1LVGA

Crystal structure of mouse guanylate kinase in complex with gmp and adp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
190
structure length
190
Chain Sequence
RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIKKAQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the closed conformation of mouse guanylate kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 64
structure length 190
sequence length 190
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2002-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1lvgA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lvgA02
1W44A 4GFDA 4BLTA 1YZLA 2D7DA 1G8GA 1O3YA 3CX8A 3FFAA 3K9LA 3AP1A 1OT3A 2BBWA 4EPRA 3VR2A 3E1SA 3K8YA 2YVUA 2X2FA 3OIUA 4RD2A 1CR1A 4OI1A 4C7OA 1W5TA 2TMKA 2VRWA 4F93B 4KVAA 5FL7A 3KXIA 1G291 5TB5A 3O8RA 1L2TA 1G3MA 2CL0X 4G01B 3I92A 2JJ2A 5KSZA 1X1SA 3L0IB 4FI3C 3W6PA 3KKQA 2NO0A 1TEXA 2YOFA 3TUJC 2I1VB 3EXAA 4CRWB 5A4JA 5D3QA 2IS2A 1UFQA 3I1FA 2B8WA 3K09C 1OLOA 1N6OA 3SEAA 3U7EB 3VR4A 4MRPA 4A0GA 4BFTA 4ZCIA 1SHKA 2C78A 2P3SA 1FP7A 1KO1A 4S35A 4HDCA 3U3JA 2IYTA 3BK7A 5FR2A 3ZD6A 4BRWA 2H16A 3OESA 1Q3TA 2GJ9A 2ZE6A 2OO7A 1ZIPA 1GFIA 1D5CA 2C9YA 4JVLA 4YQFA 5JHHB 2DY1A 2MMCA 1HH4A 2IYUA 4TLCA 3FTQA 4MRSA 1AGRA 4Q4HB 2QMUA 2W2TA 4R2HA 3ADCA 1JJ7A 1UDXA 3QEOA 1E79A 4BWYA 2A5FA 4B48A 2R8RA 3ICQB 1M2OB 1R8SA 3DL0A 5EZ6B 2QZ4A 4P4SA 1KMHB 5E3HA 3VQTA 1SVKA 4JL8A 3W3AA 5BW8A 2V6JA 5LPNA 4LI0A 1JR6A 4PQYA 2HCJB 4IJMA 5GVRA 2QRNA 3JVVA 5HE9A 4MRRA 5JCPA 4L9SA 3H2YA 3LQQA 3TNFA 3AH8A 4KFUA 3EA5A 3WMFA 2EYUA 4RFVA 4BLPA 2F9MA 3WMEA 3GJ6A 4NYIR 4GP7A 4WVFA 1E4VA 1F2UB 1XMJA 3KB2A 4NBSA 4RZ3A 1AZTA 2JLXA 5JJIA 4Q9HA 3HR7A 1ZM4A 1YVDA 4PTLA 1XPUA 1NJFA 4U5XA 5IHPA 5G40A 3PEWA 2ZRAA 2QE7D 3L43A 3TUIC 2GJAA 3D31A 5HE8A 5CB8A 3IHWA 3RC3A 1MKYA 4QL3A 4CEJB 4OHZA 2BC9A 2DPXA 2B21A 2HUPA 5C2JB 3BXZA 2ZYUX 1SKYB 4B2IA 1TAGA 1LS6A 5LD2B 1FPMA 4OQMA 4P0TA 4C0JA 4RFSA 3IPYA 3RRMA 3KTAA 2OHFA 3WY9A 3PEYA 3CF6R 4NYIQ 2OLKA 1NL3A 2R6CA 5FH9A 1KK2A 2REXB 2JEOA 4IDOA 2ZJZA 5AR1A 2VBCA 3I8XA 1FQJA 2GXUA 1TQ2A 2BOVA 2FE4A 4EIWA 4AYWA 1LS1A 3W3ZB 3CR8A 4WXPA 5JWHA 1SVWA 2OCYC 3GEHA 2ONKA 1A82A 1Z0IA 1AK2A 4AYXA 4G5QA 1XTIA 3BH7A 3C16C 2IYZA 2J46A 2IXEA 4OK5A 5HZHA 1I2MA 3QVUA 2WJJA 1CRPA 3I32A 4D0LB 1KTVA 1GDDA 3L0PA 3PUYA 4R7ZA 1WQ1R 2GILA 4QJ5A 5C4MA 1KAGA 4LV5B 1BKDR 5AK0A 3SFVA 1I4TD 3VMFA 3W9YA 1YZKA 3ICEA 1Z2CA 2GAOA 1GL6A 3RVBA 1T8TA 1IM2A 2H57A 1L4UA 1Z06A 3FMOB 2H7VA 3WXMA 5AJWA 2F43A 3A6PC 2HLDA 3Q7QA 5FOTA 4IXMA 3OAAA 3LVQE 1JB1A 4LYFA 5FBLB 5GJWC 4KHZA 4LHYA 1G5PA 4LJAA 1DARA 1Z6AA 2PBRA 2ZR7A 1VCIA 5DH9A 4Q47A 3L8YA 5JEEA 1FNMA 1Z5ZA 3BB1A 3T61A 1EFUA 4Q7KA 4B3DA 5HR5A 2DWOA 5LD2C 3ASZA 4B33A 3QPVA 1AZSC 5EUQB 2WKRA 3P20A 5HTKA 5JWOA 5KUTA 1KAOA 5LDDC 4B75A 4TMWA 1SXJA 2CNWD 4RCYA 4ESVA 4US0R 1NVVR 3KQKA 3U60B 1II0A 3QOFA 4NCIA 1SKQA 1OYYA 5DNYB 1JQJC 3L0OA 5DYIA 1G20E 1XZQA 3QKSB 1S9DA 4QGFA 3NH6A 3REFA 5EJEA 1RRFA 821PA 4BFXA 2NOAA 2C98A 1TUIA 4XH9B 1DELA 2GTPA 2A30A 4B6EA 4PC2A 1S3GA 1DPFA 2QROA 1P9WA 1YHNA 1CJKC 4TSFD 2ZRIA 1LF5A 2Z83A 2ZJ2A 2F6RA 2P5TB 3B1XA 3KJIA 3QXCA 4FCTA 4A6XA 5HPYB 4BASA 1NSFA 1AM4D 2HJGA 3SNHA 4OQNA 1DAGA 4Q00A 5GJCA 3UWOA 3PJRA 4XOIA 1T3SA 221PA 2FFAA 1E2LA 4QOSA 2O8EA 1N0WA 4XVUA 2UVQA 4HB0A 4RSGA 1G5TA 1KI3A 4URXR 3FHTA 4PAOA 4MA4A 1XWIA 5GVSA 4TYWA 2G1KA 1A1VA 4B2PA 1GG2A 1SQ5A 4WBSA 1JAIA 2W0SA 4TMXA 4KBGA 4B43A 2AK2A 2D3WA 3B85A 4V0LA 2IXFA 4BEJA 2ZM5A 3EPJA 1P60A 3CNOA 4XWAA 1JAHA 5EE1A 3ADDA 4BFZA 2IEZA 3T15A 3SHFA 2B8TA 2YINC 2YC2C 1DAHA 3W90A 3VNUA 1WP9A 2WWWA 3O8DA 4OJKA 3GD7A 5CM9C 5KSPA 3QF4B 4JT4A 4BECA 1W36D 1S8FA 2RCNA 1IOZA 1F2UA 3OFND 4X8HA 4TZ0A 2QTHA 1T6NA 4Q1DA 5EE9A 2QQ0A 4JT2A 4N0DA 5P21A 1XJ0A 4Q5IA 5UKDA 4YMSA 4L5BA 2RH5A 4A0RA 4TLAA 3RS2A 3A4MA 1GL9B 1XEXA 2AWNA 2ODWA 2VF8A 4TLBA 3TSOA 2GCOB 1BS1A 4A8JC 1LNZA 2HYIC 1TX4B 2OXCA 1CIPA 2XZPA 1PZNA 3WYFA 2VPPA 2ZU0C 4TL6A 2NPFA 2O8CB 2BHRA 2GCPA 4OQLA 5TVKA 2REOA 3BB4A 1V5WA 5FPHA 3X1XA 4TT3A 3K0AB 1Z0FA 4K8OA 2ZXUA 1EX7A 3KX2A 3L0SA 3PCRB 4HZUB 2F1JA 5L3RA 1W4CA 1FUKA 3HR8A 2ZRKA 1XMVA 5FBVB 2RGCA 4Z54A 2FSIA 1RVDA 1R4AA 2CXXA 2WWYA 1FFHA 1GVNB 4HZUA 2EVWX 2PT5A 2WM9B 4ARZA 3BJIC 5H8WA 3W5JA 4DSOA 4EAQA 5FOWA 1NLZA 5KDOA 1G5RA 1XF9A 2CVFA 4FMDF 3UIEA 3ZD7A 4HB3A 4NKRA 1KO4A 3PXGA 2QSZA 3ZVRA 5FI0B 2X77A 1E9RA 4CEIA 3T5GA 1PJRA 1CP2A 3W34A 2VO1A 2DWPA 4V0MA 4DKXA 1PUJA 1TF5A 2Q9BA 4C0SA 1Q3HA 3OIWA 3BGWA 2VHQA 1Q0UA 4KJZA 1P72A 2X1VA 3W6OA 1DG3A 1II8A 1G4UR 4YLGA 4LYAA 4HLCA 3HPRA 2QPAA 2DFNA 5KSYA 4QHSA 1J8YF 4JKIA 5HCNA 5E7IA 4D4LA 1OW3B 3OIVA 5BWMA 2IW3A 3N70A 4P32A 1P3JA 5GJVC 4HAWA 3FGNA 3LFUA 4Q4AA 3U3KA 2FFHA 4Q66C 4JLDA 4M4SA 4DLTA 2FPLA 5TDHA 1ESNA 4G5GA 1NN1A 4IOJA 4Z51A 2GHIA 4Q9LA 3ZZ0A 2R6DA 4ARZB 4PO1A 2YWFA 4GPTA 2QQEA 4P3YA 5EP4A 3LRPA 1CS4C 2CJWB 4RKFA 4M1MA 4NZYA 1TU4A 3B2EA 5HCIA 4WOPA 1E3MA 5KDLA 4A2PA 4ZIRB 1E2FA 1FQKA 1HE1C 2AFHE 3C14C 1UKVY 5L8VA 3X1YA 4RZXA 5IF9A 3WNBA 2WMNB 3SR0A 3GLFA 2V3CC 1ZM9A 2WSSA 1DOAA 5CIWA 1N5KA 2ZUDA 3R7WA 4CVNA 2GK7A 1M8PA 4LUCA 4MH0R 1RE0A 1XXHB 1LTQA 1EFTA 2P0EA 4N3NA 1KK0A 2XTZA 1JBKA 3NC1C 4W5JA 3KQLA 1UM8A 1Z47A 2QA5A 3R9IA 4NDZA 3PV0A 3WNDA 1RJ9B 3ZZUA 1HY3A 1FMLA 2C9CA 2VSXA 5TARA 5JSZB 3TVTA 4IEEA 4C0KA 1Z6XA 1HQYE 2VF7A 1OPXA 5B57C 3DM5A 3KXLA 2QE7A 1BMFA 4KLNA 3SJCA 3QF7A 4D4KA 3RRNA 4LJ5A 3Q5DA 1IN6A 2JCSA 3NBXX 2WWXA 2JA1A 1GP2A 3I5YA 1QF9A 3QG5A 2RGGA 4GOJA 1GKYA 3LAWA 3DOFA 2JIZA 2VL7A 4LJ7A 4Q7MB 2XNDA 4OBEA 4DB2A 4MUBA 5IT5A 5B30A 1G8HA 2CCGA 3B1VA 4QHTA 1NP6A 5FUXA 3D3QA 1Q1BA 1SVIA 1NMZA 3EG5A 4LBWA 1NRJB 5TMPA 1N6RA 3CRRA 2NO1A 3AP2A 3IO5A 1OIXA 4MGYR 4QNMA 4Q01A 4OYHA 1CR0A 3RABA 5EE5B 4MITA 1GNQA 5DISB 1KGDA 5J4LA 4G5OA 4GMXA 4DXAA 2CE7A 3MSXA 4TYYA 4NCJA 5B58C 4MDFA 1SKYE 2HF8A 5K8IA 2ODNA 1GAJA 2RGDA 3IPXA 3QF4A 5AWFC 1XD2B 4TYPA 2V8OA 2CNWA 4ACBA 1ONBA 4R2IA 1CKEA 1SZPA 4WIAA 1II8B 3EASA 2CCKA 3LA6A 3PR1A 3GFOA 4ON9A 3AKEA 4PQFA 5L3VA 3KUCA 4E5UA 4MKGA 2B7BA 4BGDA 4QBIA 4I4LA 2IK8A 4QJ3A 2W6JA 4RKEA 3BRWD 3M4YA 2RGAA 5JLJA 2V4ZA 3G0HA 2ZETA 5K8TA 1QVAA 3EAQA 2PMKA 3THOA 2O8FB 3WP1B 3P1JA 2EFEB 4ABYA 1SGWA 1DADA 1G16A 4WW0A 3OEHD 2OG2A 1MO5A 1OB5A 1Z0KA 4OL0A 3QI2A 2HF9A 1N2CE 3ND9A 2GWHA 4MUAA 1VECA 4DB4A 5CK5A 4US2R 1KI8A 2ZU6A 4X8MA 3C15C 2PCJA 4EQ6B 2JATA 2HT1A 3TR5A 4GDFA 1BH2A 2ZSAA 3IGFA 4JMPA 2JLVA 3OEED 3A1WA 3QPWA 1PLJA 5TV2A 2QP9X 4H1VA 2G88A 3X1WA 4A0HA 3GLFB 2ZJYA 5AJXA 2GXSA 1FZQA 4Q18A 1E96A 1YU9A 4LJ6A 1OFTA 2GJSA 4ZDJA 3LO5A 3QKSA 3NWJA 4TZ6A 5SZIA 2YZ2A 1UJ2A 2GNOA 3TH5A 3AVOA 1CJTC 4HUTA 1KJWA 3I8SA 5KNBA 3FOZA 2QUZA 1P9NA 1G17A 2JIZD 4OQFA 2OCAA 4AURA 2R6AA 1NSTA 5LB2A 1SXJD 1NIJA 1GZSA 4FINA 3W8RA 1U98A 2Q6TA 4IVPA 5EE3A 4E03A 3K1JA 1U81A 4RD0A 2EU8A 1GTVA 2XOKA 3NHAA 1FW6A 3B60A 2SHKA 4F4IA 1GKIA 5J4VA 5FBQB 5FTJA 3EIHA 4OKSA 3VKGA 3K0SA 3DPUA 4QHYA 4L8GA 4URVR 1W48A 4QGAA 4KU4A 4QKQA 4E22A 2JLWA 121PA 3AM1A 2PMDA 3GFPA 1RRCA 4LYHA 4DT1A 4HAVA 1GNRA 1Z22A 5L3QA 2PCLA 2X8AA 4XJXA 5JFGA 1YR7A 2CL6X 3D7MA 2FG5A 3GJ3A 4LWZA 1CULC 3FKSD 1Y3AA 3AF1A 4P33A 1X86B 2J7PD 3TR0A 1HTWA 1US8B 2OSBA 3KB1A 4PPNA 5CM8B 4A15A 4IVQA 3AF4A 4PO9A 4AI6A 4AKGA 1U0LA 4NYJQ 1GRQA 4KITB 4D2IA 1NKTA 3BE4A 1E0AA 4TQ9A 3DKPA 4DLRA 5M04A 2D2EA 3D6TB 5FTMA 4DLSA 1E1RD 2ORVA 2ZRMA 2Q21A 4C0BA 1C4OA 5FPSA 4M9SA 4NYMQ 1OXUA 2PLFA 1M74A 2EW1A 4HATA 1JR3E 3Q7PA 4C0HA 2ZE8A 2BWJA 4FCWA 1IY2A 5D3MA 2NTYC 4PSKA 3ZGXA 4OI0A 2A9KA 2OBMA 5DHAA 1UKZA 5BYJA 4BFUA 1EGAA 2NG1A 1WF3A 5FOXA 1E1QA 721PA 1LFDB 3GLGE 4DSUA 4GI7A 4Q02A 5EP3A 1IN8A 4RCZA 4A6PA 3UWKA 3KFVA 3ZQ6A 2FPKA 3ZQJA 4IHQA 1E6CA 3AVPA 4YMUA 4D4JA 3T35A 2J7PA 1RYFA 3BC1A 1KYIA 2GZAA 4JS0A 1KSHA 4PZZA 1W2HA 2J7KA 4KCGA 2ZSDA 2OZEA 1K5GA 3BH0A 2IYWA 4DDVA 3MGCA 2C9OA 3IIMA 1M7BA 3UMRA 1A5TA 1XX6A 4C30A 3W5IA 1H65A 4M9QA 2ZSFA 1WB9A 2IYXA 4JLBA 3CX6A 3KKMA 3GLIA 4LYJA 4DWJA 2OLJA 1R10A 3DKVA 1DAMA 1EFRA 1G19A 1R0YA 5B64A 2C03A 4UXJA 4PC1A 3TVDA 2RGXA 4I99A 4HAUA 1QDEA 4M1SA 2QL6A 3KL4A 1G3IA 621PA 1E2QA 2L0XA 4MYHA 3CH5A 4PXAA 1C9KA 1CU1A 2IYYA 4QM6A 2FA9A 2CLCX 2IS4A 5AJZA 4URWR 1KDTA 2YV5A 2MSCB 2EWWA 1RFLA 1D2NA 2ZR9A 1TEVA 2V6IA 3VAAA 3RWOA 5GADl 2CK3A 2Y8EA 3K9NA 3UG7A 3NDBB 3AVTA 2C77A 4JL6A 3E70C 521PA 3K0AA 3LW8A 4UXIA 3B1WA 3A1VA 2QAGA 5DLQC 1N5IA 3CH4B 4UNQA 4ZDWA 2VYFA 2JJ8A 8OHMA 3CRVA 4I1OA 2WPDA 1IJEA 4JLKA 5GJBA 4BZQA 5FR1A 1GRNA 1W0KD 3HWSA 3KTAB 2O8CA 2ODEA 4A36A 3RAPR 4LDJA 1ELOA 1JQLB 3QKUA 3IHLA 1XRJA 1KDOA 3K9HA 4TWZA 2A78A 2QY9A 4FWTA 4F4JA 1JNYA 2R44A 3G82C 1YKSA 4PX9A 1MRNA 1OKKA 4C2TA 1ZP6A 5F9HA 3AEZA 4B6FA 5BXQC 3GFTA 1WBDA 2BJVA 4EKDA 2QPOA 5CJ2A 3R8FA 4EPVA 1G64A 3OEHA 2GZHA 2WAXA 1E2KA 1XXHA 3IIJA 4LPKA 1NVUQ 2H17A 3HU3A 4D4MA 1NN0A 1XZPA 3C5CA 4MQBA 2PZFA 2ZVQX 4Q03A 4DDTA 5FPYA 3WHLA 1QHXA 3U6BA 4NYJR 1F3OA 4IRUB 4DC9A 1U8YA 1YQTA 4JBYA 1KJZA 1U8AA 3HP1A 1QG4A 1SHZA 4HLUC 3U5ZB 1N25A 2BM1A 2WIAA 2YNMA 3GEEA 1TMKA 2BCGY 1N6IA 2Z6VA 2GEVA 4MRVA 4PANA 4D0NA 1RRGA 2PT7A 1XDBA 2ERXA 4WZBE 3WMGA 4V0ME 1LW7A 4JLPA 5D3MB 2G9NA 3VKHA 1DE0A 1J99A 1HA3A 2V9PA 2WJYA 3NVAA 1XXHE 4O0MA 4US1R 3T1VA 2F1RA 2VSFA 2ZRNA 2GVDC 4WZAE 3FWYA 2FWRA 2HCBA 5J5CA 1WRBA 2DYKA 5JI3E 2Z0MA 4NHOA 4TT3D 4EUNA 4KFTA 3CRQA 1HE8B 2QP4A 1UKYA 2VHTA 2PZEA 3QENA 5FOUA 3IQWA 2F3RA 4M21A 3GLHE 3W8NA 3UK6A 4A8JA 1RZ3A 3U3OA 3EC2A 1KHTA 2HV8A 3B7GA 3BBPA 1A7JA 3SFZA 3UG6A 2QGNA 3DMDA 3GCGA 3RS0A 4TL8A 5KDDA 3B8HA 1MT0A 2ZROA 4C0LA 4CEHA 1G1MA 4IEIA 5E7MA 3HYTA 4B35A 3IKJA 4Q19A 3A8TA 3M0EA 3FKQA 3FMFA 4WXRA 1Z83A 4DCUA 2BBOA 2YWHA 5C1BA 3NEJA 3AVUA 1AS3A 3MJHA 3CNLA 3KDSE 4FCVA 4HUQB 4KV9A 2P67A 5G3ZA 4IOLA 5JJKA 4MYCA 4QXAA 2OFOA 5EXPA 1E9EA 2FN4A 1XFAA 4C9BA 4LV6A 1Z6GA 2QAJA 2EWVA 3QUSA 3V4FA 4LHVA 4Q1CA 2MSEB 1O87A 5EXSA 5BQ5A 2DBYA 2W6JD 3SJZA 4YONB 1E2PA 4BFVA 3ZVLA 5F3WB 4B3BA 4YMVA 4Q9JA 2BV3A 4PFSA 1DBSA 2ZJAA 4NU0A 1U99A 3GJ7A 1F60A 1E2JA 1ZUNB 4IW3B 3CR7A 1OIVA 1GOTA 1P2VA 5DI3A 4HB4A 1YR6A 4PO8A 4CEHB 1VCOA 1YE8A 4ESHA 4ZI2A 1S0UA 1WE2A 3X1DA 2N46A 3TMKA 3LH5A 4EFNA 1T4GA 1VG8A 3H4MA 3AQ4A 1HURA 1T3LA 2ZJOA 4TTRA 2PEZA 4JLMA 1ZNZA 4Q9IA 2ZUBA 1F2TB 1SVMA 1U2RA 4P4SB 2WICA 2DCUA 2V7QA 3LW7A 3I72A 5CYOA 5EP1A 1OB2A 4BEBA 5JZVA 2ZRHA 4I1UA 2OV2A 4QC2A 2VP4A 3JVUA 1G8YA 1G7SA 5CLQA 5FBRB 4AK9A 4ZKEA 4GNKA 3ZJYA 2Q9CA 2H92A 2VH5R 4LJ8A 3ECCA 3ZS9A 2O8FA 2QBYB 2ZS8A 4DIEA 5E7JA 2ZTSA 4KBFA 1P2TA 1XTKA 1YR8A 3A4LA 3FKSA 1CR4A 3WRXC 4D6PA 2Z43A 4PPGA 4UNRA 4TL9A 4DLZA 1XBTA 4FW9A 1M6NA 4DEXA 4JIMA 3GLHB 2FV8A 1JEDA 4B44A 3G5UA 2JDID 1E9AA 2KI5A 2ASEA 1N5JA 4ASUD 4NL4H 4RD6A 3SU8A 2WSSD 1NI3A 1XTRA 1F2TA 2ZRFA 3CX7A 4PQRA 4J0QA 2NIPA 2E9SA 4CEIB 3LXXA 4IOKA 1CEEA 5SZJA 3VKWA 4U00A 4DLUA 3KJHA 5EZ5A 5CDFA 2OUKA 3B82A 2ZRBA 4LRWA 3RSOA 1GWNA 1N6LA 2FFBA 3UATA 1VYUA 3AVQA 3F3YA 4OI4A 3GP8A 3ZLJA 1FL9A 4PC3A 2P6UA 2KSQA 3CKLA 1OXVA 3BB3A 1QZXA 1NVVQ 2CE2X 2XX3A 1D6JA 4QG7A 2G0NA 4PC7A 1XCPA 3U4QB 1H8ED 4NH0A 2OXRA 1TU3A 1D8TA 2B6HA 1X8KA 3AVVA 2GJKA 1YZNA 3VHLB 2QG6A 2FGKA 5TXGA 3SYKA 2I3BA 2FGJA 3O8CA 1KKLA 1KZ7B 2ZRGA 1GNPA 2GK6A 3NHBA 1WMSA 4KLZA 4BUJA 3RS7A 3WHKA 2P65A 5E95A 2ONJA 1ZUHA 2QENA 3QQ5A 3BWDD 4YMTA 1Z08A 4MGIR 4KSCA 4R98A 2DR3A 4PHTA 4LCBA 1DG1G 2ZUCA 2LKDA 2IS1A 3B1ZA 5F98A 1D9XA 3MFYA 5E4FA 1MRSA 2CHVA 5DIFA 2ZREA 5C18A 4OHYA 4JVNA 3VHXA 2GVZC 3REGA 3CBQA 2G3YA 1NBMD 2AXPA 2ZSEA 3VR6A 4AG6A 3AP3A 2CCJA 3THYB 1VTKA 1ZIOA 3PIRA 1JEEA 2JLZA 2GF0A 2ZI5A 1LF0A 2WJHA 4JL5A 4F91B 1B0UA 2YC4C 4FN5A 4A8JB 3EX7C 3NC0C 1F48A 2G77B 3IBYA 1R0XA 1ZRHA 3QBTA 2V54A 2YOHA 2AR7A 2QSYA 2V1UA 3KQHA 2ZS7A 4KFRA 2VHJA 1VCNA 2R2AA 3T1OA 4ZCLA 2N42A 3K0FB 2WVJA 1IY1A 2FF7A 4GP6A 4JLVA 1GM5A 1DEKA 5KO2A 4QBGB 2DFKB 1LY1A 1ZCBA 2XNDD 2QAGB 4D25A 5G41A 4CIDA 3I5XA 4JVSB 4HB2A 1Q1ZA 2PEYA 5KU1A 2GCOA 2QMEA 4AD8A 2YOGA 2BDTA 2CVHA 2ZJ5A 4G5SA 1G21E 3RANA 3CPEA 1S1CA 4CGZA 3AKCA 1ZVQA 2XNSA 1MO3A 3B9PA 1E2EA 1Q1QA 5FOVA 1AJEA 1OYWA 4NP6A 2XXAA 2B7CA 3TQFA 1S96A 3Q3JB 3RS3A 1GL7A 1ODFA 2QRZA 1QHNA 2CBZA 4QRHA 1KI7A 2VP9A 2H5EA 4H9GA 2R6FA 1GKUB 1KY3A 4POAA 2OESA 3NIBA 2RGNC 3ZDQA 1Z8FA 1FP6A 2QU8A 4JBWA 4W5WA 4EJSB 5FTKA 5G53C 4LHWA 4QNRA 1KI6B 1J2JA 3TKLA 2VP0A 1R0ZA 5AJYA 4DLXA 2FPMA 2VA8A 2QT0A 4IDHA 4DDWA 1OKKD 1L8QA 2ZRCA 4PPFA 2IUUA 3SN6A 1DS6A 2W0MA 3EZ7A 4UKDA 4D80A 2W6IA 1COWD 1R0WA 4TL7A 4MGKR 2OAP1 4RZUA 3JZMA 4M8NE 2BEJA 3AGQA 3DHWC 4CT4B 3CNNA 3CZPA 4PHGA 4DCSA 3KQNA 4P4TA 1NKSA 2F3TA 4V02A 2QAGC 3LV8A 3RLFA 4AG5A 4O3MA 1YZUA 4U02A 3I62A 2IYQA 3W6NA 1J7KA 3HPQA 4Q1FA 4LBVA 2EFCB 4BE7B 3MJRA 1QHSA 4BFSA 2G6BA 1GITA 2X19A 2J1LA 2WWIA 4ILEA 4IVRA 3RS5A 3RS4A 1R5OA 3A37A 2IL1A 2WJVA 1IN4A 1JR3A 1W5SA 2JJ1D 2PX0A 2R9VA 4PPQA 1GRRA 4DCTA 1G7TA 2WOJA 4M0LA 4GL2A 3ASYA 1L4YA 1KK1A 1U94A 2XB2A 1E2DA 3LWNA 1MO6A 3SHWA 3P27A 1W4AA 4RZ2A 1ZD1A 1ZD8A 4LJ4A 4TMZA 2C95A 4FMCB 3MUFA 1OH7A 4TLEA 4HDOB 4YDHB 3QKRB 3WBJA 2Z5FA 2GA8A 1SXJE 3EZ2A 3HYRA 4M1TA 5C4GB 2ZSBA 3BORA 1ZJ6A 2ZQ5A 3IILA 3DEFA 4TMKA 3LBNA 3GPLA 2F55A 3CONA 2RAPA 2VP6A 1S1MA 3TIFA 2WAYA 1W7AA 1E32A 1LB1B 4QM7A 1CJVC 1IJFA 1EWRA 1BIFA 4G1UC 3B78A 1CXZA 1EX6A 3TAUA 1VIYA 1HV8A 3LNCA 3L2OB 3OAAD 1NJGA 4BLSA 1XD9A 2LWIA 3EA0A 2LCFA 5AUOB 2VSOA 1F5NA 1KSFX 3GEIA 2ZR0A 1PLKA 3U61B 1ETUA 1QHGA 2JLRA 4F38A 4AY2A 1T0JB 1W1WA 2WJIA 3DOEA 1ZNWA 4Z8XA 4FD2A 2WPDD 4CT5A 3JZAA 2LKCA 3QXSA 2IUSA 3KZ1E 1UEIA 4I1SA 2ZE5A 2AK3A 1KSGA 3AF3A 1IBRA 5DE3A 2GZDA 3OE7A 4KFSA 2FX3A 1UDWA 4TMTA 5JRZA 2GJ8A 3I4LA 4Z8YA 4O2LA 3GJ5A 3B9QA 2G83A 2RMKA 4JLJA 1OV4A 4EPYA 1PLLA 1YJ5A 1GIAA 3SI7A 3VX4A 1S2MA 3EPKA 2JLSA 4HAYA 3GLIB 4FXPA 3QSYA 4Q4LA 3H86A 1OSNA 3UANA 1NLYA 3THXA 2ZS9A 4WA7A 2QN6A 2CHQA 1ZNXA 1XEWY 2G0TA 2VHCA 4FWIB 1E2GA 4Q4HA 4KO8A 3X2SA 2REBA 1US8A 4FMCF 4DUGD 1Q12A 1RC8A 3V9PA 1Q1EA 1T3HA 3NH9A 1U9IA 4KAXA 5JS8A 1FNNA 5JI2E 5DI9A 3UPUA 4A4DA 1G8FA 1N3BA 3GLIE 4PHFA 5KNCA 2ZYVX 1UBFA 1G3UA 2W00A 1XU4A 1E0KA 5DYGA 3V00A 1YZQA 3K70B 3LD9A 1CR2A 3X1ZA 2K5UA 1Z0AA 5FPTA 1QHIA 1Z0JA 2OFXA 4LBZA 5J4KA 3Q72A 4B71A 3E5HA 2ERYA 3PVSA 3Q9LA 1MH1A 2F43B 5CLLA 3A1UA 4LK2A 2GESA 4GZMA 2ZPTX 2PJZA 1ESMA 2P6NA 4YXWA 5KHOC 3MCAA 1JALA 3FYHA 3FHOA 3LQRA 3MWYW 4WZ6A 3UMSA 3QXXA 1N6KA 2HEIA 4XTRA 4GRAA 4IDNA 2A5GA 4D26A 1KO5A 4C4PA 3EWSA 4Q1BA 4TSFA 1EFCA 3LBIA 4M1OA 2O8BB 1NLFA 1U8ZA 2A5JA 2AFIE 3RWMB 4EFMA 4LX0A 5JECA 1D2MA 2FDCA 2YHSA 4FMBB 2WBLC 4Q1AA 2RGEA 2J45A 2E87A 5AUPB 1N0VC 3KKPA 4ZI3A 5JRJA 1R2QA 3ND8A 1AKEA 5FBWB 4MYTA 2IYLD 1AA9A 2ZJ8A 1MO4A 1H8HA 3KKOA 2CJWA 3U3MA 1HUQA 2J9RA 1G6HA 1S9HA 4ZDIA 1U0HC 2QEQA 4MKHA 2XTMA 3KFXA 4QGGA 1RYHA 4C3ZA 3K53A 2HYDA 1PUIA 2YYZA 4HAZA 2D2FA 3BOSA 2OCBA 3IBGA 1XEWX 1GUAA 3EPHA 1P9RA 1CF4A 3HU2A 2WV9A 3FVQA 3QIAA 2GXQA 3OHMA 1JI0A 1UBGA 3K70C 5FOSA 5JMTA 2D74A 1N6PA 5IRCD 4B32A 3K09A 4IFBA 4RJLA 5AJVB 3FMIA 2ZJBA 5TY0A 4C0AC 5K8UA 3MG9A 3VR5A 5KTYA 1E9SA 1N0UA 1Z6YA 2GAAA 3IIKA 2EQBA 3QBVA 2RB4A 2PX3A 4TTPA 2DFLA 3IO3A 3ZH9B 1TTTA 3NDPA 1W36C 2C5LA 3M6AA 3KJEA 3NBYC 1P75A 3H1TA 3A1TA 5BN5A 4PAMA 1UF9A 4A1FA 2R62A 3THXB 1XJQA 2E1RA 4OK6A 4NYMR 5F2EA 3R8CA 4DJTA 1QVRA 1NNEA 1Z0DA 4BZXA 4Y0VA 5JJLA 4A0FA 1G3RA 4TLDA 2FSGA 3T06B 2Q3FA 3FHCB 2AD5A 1AS2A 3T12A 3AKDA 1VHTA 3NTUA 3OIYA 1TQDA 1G7RA 4GMDA 4AC9A 4DLWA 1M1YE 1HEIA 1F6BA 2AWOA 3MRSA 2A3RA 2BMEA 3R9XA 4CW7A 4IDQA 2WWGA 1DTSA 4GOKA 3DVLA 4EFLA 3HDTA 4A9AA 2CK3D 1II9A 2C2HA 1TF7A 3CPHA 1OFUX 1QRAA 1X1RA 4G5RA 6Q21A 1E2MA 3GJ8A 2EFGA 5BYKA 2ZANA 3VU9A 1T0HB 2NQ2C 4OI2A 5EQTA 1KOFA 5B2ZA 1A4RA 1DAEA 4OK3A 3BIFA 5DO9A 3DO6A 3ZVNA 1OXTA 2F7SA 3K9GA 4Q1EA 3UXMA 4NCKA 5EE0A 4JJZA 4LHXA 4D81A 4W9MC 1CJUC 1N6NA 4JYBA 4E09A 3THWB 1BYUA 2ZRLA 4M1YA 3THYA 1AGPA 4JLAA 1BYIA 3B1YA 3WYGA 2IWHA 2XZLA 2CL7X 4LBYA 3PUVA 2O0KA 1BMFD 2HJVA 1AS0A 2XJ4A 5FL3A 3C7KA 5CIQA 1W36B 1VYTA 4BLQA 1W2GA 2B92A 4JSYA 4MYUA 4B34A 4XVRA 3R9WA 3R7WB 1K6MA 5SZHB 5L3QB 2BBSA 1P5ZB 2JJ1A 1KMHA 4V03A 3U2QA 1XNJA 1YRBA 3NXSA 4LC1A 1KJYA 2DWQA 1C1YA 1W0KA 1XPRA 4UJ3A 3VU9B 3UKDA 2Q9AA 3AB3A 4LJ9A 3Q5EA 4BFWA 4DLVA 4M22A 4DSNA 1DVRA 3GLFE 3CIOA 5FTLA 2KBEA 4DIDA 5JEDA 4N0EA 1M34E 4GT1A 2FSFA 3LDAA 3MWLA 4B47A 4BLOA 3ADKA 4B3XA 2O8EB 3EWAA 4UNPA 1DO2A 4LY6A 1WXQA 2OE2A 1XPOA 4YC7A 1AIPA 3K0FA 1IHUA 4QJ4A 4TN1A 1WCV1 3R20A 1KO7A 4O2RA 3TSZA 4GZLA 4WAUA 2J59A 4BLRA 4DRZA 2QT1A 1QHHA 2NO7A 2BVNA 3LLUA 1ZAKA 4XD7A 2OILA 3SBDA 1PV4A 2H8KA 4Q7JB 2F9LA 4IDPA 1B23P 2NO6A 3OFNA 1FTNA 4K81B 2UZ3A 3RRZA 3K70D 1EFRD 2EYQA 1KI9A 1KO8A 4O25A 3ETLA 4EJSA 3GLHA 1QHYA 1UBEA 3B5JA 4NE2A 2IF2A 2BBTA 3TRFA 3CW2A 2F1IA 2BKUA 4PSAA 2WWFA 2NZJA 4OHVA 1ZM2A 3ZYCA 4XTCS 2WHXA 2JLUA 4TYQA 2JLYA 4L15A 5J4YA 2VLIA 4AIIA 2ZRPA 2WJGA 1CLUA 2XOKD 1P7CA 4DT1B 2NMVA 4ZV4A 1N5LA 1VG0B 2G1JA 2V55B 4KODA 2IBMA 4RD1A 4HLDA 1E9BA 2PJRA 2HLDD 3GMTA 1DAKA 5F9FA 2OM2A 3N5CA 1KI1A 2QORA 1TUEA 2O5VA 1FTSA 2J5XA 3P4XA 4B3CA 1NIPA 2FEMA 4X8LA 3MWKA 3OZXA 2OAQ1 2D06A 3CM0A 4PAQA 4F4CA 4P31A 2AKAB 2EFDB 2ZAOA 3LLMA 4N1AA 5CB6A 1SVLA 2C8VA 5G3YA 4CF7A 1KMQA 4TTQA 4E07A 4G0NA 2IXGA 1E1RA 4CDGA 1T9HA 4CYMA 2VP5A 5DN6D 1NBME 4K46A 5FUVA 4NTZA 4JKYA 1XB2A 3KJGA 2F1HA 3TJZA 3BFVA 1G7CA 4RD3A 4RD4A 4DSTA 2QP3A 4PR0A 4QFMA 4R71A 2XXAB 3QEJA 4UQOA 5IK2A 2XJ9A 5CITA 3IUYA 1SXJB 3CLVA 4AKHA 4A92A 4HLQB 4RFSB 5IDVA 3UMFA 4Q9KA 4C0QC 2KE5A 2J0QA 2ANCA 1TF2A 1P2SA 421PA 2BJWA 3NG1A 4Q48A 1NG9A 3KKNA 1NBMA 1EK0A 3BERA 3S1AA 4JLOA 4LC0A 4XWKA 3EZ9A 4EPWA 1E9FA 1Q44A 1X3SA 2AX4A 3MLEA 2AL7A 3O8BA 3RYTC 1VIAA 1AN0A 1JJVA 1E0JA 1G18A 4H1UA 3T1TA 1ZU4A 1Z2AA 1G9XA 4UJ5A 2MSDB 3CF2A 3QPUA 1NF3A 4JJKA 2IF0A 4B76A 4UNSA 1EESA 1IXRC 4B73A 1ZC3A 3A1SA 4GOXA 2QBYA 1E94E 4UNNA 3FDIA 2QTFA 2XAUA 4L9WA 1RJ9A 3WBKA 2PLRA 1XCGB 4B2LA 4DEYA 2WOOA 1E99A 3H84A 2HT6A 2PH1A 1Q22A 2IYSA 2Z4SA 3QE0A 2OCPA 2Z4RA 3CO5A 3PG5A 3NKVA 1ZC4A 3QNUA 4LPSA 5KPDA 4Q4JB 1XEFA 1ZINA 2PL3A 2O8DA 1XP8A 3PENA 3PITA 1KNQA 1XJCA 3D8BA 1CRQA 3TUZC 1OFIA 2J0VA 2QPTA 4PZYA 4BFYA 3MD0A 4JZKA 1NY6A 1UPTA 4Q4JA 3I3SR 2VQSA 1KKMA 3TQCA 4KXFB 5DI3B 5ANRB 4JSTA 5JCZA 1R7RA 2ZRDA 4F92B 2BMDA 3QY0A 1P4SA 2GRJA 1SXJC 2KWIA 4CEJA 4V0NA 2RHMA 1XMIA 4TYNA 3EPLA 4W7SA 5KSOA 1Z28A 3C5HA 2GCNA 5EP2A 2ZAMA 3RNLA 1VG1A 3QXJA 3N2IA 3CB4A 2AD1A 5JHGB 1WDTA 4HUQA 4MKFA 4HLUA 1DAIA 3PEUA 4MRNA 5L3SB 4DCVA 2P5SA 1IXSB 1CBUA 3VNVA 1YZGA 3SOPA 1U9IC 1Y63A 2A5DA 3AF0A 4ZCMA 1IN5A 4JYCA 2FEOA 3SBEA 3U7FB 4LGMA 3B6EA 4XD7D 2GKSA 2DB3A 2YWEA 2O8DB 2IEYA 3ZS8A 4DCNA 1Z6TA 3BFXA 1ZD9A 2ZI6A 2ECKA 1OF1A 2H1LA 1M7GA 3U6KA 1LV7A 1XMSA 1T5IA 3FPAA 3GQBA 5LB4A 2QMOA 2JASA 2ZIAA 3EZ6A 3EZFA 3OE7D 4A82A 3TLXA 1VMAA 2Q0HA 3CRW1 2QTVB 2O8BA 2IHBA 3BS4A 1UAAA 1NVXQ 3ZIAD 2GXAA 1X8JA 2WSMA 2XTNA 1NG1A 3AVXA 3SJBA 3F0TA 2JGNA 2VHUA 1COWA 2C99A 1ZMXA 5L3SA 1IONA 1FUUA 4V0KA 2W58A 4NONA 2C04A 2IC5A 2QMHA 2ORIA 3AV0B 4ACAA 3IDQA 1HYQA 5C46F 1P2UA 3SZRA 1RRPA 1Z29A 1K5DA 1AQYA 2NGRA 1T91A 2XZOA 3CZQA 1HT1E 3U7GA 3RC8A 4UXHA 2JDIA 3QG1A 2H18A 3HU1A 3BFKA 4Q7LA 3TAHA 2KB0A 2FSHA 4MDEA 2BEKA 2KBFA 1UEJA 3ZVMA 3GJ0A 5H70A 3RDPA 5FUWA 1FOEB 5J40A 4M2LA 1MABB 2QGZA 2WKQA 1I4LD 4M1KA 2VP2A 2A7QA 1TNDA 3RSLA 2ZI7A 2QNRA 1UBCA 3Q85A 1IAQA 2KJQA 1KY2A 1I2DA 4II7A 1E1QD 5HZKA 2FZLA 2N1BA 2FMXA 4ZKDA 1FX0B 2JLQA 2A2ZA 5A0FA 4U7DA 4ZIRA 2YKGA 3NEYA 2I1QA 3FFBA 2P2LA 1P73A 3B13B 3SE0A 4EPTA 1M7HA 4S2EA 1IN7A 1ZU5A 1E4YA 1RKBA 2GEUA 4IKEA 4HSEA 4NMMA 1DO0A 1W49A 5CK4A 2CEAA 3PUXA 1OFHA 1Z3IX 1E79D 1WBBA 3QXHA 1JXOA 2DHRA 4TQUS 3PFIA 1EFHA 2P6RA 2ZE7A 1TADA 2C96A 3VR3A 2XEXA 1QG2A 2BMJA 1XEXB 3U3RA 3O47A 2OT3B 1N6HA 1XTQA 3ONWA 4OHXA 5FPKA 4LZZA 1J90A 3LXRA 4DVGA 1OXXK 3CWQA 4QBFA 1YR9A 1MOZA 4URZR 4ASUA 2RGNA 2HXYA 4I1VA 4B74A 1MV5A 1OJLA 5FL7D 4A2QA 4EJSC 2D62A 4MGZR 2JJ2D 1BOFA 2FOLA 2ZEJA 4PSVA 2IS6A 4AWXA 5EXTA 3DZDA 4IFEA 3K0EA 3SYNA 1S4QA 1JECA 3SC3A 4W5HA 2J0UA 1HQCA 5CJPA 5FFMA 1R5BA 4HZIA 5ELXA 2QM8A 3GJXC 5LBIA 4JVMA 1R8QA 1VDZA 3DMNA 3M1IA 2OBNA 2R65A 3SDZA 3IQXA 4Q21A 4DBLC 2QM7A 5FTNA 3WNCA 1H8HD 3LY5A 4NPHA 3WP0A 3AF2A 2XITA 2XB4A 1W4RA 2BCJQ 2J3EA 3P26A 2ATVA 3I61A 4Y0AA 4IOMA 3IEUA 1YZTA 3CRMA 2YJTD 3VX3A 1ZCAA 3PQCA 3TK1A 1OE0A 3H0KA 3LX5A 2O0JA 2WMOB 3QKTA 5H68A 3VTKA 3GLGA 1DAFA 2ZI4A 3TW8B 2AHOA 4KVGA 4FIDA 3OEEA 1XTJA 5BN4A 4Q4AB 2WTUA 1Z63A 1Q21A 5KYKA 1OHHD 3V4RA 1CJMA 3HJNA 3GLGB 5J4HA 2IUTA 3EIEA 2Q3MA 2AXNA 2FZ4A 3VR1A 1OH8A 4G3XA 4L4UA 4YXWD 1KNXA 3THWA 2CMKA 2XSZD 1NMYA 2ZRJA 3MMPA 5KPJA 3C41J 3FMPB 1VYVA 1XTSA 4QGHA 3K0CA 2CLDX 4ERNA 3KUDA 2IYRA 1RIFA 1TL7C 4JBXA 5DGXA 1P62B 1X8LA 4AKEA 2FNAA 1D9ZA 2ODBA 1OXSC 1G6OA 2J41A 1TPZA 4XVQA 1VCMA 5DHFA 4A2WA 2OFWA 2FFQA 5IK2D 1KIMA 3QKRA 1KK3A 2VTKA 3C8UA 2AN9A 4L16A 4I81A 3S1AB 2NZ8A 3DZ8A 2WKPA 1JR3D 4ZPXA 2V1XA 4QBHA 1MR3F 3U4QA 1VPLA 4M1WA 5EUMA 4Z1MA 4EDHA 3BAFA 1D2EA 4HEJA 2CDNA 2A5YB 2GF9A 3N2EA 1NN3A 4CZ2A 2Q3HA 1H8EA 1UKEA 1KI2A 1ZBDA 1XD2A 3OF5A 3WYAA 1NN5A 3SS8A 5KNDA 3U44B 4M9ZA 3TGPA 4OQXA 2O0HA 1L7VC 1EWQA 5CYPA 4F7WA 5DN6A 1NVWQ 4KYIB 3ZZTA 3PUZA 3L82B 3QJYA 4URYR 4NCHA 3TSWA 2YWGA 2RHDA 2I4IA 3U44A 2FH5B 1IY0A 3AUXA 1S3SA 5JS7A 2DFTA 5KOYA 2NPIA 3DM9B 3LX8A 1U0JA 3Q8XB 3KXKA 4LJYA 5K8LA 1MABA 3QVVA 2IX3A 2ZI3A 4OHWA 4MKIA 1J70A 1KZGB 4BZPA 3AKYA 4M9XA 2ORWA 3PUWA 4PZLA 1E9CA 2O52A 3I73A 4B3GA 4P4UA 4XIGS 1XCMA 3SQWA 3NBFA 1G8PA 4ITRC 4EPXA 2FJUA 1W47A 4JLNA 3T1QA 4C2UA 2HDNB 4XSGA 3CPJB 2CHGA 1FX0A 3EC1A 3E2IA 4KSBA 1ZM3A 4EQ6A 1SVSA 1NMXA 2CLSA 4D0GA 1RW4A 1OH6A 3BD9A 5HKKD 1E2NA 3EW9A 1BO6A 4KI0A 4M53A 1EG7A 2D7CA 2ZITA 5HKKA 2BKEA 2OBLA 1TQ4A 4URUR 4AYTA 1VG9B 1G41A 2WWHA 1FMJA 3AUYA 3PEVA 5J47A 1NY5A 2OEPA 3AGPA 5A5GA 4TQAA 3WRYC 4D82A 4ZDKA 4DUGA 1AQUA 1A2BA 5CDFE 2VIIA 2ZYTX 4LOAA 4YDSA 1PVOA 1E9DA 4XWOA 3IEVA 2IYVA 3VFDA 2PZGA 2X2EA 1E2IA 1OIWA 1ZYUA 5FI1B 4YMWA 3BH6A 3RHFA 3A36A 3CF0A 2IHYA 2IWRA 1E69A 1G4AE 1IQPA 3CWZA 5SZKB 2QI9C 5H1YA 2W2VA 3NBZC 1RPZA 2ANBA 4X8OA 3DDCA 1E98A 1EXMA 1X6VA 4DDUA 5AUNB 4B3FX 3RRYA 1Q57A 1KI4A 1UADA 3MWJA 1JPNA 3P4YA 4GSYA 3SJAA 3AVYA 3ADBA 4PHHA 3EIQA 1VKJA 4LSGA 2XGJA 4DLYA 2W6ID 3LBHA 1E2HA 1GSIA 2FU5C 3SYLA 2J87A 2BMFA 2RKOA 5DSZA 1T8UA 3LVRE 1K8RA 4FMDB 3J81k 2ZVPX 1KI6A 3F5FA 1WA5A 1XD8A 2J0UB 3GJ4A 3MAAC 1ZM7A 1J8MF 3C4JA 3L8ZA 3TBKA 5JWRA 1JPJA 1SULA 1ZW6A 2UKDA 1KSJA 4PC6A 1ZNYA 1OH5A 1Z07A 1AKYA 1QBKC 3A58B 5JSZA 4RVCA 3AVWA 1KDPA 2HXSA 3FE2A 1W46A 1A2KC 1TQ6A 1YRAA 5FUYA 2WIBA 3K0CC 1T5LA 4C7OB 2BIFA 2ATXA 4HAXA 5EXXA 3EARA 4BQSA 4DHEA 2AKYA 5AUQA 1G3QA 1Q20A 4XSHA 1SVOA 2XSZA 4GBMA 2BM0A 2UZIR 1W4BA 1W0JD 3T5DA 1U90A 2ZI9A 1OHHA 2GBLA 2IA5A 2JAQA 1JXMA 2V7QD 2MMGA 2W2XA 1GILA 1E0SA 1P61B 2W83A 4LHZA 4V0OA 4HDQB 4BRUA 1QHHB 1P6XA 1LVGA 3P32A 1R6BX 2IT1A 2RGBA 1HT2E 1KDRA 3F8TA 2R6GA 1CTQA 4HI0E 3ZIAA 2GETA 1I4DD 3A4NA 4LV8B 4DZZA 3KQUA 3SQXA 2NO9A 1VHLA 2D4HA 3FB4A 1IXZA 4HYYA 3CUEF 3TW4A 2EFHB 4R9UC 1R5NA 2VEDA 2GDJA 5JBQA 2WZQA 2GBLC 1V43A 4KYUA 4OJQA 3T34A 4RY2A 2J0SA 4IXNA 5BN3A 4ZO4A 3U7HB 1W0JA 1ZUIA 1ANKA 4Z1MD 4AKIA 4NCNA 2GEDA 3TE6A 4TMVA 2ZYWX 4BPBA
chains in the Genus database with same CATH superfamily
4GFDA 4PLYA 1D0VA 1HGXA 2ZT6A 3O3OB 4HQRA 2JGJA 2QYHA 3GLKA 1W34A 2VDJA 3LUAA 5AVYA 1YFLA 1JEOA 1O3YA 3OWOA 1YA8A 4AMBA 3H1EA 2V59A 3DDOA 3R0ZA 2BBWA 2Y1FA 2PSSA 4EPRA 4JXKA 4RD2A 5LYJB 1YC2A 4F93B 1G291 3C7DB 5TB5A 5IW8A 1I6LA 1L2TA 1G3MA 1T13A 2P9YA 2JJ2A 5D85A 1KEZA 3LT2A 1UPXA 3GG9A 3KKQA 3TUJC 6REQA 3AK4A 2I1VB 3NBQA 3UK2A 4CRWB 2WEKA 2PZMA 1IMJA 3HVRA 2Y67A 2IS2A 1JR2A 1UFQA 1F9EA 2ZYSA 1OLOA 3I1FA 4R4JA 3R75A 3U7EB 4DVJA 4DSAA 4JS0A 1SCIA 2IKSA 1FP7A 1NJ5A 4S35A 4MPTA 4XM0A 1G38A 2IYTA 3C3YA 1LWOA 5BSMA 2GJ9A 3VR3D 2C00A 2ZE6A 3HBNA 3OQMA 3VZDA 1GT91 4R0MA 1GFIA 4G8BA 1QP0A 3WWPA 3TLKA 4NJOA 1S3IA 2MMCA 1WDLA 3PC4A 3H11A 1TCVA 4OO3A 4BQRA 4L6AA 5L6MB 4Q4HB 2QMUA 2W2TA 2WE7A 5AK4A 5ARCA 2ZIZA 2NZ2A 4R2HA 3ADCA 5CFQA 4BB6A 1UDXA 3TTTA 1E79A 2PO7A 2Y92A 4GVLA 2YIMA 3ICQB 5IJ0A 1R8SA 2XUDA 3VYSB 3O4JA 4PX3A 4INOA 4JDUA 1DFIA 1KMHB 1VHDA 3AO0B 5E3HA 2V6JA 4NV1A 4FYVA 1P3DA 4YCJA 1FS4A 4XAQA 4DMHA 1RDFA 4Q3CA 3DCYA 2QRNA 3V1YA 3JVVA 3H2YA 4AECA 1GEGA 5LN1A 2YV3A 1XNHA 3HB7A 4QQFA 5TQ2B 4D8VA 3EA5A 3UB3A 1ABBA 2B9VA 1G5FA 3DPIA 2HM7A 3L7AA 5L7YA 3RM3A 3F74A 3WMEA 3ETCA 1F4LA 3H5AA 4GP7A 3H83A 4WVFA 2IIQA 2B5WA 3IMFA 4YJFA 2Z6AA 2PJDA 4YP6A 4RY8A 5K3AA 5JJIA 1YCHA 3NWBA 2DQYA 4J9VA 3I5AA 1ZM4A 1AE1A 1S7CA 1NJFA 4LZLA 4U3JB 2FEWB 4H2DA 5G40A 3WFJA 3DTYA 3FWZA 5AHOA 4MQ6A 4OBBA 3D1JA 2XKJE 2A4MA 5K3OA 3L43A 5KYWA 4CU2A 1L1RA 2O9JA 1DNPA 1WSWA 3OJFA 2JW5A 5CA1B 3DTVA 2ID8A 3BE8A 3PYMA 4B81A 2NXCA 5ESXA 4EUSA 2AVNA 2B21A 2HUPA 3KTFA 3S2ZA 2YVAA 2CFSA 3OOYA 4PGAA 5C2JB 4GR9A 2GOYA 3RWBA 1AO0A 3P9CA 2BFCA 4QO8A 3VH3A 1FPMA 4OQMA 5IXYA 1WM1A 1LSSA 3WIUA 2I9KA 1LBSA 3BVPA 5HK8A 4BWGA 1EUQA 1Q50A 3WY9A 2HIMA 4NYIQ 2OLKA 3PT5A 3ANXA 1B1AA 1X7DA 1WULS 3I8XA 5KVCA 3UJ6A 5A03A 4QVIA 3DDZX 3GCDA 1P1BA 1YZ3A 2BOVA 2FE4A 1BFKA 3JQFA 3T9AA 3UMCA 1LS1A 1TW3A 1U8XX 3FYDA 1QV7A 3W3ZB 3WQBA 2ZBVA 1Y6RA 3WV4A 3U4HA 3N8KA 2JAWA 2R47A 3DPSA 1KFBB 3IT3A 4M38A 5EZYB 4G5QA 2RHTA 1YV9A 3R44A 2IYZA 2PN1A 5KC9A 1A2QA 1KE2A 4ZREA 2XPCA 4QXOA 3QVUA 4MUKA 3RSQA 5ADVA 1I8TA 1SHLA 4MO2A 3DP9A 1C0KA 2B2XA 4REQA 1GDDA 4OUKX 3ZNOA 1EYZA 1NF8A 2RJ3A 3SF8B 4MI1A 3WNQA 2GWRA 3JQCA 4YRTA 1JHOA 1BKDR 4LV5B 3SFVA 4A2CA 5C4MA 1OLSB 1GL6A 3X2EA 3RYCA 4AMZA 5EMHA 4B80A 4CN8A 1VSVA 1L4UA 3DAOA 1P5RA 3T99A 4P7FA 5LYJA 4EVSA 2H7VA 3STUA 3OTHA 4MQFB 3WXMA 5HRAA 3Q7QA 3ROZA 4MAMA 1E77A 1E6MA 3H17A 4IXMA 1JB1A 2F1OA 3FBGA 5GJWC 1LVUA 2QK4A 3BZUA 4LHYA 1I3OA 2O4CA 3TE7A 3A32A 2EKDA 3Q3VA 4UEKA 2PBRA 3RVLA 4COKA 3BXXA 4PX2A 1VCIA 1YAHA 4M7RA 4Q47A 1XKLA 3L8YA 4Y2YA 1Z5ZA 5JEEA 1EFUA 3R2JA 4E7OA 3KOMA 4UUMA 2ZBRA 4XD2A 1ZD2P 4XQGA 1PNOA 4ZYTA 2NYAA 4X71A 5GZ1A 1IK4A 3L4JA 1EG2A 3BE6A 5IAKA 3P20A 1DJLA 2O19A 5AIAA 1JFTA 2QTLA 4YASA 5JWOA 3PE3A 1GZ4A 1GPAA 2O4UX 4A6DA 2NU9B 3QFHA 4TMWA 4GPZA 4GVXA 1SXJA 1IM5A 4R41A 2C0QA 1U7WA 3R8XA 2I2DA 3DHEA 1II0A 1SKQA 1OYYA 1C1XB 4MA0A 1GSAA 3QKSB 4BQPA 3E3OA 1FRQA 1RTTA 2XVXA 3A31A 4IICA 3WK7A 4YJ3B 4JI3B 2XUHA 2NUAB 3REFA 5DHQA 5EJEA 1RRFA 3VDQA 821PA 1OASA 3EEQA 5CPBA 2C98A 3HBAA 4OJYA 5KSWB 4OYLA 1VJRA 1DQPA 1S3GA 3BGOS 2WTXA 3KU1A 3RYFB 3PQ4A 4YP0A 1CJKC 3TGLA 3COSA 1GA1A 1TYZA 2F6RA 3B1XA 3FHLA 3KJIA 4BASA 1CHNA 3LPAA 1V1MB 2OCDA 3PP8A 4DQLA 2B69A 3HKEA 4XOUA 3RHZA 3SNHA 3VZRA 4TS9A 1BJRE 2VNIA 2Y1DA 1JYSA 221PA 4WFJA 1RHMA 1N0WA 4M9UA 3WIEA 3ELYA 4FNGA 2UVQA 4HB0A 4D9BA 4IP0A 1QQBA 2NW6A 5JMWA 4YY3B 1J23A 3H2GA 3ZU5A 4PAOA 1XLTC 4MA4A 1XWIA 2FMUA 4MQLA 2G1KA 4OGLA 4BU1A 5CB4F 1T9KA 1SC4A 4KQMA 1N36B 5JARA 4LF6B 1PGOA 2W0SA 3OHPA 4TMXA 2A0XA 3TEFA 3W8FA 4KBGA 4AJHA 4B43A 1NU8A 2C31A 5CA1A 3K2BA 4ARIA 3B85A 2IXFA 3KPJA 4BEJA 4AKTA 3CNOA 1JAHA 4O4HB 2QF7A 1E3WA 1KXJA 2O14A 2BH9A 4RF4A 4R9RA 3IPAA 1S02A 4FGWA 1A9SA 5DXJA 3TRIA 1WP9A 2VHVA 1HLFA 3JQ8A 3O8DA 4MI9A 5CM9C 5KSPA 2R751 3QF4B 5AXBA 4BE9A 3H2SA 2HRCA 1S8FA 4EGFA 3AETB 2PD4A 3WLPA 2QTHA 4Q1DA 2VQDA 2ZQYA 3NHFA 1IBSA 2WHPA 1L5HA 5P21A 1M1NB 1XJ0A 2I5PO 1H2ZA 5EUCA 4YCCA 4Q5IA 1WU8A 2P6MA 2JCXA 2Z8XA 4DREA 3HZHA 4JP3A 1HEYA 4DN6A 3RYHA 1KEUA 2OORA 1NNLA 3NP7A 3I5UA 3A4MA 1GL9B 1WG8A 2JHGA 2ODWA 4TLBA 4ZVVA 2IE0A 3M4JA 1BS1A 2FQ1A 1LNZA 4H31A 1B0ZA 1TX4B 2OXCA 1CIPA 2IGBA 3HWRA 1PZNA 3WYFA 4LMBA 4GQAA 2VPPA 2ZU0C 1CR6A 2GCPA 3FVTA 4GR4A 1ZEMA 3BB4A 2PRZA 4TT3A 5TQ0A 4K8OA 1F8YA 2YIJA 4WSOA 3PCRB 2ZXUA 2F1JA 4KPYA 3P0RA 1VHQA 2H1VA 1O0SA 1XMVA 4CM9D 4Z54A 3V8BA 1KVUA 1UMDB 1BCSA 4RAQA 4Z0NA 3O9ZA 1RVDA 4U7WA 1R4AA 2GVNA 2AN5A 3MK31 2NYVA 4X94A 1GVNB 2Y99A 2QJFA 3DTNA 4E30A 5JYDA 1CYEA 4BNVA 1GCAA 1J33A 2PT5A 5DM1A 3KBBA 4MMYB 3ZPXA 4BUCA 5BRJA 4I4TA 4L7VA 5HOEA 1CWUA 1F0PA 5KDOA 2JGLA 4PPYA 4WL0A 4OFXA 2JAXA 5BN5B 3NPMA 4KMOA 4J6EA 4JXZA 2C7VA 4IQ8A 5KINB 3OQIA 4UUQA 1QGZA 2IVZA 3DGEC 1KO4A 2WFLA 2C7QA 5FI0B 1E9RA 1OPRA 1X7ZB 1PZGA 4QDXA 2JAPA 2O2YA 2HU2A 4DKXA 3O93A 3ROFA 4CV1A 4UW9A 1XTUA 3DSRA 4KPUB 3BFJA 1DG3A 3C1UA 4HDRA 4NFLA 2F64A 3GRUA 3PI7A 4NABA 1XDGA 4DTIA 2FQXA 2QPAA 1BCRA 2WABA 3R74A 4IXDA 2XDAA 3N2ZB 4IFIA 4TRNA 4LNUA 3PX2A 2AFHA 5CLGA 2AYXA 2CBXA 5AO9A 5EFZA 1B0PA 3LUBA 3MCZA 5DF1A 1PK9A 3N70A 4NE7A 5F2OA 1KZ9A 2IIVA 1CUYA 4Q4AA 1ZEJA 4MUFA 1ZD5A 2FFHA 3QFFA 4LW8A 4UTOA 4E2ZA 2HPHA 3L02A 3COVA 1OFGA 4Z51A 4B85A 2GHIA 2GNPA 3PDCA 4C2AA 4FQ5A 1YD7A 4X3CA 4C6SA 3DBLB 3L8GA 3ZWBA 2I2XB 1FP4B 4CR8A 2ZSIA 2PSHA 1NQOA 3D9QX 5FIUA 4ZAXA 1GPYA 2D0DA 3CX4A 5EP4A 2B2CA 4CMEC 5LZ9A 1WZ2A 2DOKA 3IYLW 4MICA 4IDEA 3S2YA 2IQIA 5KDLA 1OVMA 1ORHA 1FQKA 5BWCA 1K5HA 3OBBA 1X42A 1CE8B 5IDQA 4PBRA 5L8VA 3ZU6A 5IF9A 4X44A 4GS5A 2FR0A 1XR3A 3HLYA 4HNAA 3R24A 4K6HA 4OXQA 1VB5A 3CZ9A 3VM6A 3L1KA 2HMWA 2O7VA 3H05A 4BIIA 1RCFA 2WSSA 1DOAA 3PC6A 4CKCB 3KJQA 5IFLA 4C5BA 1A88A 2J31A 3L01A 4MH0R 1YDGA 4HF7A 4MSUA 1IZ8A 1E8DA 1RNLA 3ASUA 4GVPA 4N3NA 1KK0A 2XTZA 1SCKA 3R3YA 4W5JA 1ND5A 5T41A 1W6RA 3FCSB 2CLIB 1UM8A 2QA5A 2XRFA 1GG8A 1QYXA 2H52A 3P9IA 2D13A 5BPFA 4INZA 2NUPA 4J94A 3RU3A 4ZCSA 1VL1A 4EJFA 3IL2A 1OPXA 2CLFB 1A98A 2P2SA 5IARA 3DM5A 2XNCA 2QE7A 3KXLA 4FK8A 4WCFB 1L7DA 2FSVC 4BC0A 4QU8A 1IFXA 2ZP1A 3ET5A 4PG5A 3WC4A 4XRRA 2JCSA 3PNMA 4ZVTA 3KV1A 3IHKA 2JA1A 1CY6A 3MD9A 3PE4A 1H5UA 3ESQA 5B3JA 4DA0A 1ZIYA 4HNHA 3QG5A 4DV0B 1BX3A 2ZSUA 3NBAA 4IUYA 3WL4A 3BFPA 1VXRA 4R1OA 4Q7MB 4JC8A 1SBHA 3PIDA 3B6KA 3AI3A 3C7TA 4DB2A 4J43A 3PHJA 4FSDA 4JOSA 1P1FA 4NAVA 5IT5A 2GRAA 2YIVX 1G8HA 2OGSA 4ZODA 5TQ0B 4Z3KA 4QHTA 4JZYA 3K9CA 3B70A 3D3QA 1JIUA 1B8PA 1GSOA 1NRJB 3B48A 4UHBA 3TFWA 3ASVA 1E92A 4RS3A 1HG0A 4IDGA 4EG5A 5JSFA 1WJGA 5KTPA 4MTLA 4MKXA 3LPNA 1A2OA 4QNMA 5E3IA 1RKXA 4OYHA 4Q01A 4ZU3A 2BRUC 4RK1A 3C1OA 2YYAA 1GNQA 2VTDA 1M6VB 3N7AA 4G4JA 1IQUA 2HU8A 2Y0BA 2Y1GA 3NV9A 2CE7A 3SIRA 4TYYA 3TXXA 2K7FA 2O6HA 4W9RA 5B58C 4MDFA 2HF8A 3GK3A 2VHEA 1GAJA 2DFDA 2RGDA 3KD2A 4ZYYA 1XD2B 4NAHA 4TYPA 5IM5A 2FVXA 2RG1A 3EY9A 1ONBA 2HA0A 1DWPA 4BVFA 4OQDA 1PV1A 3UGTA 4WIAA 2CCKA 5L3VA 1QFMA 1CUDA 3KUCA 3MXTA 4NZPA 3ZK9A 3LQFA 2BGNA 2FVYA 1NDQA 1W25A 2HOQA 2VAVA 2DWUA 3JQ6A 4BGDA 3EMKA 4JSRA 4WN9A 3S3TA 5LU9A 3WK6A 4P4GA 5HZMA 1UIRA 4JBNA 4QOFA 2PMKA 4HNQA 4L76A 1L8AA 1U0SY 3HUFA 5ENVA 2HZ7A 3S8EA 3HTXA 4M86A 3DXYA 4F11A 1EUCB 3OEHD 5AQ1A 1YZHA 4CMBA 4M98A 1TM7E 1Z0KA 5JYBA 4C0HA 2W6ZA 1D1SA 2HF9A 2V7PA 3T41A 1TEZA 1XLWA 2C2ZA 3CE6A 2V98A 2DBZA 4OIFA 3LUKA 3GFQA 1SC6A 4IGKA 3ND7A 1G2PA 5CK5A 2JK0A 1BNCA 4OATA 2ZVDA 4M0KA 1Q1AA 2J3LA 3I04M 3PF9A 1M8GA 4BTLA 3TR5A 4GDFA 1BH2A 1GGFA 4QYSA 3IGFA 3BX1A 1RTKA 3OEED 3QPWA 3Q9SA 5LYJF 1RQ2A 2VN8A 4H1VA 2YHIB 3P9RA 2X0EA 2VYVD 2Z8YM 3X1WA 2VQFB 3MTAA 4M1EA 1BKYA 1QWSA 2GXSA 3IP1A 4UVEA 3ZDAA 4LGVA 4Q18A 5MDHA 5T4BA 4D8TA 4ZDJA 4MTCA 2COUA 2IFTA 4X3OA 4LX8A 5T64A 3NWJA 2CV1A 2A1IA 2GNOA 1P33A 2WYVA 1NVGA 3AVOA 4AQ7A 2WF7A 4HUTA 2Y6VA 3FOZA 1RLIA 1UPUA 1P9NA 1Y3CE 4KE9A 1FU4A 3CLTC 2Q2QA 4ADSG 2OCAA 4XASA 4LTNA 4AURA 1SXJD 1UFRA 2C2OA 3BXOA 4FINA 4H4EA 4XWWA 3D0QA 1UXGA 3DV2A 3SS7X 3HUUA 1U81A 1SCBA 4FOLA 3SXUA 1GTVA 3NHAA 4L4ZA 5B6JA 4RK5A 2Q8NA 1BZYA 1TU0A 4BKQA 3EIHA 4CIBA 4RF3A 1W48A 4P93A 1HG1A 2CLLB 2TSYB 1PX2A 1LPPA 1QTRA 1G5QA 1PT6A 2PMDA 4H7IA 3IXMA 5C8ZA 4BB0A 2PUGA 4LYHA 3NTVA 4N8SA 2CXQA 1Z8NA 3A4VA 2O50A 3F46A 5GONA 2PCLA 1SUAA 4TSKA 5E0OA 1O94D 4QATA 4ZRMA 4BMDA 4M55A 1NA5A 1CULC 1SM4A 3P2YA 3NYWA 4TKVA 2CY0A 3SAJA 1K3TA 3BICA 3OVMA 5KVAA 2C0CA 4IJ5A 1U4SA 1X80A 2CVZA 1FRVA 4QYIA 3LCMA 3OM9A 2WTEA 4AKGA 3Q8MA 3MS2A 1WMFA 4D2IA 1YVRA 1NKTA 2WYHA 4TUYB 6AT1A 2GARA 5CVUA 2NUAA 1E0AA 2EP8A 2D2EA 1GA4A 3D8TA 3D6TB 3DR3A 3WLKX 2XWQA 1O95A 1QTQA 1JAYA 5K45A 1M2FA 1R0CA 1KETA 4L2IB 3D3WA 1Q83A 1C4OA 1M2NA 3OFSA 1ADJA 2Q5OA 1CZRA 3IA7A 2ZB8A 1SB8A 4BVHA 3G6WA 3Q7PA 2A8YA 2VAWA 3L05A 1ECBA 1CY2A 1EFPB 1A7KA 2AEMA 3PF8A 4WZZA 4XXHA 3G9XA 2EZ8A 3P9QA 3PTLA 3C8DA 2XCOA 1I4EB 3ZGXA 2OBMA 4GBED 5DHAA 4BFUA 4YR9A 3ZDRA 1MEEA 1WF3A 1XMPA 1EFPA 2Z1DA 3PDJA 4LKOA 4Q02A 5K8VA 2GSWA 2FPKA 4KXYA 1NQ5A 1V8PA 3NEAA 4KV7A 1R18A 1NONA 4TV8F 1RYFA 4XQCA 5FLEX 2YICA 9ABPA 1KSHA 2BMAA 4K6FA 3EDYA 4F9TA 4KCGA 1X7XA 5I9MA 1K5GA 1K0FA 2R2GA 1ZR2A 3DOHA 4RIGA 4TMFA 2QN9A 2QTNA 4IHAA 5A3JA 3IAM1 3IIMA 3FCAA 3K35A 1YIOA 3W5IA 4ZGGA 4B7AA 2HHLA 3BRWA 1XHEA 3PLRA 4G0XA 2IYXA 4JLBA 4PFKA 1RWPA 2AUNA 4L28A 5DGTA 1VBFA 1NXOA 3NC4A 4XRGA 3SC2B 2OLJA 4REMA 1Q92A 3DKVA 1ESDA 1EFRA 1R0YA 3KQYA 2C03A 2XBLA 1JQKA 2XUKA 3IC5A 5AHWA 4KX5A 2R87A 4RE5A 2YMQA 5JNVA 1UDAA 4M1SA 3ZDFA 3CJRA 3RKRA 2WTAA 621PA 2L0XA 4MYHA 4PXAA 1BWSA 1TO6A 2IYYA 3NATA 4KACA 2AEEA 4OHBA 4QM6A 4B79A 4Y2QA 1U7UA 1WUJS 2WFZA 2MSCB 4Q1VA 1X7WA 4QULA 5ILOA 1WOYA 2ZR9A 3HKDB 1RHKA 1TEVA 1YQWA 1CZHA 3HA2A 3RWOA 3HM9A 2I8AA 2CK3A 3W5BA 2BI4A 5BURA 1VE9A 1D2RA 2V7EA 2WHEA 3MB8A 4IS3A 4NK5A 3EUWA 3S70A 5JISA 3WYNA 4EMSA 3B1WA 3ZY5A 1YBMA 4G67A 3SHQA 2MHCA 2YN4A 4KXNA 1E1DA 4RMGA 1G6Q1 5ALTA 3CU5A 3DZFA 5EN4A 5LYYA 3ZHSA 4ZDWA 3CH4B 4DLAA 2BFCB 2IKQA 8OHMA 2C5FA 3JQ7B 1IJEA 4JLKA 4FGLA 5BSWA 3FRHA 1UZLA 2GHQA 1HX7A 5FR1A 2Q28A 3HWSA 2IZ7A 1HFKA 6CHYA 1PJTA 1JX6A 1VPEA 4IIUA 4D5EA 4DUZB 4A36A 3QKUA 1IZZA 1ZX1A 1R9JA 3IHLA 1XRJA 5B3AA 3GQVA 2CYAA 4O1HA 4TWZA 2QY9A 4FWTA 3OM8A 5ALZA 3BEDA 2QYSA 3VNRA 3G82C 2AI2A 3R3VA 4UMVA 2QY6A 1AK1A 3ILXA 5HIIA 5SYAA 2AVDA 1OKKA 1X15A 1I14A 2VJAA 3T3HA 4HYTA 3KQWA 3Q40A 5F9HA 5BXQC 1WBDA 3H5LA 3W8EA 2QPOA 3MJFA 4S04A 4KQEA 3Q7SA 5EHNA 4OOFA 1PR5A 1I24A 5K4GA 3U4IA 2BKVA 2GZHA 1FCJA 2RBKA 3IIJA 1XXHA 3SC2A 1EUYA 3FUTA 1NVUQ 4NMXB 4WZAA 4RTLA 3WHLA 3U6BA 3DQPA 1H9CA 3QMVA 1NXTA 1S3FA 3FFTA 4LWPA 5TQ2A 3T5BA 4JEIA 1U8AA 3RADC 5FBHA 2I6GA 3AFMA 1HDGO 1A3CA 4U0KA 2BM1A 2WIAA 2WIKA 3VAYA 2Z6VA 2P0AA 2GEVA 3CBGA 3GX1A 4MRVA 2SICE 3GJRA 3V4ZA 5H0IA 1B6RA 3SS9X 4D9MA 3EPPA 2FKNA 2M1ZA 3AFIA 2XUGA 3EUAA 3P9KA 3L8EA 1F7UA 4KTTE 4H3SA 4YGXB 2PO5A 1ENZA 3IVCA 1J99A 1HA3A 3T61A 4O0MA 1XXHE 5EY5B 4XVHA 1RJWA 2F1RA 2ZRNA 5TLSA 2GVDC 1R12A 2C8LA 3GVHA 1NVFA 4C7MA 2ZWVA 5KWSA 1DJNA 4YFVA 3CTPA 3O95A 1E6LA 5DT2A 1QWOA 5CH3A 3GOHA 2AUTA 4C89A 5LP6B 1NQAO 1SCJA 1NW7A 4DR2B 2JCBA 3UHFA 1ILWA 1B6SA 2I55A 2PZEA 2X40A 2DBRA 3IQWA 4LECA 4M21A 4MX8A 1N34B 2YFHA 2YTZA 3W8NA 3EGDA 4A8JA 1JXQA 4WGFA 3U3OA 4GR5A 2HV8A 4QSMA 3MTIA 1JIJA 1X39A 2IU3A 2FW8A 4L0MA 4KXVA 4RV9A 4GEKA 4F2WA 5KU7A 2FR8C 3K1TA 2Q5QA 2XMQA 4GLLA 3B8HA 2EW2A 5CHYA 1DCTA 4DV3B 2GBCA 1N2XA 1TA9A 2PGOA 1YOBA 1ES9A 3QMMA 1G1MA 5B7GA 2YJ3A 5IVDA 3D43A 5E7MA 1C8LA 4L4SA 2HJ9A 3IKJA 2RARA 4TKVB 3CUTA 3RFCA 5GGYA 3EG9B 2NU9A 1NMEA 3O9MA 1EWYA 1MH9A 3K5PA 1KAHA 3ZE9A 4WGGA 3TQOA 3CNLA 4FCVA 5G3ZA 3UA3A 2P67A 1XT6A 1R0SA 1U28A 2D8AA 4UCWA 4QXAA 2OFOA 4AB1A 1ZK4A 4LN1A 5CNJA 5J2TB 2QLLA 1J56A 4IIDA 2X15A 3FRJA 3DDSA 4CKEA 5B6IA 2DR0A 1Z6GA 1R88A 2EWVA 4WDQA 1U0GA 1FTYA 2AG5A 1SRRA 3C3AA 4MLPA 3H6GA 4QRDA 5SY6A 2WM8A 1FUIA 4WK0B 1QLWA 3KFLA 2NU8A 3VVCA 4NG4A 3WB2A 3ZHYA 3ON5A 3WIDA 2DBYA 3SJZA 1E2PA 4BFVA 5F3WB 2Y0PA 4WFKA 3VC7A 4Q9JA 3LF2A 3O8OA 1V16B 3IQDB 3N2KA 1DBSA 1N8NA 2ZJAA 4NU0A 1U99A 4QELA 3DLHA 2UYYA 1PT7A 1SU6A 3Q1KA 4FHEA 1YHZA 4ZAWA 2A1UA 2X7JA 1DHTA 1I1OA 1E7QA 1C3VA 3OHSX 2V4MA 3GWGA 1PGQA 4R3WA 1YR6A 1Y4ZA 2GAIA 1MBZA 4BGUA 4ESHA 1Y5RA 3L04A 1S0UA 2YHAA 4CIXA 4I50B 3KU4A 4GLFA 1HZZC 1DTWA 4DM3A 4JASB 2QW8A 4RV4A 2E3JA 1K6IA 1DIRA 2ZYGA 1SU8A 3BHJA 4EY4A 1EP9A 4CF5A 3NVKI 1A8SA 1V8BA 3IT2A 3A6FA 1YS1X 4Q9IA 1SXQA 2AW3A 4FLFA 3LYUA 1GPDG 2YUTA 4HBZA 4LXIA 4ZAGA 2IXBA 3SMQA 2WICA 4XIIA 1SBCA 1QCDA 1NPDA 5KYNA 1BS2A 3I72A 1XCBA 3JPWA 3A9TA 2CMGA 2W48A 5DJ5A 5JZVA 1OB2A 1DXHA 3S2GA 1L7EA 2EARA 3FZQA 4UZSA 3WB1A 3AY6A 3FWHA 3AMVA 3N8HA 5FBRB 2VP4A 4OB8A 3D5QA 1MNQA 4OFBA 1SCUA 5E6UB 1YQDA 4IV5A 4M0UA 3ECCA 3ZS9A 3EFOB 5JAOA 3ET4A 3CLRD 3IP3A 2QBYB 2ZS8A 5MN5A 3DB1A 5E7JA 1NLUA 4O6VA 1RQPA 2C9BA 2H07A 4UTRA 1ULZA 1YR8A 1C81A 3FKSA 5AT1A 2QRMA 1Y81A 4CKWA 3KYJB 3EULA 2WZBA 3FSRA 1XBTA 1AHNA 1IEWA 2OZPA 1ISMA 4DEXA 3MJ4A 2I62A 2PZKA 1MZVA 2LRHA 1KQGA 2FJ0A 4RTOA 3L93A 3NHPA 3I0NA 3EXHA 3ZKWA 4DMLA 1ZPDA 4U3JA 4FR0A 1N5JA 1YTLA 4ASUD 3QELA 2ZDQA 4LYDA 3OJLA 4RLQA 1VSQA 5IT9A 1NI3A 3B9RA 5KI6A 5I9LA 1WDKA 1QE3A 3A9WA 5EZSA 3RBZA 4J0QA 2HQRA 3WLJA 3D4LA 5AI9A 4ER6A 5KQGA 4GSKA 1GNSA 2VXCA 2I4TA 5DK4A 5ALHA 1N8KA 1IZ9A 5ALFA 3GRYA 4TM8A 5SZJA 3ZOKA 4U00A 3FOCA 4UPDA 1YJXA 2D2IA 2ZBDA 1EM6A 1TZJA 2OUKA 3B82A 4S24A 4UU1A 2CW5A 4B8WA 5HW0A 2NYRA 3PC7A 3TW8A 3NORA 3ZY4A 5IF3A 1GWNA 3UF0A 5K0JA 2WG2A 5AM4A 4AXXA 3M34A 3UATA 1VYUA 1JDVA 3ZLJA 1EB9A 3AI2A 3PCXA 2IITA 1DWUA 2J3JA 5AKKA 4IX1A 3K16A 4PC3A 1V2HE 2QRLA 3GGPA 4CM1A 3T7SA 1FSGA 1OXVA 2JIRA 2HRRA 2X14A 2XX3A 4OJTA 1KY5A 1N75A 4PC7A 1XCPA 3U4QB 4XB2A 2HPAA 4NH0A 3ELWA 4J4BA 1TU3A 1D8TA 2B6HA 4F5YA 4YRQA 1GAXA 3JASA 3PXDA 3UHOA 1X8KA 1FFWA 2R8XA 4AY5A 3AVVA 1XCLA 4QU5A 1LLDA 1IOLA 3K0HA 4KREA 4BX9A 1LNSA 2OBFA 4FZJA 3VHLB 4EMUA 1D0IA 1KYYA 1JHYA 1VJ5A 5DM60 3GRZA 4CWAA 2ETXA 3F49S 1HYGA 2FGJA 3KB8A 1KKLA 2A7XA 3O31A 4OUDA 4QYMA 1GNPA 1XZGA 3OE1A 1W30A 4P22A 2H11A 4JNKA 1WXWA 2HRZA 4ZEMA 3MCUA 4Z4QA 2WUFA 3MOGA 2O7NA 2QENA 4G0ZA 1C41A 2FN7A 3PGLA 4FKBA 4I5GA 4MGIR 4KSCA 4BV9A 4D99A 2ZR8A 5JNWA 2GPNA 3IPCA 4NZZA 1DG1G 3Q0EA 4OHPA 3JQAA 3B1ZA 1N5OX 4KZPA 5C18A 4JVNA 3H7IA 2GVZC 3MT7A 1DC4A 2H51A 3VHXA 4CLRB 3QW2A 2Z2JA 1NBMD 2ZSJA 5C5CA 1ESEA 3T3DA 4RVUA 4AG6A 4ZYZA 1QR2A 4MQMA 3U16A 4IMPA 1GR0A 4MW2A 4E14A 1QFXA 2HSZA 3W05A 4EITA 5C5EA 2JLZA 4Z4CA 1KRXA 1F20A 1L5VA 2WJHA 3F4LA 1U1GA 1M34A 3FAKA 5AI8A 4HWOA 2FQWA 4A8JB 2B5VA 2X6RA 3T1HB 5BSEA 1INLA 2E21A 3NC0C 5FFFA 2Q9UA 2BFMA 4LVUA 4QPZA 3QBTA 3GAAA 3B9BA 4MR9A 3V97A 4X1YB 1Q0LA 2R2AA 1EZ4A 3L8FA 1P80A 3NI2A 2WYUA 4BTEA 2WVJA 2G5TA 2OECA 1IY1A 1Z26A 2Q46A 3EOBI 4F6RA 2H9IA 2MDTA 1RC0A 2QD5A 3IHTA 3M1AA 4IDFA 4JLVA 4O4IA 4F4FA 4F4HA 1GM5A 4REOA 2JGMA 1KZHA 3H1PA 4BBAA 5KYYA 4YP5A 3PQ5A 4O4JA 1U3TA 2XNDD 1Q2XA 1WHTA 2HO4A 5J5AA 4CIDA 3LC2O 4GI1A 1BSVA 4DV7B 2EIHA 3C7AA 5KU1A 1PL7A 4DJ5X 3DLAA 2QMEA 5IX8A 3L0YA 1FP4A 2E4YA 2YOGA 4AD8A 2H3EA 4II2A 5TGZA 4X84A 4JA2A 3GPCA 3WDKA 7AT1A 1JWLA 2CVHA 4AXBA 3AKCA 5IKPA 1XC7A 1ZVQA 2HCTA 1HDYA 2F3SA 3R7FA 1ZL2A 3E0XA 1GN9A 1FUYB 4Y0NA 5EL0A 3FPJA 4RSHA 5FOVA 5ULLA 1MP0A 4LFCB 1OYWA 1AJEA 2WR8A 3D3KA 3JYHA 4CIVA 2G1PA 1ICIA 4OSEA 3BTSA 1S96A 3G59A 4XR9A 2RHCA 1THMA 1YFKA 1BJKA 2EERA 4UDYX 3IR7A 3H9UA 3IV7A 4RVOA 2R6FA 1GKUB 1KY3A 3RSHA 3ZIUA 3EK2A 3NIBA 1ORIA 1BDBA 1BDJA 3ENQA 4EJSB 1GYRA 1M72A 1E20A 5LMUB 5LDHA 1MW8X 3K2IA 2JIQA 1R8JA 5AJYA 4FHCA 4XGKA 1KMCA 1Y7IA 2X9NA 2WFLB 2FPMA 3QPAA 4WK2B 5BNTA 3C1TA 3EVZA 4I5DA 1OKKD 2YN0A 5I6DA 4MA5A 5B7PA 5ISMA 2GPSA 3RVQA 2EF1A 4A73A 1YL6A 3RB8A 4LY0A 3BL8A 1SXHA 3HJUA 2PUCA 1JKMA 4BNMA 1RBMA 2IX9A 2IZOA 4V0QA 2XB8A 2OAP1 4F1WA 4RZUA 1NFQA 3JZMA 4MMZB 4N3BA 3ZLVA 4ARBA 4DCSA 3KQNA 1E3EA 2V74B 3I42A 1MOPA 3G23A 3V7UA 1N0IA 3SIWA 3OZAA 1L7BA 4JBLA 2VT2A 2GEFA 3RLFA 4AG5A 4O3MA 3ZCQA 5KYUA 5L45A 4U02A 1BXRB 3W6NA 5G0TA 3DCJA 2O3RA 1RD4A 3FA2A 1AG9A 1D2AA 2JIMA 4Q1FA 3RU9A 5ALSA 2EIXA 4EFDA 1ST2A 2EFCB 3BPSA 4BE7B 1QHSA 4S1VA 3F96A 2ZCVA 4AO8A 1TEHA 1CS0B 4IDDA 3I6IA 5JASA 2QR5A 1R5OA 2QRVA 2DC1A 4ERXA 4QAQA 1W5SA 2NV6A 1UMBA 2Q2OA 4PPQA 5DP2A 4N7MA 1G7TA 3KEOA 1L4YA 4WCFC 4C1NA 2V7XA 1E2DA 2IBTA 3EGXB 3G1UA 3P27A 4KGDA 4RZ2A 2ST1A 5T5QA 4FMCB 5I7UA 3TQRA 4OEHA 2AE1A 1YUMA 4HDOB 4M1TA 4AZTA 4LY9A 3GVXA 2PGDA 4TOIA 3DEFA 4RCVA 2PA0A 4S3MA 1K98A 3CONA 2C61A 1IE3A 4ENPA 3LQYA 1IEQA 1IXYA 3IRUA 3SQOA 3DOOA 2VG8A 1RI3A 1IJFA 1EWRA 3AEYA 2CXTA 3CLKA 4G1UC 4LXHA 1TCAA 2JFGA 1IRXA 3INNA 4LZJA 3A10A 5ALYA 4QWMA 5I9NA 1J4AA 2LCFA 1YQEA 1IIRA 4UFPA 4KSYA 3U61B 2D4AA 2LR0A 3DZKA 2F8SA 3V8QA 4GU5A 3ABZA 3WGLA 2PD6A 1DKQA 2VI5A 3CMCO 3N8NA 1V5GA 2J3KA 4PYLA 3JZAA 1N9KA 2YS6A 4KDRA 3FNFA 4IMIB 2XE6A 3KZ1E 3KLNA 5DCWA 4L27A 4N7JA 2V45A 3V7YA 5DE3A 4PG7A 5A7HA 2CN1A 1QIJA 2GZDA 3AL3A 3T54A 5CBPA 4ZVLA 1VE5A 4Z8YA 3I4LA 3CF4G 4O2LA 4C7JA 4JLJA 1QQAA 2BEUB 1TZ2A 1WB5A 2XYGA 2EFJA 4RDCA 1YJ5A 2QZZA 5ELLA 4PLTA 5A3SA 4Y9DA 3X2FA 1O95D 1LRLA 4EUFA 2OBXA 1S2MA 3LT4A 2JLSA 2PIDA 4HAYA 3BWCA 4JLWA 2NTNA 3H86A 4LMPA 3SCZA 2J3IA 3KUXA 3VOTA 4BMVA 2Z56A 2KW5A 3G8BA 4H16A 4YMIA 4CLRA 4KMSA 4ALNA 4KO8A 2GJ4A 2REBA 4CG1A 4FMCF 1CUZA 1QHEA 1SD2A 5FNVA 1A8IA 3UGJA 4HFJA 2XW6A 2WF6A 5BMVB 3UPUA 4A4DA 5JC8A 1G8FA 4AFNA 3SEQA 4PCUA 4IGIA 4O59O 1QYVA 4KI7A 1X94A 1VJGA 4GXTA 5KNCA 2DX7A 3L7YA 1BEEA 2W00A 3GEBA 4L08A 4UD2A 1CR2A 3PQ6A 4DV4B 2CXNA 2DXIA 1Z0AA 2FZEA 5B1YA 3MVEA 3FOBA 2WZCA 3KQVA 3ZR4B 1C8BA 4WASA 2DVMA 4B71A 3HYSA 2JANA 1NE7A 3G0IA 4MQFA 4PFQA 1T2DA 3C6MA 3EQ9A 4LNHA 4PLPA 3PWZA 4ZALA 1XWFA 4G4SO 3U0VA 5JUWA 4KRFA 5ECYA 1XMXA 5DNUA 3SKVA 3AHIA 3N0VA 4JBGA 1JALA 3BHMA 1TKCA 3MWYW 4G0WA 3UMSA 5K7SA 2HEIA 5BQ3A 2PWBA 4D26A 1D1QA 4C4PA 4ZVKA 3KLPX 1EFCA 4M1OA 3U5TA 1MJFA 3F67A 1U8ZA 3SZ3A 3TZEA 1CD5A 1H93A 2FDCA 2B4TO 1XZLA 2WBLC 5JFTA 3PC8A 3MT0A 1IM8A 4QTXA 5D01A 1NP7A 5AKIA 3ZGVA 2DPMA 4JJ7A 3KKPA 4ZI3A 2GBPA