1R5OA 3CIOA 3GCGA 3QXJA 3TR5A 4DSNA 2V54A 5HR5A 2H16A 3H4MA 3SYLA 3QNUA 5FBWB 3V00A 4MYUA 2W6ID 4A36A 4YMSA 5DO9A 3CM0A 1TEVA 3SOPA 4P4TA 4JLJA 5CM8B 2CCKA 4JBXA 5HKKA 3B9PA 3DMNA 3QKTA 4D82A 5AJXA 4KFSA 2Z0MA 4A4DA 1XFAA 2ZRCA 4KFRA 1HT1E 1FTNA 4D4MA 1P61B 1YRBA 1Z2CA 2B92A 3M0EA 4LYAA 2J0VA 1RZ3A 3PUVA 4IEIA 3QG5A 1OXXK 1PZNA 3BERA 4G5SA 1IHUA 3K9HA 5JI2E 4B34A 1Z29A 2Q9BA 3AVYA 4N3NA 3TIFA 5JBQA 1GKYA 4LRWA 3TUJC 4DCTA 4NL4H 1E98A 2NO9A 4P4SA 5E4FA 1ZNXA 3T06B 4A0GA 5AUOB 5B30A 5CJ2A 5JHGB 3B1WA 1GZSA 2J9RA 3KKPA 1IXZA 4A1FA 3AM1A 3KKNA 3REFA 3GP8A 3U4QA 4MYCA 2BMEA 2DFTA 1P2TA 3Q72A 1OKKD 2BEKA 1Q20A 2C2HA 4LJ6A 1CJMA 4O2LA 4TWZA 3QOFA 5J5CA 2RCNA 1XNJA 2PEYA 4C0SA 1LTQA 1TF7A 2MSCB 3UWOA 3MWYW 3QEJA 5AUQA 1ZM9A 4HEJA 5L3RA 1G3QA 4A0FA 3WMGA 1W2HA 3AH8A 3A1TA 1LB1B 3X1DA 4OK5A 3DL0A 4DJTA 3Q5DA 3D3QA 1TUIA 1IONA 1JQJC 4Q19A 2AWOA 2BMJA 1S8FA 3BFXA 3Q7PA 5CLLA 5DHAA 1UM8A 2H92A 4NCIA 2ANCA 5DYIA 4FCVA 2FFAA 1KKMA 1LF0A 3ZQ6A 3B1YA 1J90A 2WBLC 3I3SR 4RCYA 3AF3A 4EFNA 4KO8A 1E0SA 2PCJA 3BS4A 1A2KC 1E4YA 3X2SA 4LC1A 1OXVA 2O8DB 1SXJC 5E7MA 3BK7A 1E69A 1G8GA 1OT3A 3MRSA 3RS7A 2VHJA 3CF0A 1R10A 2DPXA 1WRBA 2NZ8A 5LB4A 3W5JA 1G64A 2XGJA 4E03A 2R6FA 4OHXA 4PO8A 4V0OA 4XVUA 2AKAB 4OHVA 1COWD 4YDHB 3QKSA 3FOZA 1E2MA 2NPIA 1ZIOA 4TTRA 4AK9A 1FP7A 4DHEA 1PJRA 1RYFA 1LFDB 3ZZUA 1YZKA 2OFWA 3W5IA 5KUTA 2BMFA 4FN5A 4LHVA 4A2WA 3F3YA 1DEKA 5L8VA 1KAGA 3KL4A 3DOFA 5CK5A 3AV0B 1G1MA 4S2EA 1GOTA 2C77A 1G41A 5DYGA 1EWQA 2BCJQ 1OLOA 1UADA 3GLHE 4B32A 4LOAA 1DVRA 3VQTA 1XPRA 1HEIA 5SZKB 5JHHB 2IYYA 1E0JA 2QP3A 2AX4A 2CMKA 1N6KA 2PEZA 4ACAA 2GA8A 1LW7A 2GBLC 2WSSD 2VIIA 3KZ1E 4IVPA 2ZSEA 5FL3A 2IYSA 4NYIR 4V02A 2RGXA 2JLWA 4C2UA 4FMDF 1AS2A 1VYUA 1Y3AA 4ZCMA 3UATA 3AF4A 1D2MA 2P67A 3GJ4A 1W0KA 2D62A 1GRRA 4LK2A 4C0HA 2D74A 1IN8A 1OW3B 2GZDA 5FI0B 3V4FA 4XD7D 1DAGA 3AF1A 1KJZA 4GP7A 4URVR 721PA 1Z6GA 3P26A 3TQCA 4XVQA 5J4LA 1W0JA 2N42A 1SVLA 4MUBA 1DAEA 1EK0A 3LLUA 4URXR 1NNEA 2ZS8A 4B2IA 1QHHA 2RMKA 3GJ8A 3OAAD 2V1XA 2ZI5A 5GVRA 4ESVA 2FH5B 2GF0A 3E1SA 3OIYA 2IC5A 3QENA 1NN0A 4NHOA 2N46A 3U3MA 1T4GA 2ZRMA 1JXMA 2WPDA 2WWWA 1R5NA 1K6MA 1KSJA 3QEOA 4A6XA 1QG2A 3K0CC 4TMXA 3EASA 2FZ4A 3PEVA 2KSQA 4JMPA 3L8ZA 2HJGA 3H84A 3IHWA 4CEIA 1KAOA 1N3BA 1SVMA 2OCPA 2JLUA 4RD6A 2GVZC 4DZZA 8OHMA 4TYQA 3Q3JB 1JAIA 3RS4A 3GJ7A 1KGDA 2CVHA 1GTVA 1IN5A 2PX3A 2JJ1D 1H8HD 2AK3A 2P3SA 2OCBA 4GI7A 1UEIA 3CR7A 5AWFC 1N0WA 4KSCA 4RFSB 2ZJAA 2GXUA 1NSFA 4MA4A 1BH2A 821PA 2QZ4A 4G5QA 1KY3A 2QMEA 5DHFA 4HB0A 1D2EA 4E07A 2DYKA 3EIHA 1K8RA 4L15A 1WQ1R 3SR0A 4OQFA 3GLIE 1VHTA 2CEAA 4WAUA
chains in the Genus database with same CATH superfamily
1ZRNA 5CB4F 4CTJA 1EUCA 4YRRA 1EEHA 1N4DA 1PJ8A 4EO4A 1FYVA 3SU8A 1N8NA 4QAQA 1ZKMA 4UBMA 3R0VA 1X6VA 4AJKA 4N6NA 1U0TA 3EEOA 2Z6AA 4RENA 4TVKA 1BMFD 3IEMA 3HWSA 2CJFA 4KO1S 2C9OA 4QWMA 2AFVA 4OXKA 3I37X 5L3ZA 1DDIA 3BCRA 3HDHA 3IBCA 2HDOA 4NAHA 4S1VA 3MJTA 1O58A 1XRLA 2JL1A 1T36B 1ESCA 4HYQA 3SX0A 1YWGO 5FV4A 5K6AA 1SUIA 4KR0A 2QLBA 1DKRA 3A7EA 5HUJA 2A0KA 2EJUA 1PP4A 1GGKA 2BE7A 2AWNA 3G5UA 1SNYA 3UENA 3VO8A 2IBTA 3IOMA 2XV1A 3FCCA 2XPCA 5CP8A 4CT4B 1IB0A 3I6QA 1BCSB 4RZQA 2FR0A 3F3SA 5FA5A 2YZKA 2VHQA 2ZJ4A 2P30A 2RH4A 4X85A 4Y1EA 4L0DA 4O6VA 1I3NA 3B70A 2GRJA 3CRZA 4LZPA 4D3SA 1J9EA 4M0MA 4TMYA 4RETA 4XWYA 3JWJA 5A5DA 5B1YA 4AJJA 1CZOA 3D4OA 3HBAA 1KEUA 5IT9A 3TL3A 4CM7A 4CETA 5HCNA 4P3KA 2YXNA 1SXJA 4BTEA 1G5TA 4LRQA 5FI3A 5CTAA 4WINA 5AM3A 4Q9AA 3KQKA 3CUKA 3THWB 2EGUA 3I1FA 4PLWA 2WTAA 2XUHA 1PKEA 3LQKA 2CVPA 4ZANA 3LC0A 4TLEA 2QL5A 3R7BA 4OYHA 1I6MA 1U94A 2FPIA 3CEAA 1I13A 3A6HA 2ISQA 2WR8A 3L6DA 1T91A 1T0JB 3MTJA 3JZMA 4JP8A 4EB6B 2V6GA 3INTA 4KUEA 4IJQA 2HKIA 2OCLA 1XNRB 2WJVA 5GOZA 2IEIA 2VAMA 3LPNA 3GLUA 3RYIB 2BMDA 2H57A 6REQA 3WWYA 3ENNA 4NU0A 1I8TA 4AJ2A 3JAWA 4I9HA 3EDOA 2XZOA 3MT8A 1SG9A 2CJXA 3D6AA 5DIZA 3WXMA 3HNRA 3CO0S 3IBGA 1GVHA 1BJTA 3AVXA 3GZNB 4RSGA 1PG0A 4JJEA 3A1UA 3IQZA 3GLIB 3A1DA 3R74A 4D8XA 4OGGA 3RABA 3WLMA 2PGDA 3EIEA 4C5CA 4YPOA 3ICEA 2AG6A 1CEEA 3COSA 4FFWA 4GBJA 1J0CA 2QX7A 5BSVA 1F2UA 3ZVKA 3AR9A 4K6MA 1H66A 3NH9A 4MWSA 3ZHOA 5BV0A 3O6VA 1YR2A 1RAAA 2GBLA 3AI3A 2VWPA 3OMXA 4HXFB 4RK5A 3TJRA 4CG0A 3VSAA 4NPHA 2O6LA 2NV6A 4RKYA 5SICE 1QLHA 1M1YE 3JPWA 4MROA 4X61A 4BMYA 2X1VA 5FH9A 1GGJA 4GPEA 4PANA 5G53C 4KODA 4KQWA 5L3QB 3QLUA 1OVGA 2QPTA 3RYHA 1LUAA 2FJ0A 3MCVA 4XCQA 1R00A 2XNKA 2HMSA 1ZOIA 3EXAA 4DC0A 4MUKA 2FUG1 4QLOA 2H2GA 2VQSA 1ORRA 1EXMA 2VJPA 3AF0A 3CRMA 3OTHA 3RS8A 4YXWD 2VCYA 4REQB 4N18A 1ND5A 2ZI4A 5C37A 1E2DA 1IM2A 4L5AA 2Y71A 1PL7A 1GLNA 3Q9UA 2AOXA 3GDFA 1BIFA 1K5HA 2GPTA 3CO5A 1FDVA 3V46A 2VNJA 1ISPA 2ODQA 4M36A 4P58A 5JQGB 5DKFA 3GT7A 4PQYA 2WUGA 2A9QA 2WIJA 1FBTA 1R0ZA 3K0BA 1ZBDA 3GPIA 1DC3A 3IIKA 3JWPA 1UKAA 4GIBA 3ZKWB 2DHQA 4C3UA 2ZWPA 3DNMA 3GJYA 3N5KA 1K0UA 3PFGA 3TZHA 5LDDC 1O0CA 2HK9A 1D1PA 4OQZA 4URUR 5JWRA 1KE1A 5KOHB 1BXZA 3E35A 3K0CA 4JGIA 4YRGA 1I0ZA 1TM7E 4TLCA 1FZTA 2Z95A 1C3VA 3LC7O 2NTYC 4IOMA 2C94A 1F2TA 4OKSA 2C4HA 2GCOA 3AJ8A 3AMVA 3INGA 2GJSA 3L7BA 4OCZA 2JKZA 3U7QA 1QNLA 2GDJA 2DKNA 2X2EA 4JHLA 4K9RA 3FPKA 4RYLA 1PE0A 1RKQA 2R2GA 3AL2A 1X9IA 2A9KA 1N3YA 3DAPA 4QOHA 3DXFA 3GA5A 4Z9FA 5G1NA 4I50B 4B6PA 4YPVA 4LF7B 1NY6A 3N59A 1JTFA 2F1IA 4IDQA 4Q4CA 3FNRA 3H0EA 3OIDA 4G63A 1Q0PA 4D9BA 3IH5A 1JAHA 1KZ7B 1T0BA 2WU1A 5IEBA 3RQSA 3TJMA 1P74A 4ZTBA 2PZLA 4Q3CA 1GYRA 3I0NA 4ENPA 1I3OA 2WLSA 1ZIYA 3SD7A 3SQMA 2ZB8A 2OFFA 3EWIA 3S8MA 2G77B 2IOFA 1F14A 3O74A 4HH1A 3C3YA 3FWKA 1IMJA 4KNWA 3RSZA 3UJ8A 1EDBA 3Q2OA 3EGXB 3SDZA 1XCPA 2OLEA 1CV2A 1N2BA 1ZR4A 3D54D 2H8KA 3T7EA 3ETHA 3SXPA 2YKGA 3FGZA 2FDCA 4EUHA 3I04A 4B48A 3WQRA 4GE3A 1ZISA 2DCUA 3I2YX 2XRYA 4H3VA 5FWXA 4UE6A 3UCXA 3V8BA 1SBHA 4IKEA 2P3OA 4K03A 1PJAA 3JAKA 4RIEA 5H3CA 3UHJA 3W3AA 3MPOA 4XQ0A 4QJBA 2RG7A 2E6UX 1I4OA 3ZCUA 2IS4A 4L28A 5B12A 1M83A 5HQ3A 4WIAA 1STOA 4FDUA 1U8FO 4JUAA 2J4CA 3RH0A 2DG2A 3T7JA 4B6OA 4ASUD 2A9PA 1G8JA 2YHBA 2PX8A 3N76A 1A7UA 1GP2A 2W2OA 3PUZA 4QTZA 5E8JA 3WWZA 2GXAA 4K6GA 2DBYA 3VBEA 2IYUA 1FUEA 4O4JB 1XJCA 2GZAA 2VYVD 4B6QA 3IIJA 4PX3A 3TI7A 4UUOA 3VPCA 5GONF 3DV0A 2P2GA 4QUDA 1TJYA 3MNFA 2VPYA 4FLMA 1AF7A 3DZJA 3RRBA 5A02A 2YOGA 2G6TA 5AVTA 2WRZA 1S2IA 2DWUA 3F5DA 4NX2A 5FP0A 1JEYA 2QMYA 5AI6A 1AQLA 4MUXA 3T4EA 4DE5A 4ZOQI 4KSBA 2VDWA 1I9GA 3ENVA 2MU1A 1KZGB 4CQNA 1NVVQ 4YCBA 2EX4A 2QJWA 3VI3B 4G2TA 4L4ZA 1J97A 1BW9B 3GVCA 2VR1A 5AJZA 3OLVA 5ALDA 2ZXFA 1S1MA 3U80A 2XCUA 1BS2A 2P0EA 3MCUA 1ZUIA 3IDZA 3WQQA 3CG4A 4WN9A 2LP4Y 5CYOA 1G8PA 2XJ9A 5BQXA 2FQWA 1T5TA 3RTDA 3STWA 1XA3A 4GUDA 4D4JA 2XUDA 4A0HA 3ONVA 4YFYA 5F4ZA 4LVOA 1X3SA 1GTZA 1VLJA 2PRJA 2W6ZA 3OFVA 3WIVA 4CKYA 2O2EA 3T3MB 4JYAB 3A4IA 3O8CA 2JH9A 3VV2A 1ZNYA 5FUMA 3OQMA 2R1ZA 4BFZA 2ZS9A 3TEJA 1XT6A 3TZQA 4CQLA 3DULA 2WU3A 5KQMA 4S1NA 3TNYA 5DHUA 3HXKA 4Q15A 2B4TO 3KSDO 5DE3A 4HPWA 3ECSA 2XECA 1PR6A 5DIFA 4GICA 5D6NA 2W4IA 4HQNA 1ICEA 1M3SA 2G1UA 3GUZA 4PLPA 4RJJA 2GERA 2IKSA 2X5JO 3H2IA 3OZTA 3BFJA 3CUVA 1JJIA 1PR9A 2W6CX 2MHCA 3DE6X 3IIEA 3MJSA 1UBOS 3R3JA 2H5EA 2HRDA 2O2IA 1ENZA 3PFKA 3RJ9A 3CLHA 2GK6A 3K96A 1NJ6A 1R9GA 2AC4A 4TKVB 4L16A 3WO0A 3K09A 1Y8ZA 2GLUA 4H4CA 2O2XA 2A1TR 3E9RA 1XMIA 4HYYA 4G8BA 5DM1A 1PYDA 5G1PA 3W4KA 2P75A 3D7LA 1ZU4A 3GDWA 4MMZB 4TM8A 4C7VA 3B36A 4RNCA 1VLHA 5GZ3A 4E4YA 2ZIFA 1YQQA 1CR4A 1TM5E 1B2RA 1S8OA 4Y2XA 1ZVVA 2I6SA 1ZSNA 2VP6A 2YWJA 4H17A 3VR1A 3L8DA 2UYOA 2QPLA 3W6NA 1LK0A 5CU7A 1SEVA 2H1HA 1L4BA 1S9DA 3CKMA 4NU5A 2R47A 1KAEA 4XUCA 4YJ3F 2J6HA 3DFZA 5H81A 4A8TA 4FUTA 3VR4H 2ZYVX 3L5KA 4AYTA 1L5VA 1NYQA 3OP4A 4R1OA 3B1XA 2QZ9A 4HD8A 4KFSA 2GN2A 2QT1A 3FNGA 5EXEA 5BW5A 5GIOE 3AXSA 3WV4A 4X6LA 4H0CA 4GKJB 3M5PA 2V7UA 2F8TA 4DLWA 2HTEA 3HVIA 1R4NA 2QDXA 2WQ6A 1SA0B 1CKEA 2W6PA 1ECCA 4C4YA 2P0AA 4K9SA 1FLVA 3KTAB 4BLSA 4N0MA 4DV3B 2HX1A 1EBBA 2X5XA 2UZ3A 4IIJB 1NY5A 3OZAA 5KO2A 4P92A 1EDEA 2QIPA 1CUEA 2QROA 4X3OA 1OBOA 5BRNA 3MN1A 3T1TA 1DS6A 3NANA 1EDDA 4RC9A 2A5GA 1KERA 4POAA 2YRFA 1FFCA 2Q5FA 1QHFA 4WLFA 3MLAA 1ZGBA 3LNCA 2FOIA 1OPXA 3HWX1 3MMZA 4HNAA 2H06A 4AKTA 1Y5LA 3C5HA 3ML1A 4I5DA 3QWIA 4UBIA 1XZMA 3UK0A 4CM1A 5CDGA 5KCZA 1I4DD 1DX9A 1YVEI 4MGHA 4QTYA 4ZQCB 1JRLA 3SPXA 1E2KA 2ID7A 3EVZA 3ZDDA 1DLJA 1PZMA 1J2EA 3B8EA 4TTTS 2P5UA 5JYEA 5DYYA 2PBZA 1TF2A 5FUVA 1LQUA 5EMNA 2X9LA 4GAEA 3A4VA 4UQLA 5KWSA 4Y2UA 3S28A 2QU7A 3PK0A 1OI2A 3B2NA 5CNMA 4ZKEA 1CNEA 2OHJA 4K9NA 4RVDA 2C3MA 1SB9A 5KJEA 1KPIA 1JHYA 2X5KO 1PZHA 3PZRA 4G1UC 2IS1A 3W7VA 4GZ5A 3M9WA 3HFRA 3JQGB 1Q1QA 2ZSFA 4HTFA 4ARSA 1HXHA 5EWLB 4BNVA 3PGJA 1HWYA 3R0JA 3BGDA 1W9MA 3ANXA 4JLNA 4QO8A 3ZUPA 3EXG1 2MIIA 3G0IA 1BYIA 2YV2A 3ND5A 4KI0A 5IW8A 2ZYRA 1H4VB 3AESB 2X3UA 2AW3A 4GX2A 4O59O 1YJ5A 3IUEA 1GZVA 1Q57A 5EHZA 2Q2OA 4MRPA 5KU1A 4ER5A 4MW2A 1QZ3A 3OF2A 2HLDD 3OQVA 1YBHA 2EP7A 1YQEA 4JMLA 4UDXX 4CMHA 3RUIA 5BWNA 1EJBA 1EB8A 2OFOA 1KZ1A 2O2CA 3IB6A 5TE9A 2R00A 3TD9A 1JNXX 3AR7A 1L5LA 2Q3MA 2XUPA 5I7RA 2R1TB 5KKAA 2BKAA 4KMRA 1G7RA 1T2UA 4QFBA 3COYA 1D04A 3KUUA 4ND8A 3EG9B 1QHSA 3F5QA 2QW1A 2QN8A 3B9RA 1D1QA 3QVJA 4GWLA 1QRUA 4R0VA 1RQNA 3JYNA 3NHKA 3ZE8A 3ZU5A 1JHVA 5JECA 3PEEA 3SQNA 3SR3A 1Q1NA 2ZYWX 4Y0VA 1JFLA 4QUIA 2IWHA 5F7OA 1GZ6A 1C4XA 4BVEA 2C57A 1RPJA 3P9QA 1VQ1A 1TKAA 3H7IA 2WQZA 1UJ5A 2H7VA 4OXXA 3MBOA 5JJCA 4KK3A 2H4YA 1OXBB 3A9SA 2PD3A 3CPHA 2OM2A 2WV9A 5HDBB 5M5BA 3G2KA 4V0QA 4BFUA 4EHNA 2IDJA 1ORIA 1MHTA 3SQXA 1C4WA 1NBWB 5ERXA 3DLHA 1E96A 1XK7A 3FSGA 3O21A 5BORA 1VCNA 5FA6A 1MP0A 3HKDB 5FUQA 3K6KA 1US8B 4WKGA 3OM0A 5CLIA 3TTSA 1C30A 3DGEC 4YP5A 4L3VA 5FJIA 3W3ZB 5E2AA 1B6TA 1LNSA 2B61A 4POOA 1TVEA 4B3JA 4TVSA 1IQPA 2GYYA 1OXTA 2GVNA 4TLBA 4YXFA 2AFHE 1BMTA 4NFSA 4PRZA 2VKQA 3CVOA 5TMPA 4TXHA 3MTDA 2PSJA 2REQB 2QUKA 3O2NA 2COKA 1EFVA 1OZAA 2IIPA 2LBPA 4MUNA 4YR7A 3OPQA 1P6XA 2I3BA 3IVGA 3PEYA 3FZQA 2PGNA 4C1NA 1EWKA 1J0DA 1PN3A 2Q41A 1YAHA 4HZUA 3RFVA 4NMWA 1FMLA 4Z51A 1XCOA 4Y6RA 3WL4A 2B2CA 4WDQA 5ELLA 5C1PA 4MUFA 3KPJA 5C5EA 4XUGB 5IAGA 4D6XA 4UJ5A 3NJ4A 1GCIA 4BNUA 2P2YA 5KCMA 5CEJA 3HVRA 1YQTA 1UT6A 2FKAA 4LXTA 2GXSA 4CMCA 4J7AA 3LH5A 3LUFA 1S2LA 2Q6VA 1PW7A 5DP2A 4FFBB 1M2HA 4HDSB 2JK1A 3ZH9B 1LVHA 1E2UA 2X14A 4LRYA 1VL8A 2FEKA 1TUGA 4PAWA 5A71A 1SBZA 2L18A 3P0EA 4EJSB 2IYVA 4BN0A 1F5SA 4I1PA 2QSZA 4WFKA 1U7UA 3BB3A 5AKLA 4IDAA 5HZKA 2QORA 1J8YF 5KNBH 1J0XO 4JI8B 2C2KA 2KQUA 1T6XA 4RH3A 3S4YA 2GN1A 5A9SA 2M98A 3E58A 4EY5A 2JG3A 2P77A 5E3JA 1VLVA 4DYHA 1RE0A 4Y6QA 4FWTA 3CVJA 5SZJA 1MO3A 4XIYA 4KQIA 1ECLA 1SKAA 3CMCO 4ZQBA 2A9VA 3WRXA 4ADSG 4S1WA 2IZ7A 5FO1A 3U44B 1SURA 2QNIA 4CMKA 5KTOA 5DWQA 2FR8C 3FVTA 3MWGA 5EZYF 1OH6A 1YZNA 3T9FA 3UWMA 2P5SA 4OJMX 1GM5A 2H2WA 2A94A 3QTLA 4Z2AA 2Z8YA 3UB3A 2V3WA 1E3JA 1XKLA 2FXIA 3P9YA 3ICQB 5I9BA 1YDWA 2ZIWB 3C3AA 4Q12A 4TN1A 1ISRA 1CLUA 4JOSA 2HCBA 5FPSA 3IEIA 5FTWA 4RXTA 2VJAA 2G1AA 4X1IB 4RV5A 3G5MA 5IARA 1NQVA 1Q0QA 1T9GR 5CD9A 1WKBA 2RC5A 5HKOA 1FRVA 2ZR8A 3W1WA 1VDZA 2FW7A 4QLAA 3JWEA 1W4LA 4L22A 3QE9Y 1U7HA 2NO5A 4N7MA 4EJ0A 3UKJA 3PCTA 1XTBA 2FUNB 4JBLA 1ODFA 3LWBA 2XXAB 3SBXA 4DS3A 1UXHA 1V8OA 3ZDEA 1QJ4A 1V8DA 4KPGA 1DINA 5E9QA 2A30A 1XYVA 4CLHA 2W22A 2PLFA 4PZUA 3WB0A 2JANA 2W2KB 4FR2A 4PE5B 2IKQA 4H7PA 2R65A 3FVVA 3K5IA 2E4ZA 3DZIA 4I6GA 4M1QA 3KSUA 1YDMA 1LSOA 2V3VA 2DLCX 3EDQA 3CISA 2VDNB 2B99A 2C1XA 2YXPX 1SQGA 3E9QA 3JU3A 3PX2A 4B6EA 1VKHA 2JGLA 3AOEA 1FXUA 3AR2A 1PQWA 3Q41A 2G5TA 4HH3C 4UHKA 1EX6A 1FBNA 1WDTA 1WB9A 3BK1A 1NW5A 2VN8A 2IWRA 1L7OA 4MQBA 4TGLA 3D8BA 4RAOA 3RRYA 3FHTA 2E1RA 4DR1B 5J5AA 1N9GB 3BMCB 1FFAA 2MSLA 4YCAA 1WE2A 5D3QA 3UTCA 1MH1A 4AIIA 5LZ4A 4YIKA 2R6HA 1YRLA 2XNDA 2ZWIA 3SR4A 4HDRB 3H1EA 3LUJA 4HB4A 4HC4A 3QHQA 4ARZB 1AHIA 1KEWA 1NT4A 3K73O 2VJDA 3IIMA 1L3BA 1O97D 3OWOA 4YRKA 3ZOZA 2NSLA 4IYRA 4Q05A 4OLHA 4LXYA 1JEQA 3OTOB 2R6CA 3L0IB 4HS4A 3IE1A 1U0BB 4HLUC 1ZSVA 3E7DA 3BXGA 4RVSA 5AVWA 1JEDA 3BPSA 1ZI9A 1NXWA 3TLBA 4R2MA 3WYBA 1ADYA 3DZDA 4X00A 2IDMA 3I9KA 2GS9A 3HL4A 1N1DA 2LW7A 4TS4A 4YAIA 2QD3A 4HQKA 3M89A 4LWPA 4YA6A 5KSYA 5D8DA 2UKDA 5EJ5A 3AJRA 2WJYA 4OSPA 4W5NA 3B6MA 1IOLA 3P52A 3SS7X 3SHQA 3HYSA 4L5BA 1NOIA 2BJHA 2KLHA 1G3RA 3R41A 3DWEX 2OHIA 3A37A 3NIGB 4TYYA 1A4UA 1AB5A 3RF7A 2Q4EA 3GD5A 3VX4A 3ETNA 4RK1A 2P69A 4F4UA 2GGSA 2QMHA 3IR7A 4RF5A 3KNZA 5ADWA 1GCUA 3D6UA 3VSEA 3R77A 4RTSA 4C2TA 3EPJA 1DTEA 3H2ZA 5CDFA 3I6IA 4H27A 1KKUA 1RWBA 4Q9JA 3E6AA 3EZ7A 1YTUA 2D59A 3VOTA 2FPSA 3D1VA 3GOQA 3LM8A 4HUJA 5B1EA 3KQLA 1FW6A 4L2IA 3UMMA 5F1KA 4RL6A 1YT5A 2FOXA 2WAYA 5F2OA 4GXTA 1XA4A 4K6CA 5K2OA 1UXOA 4ZYYA 4GD3Q 5E9JA 4QJ3A 1AQUA 3HMQA 2WD9A 2H9IA 4RTNA 2ZUEA 1LJ8A 5FHRA 1SXHA 1UH5A 3WL5A 4G0WA 3SJZA 4P81A 1J06A 4RNDB 1BS9A 2O50A 3M6AA 4KU4A 5MN4A 2IX3A 5DTEA 4X7PA 3M6UA 5GAJA 4DWJA 2OD7A 2ZB7A 1S3FA 2BONA 5DM70 4AY2A 1E8DA 3BHMA 2QYTA 4BUJA 2Y93A 4HY3A 4UCQA 2YWBA 2ZBUA 2KPOA 5HDQA 3M1AA 4D02A 1UKVY 1SU6A 4PSVA 2IF2A 2I1LA 1PNVA 2N3ZA 1JZTA 4MQLA 3ROFA 5BSHA 1C3OA 1Z36A 3LKZA 4IO1A 1LS1A 2HWWA 3RKUA 1QQ7A 2BPOA 4B3HA 2QP9X 1R4MB 3A6LA 4R16A 2VSYA 1I94B 3DOCA 1USGA 3WRVA 4Q01A 4EVQA 2CLSA 4HLDA 2AJDA 5ENDA 5CVTA 4BBZA 4JU9A 1SGWA 1K8XB 2L2QA 3MELA 4RXUA 3KIPA 3SEAA 3QYAA 1YA8A 2P8SA 3LDAA 4JLMA 1V5GA 2ZTUA 3EYWA 3BFKA 4J1NA 1OXUA 4DLNA 3LBHA 1U4SA 2XOEA 3HBFA 4D26A 3D7MA 4QBFA 5M34A 5B1SA 5IVDA 1B16A 1OBCA 5K45A 4PCVA 3F6EX 4LV6A 1XP8A 1OKKA 5D85A 1Z12A 3MJEA 1ZUNA 2I65A 4GOJA 4EJSC 2I78A 3SP1A 4K9LA 4K8OA 5LQRA 2DE0X 3UB2A 4MICA 4DRXA 1YB2A 1U7DA 5T3UA 3ASUA 2B5WA 5EJMA 2I71A 1Z39A 1XEWY 3W05A 2VXBA 1UF9A 4R2HA 5AKEA 3WISA 8ADHA 4GVXA 3VHRA 4R71A 1WCIA 3KYDB 5AI5A 2B8NA 2C4UA 1EIZA 1VLZA 4HMQA 4HAXA 1LPOA 3UC9A 3I34X 5JSQA 5K0BA 1DMSA 1ZM7A 2ZYGA 3HGQA 3LE8A 4TLAA 4XX1A 1QBKC 3Q6NA 1T4DA 4MGYR 3AVVA 5IKXA 3EDCA 4INPA 2CJPA 3HLYA 3MXOA 5G41A 1GNRA 3TKLA 1N7IA 1Z0UA 2PY6A 3G02A 4NKRA 3RAJA 1B0PA 3K72B 4TUYA 3TLGA 2Z1MA 3DAHA 2R8BA 5AXCA 1Z73A 2PXCA 2C2XA 3A3KA 4RGYA 4FEYA 2Z4RA 1N8KA 3PQ7A 1VCHA 4IZOA 4QXPA 3Q98A 2HCRA 2XSZD 3HJHA 4TYPA 4UBNA 2XWBF 1GL3A 1NR5A 4QL3A 1AO3A 4BMPB 3EHDA 1IXKA 2JFNA 3NVDA 2ZI6A 4R4JA 1VG9B 4KUGA 4EX6A 3D6HA 4KQ6A 4W9RA 3CBGA 3TPZA 5JALA 3HS3A 3NOXA 1JLLB 1LDBA 3S8YA 3AWIA 1E89A 2FPXA 2XJ4A 2XWQA 4B3BA 3JAMA 1XMQB 4CEJA 1Y9DA 2J3JA 2C2YA 4KTVE 4UHJA 4ZOAA 3DV2A 1GNLA 1RR6A 4GECA 4MYRA 1NVWQ 2BE9A 2QRLA 3LQYA 2EJBA 2X58A 3WYGA 1C0KA 3B6ZA 1P29A 2OGWA 1VPVA 1B2LA 3DHWC 5K4HA 2FSSA 2ZJOA 3R3SA 2F3UA 4X3PA 2BVNA 3RJ5A 3QJGA 3WIBA 1JXQA 1YUNA 4PW0A 4RDXA 1BHSA 2UZ1B 1XCBA 2R48A 3OJLA 5TIIA 2ZR7A 4BC1A 1EE9A 1E0DA 1QIJA 1SQ6A 4LOLA 3WSTA 2Z56A 4RJLA 4U7PB 5BVGA 5JSUA 4ZVVA 1U9IC 3S99A 3PLRA 3PQ3A 4K86A 4IEEA 4R7TA 3TR6A 5FOXA 2VS1A 5LJIA 4ZRDA 1V16B 2WSSA 4DCPA 4U6NA 5F5LA 3QJ5A 3RARA 5BYBA 1TVKA 3ELWA 4ZO8A 3IL2A 4ARCA 4O2RA 2JD0A 1T3LA 5LA6B 1WVMA 4OA8A 2AA3A 5AUNB 1TXGA 3UPDA 4I9FA 1BXGB 4ZZ1A 1IY8A 2CXUA 3OF5A 4MDHA 2FHSA 4Y6LA 2FN4A 2F9FA 3OQPA 5AVXA 2ZRQA 4EW1A 4TROA 5MF6A 1QV7A 3P9KA 4MW5A 3ZGYA 4DDKA 4FE3A 4B4VA 4EY7A 5F1OA 5IM5A 2SCUA 1XRQA 3BCUA 2PUGA 2A7QA 4CLRA 3CEMA 3HUEA 3A1VA 2RDMA 1CQIB 3H5AA 3I3OA 3CVUA 1KBZA 1PYGA 5K3EA 4YRNA 3Q3CA 5A3RA 5LZ2A 4QEZA 3IBSA 1Q7TA 4KXUA 1DAHA 4MKXA 4RZ2A 5JH7B 4O3MA 4KW7A 4MB2A 2VSFA 1Y81A 3K1JA 3L43A 3TUZC 3H8SA 1T8PA 1J2TA 2HR1A 2ZM5A 1RM3A 3OQIB 2K7FA 3LBNA 2BEWB 2BR5A 4I4LA 1IAQA 4X20B 1VP9A 3RREA 4C6TA 1XRSB 2IY8A 3BQNB 3HB9A 2B8JA 4MRVA 2VP2A 4O4HF 2FMHA 2GVDC 2IYFA 1IPFA 1Q3HA 4ZC8A 2VWQA 5HMMA 5K3DA 2WSBA 4FQ5A 4F45A 4F96A 1RXSA 5CBPB 3INNA 3PG5A 3WGTA 1IXSB 2BM9A 3V2GA 1MHPA 1UEJA 3RC1A 3VYSB 4TYNA 4ZN6A 3KWMA 1XRPA 2UUOA 1SOAA 5IU6A 3KTOA 1KMCA 3DVLA 4PY2A 3T9CA 1JDZA 1A71A 1GPYA 5E4YA 4PC2A 3SHOA 2D5LA 3WOVA 4PYNA 1E32A 3T1NA 4MVJF 1KI9A 1TK2A 3Q3HA 3V3KA 5IJZA 3DPUA 3W2EA 4FU0A 5BWBA 2EWMA 2QW8A 4WOPA 2W48A 1XCJA 4MV8A 3VU9B 3TW8A 2QQFA 5FEMA 4B4OA 1CF2O 1D2CA 1DAOA 1CU1A 1Y3FE 2E2WA 5FV7A 3QUCA 3CUYA 4UZSA 4J6EA 1QK4A 3IV7A 5H80A 5LL6P 1DCFA 1FUYB 3AVUA 3DGFC 3SVTA 1HA3A 2WF7A 3OT4A 3ADOA 4HDNA 4NH0A 1RMQA 4BNDA 3R9KA 1U8CB 1AZSC 3Q3EA 4MS3A 3QVOA 4CF6A 2NZWA 3L7LA 4RLHA 4LOJA 4UU7A 4WZBB 5CJPA 3TRKA 3S1SA 3RFXA 3MT7A 3UB4A 1P7WA 4PU0A 3ZHVA 4BQPA 4C7BA 1QFMA 3EXG2 2FYTA 3IQEA 4YRPA 3E7PA 3RIYA 3TDKA 5DBIA 1RC1A 4DMUB 3H4IA 1TL7C 3TOCA 1C5KA 2PMEA 3SXUA 4TT8A 2WFLB 5LU8A 1TZCA 1XDBA 2VQDA 4TKUB 4YT5A 2CHGA 3GBVA 1C7FA 5H9WA 3RGGA 4KQ9A 3VKHA 2I87A 3FYSA 1GGEA 2Q5CA 3HEAA 2D0PB 4WL0A 3LW8A 1KK3A 1EE1A 1KMHB 5TC4A 3R5KA 2GBPA 3FBGA 2R8YA 4G56A 4WHMA 1I14A 1LSSA 4PR3A 2CFIA 1Y1SA 1P73A 3HADA 4BWGA 4EKGA 3V1KA 4GKBA 5CIQA 1ZH0A 3D5QA 5JZVA 1S2MA 2HXSA 3W4IA 4O4LA 3GX1A 3VZQA 2EP8A 3WY9A 2FF7A 2VEDA 3RIGA 5A0VA 4FUQA 5KAPA 4CM9D 3R20A 1GZUA 1ZJ6A 2NSYA 5KNDH 3VPDA 2WDZA 2GYVA 2HIGA 1T2NA 1T2CA 2JBHA 3LSYA 2H1IA 2H31A 2BEUA 4KXYA 3PEWA 2PE5A 4RVGA 1Y7TA 2AOUB 4BYGA 2W6OA 3EMDA 3VKFA 5A3QA 1R9NA 5CMLA 4MUEA 3RM3A 1IY2A 4MYDA 3DVAB 1Z2NX 1ADJA 1ZSYA 5ERYA 4DKXA 5KX5A 1E9FA 1CZUA 1SUEA 4FNAA 1VLQA 2VBGA 3I6YA 3PP8A 4N7BA 1SXJE 4N49A 5LQSA 1AKEA 4RTKA 1ULHA 1ESMA 3LK6A 1DOAA 1BKSB 1MGOA 4Y2SA 1E3QA 2NP7A 4KWIA 3GNTA 4CCYA 3HA3A 4FHDA 3R3UA 4DDWA 4GYKA 2XUGA 1OFUA 3IA7A 1EDZA 2DY1A 4LJSA 2PVCA 5SYNA 5T67A 5GZ6A 5KINB 2I8CA 4W7HA 4RZHA 2A5DA 3EPRA 3QOXA 4Q9KA 1CIVA 1RKUA 1T15A 2DH5A 4AN0A 1MB9A 2UUCB 4UXJA 4C87A 3NRBA 3OZBA 4OK6A 2AOTA 3C3WA 3L7OA 2A6PA 2B0JA 1V39A 1C9DB 5JVDF 1NMYA 1J24A 4IJMA 4Z1MD 2QVZX 3DUFB 1NLYA 2PYIA 2ATCA 3OPNA 1Q0SA 2GLTA 1H9BA 5C8YB 3A6EA 4ZCLA 5BT8A 4X8HA 2O8BB 621PA 2G9UA 5AICA 1MQSA 4OYLA 3HM9A 3G1WA 2J3QA 2CLKB 3AZQA 2DJ5A 4CMIB 4AJIA 4DG9A 4BUZA 3K32A 5D01A 4FYIA 4P3PA 2Y77A 5J1SB 4NCBA 1XNQB 1EUZA 1MRZA 1ZN7A 1RQXA 5CX1A 3SE7A 2FPKA 4OHOA 1GNPA 1N6PA 221PA 5E7IA 1FA9A 1JEEA 1L7VC 3RT1A 4A8HA 1IMOA 1AQ6A 1RWMA 3NEAA 4Q4HA 4X1YA 4CKCA 3P2OA 4GKVA 3Q7QA 3F7TA 3ROXA 3GMTA 2GHIA 3R6LA 3K1ZA 2R68A 4P3XA 1GQOA 1F12A 1OLSB 2OCYC 2HFJA 2PMCA 3NASA 2QM3A 3BHJA 1GPAA 2X8AA 5BQ5A 3E9CA 3MTBA 5EIHA 4DBVO 4ZYVA 4KCGA 1D5WA 1NJ1A 1YH3A 4HEHA 5AJVB 4IRMA 2A9OA 4X7BA 3ICCA 1U2DC 1XK6A 1OFIA 3IESA 4OXQA 4DG5A 3FM9A 3S0JA 2CBZA 3QFCA 4B83A 4R9RA 1B0UA 3K0AB 5MGBA 3FSJX 4GMFA 4ZT7A 3I1IA 3NWBA 3ZQ4A 1T4MA 4B4KA 1EVJA 2TMGA 1N6HA 2DUUA 2YV5A 2Z2XA 1TA4A 4F2PA 2IU0A 5JXWA 5TMBA 2W2LA 4I5EA 3SC6A 1MIOA 5K1ZA 4PFQA 4A3SA 4QFCA 2ODEA 5FTNA 2YMLA 2WB4A 3ZCVA 4CUZA 2Y1LA 2H52A 1IUOA 4IH9A 1FL9A 1JDJA 4M1WA 4YVFA 1W96A 3AHCA 4JFRA 4XOUA 1K98A 1YC5A 3KB1A 2Q5HA 1X8JA 1XEXA 3O3CA 4YC7A 3P97A 5TQJA 4ALMA 2UZ4A 2OBBA 3IT3A 3TI9A 1QR6A 2QLTA 5AW1A 3PNSA 2BJVA 1GTL1 2V5AA 1X9HA 4XJTA 3J80A 4Q3OA 5IYZB 4N48A 1J2RA 1PVOA 3PRJA 2FCRA 3C8DA 4D0RA 2JIPA 4XWTA 1T1IA 3ZZ1A 5IXYA 4F92B 5KJ1A 1N2CA 1T0IA 1H05A 2RHMA 3HA2A 5LP6B 4QFMA 1DQZA 2Q49A 4G5YA 3TGPA 4UMVA 4F1JA 1RXVA 5IAAA 3KVRA 3V2UA 1C2YA 1T6BY 5T64A 5IN5A 4MITA 3UHPA 5IM4A 4GLJA 4P3NA 2ECOA 3DFFA 4EHAA 4Z1OA 1A27A 5JAQA 2XITA 4XDGA 4XB2A 4YCDA 4N5NA 2XEXA 5ALMA 1Z4OA 3O95A 1QYXA 3OQJA 1P5FA 3QI2A 4GYWA 1T9KA 4WOBA 3GRCA 1N2GA 1LLDA 1NPTO 2W8BA 4HNHA 3TKAA 1R12A 3TXYA 4EB0A 5TEVA 3U19A 4LMRA 4H18A 3C6YA 4C4XA 1W85A 1K3FA 1NVMB 2ODTX 4FC7A 2V4UA 4L5YA 1Q92A 3AY6A 3SYRA 5CAEB 1DJPA 3THSA 3TYXA 3ROTA 1H8ED 1Z6TA 2HXYA 2V59A 1NOKA 3ACCA 3FFTA 3K9QO 3KQSA 5KDLA 4BP8A 1AZTA 2HHHB 4YAUA 4EZEA 2C2BA 4HAWA 3U3XA 4MVJH 4BC0A 4EG5A 3CNOA 3I0MA 4FIDA 4W4TA 4N3BA 4WCFB 5EEHA 3WBBA 5DEIA 4YRBA 1J33A 3OKCA 1G6HA 1I5OA 1JQAA 2ZETA 4IIYA 4JCOA 5G40A 4KMMA 1X1BA 2AG1A 4MKFA 1H2HA 3GQBB 1GPDG 2QUZA 3UMSA 3QVSA 1EVYA 2BFOA 2C7OA 4ARIA 4BIMA 3TDNA 1F8XA 3L18A 3OU6A 1H2FA 3INRA 1QPBA 4ZVUA 2RHWA 1RYDA 2VO1A 3E8SA 1NF8A 3JCZA 3CH6A 4MW0A 3V8MA 4DA9A 2HA4A 3ESAA 1W19A 3KZMA 3OZVA 4XYEA 1H6BA 4OTZA 4E08A 3EX7C 1DX4A 1SK9A 1W0JD 1VTKA 1UZAA 4L51A 1CRLA 3VH4A 3IBTA 1A5AB 3K0FB 4Y2GA 1KHTA 1YR7A 5AVUA 2IHNA 3MWKA 4AKIA 3F7MA 2PYDA 4MUMA 3P2KA 4NIMA 4WTOA 4ZCQA 1THMA 4CMAA 3NBXX 1XCMA 1WZEA 2IXBA 2IYWA 2CK3A 2ZE8A 4OMCA 2GMWA 1MA3A 1CW2B 3EZ2A 3AB7A 1ICIA 1QAQA 5F9MA 2Z6UA 1D0VA 5EMKA 4JI3B 2PG3A 3ZG6A 2QTCA 4G1MB 3I12A 5GJWC 2EL7A 4FQ7A 4DA6A 3ZIAD 1T5DX 4BO3A 1YV9A 3QBEA 1R66A 2KBEA 2I6UA 4IOLA 4XPIB 2B7BA 5EUMA 5HILA 4W8HA 3RU9A 1YB6A 4JSTA 5JCJD 1Y89A 3NHUA 1QQAA 4PG6A 1T4BA 1XQ1A 5DRYA 3ME5A 1Y4SA 3KQNA 4C7OB 4DDTA 5DNCA 1RC0A 1TT7A 2HF7A 1TZKA 3EZXA 2A1TS 3HZHA 4FQ8A 2O48X 4CTNA 4BVBA 1TRKA 1VE7A 2J4DA 2P3LA 3GZNA 2XVAA 4L9RA 2O8FB 3GLIA 2BKEA 3CX6A 1N8SA 1TTPB 3OCJA 3T5AA 1TM2A 2W2XA 3OZ7A 1JT9A 4OPMA 3A6JA 1EGVB 4N9QA 3UV3A 1AGYA 1TAGA 4LHXA 2C4VA 2FSIA 2P6UA 3ESBA 1OE0A 1U31A 1QVZA 1CE8B 1ZMR