1LVGA

Crystal structure of mouse guanylate kinase in complex with gmp and adp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
190
structure length
190
Chain Sequence
RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIKKAQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the closed conformation of mouse guanylate kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 64
structure length 190
sequence length 190
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1lvgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lvgA02
3W3ZB 4G5SA 1QHXA 4PPFA 2ZS7A 1H8EA 1XD2B 5EP4A 4TYQA 1DAMA 3SHWA 3R9XA 4GSYA 4YMVA 4OI4A 5KPJA 3OIUA 4U5XA 2W6JD 2CK3D 4Z54A 3ND8A 4NTZA 1IJEA 3A1TA 4F7WA 2NO9A 4BFWA 1P5ZB 4E5UA 4ZIRA 2VSOA 3T1OA 4D82A 1XU4A 2QMOA 4K81B 3HPQA 3U7HB 1HEIA 3X2SA 2QGZA 3WXMA 5C2JB 5FPSA 621PA 2J0UB 1VTKA 2C2HA 4B76A 2H18A 2I1VB 1HQYE 2VP4A 2BBTA 1DELA 1N6HA 2ZI9A 5JCZA 1IY0A 1Q12A 4FWIB 5EXXA 4B47A 4C2TA 5CM8B 2QQEA 3TVDA 2GRJA 4BRWA 2ZR7A 2QTFA 2W6ID 1G8HA 2Z5FA 1RC8A 4LBWA 3H1TA 1M8PA 4LK2A 2C78A 2ZSFA 2IYWA 1Z63A 5K8UA 3VHLB 4Z1MA 2B8WA 4W5JA 3THXB 4PO9A 4A8JB 3MD0A 3TBKA 1F5NA 1NL3A 2C96A 4LBYA 4Q1BA 5E95A 4OI0A 4QM6A 2FH5B 3GFPA 3EPHA 3VKWA 5B58C 1AQYA 4ZKDA 2GBLA 3KJEA 3M1IA 4ZCLA 3Q9LA 1PLLA 3O8DA 4WW0A 1U90A 3U2QA 3JVUA 2G1KA 2GK7A 5JEEA 3OIWA 3PJRA 1G5PA 2QEQA 1R4AA 1KY3A 3TSZA 3W9YA 4A0HA 4KFRA 1MH1A 4JYCA 2QTVB 2ZRMA 1RRFA 5GJBA 2ZYVX 2QQ0A 2RGCA 1VCNA 4URZR 2BBOA 821PA 1ZCAA 2IHBA 1CF4A 3BD9A 5EP3A 2G83A 4TL6A 2JLRA 3OZXA 1E4VA 4EPVA 5L3VA 3I32A 1DAHA 2NOAA 2VYFA 1TF2A 1TF5A 2F9MA 2B8TA 2NG1A 3NKVA 3FOZA 3NBYC 1A2BA 2O8BA 3EC1A 1ANKA 1YRBA 5F2EA 5CDFE 2R65A 4M8NE 3UK6A 3LO5A 2QRZA 3NC0C 1U8YA 3ONWA 2F1IA 4ZDIA 3K70C 2OFXA 2R6FA 3SQXA 4ESHA 2YYZA 4QHTA 5CIWA 4LV8B 4NH0A 4I99A 2GZHA 2ZVPX 4TYPA 1JR3D 3LW8A 2G6BA 1N5IA 2ZE6A 4DDVA 1FP7A 1ZU5A 1ZYUA 1HV8A 1OXVA 5JHGB 2VEDA 4JLKA 3T1QA 1W4RA 4TN1A 3RDPA 2OZEA 1TX4B 3BIFA 1L8QA 5KNCA 3X1ZA 4B2IA 3QXSA 2ZS8A 1E2MA 1T4GA 1G7CA 4IDOA 3DOEA 4GP7A 2GAAA 4OQLA 1LS1A 1Z2AA 4IOLA 5HCNA 2WJHA 5IK2A 3SR0A 3U6KA 1YU9A 2VP6A 2OXCA 4MKIA 5IK2D 2QU8A 1OH6A 1ZP6A 5HKKD 5F9FA 5CJPA 2ERYA 4C0BA 4JLBA 3GLGB 3G82C 1OFHA 1JPNA 1QHNA 3A1UA 3MJRA 3P1JA 3ZZTA 4KYUA 2CL6X 1TQ4A 1YZQA 1EFHA 4D4MA 2FEOA 1D2EA 5B2ZA 4BLSA 2YC2C 4BEJA 4Q4HB 3W6NA 4KFSA 3PQCA 1JAIA 2Q9BA 4JBWA 3L82B 1AGRA 2VSFA 3MG9A 1KO5A 1F2TA 4Q19A 4R98A 1XCGB 2QZ4A 4RJLA 3WNBA 4HZUA 3EPKA 2JLWA 3KXLA 1FX0A 3LWNA 4EUNA 3FYHA 5BWMA 3T1VA 4RZXA 2P67A 4PXAA 4NYMQ 4ZO4A 2A78A 4HB4A 3EWSA 5DI3A 4K8OA 3IQWA 4WZ6A 2ZRPA 4AYWA 5HKKA 1S4QA 1T91A 3C8UA 2BJWA 4MGZR 4RFSA 1NLFA 2ECKA 4MKFA 2WJYA 4KO8A 2AK3A 1KDPA 4JLDA 4L9WA 4GP6A 4QG7A 2SHKA 2ZRKA 4ASUA 2PZGA 1OYWA 1E99A 1SXJB 3BE4A 4NCNA 2PEYA 2Z4RA 2ZI3A 2ZJ2A 1B0UA 2ORWA 3B6EA 1DVRA 1Z8FA 3ZS8A 4F4CA 3U60B 1MO3A 4Q48A 4TT3D 3LLMA 5EUMA 3LBNA 1A82A 3QI2A 2IWHA 3UPUA 3VU9A 1T3SA 1V5WA 5D3QA 3BB3A 2WBLC 4B73A 1UFQA 1E2JA 4AKHA 5DISB 4BRUA 1ZNYA 2WWIA 3D3QA 4KLZA 3SYLA 2VHTA 5C4GB 1SXJE 3CNOA 1O3YA 2ODWA 5JMTA 3KQNA 2CBZA 2O52A 2DHRA 1YZUA 2CVHA 2GCNA 4HDCA 1HTWA 4B71A 3GLGE 4JVLA 3QKRB 4KFUA 5BYJA 2ZUDA 3GPLA 4LDJA 3CX6A 3THOA 3B7GA 4ZV4A 3X1DA 2A5JA 3SJAA 3OF5A 1ZU4A 3GJ7A 3DKPA 4A2WA 1WXQA 1AQUA 3R9WA 3AVQA 4Q1FA 3PG5A 1KI9A 1FZQA 1SVIA 3C14C 2KWIA 1AS3A 3TUZC 1XRJA 2RH5A 1QBKC 4HLUA 3B60A 4GDFA 2ZRBA 4DCTA 3MGCA 2X19A 4HUTA 1JI0A 4E22A 1RZ3A 2YINC 3DPUA 5KPDA 2C9OA 1IAQA 3I1FA 3OEED 1KSJA 1YZLA 4M1OA 4UNRA 3OE7D 1DAIA 3DMNA 4OI2A 2YOFA 5FTMA 3TK1A 3K70B 2ONKA 1KK3A 3GCGA 1VYVA 1OHHA 2YWHA 1HQCA 2OO7A 2IT1A 3PR1A 2B7BA 1W49A 2BCGY 2IHYA 3UIEA 3F0TA 2IYQA 3SHFA 3HU2A 2ODEA 4DBLC 5IDVA 3QBVA 1NKTA 1P60A 4NKRA 2VHUA 3MWKA 5SZKB 1MR3F 2CDNA 4CVNA 1AKYA 2XZPA 2WOOA 4G01B 3UKDA 1FUKA 4JLAA 4D81A 3QVVA 3VNUA 4D4LA 1TQ6A 1RJ9A 2CK3A 5E7IA 1IN8A 3BB4A 4BFVA 1UKVY 3GD7A 3I72A 3I92A 3AF2A 2YVUA 1E1QA 3CR7A 2VPPA 1GDDA 3U7GA 2HXSA 2F6RA 1E2IA 5BYKA 4B44A 5HTKA 4Z8YA 4DVGA 5JCPA 2QT0A 1JJVA 3EA0A 1ZINA 2PBRA 2QNRA 4R9UC 5KOYA 4TLDA 1N0WA 4HI0E 3C5CA 1VECA 2DCUA 4CGZA 4QL3A 2IS4A 1I4LD 1TMKA 1U9IC 4PC6A 1B23P 5K8TA 4WVFA 2AFHE 3GLFE 3BWDD 2G88A 2J45A 1OH7A 5DI9A 3NEYA 2DFNA 5CB6A 5BW8A 3IKJA 3OEEA 1J8MF 4N3NA 1IQPA 2V8OA 4PPQA 4TSFA 5BN5A 2FN4A 3K0AA 6Q21A 3JZMA 1RRCA 4MKHA 2G3YA 2DWPA 3U4QA 3LQQA 3IEVA 1W36B 4MRVA 1NVUQ 1W46A 4M9XA 1II8B 1IY1A 4PHFA 3PVSA 2QRNA 4HZUB 4PFSA 3RC3A 2WPDD 1YR9A 1G20E 1E9CA 5HZHA 4RD0A 4RD2A 2A5YB 2MSEB 1TEXA 3KKNA 2R6AA 1GITA 3P20A 2LKCA 4HUQB 3OIVA 4DDWA 1IONA 1OJLA 2QP3A 5CK4A 3E1SA 1KO7A 4HSEA 4UJ3A 2WIBA 1QHHA 4AD8A 3NDBB 4L5BA 2KJQA 3RABA 1F60A 4NPHA 1XEXB 1GILA 2KBEA 1P3JA 5HE8A 3EA5A 4UQOA 4DRZA 2C04A 1L4YA 4QHSA 3RVBA 4RCYA 1H8HD 1T3LA 3JVVA 2G9NA 1MOZA 2V3CC 1WRBA 3B1VA 3MCAA 5LPNA 5G41A 4EQ6A 3W6OA 3U5ZB 1TUIA 2FFQA 3NDPA 3ZQJA 1CR1A 1XTSA 2A30A 2UVQA 1F2UA 4FIDA 4DKXA 4LJ6A 5JI3E 2FFAA 3TUJC 1UAAA 2GVDC 4MYCA 2IXGA 3OAAD 1XNJA 3QOFA 2G1JA 4PPNA 1RVDA 2JJ8A 4RVCA 5TMPA 2ZI5A 4LPSA 1G8GA 3BK7A 3CM0A 4ARZA 3FHOA 1L4UA 3R9IA 1DO0A 2FPLA 2EFCB 1KI4A 3MWLA 4Q9JA 3CW2A 4WXPA 4AY2A 3NIBA 1Q21A 1Z6GA 4EPYA 5FOVA 4XVRA 2PX3A 1E94E 3MLEA 3UATA 3AH8A 1Q57A 1GRNA 3ZZUA 2GJAA 1E79A 5EE1A 1MO6A 1KZGB 1GNPA 3TIFA 2YWEA 3QXHA 1P2UA 1KO4A 1S2MA 2O5VA 1UF9A 1KYIA 5A0FA 1YR7A 1W5SA 5L3RA 3KL4A 4ILEA 2AHOA 4URVR 1II8A 5AJXA 4XWKA 4M9ZA 4TZ0A 2ATXA 5AJWA 3K9NA 3B85A 4LYJA 1PUIA 1E2PA 3V9PA 1QHGA 5GVRA 3B2EA 1GM5A 3CB4A 1N5JA 1P6XA 2J7PA 2V1XA 2B6HA 1T6NA 4TWZA 3TAHA 2UZ3A 121PA 2QAGC 4OK5A 4MRSA 4EPTA 3KJIA 4PSVA 5JWRA 4YDHB 1Z0JA 3TGPA 4Q9LA 1G21E 1FPMA 1ZD1A 4GMDA 2XGJA 3SU8A 2QSYA 4AWXA 2XOKA 4XVUA 1N2CE 3OE7A 3SDZA 3DM9B 4NBSA 3IIKA 1JB1A 2XTNA 3BJIC 2GWHA 3OHMA 4KI0A 3W3AA 5FPHA 1VCIA 1UADA 5LBIA 4A8JA 1LS6A 1GSIA 1CRQA 1GVNB 1UJ2A 5KHOC 2KI5A 3LV8A 1N3BA 3ADDA 3ADKA 1GZSA 2GETA 5JI2E 2J3EA 1S9DA 3P27A 4RKEA 1KMHB 3EASA 3IILA 1GP2A 2C98A 3CR8A 3WY9A 3DM5A 4L15A 5DIFA 2CHGA 2FOLA 1NVVQ 2QP4A 4MA4A 5LD2C 1R10A 2ZE5A 5H8WA 3K09C 1WBDA 4OI1A 3X1YA 1KHTA 4LSGA 3ZIAA 3IEUA 1XZQA 2ONJA 1UDXA 1U8ZA 4AK9A 4IFEA 4LYFA 5CB8A 4WBSA 1EGAA 1YR6A 4YLGA 4TYNA 2V6JA 1Q1BA 5FL7A 5TY0A 2F9LA 3EC2A 5EUQB 2J59A 4QKQA 3RHFA 2FPKA 4G3XA 3T12A 1ZRHA 4IEEA 5FUVA 2P5SA 4FWTA 1Y3AA 2VF8A 3OEHA 4P4UA 1KOFA 4JLJA 1ZC4A 2GZDA 3I5XA 4JYBA 5ELXA 3QSYA 4OK3A 1RFLA 2PMKA 2ORVA 3LX8A 4QBHA 5AR1A 1G3MA 2G0NA 1DTSA 3ZDQA 4XIGS 3PEWA 3B1ZA 4X8LA 3SJBA 5KSZA 8OHMA 4GZLA 4RSGA 2BKUA 1XTJA 1HE8B 1W5TA 2R9VA 2OXRA 3A8TA 5JRJA 1FQKA 1NJGA 1ZMXA 4MH0R 5FFMA 5L3SB 2JGNA 4URYR 1E2DA 4PO8A 4XWAA 4B3FX 2BM0A 2PZEA 4ABYA 5IRCD 1VHTA 2HUPA 3E2IA 3SE0A 3WNCA 1CBUA 3A1VA 4OQFA 5G3YA 4ZIRB 3R7WA 2C03A 2ZI4A 5KTYA 1KNXA 4TTQA 3THXA 1KMQA 1XP8A 5CYPA 4YMUA 4DLXA 4NHOA 4ERNA 5FI1B 1E2NA 5G3ZA 1UDWA 4V0LA 1G19A 1DG1G 1G3QA 4DUGA 1G291 1WCV1 1WE2A 3CRRA 3QENA 3WMFA 1PZNA 4LCBA 1OLOA 1XMSA 4MYHA 2ATVA 3AF0A 4DJTA 3CWZA 4GPTA 3VNVA 1QVRA 1Z08A 2WWHA 5CDFA 4QC2A 4YXWA 2CLDX 2XXAA 2VLIA 5A5GA 5CYOA 1O87A 3CPJB 2ZU6A 2J0QA 2GJ8A 3K0CA 4JKIA 4M21A 3PUYA 3CRQA 1EXMA 1GOTA 1ONBA 1P75A 4AKEA 5B30A 1AN0A 3Q8XB 1G6HA 4D4JA 1E79D 1NSTA 3ZYCA 4JVMA 1KGDA 1WF3A 1JQJC 4Q9IA 1RW4A 3EARA 4IFBA 1M7HA 2RGGA 3MWYW 4JS0A 3KUCA 3C7KA 4JJZA 5KYKA 4AYXA 1R5NA 2OLKA 3EZFA 2QE7A 1VYUA 3ETLA 1C9KA 3SNHA 3H86A 3BBPA 3I8XA 2O8BB 1ZBDA 2R2AA 4ACAA 1FX0B 4QBIA 1KI6A 3BC1A 3PUVA 4M1MA 5JJLA 2GESA 5FPYA 1N5KA 2ZRGA 1E2EA 2ODBA 1G17A 2V7QA 4W5HA 2ZITA 5DHAA 1YZTA 4R2HA 3SI7A 2ZSEA 1DAEA 2ZSAA 1D5CA 1G7TA 2YWFA 5DYGA 4P4SA 4QHYA 4TLBA 2XJ4A 3MJHA 4OHWA 4B6EA 1BS1A 2IYLD 2J0SA 2JIZA 4K46A 3WBJA 2R6GA 3IO5A 4CEHA 3LXXA 2DYKA 3EXAA 1ZM3A 2OSBA 3CKLA 4KJZA 2FSFA 4II7A 2BKEA 1ZAKA 4Q01A 2J87A 2HYIC 4E09A 4BUJA 2FZLA 2YOHA 5GJVC 1XEXA 4QJ4A 1ELOA 2LKDA 5A4JA 1GKIA 2GAOA 5FTLA 1J90A 1PV4A 2W6JA 4JT4A 4A0RA 1DE0A 1M6NA 1KO1A 4LJ4A 2Q9AA 2RGNC 4BEBA 2ZEJA 2JASA 2DBYA 3WYFA 4PAOA 4S2EA 5J4LA 2NQ2C 1M7BA 1T0JB 2DR3A 1E0SA 2V7QD 3X1XA 4BFTA 2AFIE 3ZD6A 2CCJA 4M1KA 4G5RA 3TAUA 1N25A 2DWOA 3PEUA 4I1OA 2CHQA 2QPOA 3J81k 1U0HC 1GL7A 3WMGA 3QKRA 2RGDA 2GA8A 2O8CB 3GJ8A 2WICA 1FMLA 2NO0A 3RRYA 2VH5R 1E0AA 4Q21A 3SJCA 1AA9A 4NMMA 3DZDA 3RS0A 2PLRA 3NTUA 3OAAA 1F3OA 3FB4A 4Q7KA 4HEJA 4BFUA 5DHFA 2J7KA 4U02A 1MV5A 3GLFB 5TARA 3GFTA 1Z07A 4BPBA 1MT0A 4M1SA 1YVDA 1S3SA 3RRMA 3AUYA 4QNMA 3QXJA 4ZDWA 4L8GA 2IYYA 2WWYA 4Z51A 1X1SA 1TAGA 4OHYA 4NONA 2WAYA 4NZYA 1KDRA 2EFEB 1HUQA 1RYHA 1W47A 1WDTA 4XH9B 2JLXA 1ZNZA 2OFWA 1HT2E 1VCOA 4P3YA 5LB4A 1G7RA 1A5TA 1OHHD 2JIZD 1UBGA 4RD1A 5IT5A 1SHKA 1Z5ZA 3ZGXA 3H84A 1NN5A 3VR3A 1JR3E 2WWWA 4KVGA 1KI3A 1R6BX 1TL7C 1P9NA 4A36A 2VP2A 4A82A 4A2PA 1XD2A 2ZUBA 2ZSDA 2HF9A 3B1YA 4TMWA 2NMVA 3WYGA 2J0VA 4LV6A 1C4OA 2GF0A 4WIAA 2O0HA 1Q22A 4GOJA 2HF8A 3K0EA 4FD2A 2P0EA 1COWD 3KUDA 5FUYA 4Q47A 3TJZA 1SXJD 1YE8A 3AP1A 3LH5A 4FMCF 4ZPXA 5E7JA 3AP3A 4EIWA 4Q4JB 3TR0A 1E2QA 1OFUX 2W0SA 1P2SA 2QP9X 3AVTA 2AKAB 4C0LA 1GAJA 4CYMA 4A8JC 1TF7A 4BFYA 1KDTA 2RGXA 5DLQC 4TMVA 5LD2B 4MQBA 2OBNA 4YXWD 1YZGA 4Q4AB 4US0R 3LD9A 1QHIA 1M7GA 2BJVA 4V0NA 4MGYR 2XSZD 4TYWA 2VIIA 3LLUA 1BIFA 521PA 4JSYA 1X8JA 2O0JA 2AX4A 3SN6A 3TW4A 1R0YA 4W9MC 3KKOA 4HDOB 1HYQA 4Q1AA 1MABA 4D2IA 4X8OA 1R7RA 221PA 4F91B 2BEJA 4LC1A 2WHXA 1CKEA 3L43A 1UEJA 2WM9B 4WZAE 2NGRA 1M34E 1FQJA 3AF4A 4EFNA 1SXJA 1S1CA 4QM7A 1IJFA 4I4LA 5IF9A 3L0IB 3I73A 4TT3A 3AKEA 2JATA 4N0EA 4B3BA 4LWZA 1E0JA 3OESA 4CT4B 1KKMA 1XJ0A 3NG1A 4UNPA 5E3HA 3ADBA 3IUYA 1ZCBA 3T61A 1KI6B 2ZUCA 3AQ4A 1XPRA 2ZM5A 2GXQA 3T5DA 2IEZA 3TVTA 4KXFB 1GRQA 3BXZA 3UMFA 3L2OB 4I81A 5DO9A 4CEIA 1NIJA 1NMYA 4NCIA 3KB1A 3VX4A 3A37A 1K8RA 4PZZA 4B3DA 3Q3JB 4CDGA 1P7CA 1YZNA 2PL3A 3KJGA 1NI3A 2CE7A 1QHHB 4PX9A 2WOJA 2G77B 1XXHA 4UXHA 1QRAA 1K6MA 2N46A 2XX3A 2R62A 4J0QA 5KNDA 2V54A 2WV9A 2VO1A 4XWOA 1XJQA 1EFRA 4OK6A 1MRSA 3Q7PA 1IN4A 1DARA 1NVWQ 4MGKR 4DIDA 5EE0A 3TMKA 4A0FA 1TPZA 1JEDA 3T06B 1N0UA 1ESMA 4GOXA 5JECA 5EE3A 1VIYA 4HAZA 1XPUA 3TUIC 1P2TA 1SGWA 4Q03A 4URWR 3LNCA 5KDLA 3K53A 4HLCA 5D3MB 1D9ZA 4KBFA 2XB4A 2BV3A 4YMSA 4TQUS 1HT1E 2E1RA 3AKCA 3HJNA 4DHEA 3R20A 2ZRHA 1GL6A 2JDID 4GNKA 4Q7MB 5CIQA 2NZJA 2GEDA 1DEKA 3P26A 3EZ2A 2FSHA 4JLMA 4Q4AA 2O8CA 2QI9C 1NLYA 2H7VA 3TQFA 4JL8A 1N6LA 4LV5B 2QY9A 3VR6A 4B3XA 2R6DA 5EZ6B 4B32A 3GLIE 1GRRA 4KSBA 4A6PA 2AWOA 3CLVA 1XTIA 3VR2A 3DL0A 4Q7JB 5JJIA 5BQ5A 4TMXA 3CONA 3H0KA 1XZPA 1E98A 3VQTA 4XSHA 3GFOA 1NG1A 4F4JA 3CH5A 1XEWX 5AJZA 5B64A 2QG6A 4AI6A 2WJJA 3TQCA 2IF0A 3Q85A 1D8TA 2ASEA 2Z83A 3W8NA 3I62A 4M9QA 3W8RA 2YV5A 1TUEA 2A3RA 2DFLA 4JJKA 3U6BA 4EKDA 1ZIOA 1BYIA 1Z0AA 4KSCA 2GJSA 1OIXA 1PJRA 1GG2A 2QGNA 4I1VA 2FX3A 5TV2A 5FOTA 3GMTA 4NDZA 1R5OA 4JBYA 4XVQA 3DKVA 1Q1ZA 2J7PD 1W0KD 3KKQA 4BECA 1E9SA 3O47A 1FMJA 3GJ0A 2LWIA 4NCJA 3WBKA 1TEVA 1I4DD 2H57A 3KQLA 3Q7QA 5DNYB 2RHDA 3CF0A 1HH4A 3QXXA 2H8KA 2ZRDA 4KFTA 4JL6A 3HU1A 1XXHE 3AVYA 4TQAA 4UJ5A 2JLYA 5C1BA 4WA7A 3QKSB 4ZKEA 1XEWY 1US8B 2Q6TA 3EIEA 3K0SA 1KJYA 4GZMA 4MYTA 3AV0B 1SHZA 2RGNA 2WJGA 2O0KA 1G18A 2GJKA 3CZPA 2V1UA 1PLJA 1XTRA 2R8RA 3O8CA 1G3IA 1FNNA 4JLNA 1E6CA 1CU1A 2ZRJA 3FFAA 1ZM7A 5KDOA 2P6RA 3IIJA 3ASYA 4QGGA 1S0UA 1P4SA 2HT1A 3QIAA 2UZIR 1UM8A 3AF1A 2JLUA 2F3TA 4TSFD 3BFXA 4HLDA 2IBMA 4Q9HA 3RS7A 3MMPA 3K09A 3C15C 3IHLA 3TR5A 1VDZA 1H8HA 5HZKA 3QNUA 3TW8B 3TKLA 2CHVA 2ZAOA 3FHTA 2WMOB 4DDTA 4OBEA 4TLAA 2HT6A 2OCAA 2W00A 1UBFA 1EWRA 1N6KA 1YKSA 3SEAA 3BRWD 4HLQB 1VIAA 3SYKA 4DSTA 4LOAA 3WYAA 5AUOB 2RKOA 4LHWA 3UANA 3DOFA 3L8YA 1NN3A 4PPGA 1R8QA 3A36A 1IBRA 1KKLA 4V0ME 2QMEA 3PIRA 4TMZA 5K8LA 2FSIA 2E87A 1QVAA 2FZ4A 5F9HA 3EW9A 4DIEA 1XJCA 2B7CA 5J40A 5K8IA 1OFIA 1S1MA 3CO5A 4BZXA 2XJ9A 3THWB 2JJ1A 2ZRCA 5C46F 2ZS9A 3PCRB 3B82A 2EYUA 3B5JA 1KI2A 2FF7A 1EFCA 4M1YA 4QGFA 4R7ZA 4DCUA 4JVSB 2WTUA 3A4LA 1CULC 1G5TA 4DSUA 3L8ZA 3VR5A 3D7MA 2XITA 4XOIA 3QBTA 4NL4H 1P61B 3EWAA 2IC5A 3CIOA 3OFND 1Z3IX 3GJ6A 2WKPA 2XTMA 2GF9A 3BERA 5DYIA 1Z83A 2OILA 4TYYA 1XB2A 2VSXA 1KNQA 1NVVR 1OPXA 4Q00A 1FTSA 4IVPA 1P73A 1I2MA 2VRWA 4F4IA 3EX7C 2QTHA 1A2KC 2LCFA 3T1TA 4B33A 2GK6A 2HDNB 3HR8A 3MSXA 1AGPA 4PSKA 2OT3B 2IEYA 2ZRAA 4PAMA 1WB9A 3QVUA 4B3CA 2YJTD 2JA1A 1VG9B 2OG2A 4DWJA 1W44A 1QG4A 2AR7A 2HEIA 2AWNA 3FGNA 2BHRA 3KQKA 4CW7A 421PA 1COWA 2I3BA 4M9SA 5L8VA 4O25A 1E69A 4LYHA 3K9LA 3CPHA 2BMFA 2FG5A 2GEVA 2TMKA 1RRPA 2GTPA 4B74A 4Q4HA 3PXGA 4QGHA 3U3RA 1Z0DA 1E9BA 2ZANA 3ZQ6A 4CRWB 1G8YA 4PHTA 1L7VC 4PZLA 1OXSC 2QPAA 1FL9A 4QNRA 2MMGA 4QBFA 4LC0A 3AVVA 2ZYUX 2CL0X 1KMHA 2AK2A 1JBKA 1NVXQ 3WP0A 4U00A 2D74A 4G5OA 3C4JA 3ZIAD 4OJKA 4KVAA 4ZCIA 1KZ7B 4Y0VA 2D06A 2QM8A 3THWA 2IYZA 4BQSA 1DAFA 3NVAA 4BZPA 3VKHA 1R8SA 3HU3A 3M6AA 3N2EA 1RPZA 2P3SA 2REXB 2CL7X 3ZD7A 3GJ3A 3QKUA 1X8LA 2J1LA 3C16C 3UG6A 4KCGA 1Q3TA 1Z06A 4FMBB 2YWGA 4M1WA 3B9PA 4KAXA 3T35A 1T5IA 2IXEA 3SS8A 1QZXA 5E4FA 4ON9A 3QF4B 2BVNA 3TSWA 4C4PA 4C3ZA 2PT7A 1DOAA 4QGAA 3RWOA 3RLFA 1XMJA 4HAXA 1KDOA 2J41A 1KI8A 4OYHA 2ORIA 5H68A 1RJ9B 3ZJYA 3ADCA 5D3MA 3EIHA 4OQMA 1AZSC 2IWRA 4LJ8A 1FW6A 1NBMD 1GKUB 4KODA 4GOKA 2P6NA 1XCMA 4AG5A 1IN7A 2CLSA 5FTNA 2ERXA 4XTRA 3RAPR 2ZROA 3ZH9B 1XTKA 5FH9A 2J0UA 2EWWA 3UMSA 3H4MA 2BEKA 4NP6A 5L3SA 3FPAA 3KFVA 1S3GA 1I4TD 1OW3B 1VMAA 4B2PA 1G7SA 3AP2A 3U7FB 1JXOA 3KZ1E 4B34A 5H1YA 2EVWX 5FTJA 1E3MA 3AF3A 1ODFA 1DAKA 4LJYA 1G4UR 3I3SR 5JSZA 2FGJA 4A1FA 3P4XA 4A15A 1QHYA 4RY2A 3PENA 5EQTA 3W34A 2ZVQX 4G1UC 5FUWA 1A1VA 2AD1A 4MRPA 2B21A 1E2GA 4KITB 3VX3A 2A2ZA 4HDQB 4PQFA 4RFVA 4UNNA 1AKEA 5CM9C 4C7OB 3THYB 1HY3A 1E0KA 2XEXA 5G40A 4JKYA 2P65A 3LBIA 4HUQA 1NMXA 4QOSA 3O8RA 4KLNA 1T8UA 2GZAA 2PCJA 3IDQA 4EPXA 2OV2A 2ZI7A 3QQ5A 2XZOA 3BFVA 2GNOA 5CJ2A 1NBMA 2WKRA 4DT1B 1II9A 1NNEA 2GCOA 1JAHA 2Q9CA 2PZFA 4IHQA 4EFLA 2DY1A 5F3WB 3MUFA 1JECA 2QUZA 3N2IA 5F98A 5GJWC 4CEHB 2XZLA 4DB2A 1YRAA 4DB4A 4PZYA 5JRZA 1XMVA 5J4VA 4EJSA 2ZYWX 2OEPA 2NO6A 4LRWA 2GXAA 3LW7A 2QBYA 1IHUA 1ZNWA 3DHWC 4TLEA 721PA 1JNYA 2A9KA 4TQ9A 4HB3A 1R2QA 2IYVA 5FBWB 2K5UA 1NBME 1ZD8A 1WMSA 2YKGA 2IS6A 1DPFA 1K5GA 5SZHB 2EU8A 4TMKA 2X1VA 4Q9KA 2CJWA 3GJ4A 4WOPA 1SKQA 1YR8A 4B35A 4F92B 4DLSA 3R8FA 2AXPA 1TTTA 3IPYA 3CUEF 1KSGA 2EWVA 1K5DA 3AKYA 3KTAB 4AKIA 2ZRLA 4M4SA 2GVZC 4RFSB 2ZE7A 1RRGA 2D2EA 4CEJA 2EFDB 3BAFA 3BOSA 2ZJ5A 3B9QA 2F3RA 3LXRA 4V03A 1JXMA 1G8FA 1CR2A 3RS4A 2HLDA 2XNDD 2ZJYA 3KXKA 3FVQA 2ZJOA 2EFGA 4BLTA 2AL7A 1SXJC 4IDPA 5DN6D 5P21A 3EZ6A 2WJIA 2WWXA 4KU4A 1LNZA 1CTQA 1XD9A 3U3OA 4CT5A 2PX0A 4P4TA 2HV8A 2QORA 1X1RA 4UNSA 1VG0B 3HDTA 1GWNA 2HJVA 2PH1A 2QAJA 4G0NA 3K0FA 3U7EB 1C1YA 2QENA 3NHAA 5AUNB 2MSCB 3IBYA 4Z1MD 3QXCA 4XTCS 2AD5A 1CP2A 2D62A 2CMKA 5H70A 3T5GA 3W90A 1E9EA 1SULA 1Y63A 4LBVA 1X86B 2GHIA 4HYYA 4NYIR 2OBLA 4DLWA 1XPOA 4NCKA 5E7MA 2JLVA 5AK0A 4CF7A 4POAA 3BB1A 4GRAA 2IS1A 3FTQA 2JLSA 1LW7A 3TH5A 4DCSA 5FR2A 3HYRA 4MRNA 2QA5A 4JLPA 4IKEA 1W0JA 4D26A 2FFHA 5FPKA 1A7JA 1KJWA 4P4SB 5HE9A 2HYDA 5GJCA 2OCPA 1ZIPA 5JWHA 2VL7A 5J5CA 2BC9A 2RHMA 3V00A 4ESVA 2PJRA 3UG7A 2FDCA 1EESA 1U8AA 4IXMA 1ZUIA 5J47A 1Z6AA 5FBVB 2VQSA 2CCGA 4ACBA 5IHPA 1OXTA 1GKYA 1UBCA 1OV4A 3K0AB 2PT5A 2H1LA 3LQRA 5B57C 2BOVA 3HYTA 4P32A 2HLDD 3RNLA 3ECCA 4BLRA 2CJWB 2IF2A 2ZRIA 4NE2A 4OHXA 1CJTC 1XFAA 3BH7A 2N1BA 2QT1A 1YJ5A 4YMTA 2G0TA 3NH6A 4Q66C 2O8DB 1XDBA 1NF3A 2PJZA 4HZIA 4LHYA 4EJSC 4R2IA 1BOFA 3REGA 4TZ6A 5C18A 1AJEA 1RYFA 2FWRA 3DVLA 1XXHB 3WHKA 4FI3C 3EPLA 2XSZA 3LY5A 1Z2CA 4KYIB 4PHHA 1KTVA 4HATA 4DLZA 3OFNA 1FUUA 2PCLA 2VHCA 1H8ED 3SFVA 3OEHD 3P4YA 2IYXA 3IO3A 1S9HA 2Q3MA 2C5LA 4A2QA 2DFKB 4IRUB 4URUR 4JBXA 5FR1A 1G4AE 5AUQA 3IBGA 4CEIB 4GBMA 2GDJA 2GXSA 5C4MA 5KNBA 1KIMA 4MITA 1E9FA 3FMOB 2O8FB 1U98A 3AVWA 1OSNA 4JMPA 3GLHE 2C9CA 2GILA 1MRNA 2PMDA 5G53C 2PLFA 3LDAA 3QE0A 1KSFX 1PUJA 1F2UB 1E2HA 4UXJA 5FI0B 3IGFA 1XBTA 1W4BA 4DDUA 3MAAC 4O3MA 3AGQA 3K0CC 4D6PA 3H2YA 4LJ9A 4G5QA 5JFGA 5JLJA 3W5IA 2IX3A 3WP1B 2QM7A 3SJZA 4C0QC 2VP9A 1LY1A 4ZI2A 2NPIA 2CLCX 1KI1A 1AM4D 3FKQA 3GJXC 2D3WA 2EYQA 3VR1A 4BLOA 2NPFA 1P62B 5DI3B 4E07A 3GEHA 1SVSA 3U61B 1A4RA 3CBQA 2JAQA 1G3RA 3I8SA 3ZLJA 4UXIA 4WAUA 4DT1A 4JT2A 5FOSA 4MRRA 1NIPA 1W4CA 2D7CA 1QDEA 2XAUA 1RKBA 4ITRC 5FUXA 3EZ7A 2O8EB 1Z22A 1XD8A 2CNWA 2WWGA 1GIAA 1SKYB 1EWQA 2FV8A 2X2EA 1U81A 2WSSA 1F6BA 3WMEA 3JZAA 3S1AB 4AC9A 2FEMA 1CIPA 3MFYA 2NIPA 3KB2A 5BN3A 1EFRD 3FDIA 4BLQA 2CXXA 3NH9A 1SVLA 4BZQA 2ZETA 2OHFA 3BGWA 1T8TA 2XB2A 2WWFA 5BN4A 3GLIA 1MO5A 1SQ5A 2ZU0C 2GKSA 3B8HA 1SKYE 1E2FA 4FXPA 1JQLB 1RIFA 1EX7A 4N0DA 4V0MA 2F1JA 1J99A 4MGIR 3C5HA 1D6JA 2Z43A 2VP0A 3KTAA 2JEOA 4ZI3A 4IW3B 3X1WA 1CJVC 1E2LA 2WZQA 5EXSA 2QAGA 1G8PA 1Q0UA 2BWJA 5JEDA 3M0EA 1T3HA 3ZVLA 1R0WA 1Z28A 2IYUA 2C77A 2WSMA 3AB3A 2FU5C 4C0JA 4GMXA 1SVMA 5AUPB 4C7OA 2ZJZA 3D31A 5L3QA 4C0AC 1Z0KA 4L4UA 4Q1DA 1KY2A 2GCPA 4LX0A 2ODNA 4Q18A 3FFBA 4AYTA 2FJUA 2ZSBA 1JJ7A 2C9YA 3K0FB 1U2RA 4DSOA 1Z0IA 2YNMA 5FBQB 4LI0A 3F5FA 5KU1A 1KO8A 2ZREA 4WXRA 1BMFA 4CZ2A 1GUAA 2YZ2A 3QJYA 3FE2A 1AS2A 1GTVA 2P2LA 4F38A 4PC3A 5SZJA 3ZVRA 1CR0A 4C9BA 5JS7A 3AVXA 3VAAA 2QL6A 1W1WA 4AG6A 4B2LA 2ZYTX 4BFSA 3QKTA 4YONB 2DFTA 2V4ZA 1JR6A 3LA6A 3KXIA 3N5CA 4EFMA 2QBYB 2H92A 5LB2A 1EX6A 1UBEA 1CS4C 2IYRA 1AZTA 2JLZA 4QBGB 3DDCA 1X8KA 3LRPA 1NJFA 4HB2A 2ZPTX 5DH9A 1CJMA 2FNAA 3BH6A 1W2HA 3B13B 4FCTA 4Q4LA 3U3KA 1VG1A 1P2VA 1US8A 1G9XA 3NBFA 2NO7A 5SZIA 4Q02A 4DXAA 2FFBA 1E9AA 1FTNA 2QE7D 3V4FA 3MWJA 3RS5A 4LZZA 1BKDR 1XF9A 3CNLA 3QUSA 4TTRA 3RRNA 2ZIAA 3RS2A 2BBWA 1AS0A 5FBRB 4V0OA 4A92A 2XNDA 2D2FA 2FPMA 3F8TA 2AN9A 1S96A 1TU4A 3KFXA 4LY6A 2O8DA 4O0MA 3AVPA 1X6VA 4DUGD 4DZZA 1KAOA 1ETUA 4MDEA 1LB1B 2F1RA 1Z6YA 1XTQA 1SVOA 2IA5A 4EPWA 4BASA 3AEZA 4OJQA 5JHHB 4BFXA 4Y0AA 1HA3A 2JLQA 3B1WA 3LBHA 2BMEA 1ZD9A 4MUAA 2QPTA 3NBXX 1JPJA 2E9SA 1PVOA 1UPTA 3VKGA 2EW1A 3V4RA 2FA9A 3HPRA 2WMNB 3FMPB 1DBSA 4IJMA 4C30A 3SQWA 2YOGA 1WP9A 3A58B 1VPLA 3SOPA 1Z29A 4M53A 3EAQA 3PUWA 1N6OA 2FMXA 1CEEA 2BMDA 2W2XA 4URXR 2XXAB 1CJKC 1G5RA 1E4YA 2R44A 4NYMR 2WAXA 3UXMA 4BGDA 2F43A 5FL7D 5JWOA 1HURA 2V9PA 3K9GA 4US1R 4JLOA 1M74A 2YC4C 4IOMA 1W7AA 2I1QA 3W6PA 3IIMA 3ASZA 4YDSA 1OH8A 3ICEA 2QMHA 1CLUA 1NRJB 3CF6R 3CPEA 3REFA 4A0GA 1NP6A 1FFHA 2FE4A 1W0JD 5EJEA 1KAGA 2HCBA 2JJ2A 4G5GA 1EG7A 1DG3A 3WHLA 3GLIB 1AIPA 1E1RD 4DCNA 1NLZA 3CX7A 4V0KA 1ZM2A 3NEJA 2L0XA 4AKGA 4RZ2A 3R7WB 2DPXA 3LFUA 1M1YE 4HAUA 3AVOA 4JZKA 4H1VA 4UKDA 4IDNA 1BO6A 2JJ1D 1TNDA 2Z0MA 5KSOA 1E96A 1F48A 3S1AA 3Q5EA 3VHXA 5AJYA 2OE2A 4QFMA 3TSOA 1U99A 3SYNA 3KQUA 2IUTA 1OE0A 1CXZA 3FKSA 4MYUA 4Q1EA 1CJUC 1OXUA 2GBLC 5M04A 4ZCMA 4ARZB 5KSYA 4GT1A 3VTKA 1G41A 4MDFA 4GI7A 4O2RA 2Q3HA 5GADl 1OIVA 5L3QB 3AUXA 2Q3FA 3O8BA 3QF4A 2B92A 4LHXA 4M22A 4NU0A 4BE7B 1RE0A 4FMCB 4A6XA 1ZM4A 3RS3A 1V43A 3AM1A 3QF7A 2Q0HA 4D4KA 2HXYA 3CNNA 4P33A 4C0SA 1OXXK 4W7SA 1LTQA 1NSFA 5HPYB 2V6IA 2ZRNA 4Q4JA 1IN6A 4FCVA 4LHZA 2KSQA 3QG5A 4XJXA 1EFTA 2Y8EA 2OUKA 1N6NA 3U44B 4PR0A 1ZW6A 1U94A 4PQYA 3VMFA 4MKGA 5KDDA 3ND9A 3GLHB 5EXPA 2W83A 4D25A 1H65A 2ZJAA 2A5FA 1CRPA 4B43A 3QPVA 4C2UA 2REOA 5FL3A 3FWYA 4D0NA 4N1AA 2GJ9A 4EAQA 4H9GA 1UKEA 1DAGA 1MKYA 1N6RA 4P31A 1U0JA 2BMJA 3KDSE 2F43B 1W4AA 1TU3A 4IVQA 3TRFA 1UKYA 4ASUD 3BS4A 4P0TA 4UNQA 4A4DA 1DS6A 1LF5A 4S35A 3TE6A 3GQBA 4X8HA 4IOKA 1MO4A 3DEFA 4L16A 1W2GA 3SZRA 2REBA 5CK5A 4X8MA 5DSZA 4LGMA 3K1JA 4HAYA 4DLUA 4XD7A 4PAQA 4KHZA 2QMUA 1Z6TA 3CZQA 1D2NA 2QSZA 3EZ9A 3U4QB 1GNRA 3M4YA 3SBEA 2YHSA 1UKZA 4JIMA 3NXSA 4TL9A 1X3SA 3UMRA 4QJ5A 5TB5A 5JS8A 1Z47A 3BH0A 5AWFC 4LYAA 4ZDJA 1NN0A 3Q72A 1R5BA 5JJKA 2OAP1 3DO6A 4I1UA 4FMDF 2ZJ8A 1XX6A 3WNDA 1U0LA 4MUBA 3ZVMA 1DO2A 1P72A 4HAWA 3EIQA 3IQXA 4YQFA 2X8AA 3PUXA 2HCJB 1JR3A 1D9XA 4DLYA 1NY5A 2DWQA 2I4IA 2X2FA 1ZNXA 2ZJBA 4RKFA 4EJSB 2O8FA 1I2DA 4D80A 3RSOA 3RANA 2BBSA 4LJ5A 1ESNA 5ANRB 1OYYA 5CLLA 3NWJA 3EG5A 2OM2A 4FN5A 3E70C 5KUTA 2CNWD 3QEOA 3GLFA 1WQ1R 4LUCA 2WIAA 1G6OA 4PTLA 4C0HA 2BCJQ 1IN5A 1KSHA 4HAVA 4M2LA 4TL7A 1WBBA 2GCOB 1FP6A 4IDHA 2JDIA 2F7SA 1VG8A 3KJHA 2Z4SA 2ANBA 4QRHA 1II0A 2ANCA 1YQTA 1IXSB 1G1MA 1KI7A 1ZM9A 3LX5A 3CWQA 3I5YA 2A7QA 2ZTSA 1JALA 2GEUA 4OQNA 2JJ2D 3ZS9A 1VHLA 1PLKA 1LV7A 1YHNA 3CRMA 4Q5IA 5TVKA 1T9HA 2OFOA 4D0GA 2QROA 5DE3A 5JBQA 4PC1A 3IHWA 4OL0A 2OCYC 1GFIA 1VKJA 4IEIA 4TL8A 1TADA 4PQRA 1VYTA 3KKMA 4M1TA 2A5DA 1IOZA 4RD3A 1KJZA 1OB5A 2OCBA 3A4NA 2W2VA 3FMIA 2PEZA 3MRSA 4PSAA 2IYSA 5CLQA 1NN1A 1Q44A 3WRXC 3UWKA 3N70A 4O2LA 3U3JA 2IUUA 1G3UA 1KK1A 1GL9B 3A1SA 3Q5DA 1Q1QA 5TXGA 1FNMA 1LVGA 2Q21A 3DMDA 4LJ7A 3A4MA 3L0OA 1UEIA 2QAGB 4OKSA 1E1QD 4RD4A 3SC3A 1NY6A 1CR4A 4GL2A 1P9WA 1J70A 1N6PA 2BIFA 4PANA 3QPWA 3GEIA 3AGPA 3I61A 3GP8A 3QPUA 4GFDA 5EXTA 5J4HA 2EFHB 1MABB 2BDTA 4EDHA 4HLUC 2XNSA 1M2OB 4DLVA 3TNFA 4DSNA 1FOEB 4V02A 1J8YF 4YC7A 3L0PA 3FHCB 1AK2A 4NCHA 2UKDA 1G16A 1L2TA 4B3GA 3QKSA 2NO1A 2OLJA 5UKDA 5J4YA 1W36D 3UWOA 3U44A 3CH4B 5DN6A 4PC2A 3FMFA 4WZBE 4DLTA 3HR7A 2XOKD 2BM1A 1R0XA 4AIIA 1J2JA 3SFZA 3B78A 2EQBA 2ZR0A 1N5LA 2W0MA 4IDQA 1XEFA 1R0ZA 1HE1C 2ZRFA 1ZJ6A 3GJ5A 4LJAA 3PUZA 4CIDA 3KQHA 1VCMA 1G64A 1IY2A 3P32A 2W6IA 3F3YA 2O8EA 2FSGA 3CRW1 4TMTA 4OHZA 1E9DA 2D7DA 2WJVA 2IW3A 2OBMA 3CRVA 4EQ6B 3OIYA 1BMFD 3NBZC 2J46A 4Z8XA 2MSDB 2OESA 5J4KA 2VHQA 3PEVA 2NZ8A 3GLHA 1W36C 2H17A 1D2MA 2RAPA 4NYIQ 3QG1A 4XD7D 4IOJA 2RB4A 4OHVA 3PFIA 3A1WA 1ZVQA 3HWSA 3PV0A 3QEJA 4HB0A 5FPTA 3U3MA 4DCVA 2H16A 1GNQA 1E9RA 5FOWA 3I4LA 3ZZ0A 3W5JA 5BXQC 2DB3A 1P9RA 1BH2A 3KKPA 3VU9B 1T0HB 2IXFA 1ZUNB 1OB2A 2W58A 4BWYA 5FOXA 2JCSA 3E5HA 4A9AA 2NTYC 4I1SA 4LHVA 4RZ3A 1LFDB 4BFZA 4PC7A 4E03A 3L0SA 4KV9A 4IXNA 4W5WA 2RGBA 1QHSA 1ZUHA 4B75A 1U9IA 1XWIA 2VF7A 1QF9A 2KB0A 3B1XA 3TLXA 3SBDA 5EE9A 2C8VA 2P5TB 3GLGA 3LVRE 3BFKA 3RWMB 5GVSA 2CEAA 4CEJB 1QG2A 4RZUA 4OQXA 4D0LB 4YMWA 4R71A 2WKQA 3AKDA 1KK2A 2FGKA 1TQ2A 1Z6XA 4RD6A 3VR4A 4BLPA 3WRYC 1JEEA 4C0KA 3DZ8A 1Q20A 2N42A 2X77A 4Q7LA 1F2TB 2V55B 3R8CA 4H1UA 4M0LA 3ICQB 2XTZA 2ZE8A 4FCWA 5FTKA 2R6CA 3CX8A 2ZR9A 4JVNA 2W2TA 4RCZA 3RRZA 4DEYA 5DGXA 2IL1A 2MMCA 2VHJA 4QXAA 1OKKA 2VP5A 5JZVA 1OFTA 3T34A 5KSPA 3LVQE 2ZI6A 4DC9A 3LAWA 2WSSD 3KX2A 1J7KA 1XMIA 4DLRA 1TQDA 4FMDB 1Q1EA 1W0KA 3PEYA 2F55A 3RC8A 2VBCA 2HJGA 1YZKA 2P6UA 4DEXA 1EFUA 1W48A 2A5GA 2ZAMA 3D6TB 5EP1A 2RMKA 5EE5B 5FOUA 3EPJA 2OAQ1 2KE5A 2AKYA 2AXNA 1IXRC 1N0VC 4B48A 5EZ5A 3RSLA 4QJ3A 1Z0FA 4NYJR 1E32A 2F1HA 5FBLB 4Q1CA 1IXZA 5CITA 4US2R 1XCPA 3RYTC 1OH5A 1SZPA 4TTPA 1DADA 2IYTA 1KK0A 2C99A 3D8BA 1N6IA 3C41J 3FKSD 3NC1C 1LF0A 4XSGA 2H5EA 2CCKA 1SVKA 1BYUA 2WVJA 3G5UA 5HCIA 5TDHA 3A6PC 4F93B 3CF2A 1E2KA 1OKKD 4TLCA 5LDDC 1NG9A 2RGAA 3BORA 4LPKA 2IK8A 4PO1A 3G0HA 2GXUA 3K8YA 2Z6VA 2QN6A 2ZXUA 1E1RA 5JSZB 2VTKA 4JLVA 4B6FA 1T5LA 2RCNA 5EP2A 1IM2A 3GEEA 3K70D 1OT3A 2ZQ5A 3T15A 4KBGA 4NYJQ 4PHGA 4EPRA 2C95A 4FINA 2CVFA 2D4HA 3IPXA 4U7DA 3QY0A 1WA5A 1OF1A 3HP1A 4LBZA 1S8FA 3VFDA 4AURA 5HR5A 2KBFA 4FW9A 1ZC3A 2J5XA 4L9SA 4JSTA 2CE2X 1Q3HA 5AJVB 1OIWA 2RGEA 2WPDA 3THYA 1NMZA 3PITA 4IVRA 5KO2A 3NHBA 4JL5A 2IUSA 2J9RA 1EK0A 2VA8A 3AVUA 1NKSA 4ZDKA 2IS2A 1SVWA 3K9HA 3ZVNA
chains in the Genus database with same CATH superfamily
4UM9D 4PPFA 1QHXA 5D5QA 1KYVA 2Q2QA 1QPBA 5EP4A 2QUBA 4CIBA 1BWSA 5K6AC 1NXOA 4YNBA 2RCYA 3S5JA 4JGGA 3LX4A 3P9NA 5JISA 4YMVA 2CUZA 3OIUA 4DQ0A 2O3SA 2W6JD 1MAAA 2CK3D 3ENNA 4U5XA 4OX9Y 3DF9A 4NTZA 3BCHA 4NZ9A 1IJEA 2AJBA 3A1TA 3ZLTA 7ADHA 3BYZA 4MCIA 2IUEA 1VJGA 1P5ZB 3L6DA 4I4TF 4E5UA 3T1OA 5LOVB 4DA4A 2BR4A 3Q98A 3CG4A 4GYKA 1SKMA 5FA8A 5FLYA 1A88A 2EF1A 2JI9A 1CYEA 2I80A 5LBUA 5ULLA 1Z45A 3QWAA 4G23A 3OWOA 4OSOA 1KC3A 3HMQA 2MCFA 1HQYE 1SKUA 2BBTA 2CXHA 2O7RA 4PLTA 1C8BA 2ZB3A 2ZI9A 3D6NB 4UDXX 3LIPA 4WT7A 3ZCSA 4DYDA 4C2TA 5CM8B 3WLAA 3OU6A 2CL5A 4W6ZA 3ZY2A 2PS3A 3E9RA 1N3LA 4BRWA 3ROMA 5DGDA 3SSMA 4OAPA 3A2KA 3RBZA 1QX4A 1C0IA 1A5SB 1P7ZA 3LP6A 3UB2A 5JSFA 1Z63A 1JG3A 5SYMA 3VHLB 3NYWA 4YO7A 5A7FA 4L02A 1YK1A 2O59A 3REOA 3V1NA 4HNVA 4DYVA 3B1KA 1PKXA 1T3GA 5KVCA 1NL3A 4WI1A 5E95A 3DPIA 4FT4A 1NJ1A 2WWRA 3ANNA 1LZKA 3N6VA 3QMMA 1XDSA 1HDZA 3C4QA 3M1IA 2JANA 3QVSA 4NDAA 2VEOA 3F4KA 3N28A 3Q9LA 3X44A 1PLLA 3O8DA 3ADPA 1MZVA 1U90A 4AVYA 4C1NA 1O6CA 5C34B 3U16A 4Q4DA 4EG1A 2H0RA 1L7NA 1AF4A 3WO1A 3MJEA 1GPMA 4D4HA 4TRJA 3OIWA 1BDBA 1EGVB 3RYFA 3VMMA 1HOXA 4HX2A 2FVXA 1YE3A 1R1DA 4L5AA 1R4AA 1KY3A 4LNUA 4A0HA 4C3UA 2A1TS 1Z5OA 2PXCA 3O2QB 1RBQA 5DU2A 4R83A 3VBEA 3VC3A 2VKTA 2I6SA 1CUBA 2V7VA 3D9QX 3EF0A 4MB0A 2DSTA 1SIOA 2DJ5A 3GT4A 2PTGA 4URZR 2BBOA 4QU9A 1LWNA 3F9RA 1KOGA 2K7ZA 3BD9A 1XNQB 3CSSA 1FDSA 5B6JA 3OZXA 1GQRA 3V1TC 3I32A 4UHDA 5DW3A 2NOAA 3CX4A 4LQCA 1MMFB 5JZOA 1TF5A 2OO3A 4WNAA 2PK3A 4L74A 3NHSA 2NG1A 3T38A 3ROTA 3LECA 1O6BA 1Y5MA 2O8BA 4DCJA 3EC1A 1ANKA 1VL8A 4KQGA 1PFWA 4IMRA 4C06A 3OKCA 5CW1A 4LI3X 2R4QA 4PNZA 5CHYA 3PTLA 5FAXA 3FMVA 2W5UA 5CH5A 3UA4A 2BW0A 4X1KA 3WYCA 3K70C 2C7QA 1UQUA 2R68A 4ESHA 2YYZA 3QLTA 1PJCA 2E4XA 1V1MB 1ZD2P 4YLEA 1YDHA 2J4CA 2A0KA 2FWJA 3KQQA 2WUDA 4R7GA 5KC9A 4Z4FA 2PUFA 4ECEA 5JO9A 1OXVA 2CHUA 2A5LA 2P4QA 3GF4A 3H13A 4FUQA 3GN1A 2VDNB 1IY8A 3RDPA 1MT3A 4B2IA 1V16B 3Q2IA 5DB4A 3QXSA 1SFRA 4J7XA 3AY3A 3O2JA 5ESXA 4TTVA 3A2MA 1G7CA 4K2HA 4ZEXA 1KE2A 4GP7A 4F4FA 3UQYS 1LVUA 5L51A 4I3HA 3ABQB 1J2YA 5DHRA 3VNRA 1VRVA 3OCCA 1C3OA 5AM1A 3V48A 1Z2PX 4IOLA 2WJHA 5IK2A 4ZQHA 4K9OA 1JHAA 5ALXA 2OXCA 3TINA 4PG6A 2ALJA 3EXIA 1G21B 3A7DA 3H1BA 1ZP6A 2F8LA 3KDAA 4HNGA 4OP2A 5CXXA 3NEPX 5ALNA 4YIHA 5F9FA 4KQCA 4JLBA 2Q3JA 3KSDO 4CBVA 1QS0A 2YWCA 3G82C 1OFHA 1JPNA 1QHNA 3MAGA 3DEAA 1RLTA 2IHVA 2VF4X 3MJRA 4UU0A 5FBZA 3ICOA 1GU7A 3MQ4A 1C8LA 5DFAA 2JGRA 4N9QA 4D4MA 3IXQA 1PD0A 2VNJA 4Q4HB 1AMNA 2HPVA 4XGRA 2M32A 2XRYA 4DV3B 1JAIA 1DEOA 1AGRA 2VSFA 2G7MC 1KO5A 3IEPA 2X4IA 4XSVA 5PNTA 1YL5A 3OX2A 4IG9A 4RJLA 5IYZA 1IDOA 4GI5A 2WKSA 3T3NA 1YI1A 1U7DA 2BFEA 2IOHA 1T0PA 2QS9A 3AI7A 4JUAA 1KEWA 1M1ZA 1FX0A 3CUYA 1J0DA 1WVGA 1OGJA 3F97A 3FYHA 3LWNA 3SSAA 5C5EA 3TGLA 4PW0A 2AFIA 2HZBA 2W71A 1K08A 1DKPA 1ZWKA 1DTWA 1C7JA 3EWSA 4IIEA 3NTOA 3I6MA 3F5MA 3HGMA 2IXAA 4MPDA 2YVQA 4RVSA 2BJWA 4RFSA 2Z5LA 2V0NA 4JEHA 3IRVA 3LSYA 3UMGA 4D9KA 3UMJA 5IZ4A 3WK4A 1ZFNA 4CMCA 4JLDA 4D42A 4GP6A 1JIIA 3DMHA 3AY0A 4JXJA 1E99A 4IIBA 3TQHA 1ORTA 2V45A 4RADA 2PS1A 2ZJ2A 1B0UA 2ORWA 4I50F 5DSTA 3ZS8A 1GD1O 1HRKA 1OI2A 2EZ8A 3U60B 2Q50A 3ND7A 1CUGA 2JGKA 1A82A 3INTA 2FMHA 3LBNA 3QI2A 4ALMA 4BE9A 3GP5A 1WPXA 2GYVA 1DC8A 1T3SA 2VS1A 3PC6A 1I14A 3BB3A 4DNXA 3LQ1A 2HLHA 1E2JA 1W6RA 1KMNA 2V96A 4GVLA 3E8MA 2CUNA 4FYJA 1PD1A 2R1TB 3D3QA 2VHTA 3DWIA 4J2OA 5C4GB 1BCRA 1H2FA 4NSNA 5JSUA 3KQNA 3EDRA 3ZYZA 4TGLA 4DM4A 2DEUA 3C3YA 1YZUA 3FUTA 2GCNA 4CM4A 3J80A 2PO7A 3M82A 4R5HA 2IYFA 4JVLA 4R9RA 3GPLA 1G42A 2VK8A 4PZEA 1G9SA 4ALIA 3HBJA 1E1LA 4QGBA 3THOA 2F4VB 1JLRA 3WNZA 1KGSA 3GT0A 3TFQA 4QLBA 3TF5A 2KPOA 5EIAA 3GJ7A 1YR3A 3A25A 4A2WA 1WXQA 1N2JA 2D3TA 2IZOA 4B7XA 3QP9A 3AVQA 4Q1FA 1KI9A 1SVIA 5SY4A 3UOWA 1Z8DA 1T5BA 3HEBA 1IM5A 1ECCA 2OAEA 1YO6A 3IPRA 3OQOA 5DN9A 4R0MA 3BL8A 4HLUA 1DQYA 4ZWNA 4F97A 1HLGA 2E21A 4IGIA 5HFJA 1MZPA 3AV3A 1JI0A 1RZ3A 2YINC 3JARB 4QNNA 3I1FA 5KTSA 1OAOC 3OFKA 4INPA 4ZI7B 1DAIA 1NNI1 5GONA 3DMNA 3L7NA 2NWQA 4OI2A 4Q3BA 2WNHA 2RKBA 3FDZA 1TO1E 4C3OB 2EZ9A 2XMBA 4J29A 3MELA 4CMIB 4DQVA 5AW5A 3ICWA 1F51E 3K16A 3KKZA 1LLDA 1O6ZA 3OM9A 1W49A 4HNAA 1EZZA 1E0DA 4P5PA 4BX9A 2GHRA 4FFPA 4CL3A 5IXJA 2ODEA 5IDVA 1RAEA 3BHMA 3HJUA 4X94A 5GOTA 1P60A 1XLWA 3QW2A 3H1FA 2QRVB 2VHUA 1FVOA 3N2GA 4IMPA 4LYYA 4RQTA 5CB4A 3D3JA 2CDNA 5BT9A 2VATA 4L6IA 3QMVA 5H9WA 1FUKA 3QVVA 3LJKA 4D4LA 4KNYA 1SUSA 2IIPA 1RXCA 2YMMA 3B5IA 3S6JA 1G5QA 4N8SA 4BFVA 4YUZA 4RHYA 5JPIA 4F04A 1I5OA 1E1QA 1JEJA 2VPPA 4TS3A 1DIRA 5G0VA 5F1YA 5BYKA 5HTKA 3UJ7A 1XRNA 4JI3B 4DVGA 1TE2A 3ZW8A 2QT0A 1XU9A 3OCWA 5ITZA 3EA0A 2Q8QA 1X7XB 1SUFA 2MINB 4P92A 4TLDA 2JFXA 4HI0E 5IH3A 1D2RA 2CN1A 1CERA 4G1CA 2DCUA 2CV1A 2BZ0A 3BWMA 2WB4A 3PXAA 1TMYA 2DHEA 3BMQA 5C5CA 4OQEA 4PC6A 4J8PA 1B23P 3WL6A 2BM8A 5BWCA 3ONDA 4IMJB 3EGEA 1SQ0A 4H7IA 4KVZA 2PKQO 3SYRA 3AG5A 1LSJA 1UL1X 4KUGA 3IURA 1Q7BA 2H7YA 4OG2A 1SCQA 1T0BA 1L5LA 3ER8A 1IQPA 3IEXA 1ZPDA 2BI8A 4FFOA 3PSHA 3QV2A 2VPQA 5DHTA 1JIUA 2KX7A 4ZI7A 5BN5A 1Q2UA 2PRYA 5DM60 2FN4A 2Z3VA 3UICA 5AQ1A 2OOSA 1SELA 5IVIA 1RRCA 1A9OA 1NULA 2EGUA 1X38A 3EZNA 3HWRA 5L45A 5BVGB 3IEVA 4MRVA 3KJZA 4D41A 5CDSA 1II8B 4K88A 1VE5A 3EMKA 4PHFA 2BFEB 3EIWA 1YR9A 4GSKA 2I34A 1YA8A 2WG2A 4P82A 1QLJA 4JYMA 2AT1A 1AKQA 4RD2A 1PZEA 1U8FO 1GZUA 1Z73A 2QK4A 3R77A 1NJ6A 4ARIA 5A5EA 2R6AA 4RMHA 2X0DA 1ZRSA 2PLNA 3P20A 4BKMA 1U1GA 3UGQA 3O1HB 4H1TA 3AZQA 2PGNA 1Q95A 1UCFA 4RAQA 1MJ5A 4YRLA 2JLCA 3NAZA 4ZCPA 2PKXA 3RJTA 1NXPA 1VKHA 1GQYA 3GRRA 1A8IA 1XVTA 2OL4A 2B4KA 3E53A 1ORWA 3IESA 2BISA 1P0FA 1VOTA 2EAUA 2JIMA 5BVHB 5KOHA 5JTTA 4DR3B 1GILA 1SRQA 3VO2A 1UH5A 3D54D 4JT8A 2R8XA 4DV1B 4RCYA 1T3LA 3K6RA 3JVVA 3DZFA 1WZ2A 2VPTA 2GHQA 1GQ2A 3B1VA 1Z4KA 3ORRA 5K01A 3CTMA 1CUAA 4D9CA 3V7WA 5G41A 3U5ZB 1TUIA 3DVQX 2FLVA 3FYUC 3I9FA 3Q88A 3JQAB 3ZQJA 1CR1A 3WGUA 3K5WA 4DDHA 2Z2IA 4UUNA 4HBGA 1PQ4A 3GYGA 2CXSA 1Y1QA 2O1SA 3I01M 4C5AA 4AZ0B 3GROA 4Z2YA 3MA0A 5EIFA 3AUTA 4HBZA 4F1WA 1IWOA 3FNHA 4HQLA 1GUBA 4ROTA 2OA0A 2VRBA 5CBPA 3HXOA 1UR5A 3B38A 5IP5A 4ID9A 2HHHB 1A04A 1FE8A 4E1VA 5C51B 3KLPX 1NXQA 5DULA 4BPRA 1EE2A 3DR3A 2W6OA 2Z57A 4PPNA 3G6WA 3PZRA 3RVLA 1RVDA 2JJ8A 2JPDA 4DIBA 1WULS 3UYLA 4IZOA 3CISA 5JS2A 3WGMA 3IAM6 2QZZA 5FYQA 4GGOA 1VKOA 2WM8A 4RJJA 1L4MA 4EYOA 3CM0A 2AYZA 3FHOA 2AA3A 2XA1A 1CCWA 2FPLA 3LPLA 3MWLA 1J07A 3CW2A 3WTCA 4UTNA 1Q21A 1U1EA 4IHJB 4GYYA 1GEEA 4GOMD 4MR7B 1SNYA 4EVQA 2ASVA 3PX2A 2B20A 4GR5A 2IJGX 4IYRA 1VJCA 1BDIA 3X3HA 1LSSA 2Q07A 3M49A 2B37A 3R5TA 5EE1A 1GNPA 3TIFA 3F6SA 2YWEA 4WKPA 1P2UA 1L0BA 2W6QA 1EYZA 3BF7A 4ZK2A 3GMIA 1E1MA 2O8NA 3PA6A 1IDN1 1QC5A 2X7JA 2FZVA 2L18A 4K9NA 2LW7A 2EXXA 4PSUA 4FHFA 2NQTA 5AKHA 4RJTA 1C30B 2XQKA 4YRSA 2C2YA 1DC3A 5AJWA 3AM5A 3F47A 3K9NA 3DV0B 2QIOA 1YZHA 3B85A 5HQJA 3OX1A 4IIHA 1SD2A 1TM1E 2J9GA 2WAMA 3EYWA 3GRPA 4QYTA 2LIVA 4XASA 5KNBH 2IU4A 4XJVA 4C4XA 2CXNA 2L82A 1EFPA 2B6HA 3DTYA 4QPDA 5TVGA 1DJQA 1WZCA 1I9GA 4R1OA 3SVZA 3NT4A 1PN3A 4QWMA 1Y6QA 1OROA 3KJIA 3SC4A 4EPTA 3IAAA 4YHBA 3CWCA 1QGOA 2D7JA 2X8JB 3D2BA 3FRHA 3DE4X 3HP4A 4XJTA 4F5WA 2J67A 3DAGA 4ZICA 1FPMA 1OZHA 4I1YA 4GMDA 1Y3CE 4OM8A 4XVUA 1N2CE 3L0CA 5JMPA 2P4UA 1HPLA 3EMDA 4MDHA 3HCWA 2E37A 4N40A 4NBSA 5THXA 2XTNA 5CT6A 3TRIA 5ILQA 1HTBA 3OHMA 3T3EA 3I1YA 2Q9UA 1UADA 2R8EA 5T41A 2NU9A 4H35A 5CAEA 3HTXA 4O3FA 1ZZGA 1LS6A 3C3JA 4IDGA 4CM8B 4DAEA 1GVNB 5CFRA 3I2YX 3PNPA 5LIPA 3VDMA 2D1YA 4ND2A 2BRUA 5CVVA 1U8XX 2J5KA 3ADDA 3ADKA 2GETA 4BO4A 3VV3A 3P27A 4NBWA 1KMHB 2F3UA 4M89A 2VYVD 3IUBA 3VPCA 1YQEA 3CR8A 5HK8A 3DM5A 4L15A 3WY9A 3GZNA 4AUKA 1UP6A 2QP4A 3IVRA 3FW1A 3GELA 2COEA 1OWOA 2D2XA 2HMUA 3DDUA 3X1YA 4LSGA 4MWGA 3ZIAA 4CQLB 1G8JA 2BTQB 3GWZA 4TVOA 4FR2A 3UUGA 1ADGA 5ESDA 4WJLA 4IXDA 2QN2A 1D7AA 4AN4A 4TYNA 4YLGA 2X0IA 4ZP1A 1ITZA 4OXIA 3PFBA 3DHEA 5MGNA 4FW8A 4JOCA 1L9XA 1ZUNA 2NV2B 4Y7DA 5EUQB 4F9EA 4QKQA 2BFCB 1U3FA 1E89A 1M54A 4G3XA 2IY7A 4FGUA 2DUJA 4EG7A 2GPTA 1DZIA 5BSKA 5FUVA 3DZJA 2KS6A 1O77A 2WC1A 5I9BA 4X1IB 1DDGA 3AR7A 3PQ4A 3QRWA 3OLVA 3BZUA 2PHZA 5TEWA 3U26A 4PSDA 5A4DA 1KOFA 5AVSA 3AHIA 4TV9B 1C9JA 4G4JA 1XRMA 3HI6A 2HGZA 3NYRA 5H9VA 2PMKA 1J00A 3K9CA 3R41A 3QPCA 4ZPJA 1XU7A 5THQA 1DTSA 2FP4B 5ER9A 3ZG6A 3JAKA 3KQWA 3PEWA 2C3YA 4PXSA 3SJBA 3DXZA 5KSZA 2E82A 8OHMA 3NASA 2CFTA 4NCAA 3H4VA 3IDSA 1HE8B 1W5TA 2YYYA 3G8DA 1F7UA 2ZBUA 5MN5A 1DG9A 1VE6A 4MH0R 1SXIA 2VNHA 4E7PA 3UENA 2OQVA 2P9QA 1OBHA 2PZEA 3OIDA 1VHTA 2HUPA 2A9PA 2WFLB 4YUYA 1CBUA 4TKZA 4WHMA 4ZIRB 5J4KA 5KTYA 4LF5B 2ECFA 3A6HA 3WNVA 4QOFA 4RA6B 4ETMA 3IC5A 1KMQA 2EDAA 2VPIA 2VH1A 4G2NA 3ETHA 1ISFA 2QM3A 2C9DA 3MBOA 3DHNA 1G59A 2NQ8A 3I64A 4HH0A 1DQRA 5G3ZA 3RSCA 1G19A 3DMGA 4DUGA 3CC8A 4YRPA 4FYPA 2WU3A 4YJ3B 1JMYA 1WE2A 2NZVG 2AR9A 3EFBA 3GVIA 1YMQA 2WD8A 3QENA 1OLOA 2YY5A 1FP1D 1I7SB 5LQSA 1Z5PA 3KOXA 4O2BA 3TLYA 3TXAA 4EGFA 1Z8HA 1QWOA 3TQIA 1Z08A 1J8QA 3LYAA 4YXWA 2XXAA 4AO6A 3IA7A 2VLIA 5CYOA 5LZ9A 1O87A 5SICE 4C4AA 1NTRA 3G8BA 2J0QA 2OGZA 3F2IA 2FKAA 1YJAA 3HZOA 1XLUA 4ER7A 2IDJA 3M3PA 3OQNA 1P75A 1V5GA 2O3UA 4MS1B 3DAYA 2GM4A 3ZWAA 2HF2A 3Q8XB 1G6HA 1AK9A 2YWJA 4D4JA 2XWQA 4FZRA 5BSRA 1F5SA 1K92A 3B3GA 3ZYCA 2WU4A 4ZHSA 1KGDA 1MJNA 4Q9IA 4ERXA 2RGGA 5TQVA 2JI8A 5LMNB 3KUCA 3H2GA 4AYXA 1OX5A 1ZVMA 2OLKA 2PMCA 3OUZA 4BJ6A 2QE7A 3BMOA 3EXFB 5DGCA 3ETLA 5AFSA 2OHJA 2A9RA 3I8XA 3EZLA 1ZBDA 4TV8A 3IXLA 4UHKA 4ACAA 1SRRA 3PQEA 4QBIA 1KI6A 3PUVA 5T4HA 3LT5A 2NW6A 2GESA 3T7EA 5F2NA 3MHTA 2FWNA 4NLLA 4LJLA 1XVUA 2ZRGA 3A26A 3WS7A 1E2EA 3HVIA 3JYHA 4BCDA 1G17A 1MC4A 2ZSJA 3GFFA 4W5HA 2ZITA 3CSDA 5DHAA 5HBRA 3SI7A 2WT8A 2Q4BA 1D2AA 3K5HA 1EM6A 5DYGA 1D2HA 3YASA 1JGTA 4N8DA 4QLOA 2ZVDA 5E3JA 1USKA 4JI6B 3U39A 1RLOA 4BB6A 4G1BA 2PJDA 3GRKA 1RP7A 2A9VA 1RAIA 4J2TA 4OHWA 5LJLA 4FYIA 2G70A 2W2PA 4BN4A 2CBGA 4FBMA 4PIVA 4K46A 3ANYB 2J9ZB 2ZJFA 2YZMA 2ZWPA 1CY2A 1GLNA 3F90A 1ZM3A 4XJSA 2CF6A 3FYCA 5ECWA 5HKBA 3DL7A 1Z4JA 2SECE 4FYMA 1R4MA 3B1FA 3WJAA 1H23A 1U0NA 4D99A 1ZRMA 5LP6A 1XKQA 2IOFK 5D87A 5BSUA 1XO1A 1A98A 1M2NA 4G1EB 2NU9B 3RJ9A 3V9AA 5A4JA 3SD7A 3JD4A 1PV4A 4NH4A 1FTWA 4CM8A 1JDBB 2H0QA 4E32A 1DE0A 1I4EB 4MS1A 4URFA 2MDTA 2ILTA 2Q9AA 3VTZA 3MTDA 4BFCA 2DSNA 1Z4OA 1D2GA 2ZEJA 5E1OA 5J43A 1TTHA 5TGTA 2NQ2C 5KYWB 3ZD6A 3U7QA 5FORA 3BILA 5FP0A 3VUFA 4M1KA 1RTKA 1JVSA 4IIJB 4AJPA 1OWNA 2DWOA 5FDFA 2CHQA 2R47A 3DMRA 3ESRA 5DOZA 2M6KA 3WMGA 5C8YF 2HSJA 1PFGA 5BOSB 1CQPA 1RKXA 5AIBA 1UT5A 1YJBA 2J33A 4MS4B 3IT1A 3IAFA 3R0XA 3RHZA 3GJ8A 1J0XO 4N01A 3RRYA 2B9EA 2UZ4A 4NMMA 5HS6A 2FWMX 1KF0A 3AI1A 3CHYA 4OMUA 4RDIA 4X1KB 3GLTA 4B4KA 3FPJA 1SKBA 3WNQA 1F3OA 4Q7KA 4YA6A 3NUGA 4L5YA 4YDRA 4QRIA 4LYGA 3H97A 4YP5A 4MB2A 3AR6A 5JZSA 1OFGA 5BN5B 3V7UA 2J7KA 4YCJA 1MV5A 5J3JA 1HE4A 1QV9A 4MVJF 4A26A 4M1SA 1YVDA 3HG7A 3WLJA 5J2UA 3W7BA 2HBQA 4QNMA 3UB4A 1EVKA 3QXJA 1GARA 1V26A 4IDEA 3KL2A 4L8GA 1WMDA 2H00A 2IYYA 3O8NA 5DX8A 3EN0A 1QBGA 1X1SA 4OHYA 4JHLA 4O4JF 2PA3A 2WAYA 4NZZA 1EH5A 4JI2B 2EFEB 1HUQA 2WD7B 3IHTA 3DBRA 2RJOA 2OFWA 4TX1A 2ZBDA 3S44A 3O74A 1HT2E 4IYJA 3RGGA 3V32A 3K2EA 1OHHD 4RD1A 4WJKB 4BV3A 4DVJA 2R48A 3N0RA 1WXEA 4BNMA 1Z5ZA 1ZHHA 2GEFA 3ZGXA 1VKNA 1X7HA 4MUMA 1ZH8A 3TZKA 3S7ZA 1V4VA 4QTTB 4ENSA 5KWEA 5HW0A 3WGLA 1TL7C 2HD4A 2RHHA 1CETA 4A2PA 4FZ3A 1V3VA 2QTVA 2JS7A 4CIWA 2A9QA 2XWSA 2ZR8A 3B1YA 4TMWA 4B9EA 1CFJA 4BLSA 3WYGA 5KOHB 4LV6A 4ER0A 3OP1A 3L7KA 4GOJA 2HF8A 3HDQA 3KUDA 1COWD 2A4MA 1MB3A 3LH5A 1S8AA 3AJ8A 1L9KA 4B6PA 3PFHA 3AP3A 3AY7A 4MRMA 4Q4JB 3TR0A 1E2QA 3RH0A 5HWSA 1H6BA 1YAHA 1P2SA 2QP9X 1F0NA 2ZT6A 3BVPA 2AI3A 4MQ4A 4BBJA 4CYMA 3L4KA 3AVTA 3ETNA 1TF7A 4HTFA 2ONZA 4IFTA 2RGXA 4BFYA 2P2YA 4X0EA 1RPNA 1OFVA 4RMNA 4DR7B 4MQBA 1TYZA 3KXPA 3I37X 4WFIA 5FEMA 1YZGA 1H6DA 4Q4AB 2FB9A 2DT5A 4PTZA 2BJVA 4V0NA 2XSZD 2BM9A 3MS4A 4G4SO 4PZ0A 1B15A 3OT1B 5DJ5A 1K7FB 3EEFA 2WU8A 3UC9A 3KD3A 2GF2A 4L7VA 4WKBA 3VZQA 1NBOA 5A05A 2Q7XA 4MYDA 3MCZA 3TLMA 1MABA 5A5VA 2YY7A 1HDOA 4OSEA 1R7RA 221PA 3IKVA 4F91B 4LC1A 1HE3A 3E35A 4ZVKA 1LFAA 3INRA 3TMAA 4ZN6A 1UMKA 3EXG2 1F1BA 1PVDA 2AFRA 1A9YA 4WZAE 3K96A 5J59A 1FQJA 2WI8A 1JU9A 3ETGA 3M5DA 4RY0A 5BR7A 5G0WA 2OMEA 2IV2X 1QGUB 1K7EB 1M0EA 3IMGA 1WCYA 3AKEA 2JATA 4N0EA 3ZI7A 3USZA 1E0JA 3GJYA 2W90A 1IL0A 3OESA 3QVKA 2RBEA 7GPBA 4N7JA 4I19A 1UWLA 1CQIB 3P45A 5E3HA 3IUYA 1VBMA 2WTNA 2OV4A 3H6HA 4R3NA 4TV8B 1KI6B 1XPRA 5AKGA 1Y6ZA 2B4RO 2IITA 1GRQA 3CVOA 3ELDA 3D0KA 4RF5A 5REQA 5DO9A 3UMFA 3UHAA 4NCIA 4WZAB 4QTZA 1M2JA 2WYUA 2PT9A 4PZZA 3URKA 3PF9A 4GEKA 1RCFA 3OOSA 3DV0A 5JASA 4PX9A 1NI3A 3U62A 3SSOA 4EKEA 3OZRA 3T5TA 3UT0A 5HTOA 3UZUA 1LW6E 1XXHA 2BH9A 4UXHA 2QG9A 1QRAA 3M4ZA 4MB6A 1GJRA 4G9BA 2O7SA 4KWTA 3CURA 4KE6A 5EQDA 3ELBA 4DIOA 1EFRA 1QRTA 2VBFA 3EVNA 1NVWQ 2H63A 4AUNA 2VOEA 4DDVA 2P4HX 4DZRA 4DIDA 5EE0A 5JALA 5F9HA 3IDFA 3QBEA 4OM7A 2AOUB 2BTOA 1JEDA 3T06B 3DLAA 3EY4A 5JECA 4JXZA 3DLTA 1VGVA 4GD3Q 1WV0A 1MJGA 4S1PA 3H5RA 1C9NA 3EGCA 5D3MB 4CCYA 4KBFA 1Q0LA 4K6GA 5FQNA 3F74A 3WK5A 4YN3A 1FRZA 3IV7A 1M6VB 2XMCA 3ZGLA 1U0TA 3HJNA 1Z88A 4RNDB 1QSGA 2ZRHA 4QFCA 1XJ5A 4DJJA 2QN1A 5AICA 3QFCA 4Q7MB 4UDYX 2A1IA 5EXEA 2NZJA 2RG1A 1V8DA 4AQYB 3AEXA 1FJHA 4ZU6X 3SXUB 2QTGA 3ZOZA 1LXCA 2H7VA 4UFOA 2B0JA 2F2TA 2PA0A 1UUFA 2D5IA 4B3XA 1N6LA 3VR6A 4HGZA 5K0BA 3N8DA 4A6PA 4K9SA 3NHZA 3FOCA 4ND6A 3CLVA 1IXYA 5KBYA 4Y2GA 3DL0A 3MTEA 4U2GA 4TMXA 1OI4A 1XZPA 1GUYA 4D9JA 2PKWA 1NG1A 3U4IA 1DT3A 1BQEA 1I6KA 1RSZA 3FPGA 5GZ6A 2CDBA 2Y0CA 4TKVA 2FEWB 3EVEA 5IKEA 1XEWX 4KIUA 4YJDA 3CW9A 3SMVA 3P2OA 4E5MA 4QQKA 4QXQA 1FCJA 2WJJA 5BSMA 3ST7A 5BSWA 2FZGA 2G40A 1D8TA 1YZYA 3OUUA 4WDRA 3UOAB 2IHUA 1SKAA 3G5TA 3W8NA 4M9QA 4RESA 4LRQA 1QVVA 3PJFA 2H08A 2YV5A 3WYDA 3U6BA 1AKVA 1ENYA 3VPFA 1VE9A 1YMVA 5EOVA 4L2IA 4EITA 3RYFB 4XM2A 1Z0AA 4KSCA 2DGDA 1UBHS 2GKOA 1JEOA 1WPGA 1AUQA 1TKRA 2UZ1A 2X9QA 4LDQA 4A16A 3GUVA 2FX3A 5FOTA 1UT8A 4NDZA 3KJFA 3V8MA 1KPIA 1YDFA 1GA6A 3GDHA 4MWOA 3OBIA 1ACLA 1W0KD 4OHCA 1IVNA 4R1QA 3OLXA 1MOPA 5AW3A 4HG2A 5EWMB 5TE9A 1JIQA 2QYTA 3KOUA 5EEHA 2H3EA 4OKIA 1CNFA 4PGAA 4PLFA 4PYRA 3Q7QA 1SIWA 4F2DA 4HJXA 5J5VA 5KTRA 1Q7EA 3DXYA 2BE9A 2CYBA 4K0RA 3TIXB 7MHTA 1ZX1A 2IOQA 3HU1A 4Y18A 2IY9A 4TQAA 5C1BA 2GKGA 3MM4A 4R1MA 1HFJA 3A6GA 4KO1S 1INLA 1QE5A 3IBCA 1US8B 3WL7A 4ZYVA 2LGJA 7MDHA 2BGWA 3IBFA 3EVAA 3AV0B 5F33A 3FPHA 1SHZA 1ZI6A 3BUSA 3BRSA 4QEZA 3JD3A 1YULA 4ZOBA 3NS7A 3A2NA 3BRWA 3EIFA 4ZYYA 2V1UA 1WXWA 3H8JA 2BLNA 3FJOA 1G3IA 4E5YA 2IUFA 1YNOA 2AG5A 1C9EA 1QFMA 1XDUA 5CB4F 2ZYRA 1KP3A 3FFAA 4BJ3A 5KDOA 3B48A 1OC4A 2A67A 2H7XA 4B82A 2HT1A 1PGJA 4RETA 3QIAA 5EJ4A 2UZIR 3WFZA 1B0PA 2YUTA 3JQGB 2ONCA 5BSHA 4JN6B 1VLQA 4Q9HA 4B8WA 5B7QA 3DOIA 4E4YA 4FFVA 3DGEC 3MC1A 1X2BA 4XQGA 3RYIB 3C15C 1ODTC 1T9BA 3GPIA 5AIAA 3TR5A 1Y6FA 4DABA 5HX7A 4CETA 1BKSB 1VC2A 2CHVA 3ONVA 5JG7A 3FHTA 2Z6UA 5BNZA 3LGSA 4LF7B 4AY3A 4F4HA 3PXDA 4MIYA 3VR0A 2V65A 2E48A 3TL3A 1Y8ZA 1YKSA 2XB8A 3O82A 4RHUA 3SEAA 4AMVA 1VIAA 4J0JA 3SYKA 3WYAA 1DRJA 4J6FA 1NW7A 2RKOA 1EINA 2Z08A 3TL6A 4BNZA 3I9JA 4YRGA 2XKKA 4PCLA 4M87A 4RVNA 4RDXA 1KP2A 5E9AA 3D3NA 4ONEA 4BAGA 4EI7A 1QGAA 1QRRA 1ZQ9A 5EMNA 2GT1A 3ZE0B 3JX9A 5J40A 4XZ3A 2R5WA 3MJCA 2JI4A 2XLCA 3Q87B 3QYPA 2BSQA 3NVKI 1GCIA 3EEYA 5ALDA 3THWB 5C46F 1MOQA 2IU6A 4TXJA 3KUUA 5SYAA 5CLGA 3B82A 5TQ2A 2EYUA 1NJ5A 1SUDA 2GERA 2H2AA 1NFQA 2PWBA 1M6HA 4I5EA 1PGNA 3EHDA 4H6XA 5GGXA 3FUVA 3UM9A 2B99A 1MP0A 4OQYA 4YJKA 3RQSA 2EBHX 1CK4A 4HPXB 2P9JA 3KQMA 4OGLA 1YRWA 3A4LA 4X44A 3LBFA 3U80A 4C7VA 4E5PA 4Q0MA 5FWAA 3MFQA 3VR5A 3PC4A 4UBOA 2JF0A 1RQXA 2B3DA 4XOIA 1RXWA 3OZIA 3VPDA 3HCDA 4MJ3A 4R9SA 2RH8A 1X94A 3QEMB 2IC5A 2NAPA 2OBYA 3EXHC 4B4UA 4FE4A 2V9CA 4FE3A 5IWAB 3BWCA 3GJ6A 3KPWA 2WKPA 1Z16A 1Z83A 5L7YA 3AZPA 5JY6A 4EH1A 3U7IA 1JILA 4P3NA 4QT0A 2J09A 1K0UA 3ESDA 1FTSA 4D3SA 2WDPA 1TTQB 4Z4GA 2DLDA 4HWRA 4M76B 3T1TA 4HSGA 5IJ0B 5CDHA 5CFPA 2ZT7A 2VQ3A 3K4PA 3MSXA 4PZ9A 3WQRA 2ZSHA 5DNAA 1ECFA 4IDFA 3AERA 2GGSA 2PAAA 3ZWBA 2ZRAA 5FJIA 1XTVA 3FF4A 1I32A 1JS1X 4NV0A 5AQEA 2HIMA 3S2IA 4PYKA 4RL6A 3C97A 4TPKA 5LU9A 1E6UA 1S3IA 3HCRA 4KR0A 1TD9A 1HYBA 4P1ZA 2HEIA 2MYPA 3UAGA 3Q7IA 1I51A 2NYRA 2P6MA 1YVUA 2PFKA 1JDNA 1V25A 1JSXA 2BDEA 3AFHA 3KLNA 3KYDB 4FDTA 4JUCA 5DNVA 5IM4F 5C1DA 3NO4A 4OYYA 2FG5A 2JFYA 3ROGA 1A8PA 2FRDA 1MB9A 1HXHA 2QYSA 3EQ8A 3EBOA 2QVYX 2PSEA 5CDUA 1E9BA 3LTNC 3GBVA 2P9EA 4P36A 2IP2A 3AIOA 4UOZA 4X84A 1KERA 4UCWA 1OXSC 1UWCA 2XMPA 3DZBA 1UOOA 3E58A 4LC0A 5B2FA 3NUZA 3AVVA 4CM6A 2CL0X 3EAFA 2R96A 1KMHA 2AK2A 2PX6A 2JRCA 4RKYA 3NEAA 1P3Y1 4YYEA 4CKXA 1ECGA 2OZLB 2WAAA 2HSZA 2JGLA 3C4JA 3QWIA 3RUEA 1EGQA 2DVMA 4G24A 2Z1MA 3FYSA 1KZ7B 1DSSG 1MQAA 3W1VA 2D06A 3GIDA 4FPXA 2IYZA 1QGZA 4DREA 2HK8A 1DAFA 4DMKA 1IM8A 1CUHA 2YY6A 3G2KA 4G0QA 1TB4A 3HU3A 1U65A 1XRLA 3LX6A 3N2EA 2OPHA 1RPZA 3NALA 2REXB 1IQRA 1WXHA 3PI7A 3WLQA 2P79A 4XVHA 4N12A 3RJ5A 4DLAA 3C16C 2ZB7A 2FPUA 1WXDA 1HE2A 4FDLA 3PHCA 4KCGA 1E3JA 3D5QA 1RHJA 2H1CA 5G4KB 1UBOS 1JP7A 4UTVA 3B9PA 3C6BA 1E3WA 1JQEA 4QPPA 2Y77A 3T35A 1BC5A 2IXBA 2PKQP 3GAFA 5E4FA 5AKIA 4P2GA 4V38A 3SS8A 4YRNA 1DFGA 2PT7A 2OHHA 1AHIA 3OEWA 4QGAA 3H7IA 2H0AA 5K3FA 1P4GA 2I6QA 1XMJA 2ZATA 3RWOA 2J41A 2IV3A 4YJ2F 5AD1A 4BYMA 2C7RA 5HUHA 3ZVKA 2HC9A 2Z8ZA 3LF1A 4C4SA 1SCUB 5EPOA 2OSVA 2R11A 4TS4A 4DMUB 2WUFA 2JCBA 2ISQA 4W1RA 2OHVA 1GKUB 4ENPA 1E7RA 1E92A 1IN7A 2B1RA 2EJUA 2ERXA 2FYTA 4ML3A 3SC6A 3ZH9B 2EWWA 3UMSA 2BHLA 4TMFA 1TCCA 2J9XB 4GKAA 2PN1A 3TLCA 1TJ4A 3VO9A 1I4TD 2B2CA 3ASVA 1QO9A 3WISA 1OW3B 1MV8A 4BO3A 4MEAA 3WWYA 4B2PA 2RK4A 1G7SA 1PO7A 1RI4A 4B34A 3QLVA 2EVWX 4X64B 1P7WA 3ZXUB 1ODFA 2IZ6A 2QLJA 4BNJA 1E5TA 4LJYA 2AMLA 3LTEA 4O4HB 3ANMA 3V7FA 1HSOA 4L95C 1BOOA 3RFCA 3OFVA 2RHJA 3A32A 4RY2A 2D0OB 4GECA 3GA5A 2ZVQX 4G1UC 5AK6A 1GZ5A 4YP7A 1DXYA 1E3SA 3FTPA 3DJYA 2V6GA 2IKSA 1P5RA 3HCFA 5G4KA 4KITB 2FZ5A 2INGX 5KOJA 5CM9C 1W93A 4HDQB 4RFVA 4QVIA