1LVMA

Catalytically active tobacco etch virus protease complexed with product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMDKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATALYTIC DOMAIN OF THE NUCLEAR INCLUSION PROTEIN A (NIA)
publication title Structural basis for the substrate specificity of tobacco etch virus protease.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvmA02
1HGTH 1D3TB 3VXFH 2BOKA 3E90B 2ZGBH 3NXPA 1D6WA 1LHFH 1HPGA 1ZHRA 1O3DA 2H9EH 1WTGH 1AGJA 4CR9A 1OP2A 1A5HA 1O30A 2CMYA 3CENA 3LJJA 1DSUA 3OY5U 2G5VA 2PGBB 3Q3KA 1E38B 4Y79A 4F49A 2OTVA 5DP3A 4B71A 3MU0A 2VVCA 2UWOA 3ODDA 2ZZUH 1Y3UA 2EA3A 7ESTE 1BDAA 1A61H 1N8OC 4YTAA 1XKBC 1K1IA 3SV9A 1DDJA 1E35B 1YCPK 1X7AC 2H5CA 4GVUA 1NU9A 1P2NA 3GY2A 2FZZA 1ZHPA 2BDAA 1UVTH 4Y76A 1GJ8B 3LGWA 4Z0KA 1WU1A 3FP8E 3MO6A 1QB1A 2R0LA 3RLYH 2G81E 1Z1JA 3A84A 5F8ZA 2ANYA 1O2XA 3F9HA 1K28D 2G52A 3NPSA 2GZ9A 1QGFA 1AD8H 1GHWH 1YYY1 4YZUA 3UOUA 3QUMP 4AORA 1A4WH 5AVDA 1P9SA 4J1YA 3I78A 3VPKA 2GCHG 5T6DA 1O2RA 5A8YA 4OS7A 3GY6A 2A1DB 5EG4A 1C5YB 2BLVA 4BANB 1G32B 1GHVH 5ESBA 3MNXA 1ELVA 5K0HA 1S84A 1MTNB 3GCTF 1J9CH 2W7UA 3ATMA 2WINI 3E8LA 1QJ6B 3OTJE 4FUCA 2XXLA 4BAOB 3STIA 2GD4B 5JBCS 4R0IA 1BRBE 1NY22 1ELCA 1P03A 4NCYA 1KLIH 2H9TH 3MO3A 5J4QA 3MNBA 2FX4A 1VR1H 1P01A 1SLXB 1P2JA 4FUJA 3P17H 1G30B 1JXPA 2C8WB 3MU8A 1C2GA 2QGRA 3UIRA 4K1EA 1AO5A 1PJPA 2BD3A 1S6HA 2ZHQH 1EAWA 4OS1A 3A87A 1UHBB 1JIRA 5GWZA 2IOTA 1PPCE 1IQHA 4B2BA 3SJOA 5F6MA 1MKXK 2Q6FA 2BB4A 1P11E 5EXLA 2FEQH 4IN2A 5GCHG 1HAZB 1PQ5A 3LDXH 1MZDA 1V2KT 1W2KH 3ZVCA 1OP8A 5F8XA 3HK3B 3RXTA 3NWUA 3T27A 1FONA 5EQRA 1V2OT 2F9BH 1Z7KA 1OPHB 1LVYA 1ZPBA 5C3NA 1ANBA 1CT4E 3E6PH 3QN7A 2FX6A 2PSXA 2OD3B 3PLBA 1BTWA 1DLEA 1QQ4A 3HKJB 2AYWA 2AEIH 3OSYA 1C2HA 2SFAA 1GBHA 4YM9A 1VITG 1CGJE 1G37A 2Y80A 2PW8H 1UCYH 1YGCH 1TGSZ 4A1XA 1KDQB 2VIDA 4NIWA 5FBIA 2V3OH 4DT7B 1TPOA 5JBAS 2FMJA 3OY6U 1BBRK 2BX4A 1D9IA 2ZG0H 3PV4A 3SU2A 4YOJA 2BVRH 2P3UB 1C1RA 1HIAA 2AERH 1THSH 1ORFA 1GJ4H 3M36A 4B76A 1W11U 2B9LA 3D65E 2FYRA 1N6XA 1TA2A 3LONA 2D8WA 3F1SB 3F6UH 4FVDA 3RXFA 5EU8A 1G3EA 4NIVA 3GICB 4MQAA 2NU1E 2EI7A 4X2XA 4AYVB 5GDSH 1KLJH 1TNGA 1GI3A 4MPVA 2Q6DA 4U01A 4BAKB 3SBKA 1CT0E 3IITA 1EOLA 5A0CA 4INLA 1DPOA 1XUKA 3GDVA 3RLWH 1Y3YA 2VU8E 3U8TH 1O2VA 3P8NA 4GLYA 2J95A 4CBOA 1E34B 2J38A 4GCHF 4X2WA 3G01A 4DW2U 1SFQB 2CN0H 1BTXA 2BMGB 4MNYA 1IAUA 3QK1A 4Y8XA 3PMJA 2HPQH 4ISHH 4YLQH 3S9CA 1Y5BT 1GHZA 2VIQA 1YPEH 5L2ZH 3A82A 2PSYA 3K65B 1GDQA 5DP6A 1S0RA 3F68H 1UTNA 3HGPA 4X8UH 1ZTKA 4VGCB 5E0HA 2AGIX 3P8OA 3RDZA 1J14A 1SGTA 3KNXA 1HYLA 1UK4A 5ABWA 5K7RA 3U1IB 1ZRKA 2QF0A 3A7XA 1TGBA 1AFQB 3GDUA 2Z3CA 1HJAB 4DIIH 1N6YA 1GGDB 1GJ7B 3QO6A 3GCOA 1L4DA 2FOBA 1ABIH 1UVUH 5EGMA 2BVSH 1LO6A 2VIWA 4LK4A 3EGKH 3TH4H 3UWJH 2FOMB 5J4SA 1WV7H 4Y6DA 2K1QA 1SGNE 1UTLM 1MBQA 1SGRE 1H9HE 1BTYA 3V3MA 1O2SA 3M7UA 1FMGA 1AWHB 2WUCA 3HKIB 4SGBE 5C5OA 1MKWH 1O5EH 2PWXA 5EXMA 3EA8A 1GVLA 4ZMAH 3RM0H 1DFPA 1OWIA 1TNLA 2THFB 1ID5H 3SO3A 3RXIA 5FHTA 1TPSA 1A2CH 3FP7E 3GY7A 2G4UA 1C2IA 2BY8X 2B7DH 4JK6A 2BLQA 1SGYE 3LH3A 2A7JA 1F0UA 1TOMH 2V3HH 1G36A 5FCRA 4B2AA 4AZ2B 2Y5GA 4O03A 4JZDH 4MNWA 1TE0A 1GI7B 2M5TA 1BBRE 2STAE 3PWCA 1W10U 1CHOF 3BG4C 4JZFH 3BF6H 4K3JA 1IQIA 3LU9B 3ATWA 1GWAA 1D4PB 1O36A 3I29A 2XC5A 3RXKA 2BY7X 1ELTA 4Z6AH 4CRFA 1QFKH 4K8BA 4H42U 3HK6B 5FPSA 3ZV9A 3A8BA 3SU6A 2PKAA 3O8BA 1TQ0B 5AFZH 2Z9IA 1F5KU 1QBOA 1V2TT 4UFEH 4NZQA 4I8GA 3PLKA 1GG6C 2XCNA 3KHVA 1T4UH 1VJAU 3E16B 3JZ1B 1O3NA 2ASUB 4VGCC 1GBTA 1C4U2 1C5QA 1AUTC 3T28A 1YPJH 1GJDB 2CXVA 1Y3XA 2XW9A 1K9OE 3WY8A 1HUTH 3ZZBA 1EASA 1AVGH 1AFQC 1HCGA 1L1NA 3SU5A 4FUHA 1O2NA 1O5AB 1WUNH 3SU0A 4ISLA 3A80A 1GGDC 1XX9A 1KXEA 3QX5H 5GXPA 2A4QA 2GT8A 1WTHD 4LZ1H 1BITA 1LQDB 1M9UA 1SI5H 1MTWA 1C1QA 3RU4T 3BTGE 3T29A 1PPFE 3PTBA 3FVFB 2ZECA 3AVZA 1O33A 2BOHB 2W3IA 5GJ4B 2QN5T 3SQHE 1Z1IA 2HLCA 1LMWB 2BQ6B 3SJIA 1C5NH 1EP6A 1FIWA 1HNEE 4Y10E 2F91A 1P12E 1YCPH 3ZVAA 4D7FA 2QF3A 1HAIH 2PUXB 1LPGB 2P59A 3M37A 4NFEA 1HXFH 5EPNA 1O2OA 4NA7A 4DOQA 2C8ZB 1GMHG 2ZGHA 4MNVA 2BD9A 4IN1A 1KLTA 1RTFB 3SGAE 5HXFA 1GJAB 4OS6A 2Y82A 4CRCA 3MI4A 3ZZ6A 4X1PU 1KXCA 1Y3WA 1Y8TA 1UTKA 3TH2H 8GCHG 4GSOA 2V6NA 4YO9A 2SGAA 1D3QB 3TK9A 1BB0B 3SNAA 1LKAA 2ZDMA 3SUDA 3QGJA 3SV2H 2I6QA 2O8LA 4WJG2 1FPCH 2NU2E 1XUJA 2SGPE 2W26A 1VCWA 2Q6GA 4DGJA 3ZYEA 3UNSA 1OWDA 2BY6X 5TCCA 3UQOA 5LPEA 3RXQA 1SHYA 1YM0A 3GYLB 1C5TA 4DJZB 3LGUA 1C1TA 5T6FA 5B6OA 1C9TA 1SGPE 2IJOB 4CH8B 4GUXA 4XSKU 4K8YA 1BZXE 1NO9H 4K60A 2R3UA 3PWBA 1NRPH 1XUGA 2ALPA 2BD4A 4WXIA 4NSVA 4IC6A 5EQQA 1D3PB 2YNBA 3IWMA 4KKDA 4AX9H 3EDXB 1RRKA 2A4RA 2A32A 2J9NA 1C2FA 3DT0H 4I33A 2GCHF 2WV4A 1H9IE 1GHYH 2QXGA 4AOQA 2VWMA 2OLGA 5DGJA 3ZZAA 1AKSB 3LC5A 1PYTD 1BQYA 1P05A 4FU9A 3Q77A 3VB5A 2FXRA 1OWHA 1MKXH 1PPGE 1TGNA 4U32A 4O9VA 4XOJA 3B8JA 3V12A 5CHAC 2BQWB 2Y5FA 1SG8B 1D3DB 1VJ9U 4FUGA 1BT7A 1QL7A 2TGTA 2TPIZ 1GCTB 3BIVH 1EJNA 2B5TB 2OC1A 3RXRA 4KTSA 4I8KA 1CGIE 4H4FA 2ZU2A 1J16A 3QZRA 1SOZA 1BJVA 5EW2H 4NFFA 1UVSH 2WPKS 5A09A 1UHBA 2VJ1A 5HYOA 1B5GH 1P3CA 2VIPA 5LH8A 5F03A 1SSXA 5EPYA 3BTTE 1FY8E 1LHEH 1O3PB 1ETRH 3UR9A 1ZYOA 1ACBE 1MCVA 2FWWA 3QTVH 1AZ8A 3EA9A 1O34A 2GDDA 4ZH8A 3M61U 2ZEBA 1F0TA 3PROA 3GYMA 4ZKNU 5GCHF 4MVNA 2SGDE 2AGEX 4NSYA 1IHTH 1QBNA 4B73A 1S83A 2AIPA 1QR3E 4Y0YE 3LIWA 2BDBA 4Y7BA 2OUAA 5ETXA 1CVWH 3A8DA 1EPTB 4JZIA 3SU3A 4TYDA 2XC4A 3O8RA 1JBUH 2BY9X 3RC4A 1MAYA 1SB1H 1ZSLA 3SUGA 1GHAG 4Y0ZE 4Y11E 3NK8A 4ZKRU 1QQUA 2ZGCA 2PLXA 1MCTA 2ZHDA 2HWLB 1KDQA 2VH0A 3RXHA 2ZDNA 4FU7A 3A81A 1LVBA 1O3GA 3FZZA 2PHBA 1BMNH 3RMOH 1TWXB 1E0FD 4F4OC 1UVOA 5IYTA 1A0HB 3TGKE 2F9VA 1TNIA 2Y7XA 1EATA 4ABAA 2SGFE 1HRTH 4ISIH 3VB6A 5FX5A 2P8OB 3UUZA 1TBRH 4B2CA 1G3CA 1UMAH 1ELBA 3EA7A 1ARBA 3ZVBA 1B7XB 1FLEE 3AW0A 5DK1A 4DVAU 2Y6TA 2FLRH 1WQVH 3TJOA 1CBWC 2AS9A 2F3CE 1C1UH 3VEQB 3CS0A 3M35A 4BTUB 1TONA 2A31A 4OGXA 2FOHA 1H1BA 3A8AA 1GJCB 4R8TB 5EQSA 1OWJA 2VB0A 1SGFG 2FYQA 1MD8A 1UTJA 2ZHFH 3DFJA 1HAVB 1C2DA 2QXHA 1O3IA 1DSTA 2ZA5A 3GISB 4FUBA 5E8EH 2A2XH 1JIMA 5FAHA 1GBCA 1SQAA 1BTZA 1YPKH 1G9IE 1QCPA 1TLDA 2R2MB 3BTHE 2BDCA 4HGCA 1K1NA 1U6QA 4AYYB 1O3AA 4BAMB 2Z3DA 3UPEA 1ARCA 1O2TA 1TRMA 4BOHA 6LPRA 5LPFA 3E0PB 3SV8A 1NTPA 2RG3A 1QY6A 1C1MA 5FCKA 5C1YA 2FDAA 3EAJA 4O97A 2KAIB 1MTSA 1KXAA 4RSPA 4GAWA 4I32A 1L0ZA 1Q3XA 2DE9A 1EPTC 1IHSH 1ZPCA 3M3VA 4O3UA 1PQ7A 4B75A 1C1SA 2O8TA 2ZU4A 2XWBI 2HALA 1DANH 1YPHE 4AB9A 4KELA 3F9GA 1CO7E 4NA9H 1ZMJA 2BD8A 4K1TA 2CHAB 4CR5A 1CA8B 3RXJA 3TJVA 1DWCH 1IQMA 3MHWU 4PROA 3UFAA 4A1TA 3S9BA 4GHQA 3S69A 4MLFB 1HAXB 5BPEA 1MUEB 1SC8U 2ANWA 4CRGA 3P8GA 2Z9KA 1C5PA 1V2RT 1TGTA 2P8OC 3M5OA 3L3TA 1GI8B 2ZDVH 4SGAE 4BTIB 1DXWA 1EX3A 2C8XB 4WXVA 4ABHA 2P94A 4LXBH 4WMFA 1K22H 1QHRB 1SR5C 4FVBA 1WOFA 1GBLA 2FPZA 1HLTH 2FI4E 2JH5D 1T31A 1A5IA 1MH0A 1AWFH 4KGAA 1GBAA 1NRSH 1S0QA 3A7WA 2VNTA 4YT7H 1AY6H 4AFSA 1C5UA 1O5BB 4RN6A 1J15A 4ZXXH 2BDYA 4NA8A 2BZAA 1GBFA 3PLPA 4THNH 3HGNA 2CJIA 2BHGA 3GY8A 4E7RG 1FY1A 4Q80A 1EZXC 1ZJKA 5CMXH 3TGIE 1EJMA 4Y8ZA 1K1JA 2A7HA 2P16A 2D2DA 3TJNA 3SUEA 2GMTB 4M7GA 2CGAA 1T8LA 4X8TH 5ESTE 1FN8A 4AGKA 2BD5A 1Z8JB 7LPRA 2HNTF 4XBCA 2ZFRH 2F9PA 1QRWA 3FAOA 1YPGH 4DG4A 2ZU3A 1K1MA 1BIOA 3U1JB 3TGJE 5TJXA 4OS5A 2GTBA 3P6ZB 1SLUB 5HMAA 4CBNA 1UO6A 5FXLA 3SORA 4K1SA 4ABBA 1RTKA 1V2PT 3UREA 2FTMA 1OP0A 1RTLA 1MTNC 1WQSA 1GJ9B 1S6FA 1C5MD 2ZCHP 2AFQB 2C93B 1P2OA 1YPHC 2AH4X 1J8AA 3M7QA 5T3HA 1QNJA 1NM6A 4CRAA 1TNHA 1IQKA 3SV6A 3T5FH 5DP5A 1S82A 2CF8H 3KL6A 3D62A 4IC5A 4XE4A 2A4GA 3BTQE 2VVUA 1MU8B 1HJ8A 2UWPA 2QYIA 3QZQA 4JK5A 3RP2A 5FPYA 3RMLH 2HNTE 1TPAE 3RXDA 3NUMA 1C9PA 4YOIA 5E0JA 3LT3A 4X1QU 1K1OA 1F5LA 3RUOA 1OKXA 3ZZ3A 2BDHA 4BXSA 4CHAB 2Y7ZA 5JYIA 2CF9H 1GMHF 1O2GH 1GBIA 1SPJA 1FZZA 1F2SE 1TQ7B 5DP4A 2BY5X 1DX5M 1EZSC 1OXGA 1QIXB 4TPYA 5JPMH 1GBDA 5AFYH 3AW1A 1GBKA 1S85A 2GV6A 3BEFB 1XUIA 1KY9A 8GCHF 2G51A 5DP7A 2AIQA 1HAPH 1O3LA 2YNAA 1PPBH 3SV7A 2PGQB 1TAWA 1OYTH 3LOXA 5I25A 3E0NB 1HDTH 1K1LA 1MBMA 1VITH 2FS9A 3BN9A 2OC8A 2ZI2H 1AHTH 3QWCH 1NN6A 3BSQA 2O9QA 2GGVB 3ZZ9A 1QBVH 4K5ZA 2ZC9H 1TX8A 3ZVDA 1AU8A 3KQBA 4XBDA 5E0GA 3SJ9A 4E05H 1O2HA 1ESTA 1ESAA 3E91A 4FXGH 4ABDA 1ZHMA 4K69A 3RXEA 2Z94A 1AKSA 4BTTB 1DITH 1TNKA 4WY3A 1NPMA 4X6MA 1DWDH 1LDTT 2NU4E 2ANKH 3ZZCA 3DFLA 3GY4A 5LGOA 1QB6A 1V6DA 1GI0A 1FJSA 1C2KA 2FS8A 1BTHH 1F0SA 2ZDLA 4ZROA 1P10A 2BVXH 2Y5HA 4X0WU 1O5DH 3GY5A 1GI4A 2STBE 5G4BA 3SU4A 3P8FA 5FBEA 3KCGH 1BUIA 1LVOA 3W95A 2ZTZA 3A7YA 1V2MT 3NZIA 2HVXA 3LH1A 2SGEE 1BMAA 1FPHH 2PR3A 1ZLRA 2GDEH 1EQ9A 2JH6D 2ZP0H 1O2ZA 3L33A 4WMDA 3QTOH 1P2IA 2GX4A 5HM2A 2XBVA 2HNTC 1DT2A 1FN6A 3PTNA 2W5EA 4LOYH 4Q2KA 1O2IA 4MPXA 4I8HA 4MG3A 2ZF0H 5GIBA 2VINA 1PPEE 1IQGA 3M3SA 1BTUA 3URCA 3MO9A 1NRQH 3BTWE 2ULLA 1C5VA 2QA9E 1L1JA 1QRXA 1LCYA 2OQUA 4AN7A 5DP9A 3TH3H 4IS5A 3LKWA 3KF2A 5T6GA 2D26C 3SNBA 5C1XA 1G2LA 1K1PA 1NC6A 3RXBA 1EPTA 1YC0A 1GJ6A 1H8IH 1GL1A 2G5NA 4A1VA 2P93A 4JYTA 1YLCA 3Q3XA 5JBTA 3MMGA 1NFYA 1MAXA 1L2EA 2H2ZA 4LZ4B 1DXPA 4ZHLU 1HJAC 1V2JT 5I46H 2ZDAH 4TWWA 1O5CB 1C1VH 1QJ7B 5FX6A 1GI1A 1Q2WA 1V2LT 1QA0A 3ZZ5A 4BXWA 1DUAA 2ZCLP 1CE5A 1GHAF 3RXGA 3BTDE 1C5RA 4TY6A 4ABGA 4I8JA 2Q1JA 1NFUA 2ZU5A 1SQTA 4E7NA 5BRRE 1BJUA 1EAXA 2ZDKA 2H6MA 3ODFA 7GCHG 4X2YA 2ZFSA 4YOGA 1SLWB 2RA3A 3PB1E 1LQEA 2VGCB 1K21H 3PO1B 3P92A 3RMMH 3NKKA 1IQFA 3D49H 3KEEA 3VB4A 3MNCA 1SGCA 2J2UA 1INCA 1XUHA 3RMNH 4YLUA 1BOQA 3H5CB 1DS2E 1GHBF 2WPHS 5IDKA 1GI9B 4H6TA 3K2UA 5A8ZA 1RIWB 3UNQA 1EZUC 1HB0B 2VWNA 1P2KA 4WH8A 1O37A 4ESTE 1CQQA 1HAVA 3PMHB 1IQJA 4TY7A 5CE1A 2FOCA 1THRH 1QURH 3RU4E 2Z3EA 1GI2A 1OSSA 4DURA 4RKOB 1GMCG 4IW4E 2FO9A 1TGCA 3T25A 1L1GA 1O3HA 1A1RA 1Z6JH 3UR6A 3GOVB 3LGTA 1VGCB 3AAUA 1PQ8A 2SNWA 1O2WA 3MNSA 1MTVA 5JB9S 3FANA 2C3SA 1ELEE 4NWKA 1C5SA 2XC0A 3BTFE 1NZQH 4IBLH 1MMJN 2HGTH 2I6SA 5FPTA 3RXLA 1C5XB 1P2QA 1LPZB 1Y59T 1THPB 1W8BH 1AVXA 2ZTYA 2OINA 4D76A 1W0ZU 3JZ2B 2KAIA 4B1TA 2BLWA 1UK2A 3K9XB 1P06A 1A7SA 1QB9A 3LPRA 4MPUA 4GHTA 1Y5UT 2F83A 3T26A 2DUCA 4J2YB 3ITIA 3R3GB 1V2QT 1SL3A 4D7GA 1C5OH 5TCAA 1KTSB 5L2YH 3MU5A 3K6ZA 3M3TA 1O2MA 2FOAA 4H6SB 2XNIA 4CH2B 1AB9B 1AZZA 2JETB 3RXOA 1W7GH 2VIOA 3SI3H 2NU0E 1C4V2 2TGDA 3SNDA 1RD3B 1OWKA 6CHAB 4ZUHA 4MPWA 4Q7YA 3D23A 4ZKSU 2SNVA 1TMTH 1DM4B 4WH6A 1SOTA 4MNXA 3GCNA 4BAQB 1RXPA 2ZHWH 3EYDA 1C1OA 1GVKB 1XXDA 3PO1C 4A6LA 2ZO3H 1Z71A 1F0RA 5A0AE 2UWLA 2J94A 1O39A 1IQLA 1HAHH 1TFXA 1XKAC 1YKTA 1RIWC 3ATKA 2XWAA 4ZXYH 1KXFA 2XCFA 1XUFA 1C2LA 1T8NA 1GBBA 1TMBH 1UCYE 2VWLA 1T7CA 1F92A 4NG9H 3SQEE 3Q76A 1BBRH 2C8YB 1IQEA 1IOEA 1CSOE 1CGHA 1TMUH 1VCPA 2YOLA 4ZKOU 5LPRA 2GZ8A 4JZ1A 3DA9B 1VCQA 3MH7A 1O2YA 1O3OA 1AI8H 2ODYB 1P3EA 4KTUA 1FV9A 2VH6A 2ZGXH 3MOCA 1W12U 1GCDA 2H5DA 1ZTLA 1AE5A 3FP6E 3O8CA 2FOGA 4CREA 9LPRA 4JYVH 3STJA 2EI6A 4X8SH 1C2JA 1A0LA 1SGQE 1W3CA 2QV1A 4X1NU 1P9UA 2FOFA 3A83A 2BDGA 1C5WB 1ZOMA 2XTTB 4CRBA 1ABJH 3U69H 3P70B 1GHBG 1NFWA 3ESTA 1TBQH 1BMMH 2F9UA 2QAAA 1SHHB 3TLOA 2ZHEH 1ELAA 2XBYA 4FU8A 3U8RH 4UDWH 3PYHA 2BX3A 1SLVB 2AMQA 1AB9C 1ZMLA 1B0FA 3T62A 3M7TA 1GCTC 3TK5A 1Z8GA 1EKBB 3A8CA 5HGGA 3HPTB 6CHAC 2XBXA 2XYAA 1F5RA 4X2VA 1QA7A 4QT8C 2JH0D 5EODA 2Z7FE 1DUEA 1O31A 1ZGVA 2JKHA 1DY9A 1SVPA 1UTPA 3NCLA 3U9AH 2W3KA 1MQ6A 1ZJDA 3RC6A 3ZVEA 3CP7A 2ILNA 3SUFA 1ELDE 1YCPM 2Z9LA 2FIRH 3QLPH 2ZIQH 2W7SA 1CT2E 1BHXF 1OOKB 3MYWA 3A88A 1RJXB 3M5NA 3RC5A 3AAVA 1EZQA 4BAHB 1TNJA 2UUJB 4ZAEA 4TWYA 1O2KA 1W13U 5C20A 3MTYA 1DWBH 1S81A 3RXVA 3SHCH 1O2JA 5DO4H 4U30A 4X6OA 1TA6A 1HJ9A 4K2YA 1T8MA 4XFQA 1V3XA 4XBBA 2P3FH 2RA0A 3SOSA 4YT6H 1AQ7A 5HM9A 1A0JA 1WBGB 1SBWA 1BRAA 1MZAA 1T4VH 2DE8A 1BHXB 5C5NA 4DIHH 5DG6A 4U2WA 3TNTA 1UJ1A 2ANMH 4ZHAA 1A5GH 1P2MA 2A5KA 8LPRA 1UTQA 2ODQA 3E3TA 2ODPA 4B74A 1P09A 3HATH 4DCDA 3SI4H 1GMDG 2TGPZ 1BRUP 1ESBA 1EOJA 4HTCH 1O2QA 3GCHB 5EOKA 1W0YH 3C27B 2GCTB 3ZZ8A 3BTME 3SU1A 4NGAH 1HXEH 3S0NA 1YPMH 3A7TA 1ZMNA 4KTCA 3S7HB 3URDA 2UUYA 1EB1H 1GI6A 4MDSA 2WPMS 3SGBE 2GZ7A 4FUIA 2PTNA 2G00A 5GPIB 4AG2A 1O38A 1LKBA 3KGPA 1GJBB 9ESTA 3A86A 1C5ZB 1O0DH 1EXFA 4GPGA 5JDUB 3SHAH 4WWYA 3DHKH 2ESTE 1P02A 3ZV8A 2ZFFH 1H8DH 1TOCB 7KMEH 1FY4A 4WMEA 4AB8A 2ZNKH 4X1RU 1FNIA 5PTPA 1AMHA 1JWTA 3SZNA 4BNRA 1EAIA 1PPHE 4MTBA 1GDNA 3M5LA 4DY7B 2WYJA 1WSSH 1K2I1 4NIYA 2G4TA 5EW1H 5EXNA 6ESTA 1TRYA 2FI5E 3K6YA 3OU0A 2BD2A 1MQ5A 3SN8A 1SGEE 3ZYDA 1A46H 1SQOA 3RXPA 1PQAA 3MU4A 2XBWA 3LGYA 3LGIA 3ENSB 3V13A 4IMQA 2WPLS 2WYGA 1FY5A 6GCHG 1AE8H 4X1SU 2CHAC 3KN2A 3MWIU 4FUFA 2ZTXA 3ZZ4A 1Y5AT 2GV7A 1L4ZA 1HAGE 2OC0A 2EC9H 1ZR0A 4Q7XA 1FI8A 3RXAA 2D1JA 5E2PA 3UY9A 4AFQA 1MU6B 2OCVB 1WCZA 4TPIZ 1GVZA 1IQNA 2O8UA 1ANDA 7GCHF 3N7OA 1T8OA 1FDPA 1EB2A 2Y81A 3BG4B 1O2UA 2PV9B 2ZU1A 1HBTH 4NZLA 1YLDA 2J34A 3GCHC 4ISNA 1RFNA 1OS8A 3BEUA 2Z9JA 3TNSA 1A3EH 2GCTC 4OGYA 1AFEH 3MH6A 1H4WA 1ANCA 1TPPA 3SNCA 2AMDA 1H9LB 4HZHA 1YBWA 1C1NA 1O3CA 4WF8A 3TJUA 3BV9B 2A5IA 1ELGA 2P3TB 4INHA 4NWLA 3MFJA 2BZ6H 3A7ZA 1GMCF 2FODA 1EUFA 1NS3A 1ZSJA 1GG6B 1EAUA 2C4FH 2NU3E 4OS4A 1Z8RA 1FQ3A 2GMTC 1XM1A 2LNCA 1G3DA 1JMOH 2ZWLH 3KQEA 1F7ZA 1UK3A 3MU1A 1TB6H 3GCTG 2FOEA 2RDLA 2ZKSA 1HAOH 2PFEA 1UTOA 4KP0A 1GL0E 2Z9GA 1C1WH 2XRCA 3TK6A 5A0BA 3S7KB 1DICA 1ZPZA 1SGFA 3P95A 1O3JA 2QCYA 2GT7A 1O3KA 1YP9A 1DLKB 5E2OA 3IG6B 4D9RA 1NROH 2ZPRA 1XVMA 3BTKE 2BDIA 1C2EA 1VZQH 2ZPSA 4RKJB 1LHCH 3EE0B 3LC3A 2Z6BD 1NU7B 2PUQH 2OP9A 4Y71A 1O2PA 1P8VC 4XDEA 3PMBB 1DWEH 1C2MA 3AASA 3V7TA 4D9QA 2WV5A 1ZZZA 3W94A 2WPJS 3Q3YA 1W7XH 1V2ST 2TRMA 5AF9H 1OWEA 3B23B 2H9HA 2ZQ2A 3BEIB 3L6PA 2F9NA 1HV7A 1WAYB 1EJAA 3M5MA 1FUJA 3SW2B 2ALVA 3OYPA 3Q00A 1N1LA 3UWIA 1LHDH 1ZTJA 2WUBA 1SMFE 4CHAC 2ZQ1A 1KXBA 3S9AA 1NESE 8KME2 3BG8A 3VB7A 1TRNA 4ABIA 2V0BA 1GI5A 1TALA 4UFFH 3GY3A 1G3BA 1QL8A 3QGNB 1DVAH 1A3BH 1T32A 2PKSB 3A89A 2RCEA 1AIXH 3RXUA 4AGJA 2R2WU 2FM2A 1OYQA 1V2WT 1XMNB 3MH5A 1MD7A 4UFDH 2R0KA 1TIOA 2ZFPH 4Y7AA 2B8OH 3EQ0H 3A7VA 3U8OH 2BLOA 3KIDU 1CU1A 1TX6A 2VIVA 5C2ZA 1KSNA 1JRTA 2F9OA 1XXFA 3LJOA 2A4OA 3ZZDA 1WYKA 1DOJA 1QL9A 3RXSA 2VVVA 2GP9B 5L30H 1HIAB 2G55A 2AGGX 4UONA 8ESTE 5CHAB 3T2NA 2QXJA 2WPIS 1PPZA 3TVJB 3H7OA 2PTCE 1BA8B 1Z6EA 2O8MA 3H7TA 1UCYK 2QXIA 2ZFQH 4A92A 4O3TA 2HPPH 2QIQA 1O3BA 5DP8A 2UUFB 1Y3VA 3ZVGA 1AUJA 1KXDA 2IPHA 4JMYA 4ISOA 1J17T 1O35A 3UTUH 2OQ5A 3O8DA 4IGDA 1JOUB 4JCNA 2NWNA 4GCHG 1CA0B 3ZZ7A 1CHGA 1P57B 1ETSH 3U98H 4ABJA 2BYAX 1GBMA 2ZCKP 1O5GH 1YPLH 2J4IA 3VXEH 4YESB 1ANEA 1KTTB 1SGIB 2ZFTA 3DUXH 3PMAB 1LTOA 1PFXC 1O3MA 3E1XB 1FAXA 1HAYB 1V2NT 5DJ7A 3ZVFA 1LHGH 2FP7B 2AMPA 3VB3A 3ATLA 1NRNH 1ETTH 3FZDA 1FXYA 2R3YA 1KIGH 2OBQA 1DE7H 3I77A 1ZSKA 2HOBA 4NIXA 4HI3A 4UFGH 5A2MH 5C67A 4ABEA 4INKA 3RXCA 1C5LH 2ZGJA 2ZPQA 3VGCB 1O5FH 2OC7A 4D8NA 2BXTH 1V2VT 2VWOA 1PYTC 3UOPA 2PKSC 1O3EA 4FUEA 1ZGIA 2QC2A 1C4Y2 1TYNA 2BD7A 3ELAH 1GPZA 4X6PA 1SFIA 1Z8IB 4I7YH 4I8LA 2A2QH 1Q31A 2BTCE 1SGDE 2BM2A 4UEHH 2EEKA 2A45B 2GKVE 1QRZA 2OBOA 1ELFA 1KYNA 1O32A 3MH4A 5L6NH 1OX1A 5DKMA 4JYUH 4Y8YA 1RS0A 1LPKB 1V2UT 2FI3E 2P95A 1BMLA 1CBWB 2IN2A 2QY0B 1UTMA 2OXSA 3RM2H 2VGCC 1CHOG 1TABE 1RGQA 3SGQE 1GJ5H 3BTEE 1XVOA 1BCUH 4X8VH 3A85A 3B9FH 4E06H 2UUKB 4AFUA 5C1UA 1UVPA 1MKWK 1N8OB 1FIZA 4Q7ZA 2FLBH 2HRVA 1GMDF 2GVFA 1AVWA 1FAKH 4A7IB 3RXMA 1MTUA 2LPRA 2TIOA 3VFEA 1CA0C 1E37B 1P04A 3OX7U 1GDUA 2FTLE 4AG1A 3UQVA 3SJKA 4ABFA 1FY3A 1LVMA 1HFDA 3BIUH 3DD2H 4OS2A 4IMZA 2J92A 4ZHMU 3SJ8A 5A8XA 2BQ7B 2O8WA 5JBBS 1YF4A 1G2MA 3QDZB 5DPAA 3PM3A 3FFGA 2V35A 3TIUA 3UNRA 2CV3A 2TGAA 2PKAB 1NFXA 1B0EA 3F9EA 1GBJA 1VGCC 1NT1A 1O3FA 1W14U 2H1UA 2A0QB 3SNEA 1GHXH 1TBZH 4UE7H 2EI8A 5F8TA 2A5AA 4CRDA 3TU7H 4JZEH 3R0FA 4A5TS 3C1KA 1JRSA 4ASHA 3LGVA 2B0FA 4UD9H 3KQDA 1O2LA 4HFPB 3RU4D 3TITA 5H4IB 2FESH 3VGCC 1C1PA 1GBEA 3CS7A 1P0SH 4WVPE 1BRCE 3TPIZ 1EP5A 5SGAE 1D6RA 2A7CA 5AHGH 1ZRBA 2R9PA 3F9FA 4AFZA 4FUDA 3ATIA 2BXUH 1VITF 1S5SA 2TBSA 1NRRH 4X6NA 3KQCA 2C90B 1BTPA 1QJ1B 5JB8S 3V0XA 1E36B 2G8TA 1AN1E 1TX7A 3GDSA 4I31A 2JETC 2SGQE 1QTFA 1DY8A 6GCHF
chains in the Genus database with same CATH superfamily
1HGTH 1D3TB 3VXFH 2BOKA 3E90B 2ZGBH 3NXPA 1D6WA 1LHFH 1HPGA 1ZHRA 1O3DA 2H9EH 1WTGH 1AGJA 4CR9A 1OP2A 1A5HA 1O30A 2CMYA 3CENA 3LJJA 1DSUA 3OY5U 2G5VA 2PGBB 3Q3KA 1E38B 4Y79A 4F49A 2OTVA 5DP3A 4B71A 3MU0A 2VVCA 2UWOA 3ODDA 2ZZUH 1Y3UA 2EA3A 7ESTE 1BDAA 1A61H 1N8OC 4YTAA 1XKBC 1K1IA 3SV9A 1DDJA 1E35B 1YCPK 1X7AC 2H5CA 4ACBA 4GVUA 1NU9A 1P2NA 3GY2A 2FZZA 1ZHPA 2BDAA 1UVTH 4Y76A 1GJ8B 3LGWA 4Z0KA 1WU1A 3FP8E 3MO6A 1QB1A 2R0LA 3RLYH 2G81E 1Z1JA 3A84A 5F8ZA 2ANYA 1O2XA 3F9HA 1K28D 2G52A 3NPSA 2GZ9A 1QGFA 1AD8H 1GHWH 1YYY1 4YZUA 3UOUA 3QUMP 4AORA 1A4WH 5AVDA 1P9SA 4J1YA 3I78A 3VPKA 2GCHG 5T6DA 2GJGA 1O2RA 5A8YA 4OS7A 3GY6A 2A1DB 5EG4A 1C5YB 2BLVA 4BANB 1G32B 1GHVH 5ESBA 3MNXA 2KFWA 1ELVA 2WV9A 5K0HA 1S84A 1MTNB 3GCTF 1J9CH 2W7UA 3ATMA 2WINI 3E8LA 1QJ6B 3OTJE 3KQ5A 4FUCA 2XXLA 4BAOB 3STIA 2GD4B 5JBCS 4R0IA 1BRBE 1NY22 1ELCA 1P03A 4NCYA 1KLIH 2H9TH 3MO3A 5J4QA 3MNBA 2FX4A 1VR1H 1P01A 2VBCA 1SLXB 1P2JA 4FUJA 3P17H 1G30B 1JXPA 2C8WB 3F0PA 4FOUC 3MU8A 1C2GA 2QGRA 3UIRA 2JIZD 4K1EA 1AO5A 1PJPA 2BD3A 1S6HA 2ZHQH 1EAWA 4OS1A 3A87A 1UHBB 1JIRA 5GWZA 2IOTA 1PPCE 1IQHA 4B2BA 3SJOA 5F6MA 1MKXK 2Q6FA 2BB4A 1P11E 5EXLA 2FEQH 4IN2A 5GCHG 1HAZB 1PQ5A 3LDXH 5KECA 1MZDA 1V2KT 1W2KH 3ZVCA 1OP8A 5F8XA 3HK3B 3RXTA 3NWUA 3T27A 1FONA 5EQRA 1V2OT 2F9BH 1Z7KA 1OPHB 1LVYA 1ZPBA 5C3NA 1ANBA 1CT4E 3E6PH 3QN7A 2FX6A 2PSXA 2OD3B 3PLBA 1BTWA 1DLEA 1QQ4A 3HKJB 2AYWA 2AEIH 3OSYA 1C2HA 2SFAA 1GBHA 4YM9A 1VITG 1CGJE 1G37A 2Y80A 5T1VA 2PW8H 1UCYH 1YGCH 1TGSZ 4A1XA 2WPDD 1KDQB 2VIDA 4NIWA 5FBIA 2V3OH 4DT7B 1TPOA 5JBAS 2FMJA 3OY6U 1BBRK 2BX4A 1D9IA 2ZG0H 3PV4A 3SU2A 4YOJA 2BVRH 2P3UB 3F2HA 1C1RA 1HIAA 2AERH 1THSH 1ORFA 1GJ4H 3M36A 4B76A 1W11U 2B9LA 3D65E 2FYRA 1N6XA 1TA2A 3LONA 2D8WA 2W6ID 3F1SB 3F6UH 4FVDA 3RXFA 5EU8A 1G3EA 4NIVA 3GICB 4MQAA 2NU1E 2KCAA 2EI7A 4X2XA 4AYVB 5GDSH 1KLJH 1TNGA 1GI3A 4MPVA 2Q6DA 4U01A 4BAKB 3SBKA 1CT0E 3IITA 1EOLA 5A0CA 4INLA 1DPOA 1XUKA 3GDVA 3RLWH 1Y3YA 2VU8E 3U8TH 1O2VA 3P8NA 4GLYA 4AC9A 2J95A 4CBOA 1E34B 2J38A 4GCHF 4X2WA 3G01A 4DW2U 1SFQB 2CN0H 1BTXA 2BMGB 4MNYA 1IAUA 3QK1A 4Y8XA 1YY3A 3PMJA 2HPQH 4ISHH 2J97A 4YLQH 3S9CA 1Y5BT 4B6FA 1GHZA 2VIQA 1YPEH 4Q63A 3A82A 5L2ZH 2PSYA 2KCYA 3K65B 1GDQA 5DP6A 1S0RA 3F68H 1UTNA 3F0OA 3HGPA 4X8UH 1ZTKA 4VGCB 5E0HA 2AGIX 3P8OA 3RDZA 1J14A 1SGTA 3KNXA 1HYLA 1UK4A 2RDEA 2KX4A 5ABWA 5K7RA 3U1IB 1ZRKA 2QF0A 3A7XA 1BMFD 1TGBA 1AFQB 3GDUA 2Z3CA 1HJAB 4DIIH 1N6YA 1GGDB 1GJ7B 3QO6A 3GCOA 1L4DA 2FOBA 1ABIH 1UVUH 5EGMA 2BVSH 1LO6A 2VIWA 3DSGA 4LK4A 3EGKH 3TH4H 3UWJH 2FOMB 5J4SA 1WV7H 4Y6DA 2K1QA 1SGNE 3N7DA 1UTLM 1MBQA 1SGRE 1H9HE 1BTYA 3V3MA 1O2SA 3M7UA 1FMGA 1AWHB 2WUCA 3HKIB 4SGBE 5C5OA 1MKWH 1O5EH 2PWXA 5EXMA 3EA8A 1GVLA 4ZMAH 3RM0H 1DFPA 1OWIA 1TNLA 2THFB 1ID5H 3SO3A 3RXIA 5FHTA 1TPSA 1A2CH 3FP7E 3GY7A 2G4UA 1C2IA 2BY8X 2B7DH 4JK6A 2BLQA 1SGYE 3LH3A 2A7JA 1F0UA 1TOMH 2V3HH 2WHXA 1G36A 4OM9A 5FCRA 4B2AA 4AZ2B 2Y5GA 4O03A 4JZDH 4MNWA 1TE0A 1GI7B 1OHHD 1BBRE 2M5TA 2STAE 3PWCA 1W10U 1CHOF 3BG4C 4JZFH 3BF6H 4K3JA 1IQIA 3UAIC 3LU9B 3ATWA 1GWAA 1D4PB 1O36A 3I29A 2XC5A 3RXKA 2BY7X 1ELTA 4Z6AH 4CRFA 1QFKH 4K8BA 4H42U 3HK6B 4XRNA 5FPSA 3ZV9A 3A8BA 2L6OA 3SU6A 2PKAA 3O8BA 4ACAA 1TQ0B 3WWFA 5AFZH 2Z9IA 1F5KU 1QBOA 1V2TT 4UFEH 4ZCNA 4NZQA 5EJZA 4I8GA 3PLKA 1GG6C 2XCNA 3KHVA 1T4UH 5GNDA 1VJAU 3E16B 3JZ1B 1O3NA 2ASUB 4VGCC 1GBTA 1C4U2 1C5QA 1AUTC 3T28A 1YPJH 1GJDB 2CXVA 1Y3XA 2XW9A 1K9OE 3DSOA 3WY8A 1HUTH 2KCOA 3ZZBA 1EASA 1AVGH 1AFQC 1HCGA 1L1NA 3SU5A 4FUHA 1O2NA 1O5AB 1WUNH 3SU0A 4ISLA 3A80A 1GGDC 1XX9A 1KXEA 3QX5H 3N99A 5GXPA 2A4QA 2GT8A 3PV2A 1WTHD 4LZ1H 1BITA 2KR7A 1LQDB 1M9UA 1SI5H 1E1QD 1MTWA 1C1QA 3RU4T 3BTGE 3T29A 1PPFE 3PTBA 3FVFB 2ZECA 3AVZA 1O33A 2BOHB 2W3IA 3OTPA 5GJ4B 2QN5T 3SQHE 3OFND 1Z1IA 2HLCA 1LMWB 2BQ6B 3SJIA 1C5NH 1EP6A 1FIWA 1HNEE 4Y10E 2F91A 1P12E 2EY4C 1YCPH 3ZVAA 4D7FA 2QF3A 1HAIH 2PUXB 1LPGB 2P59A 3M37A 4NFEA 1HXFH 5EPNA 1O2OA 4NA7A 4DOQA 2C8ZB 1GMHG 2ZGHA 4MNVA 2BD9A 4IN1A 1KLTA 1RTFB 3SGAE 5HXFA 1GJAB 4OS6A 2Y82A 4CRCA 3MI4A 3ZZ6A 4X1PU 4TT3D 1KXCA 2EQNA 1Y3WA 1Y8TA 1UTKA 3TH2H 8GCHG 4GSOA 2V6NA 4YO9A 2SGAA 1D3QB 3TK9A 1BB0B 3SNAA 1LKAA 2ZDMA 3SUDA 3QGJA 3F3BA 3SV2H 2I6QA 2O8LA 4WJG2 1FPCH 2NU2E 1XUJA 2SGPE 2W26A 1VCWA 2Q6GA 4DGJA 3ZYEA 3UNSA 1OWDA 2BY6X 5TCCA 3UQOA 5LPEA 3RXQA 1SHYA 1YM0A 3GYLB 1C5TA 3N7EA 4DJZB 3LGUA 1C1TA 5T6FA 5B6OA 1C9TA 1SGPE 2IJOB 4CH8B 4GUXA 4XSKU 4K8YA 1BZXE 1NO9H 4K60A 2R3UA 3PWBA 1NRPH 1XUGA 2ALPA 2BD4A 4WXIA 4NSVA 4IC6A 5EQQA 1D3PB 2YNBA 3IWMA 4KKDA 4AX9H 3EDXB 1RRKA 2A4RA 2A32A 2J9NA 1C2FA 3DT0H 4I33A 2OK5A 2GCHF 2WV4A 1H9IE 1GHYH 2QXGA 2WSSD 2VWMA 4AOQA 2OLGA 5DGJA 3ZZAA 1AKSB 3LC5A 1PYTD 1BQYA 1P05A 4FU9A 3Q77A 3VB5A 2FXRA 1OWHA 1MKXH 1PPGE 1TGNA 4U32A 4O9VA 4XOJA 3B8JA 3V12A 5CHAC 2BQWB 2Y5FA 1SG8B 1D3DB 1VJ9U 2HLDD 4FUGA 1BT7A 1QL7A 2TGTA 5KGOA 2TPIZ 1GCTB 3BIVH 1EJNA 2B5TB 2OC1A 3RXRA 4KTSA 4I8KA 1CGIE 4H4FA 2ZU2A 1J16A 3QZRA 1SOZA 1BJVA 5EW2H 4NFFA 1UVSH 2WPKS 5A09A 1UHBA 2VJ1A 2YMSC 2M2AA 5HYOA 1B5GH 1P3CA 2VIPA 5LH8A 5F03A 1SSXA 5EPYA 3BTTE 1FY8E 1LHEH 1O3PB 1ETRH 3UR9A 1ZYOA 1ACBE 1MCVA 2FWWA 3QTVH 1AZ8A 3EA9A 1O34A 2GDDA 4ZH8A 3M61U 5EJ1A 2ZEBA 1F0TA 3PROA 3GYMA 4ZKNU 5GCHF 4MVNA 2SGDE 2AGEX 4NSYA 1IHTH 1QBNA 4B73A 2YMSD 1S83A 2AIPA 1QR3E 4Y0YE 3LIWA 2JDID 2BDBA 4Y7BA 2OUAA 5ETXA 1CVWH 3A8DA 1EPTB 4JZIA 3SU3A 4TYDA 2XC4A 3O8RA 1JBUH 2BY9X 3RC4A 1MAYA 1SB1H 1ZSLA 3SUGA 1GHAG 4Y0ZE 2K0QA 4Y11E 3NK8A 3WW7A 4ZKRU 1QQUA 2ZGCA 2PLXA 1MCTA 2ZHDA 2HWLB 1KDQA 2VH0A 3RXHA 2ZDNA 4FU7A 3A81A 1LVBA 1O3GA 3FZZA 2PHBA 1BMNH 3RMOH 1TWXB 1E0FD 1UW7A 4F4OC 1UVOA 1NBMD 5IYTA 1A0HB 3TGKE 2F9VA 1TNIA 2Y7XA 2KCPA 1WXRA 1EATA 4ABAA 2SGFE 1HRTH 3UB0A 4ISIH 4HG6A 4F48B 3VB6A 5FX5A 2P8OB 3UUZA 3MQKC 1TBRH 4B2CA 1G3CA 1UMAH 1ELBA 3EA7A 1ARBA 3ZVBA 1B7XB 1FLEE 3AW0A 5DK1A 4DVAU 2Y6TA 2FLRH 1WQVH 3TJOA 1CBWC 2AS9A 2F3CE 1C1UH 3VEQB 3CS0A 3M35A 4BTUB 1TONA 2A31A 4OGXA 2FOHA 1H1BA 3A8AA 1GJCB 3KYFA 5IK2D 4R8TB 5EQSA 1OWJA 2VB0A 1SGFG 2FYQA 1MD8A 1UTJA 2ZHFH 3DFJA 1HAVB 1C2DA 2QXHA 1O3IA 1DSTA 2ZA5A 3GISB 4FUBA 5E8EH 2A2XH 1JIMA 5FAHA 1GBCA 1SQAA 1BTZA 1YPKH 1G9IE 1QCPA 1TLDA 2R2MB 3BTHE 2BDCA 4HGCA 1K1NA 1U6QA 4AYYB 1O3AA 4BAMB 2Z3DA 3UPEA 1ARCA 1O2TA 1TRMA 4BOHA 6LPRA 5LPFA 3E0PB 3SV8A 3H09A 1E1RD 4TSFD 1NTPA 2RG3A 1QY6A 1C1MA 5FCKA 5C1YA 2FDAA 3EAJA 4O97A 1W0KD 2KAIB 1MTSA 1KXAA 4RSPA 4GAWA 4I32A 1L0ZA 1Q3XA 2DE9A 1EPTC 1IHSH 1ZPCA 3M3VA 4O3UA 1PQ7A 4B75A 1C1SA 2O8TA 2ZU4A 2XWBI 2HALA 1DANH 1YPHE 4AB9A 4KELA 3F9GA 1CO7E 4NA9H 1ZMJA 2BD8A 4K1TA 2CHAB 4CR5A 1CA8B 3RXJA 3TJVA 1DWCH 5C0UA 1VKYA 1IQMA 3MHWU 4PROA 3UFAA 4A1TA 3S9BA 4GHQA 3S69A 4MLFB 1HAXB 5BPEA 1MUEB 1SC8U 2ANWA 4CRGA 3P8GA 2Z9KA 1C5PA 1V2RT 1TGTA 2P8OC 3M5OA 3L3TA 1GI8B 2ZDVH 4SGAE 4BTIB 1DXWA 1EX3A 2C8XB 4WXVA 4ABHA 2P94A 4LXBH 2RFKC 4WMFA 1K22H 1QHRB 1SR5C 4FVBA 1WOFA 1GBLA 2FPZA 1HLTH 2FI4E 2JH5D 1T31A 1A5IA 2V7QD 1MH0A 1AWFH 4KGAA 1GBAA 1NRSH 1S0QA 3A7WA 2VNTA 4YT7H 1AY6H 4AFSA 1C5UA 1O5BB 4RN6A 1J15A 4ZXXH 2BDYA 4NA8A 2BZAA 1GBFA 3PLPA 3F2GA 4THNH 3HGNA 2CJIA 2BHGA 3GY8A 4E7RG 1FY1A 4Q80A 1EZXC 3DCLA 1ZJKA 5CMXH 3TGIE 1EJMA 4Y8ZA 1K1JA 2A7HA 2P16A 2D2DA 3TJNA 3SUEA 2GMTB 4M7GA 2CGAA 1T8LA 4X8TH 5ESTE 1FN8A 4AGKA 2BD5A 1Z8JB 7LPRA 2HNTF 4Q4LA 2ZFRH 2F9PA 1QRWA 3FAOA 4XBCA 1YPGH 4DG4A 2ZU3A 1K1MA 1BIOA 3U1JB 3TGJE 5TJXA 4OS5A 2GTBA 3P6ZB 1SLUB 5HMAA 4CBNA 1UO6A 5FXLA 4I86A 3SORA 4K1SA 4ABBA 1RTKA 1V2PT 3PV5A 3UREA 2FTMA 1OP0A 1RTLA 1MTNC 1WQSA 1GJ9B 2F43B 1S6FA 1C5MD 2ZCHP 2AFQB 2C93B 1P2OA 1YPHC 2AH4X 1J8AA 3M7QA 5T3HA 1QNJA 1NM6A 4CRAA 1TNHA 1IQKA 3SV6A 5B6LA 3T5FH 5DP5A 1S82A 3GS9A 2CF8H 3KL6A 3D62A 5DSFA 4IC5A 4XE4A 2A4GA 3BTQE 2LELA 1MU8B 1HJ8A 2UWPA 2VVUA 2QYIA 3QZQA 4JK5A 3RP2A 5FPYA 3RMLH 2HNTE 1TPAE 3RXDA 3NUMA 3OAAD 1C9PA 4YOIA 5E0JA 3LT3A 4X1QU 1K1OA 1F5LA 3RUOA 1OKXA 3ZZ3A 2BDHA 2CK3D 4BXSA 4CHAB 2Y7ZA 5JYIA 2CF9H 1GMHF 1O2GH 1GBIA 1SPJA 1FZZA 1F2SE 1TQ7B 5DP4A 2BY5X 1DX5M 1EZSC 1OXGA 1QIXB 4TPYA 5JPMH 5DN6D 1GBDA 5AFYH 3AW1A 1GBKA 1S85A 2GV6A 3BEFB 1XUIA 1KY9A 8GCHF 2G51A 5DP7A 2AIQA 1HAPH 1O3LA 2YNAA 1PPBH 3SV7A 2PGQB 1TAWA 1OYTH 3LOXA 5I25A 3E0NB 1HDTH 1K1LA 1MBMA 1VITH 2FS9A 3BN9A 5C94A 2OC8A 2ZI2H 1AHTH 3QWCH 1NN6A 3BSQA 2O9QA 2GGVB 3ZZ9A 1QBVH 4K5ZA 2ZC9H 1TX8A 3ZVDA 1AU8A 3KQBA 4XBDA 5E0GA 3SJ9A 4E05H 1O2HA 1ESTA 1ESAA 3E91A 4FXGH 4ABDA 1ZHMA 4K69A 3RXEA 2Z94A 1AKSA 4BTTB 1DITH 1TNKA 4WY3A 1NPMA 4X6MA 1DWDH 1LDTT 2NU4E 2ANKH 5HIZA 3ZZCA 3DFLA 3GY4A 1SKYE 5LGOA 1QB6A 1V6DA 1GI0A 1FJSA 1C2KA 2FS8A 1BTHH 1F0SA 2ZDLA 4ZROA 1P10A 2BVXH 2Y5HA 2QF5A 4X0WU 1O5DH 3GY5A 1GI4A 2STBE 5G4BA 3SU4A 3P8FA 5FBEA 3KCGH 1BUIA 1LVOA 1E79D 3W95A 2ZTZA 3A7YA 1V2MT 3NZIA 2HVXA 3LH1A 2SGEE 1BMAA 1FPHH 2PR3A 1ZLRA 2GDEH 1EQ9A 2JH6D 5F53A 2ZP0H 1O2ZA 3L33A 4WMDA 3QTOH 1P2IA 2GX4A 5HM2A 2XBVA 2HNTC 1DT2A 1FN6A 3PTNA 2W5EA 4LOYH 4Q2KA 1O2IA 1SQRA 4MPXA 4I8HA 4MG3A 2ZF0H 5GIBA 2VINA 1PPEE 1IQGA 3M3SA 1BTUA 3URCA 3MO9A 1NRQH 3BTWE 2ULLA 1C5VA 2QA9E 1L1JA 1QRXA 1LCYA 2OQUA 4AN7A 5DP9A 3TH3H 3FKSD 4IS5A 3LKWA 3KF2A 5T6GA 2D26C 3SNBA 5C1XA 1G2LA 1K1PA 1NC6A 3RXBA 1EPTA 1YC0A 1GJ6A 1H8IH 1GL1A 2G5NA 4A1VA 2P93A 4JYTA 1YLCA 3Q3XA 5JBTA 3MMGA 1NFYA 1MAXA 1L2EA 2H2ZA 4LZ4B 1DXPA 4ZHLU 1HJAC 1V2JT 5I46H 1WDIA 2ZDAH 4TWWA 1O5CB 1C1VH 1QJ7B 5FX6A 1GI1A 1Q2WA 1V2LT 1QA0A 3ZZ5A 4BXWA 1DUAA 2ZCLP 1CE5A 1GHAF 4P00A 3RXGA 3BTDE 1C5RA 4TY6A 4ABGA 4I8JA 2Q1JA 1NFUA 2ZU5A 1SQTA 4E7NA 5BRRE 1BJUA 1EAXA 2ZDKA 2H6MA 3ODFA 7GCHG 4X2YA 2ZFSA 4YOGA 1SLWB 2RA3A 3PB1E 1LQEA 2VGCB 1K21H 3PO1B 3P92A 3RMMH 3NKKA 1IQFA 3D49H 3KEEA 3VB4A 3MNCA 1SGCA 2J2UA 1INCA 1XUHA 3RMNH 4YLUA 1BOQA 3H5CB 1DS2E 1GHBF 2WPHS 5IDKA 1GI9B 2QF4A 4H6TA 1YLNA 3K2UA 5A8ZA 1RIWB 3UNQA 1EZUC 1HB0B 2VWNA 1P2KA 4WH8A 1O37A 4ESTE 1CQQA 1HAVA 2JJ2D 1IQJA 3PMHB 4TY7A 5CE1A 2FOCA 1THRH 1QURH 3RU4E 2XOKD 2Z3EA 1GI2A 1OSSA 4DURA 4RKOB 1GMCG 4IW4E 2FO9A 1TGCA 3T25A 1L1GA 1O3HA 1A1RA 1Z6JH 3UR6A 3SYJA 3GOVB 3LGTA 1VGCB 3AAUA 1PQ8A 2SNWA 1O2WA 3MNSA 1MTVA 5JB9S 3FANA 2C3SA 1ELEE 4NWKA 1C5SA 2XC0A 3BTFE 1NZQH 4IBLH 1MMJN 2HGTH 2I6SA 5FPTA 3RXLA 1C5XB 1P2QA 1LPZB 1Y59T 1THPB 1W8BH 1AVXA 2ZTYA 2OINA 4D76A 1W0ZU 3JZ2B 2KAIA 4B1TA 2BLWA 1UK2A 3K9XB 1P06A 1A7SA 1QB9A 3LPRA 4MPUA 4GHTA 1Y5UT 3KYGA 2F83A 3T26A 2DUCA 4J2YB 3ITIA 3R3GB 1V2QT 1SL3A 4D7GA 1C5OH 5TCAA 1KTSB 5L2YH 3MU5A 3K6ZA 3M3TA 1O2MA 2FOAA 4H6SB 3F2FA 2XNIA 4CH2B 1AB9B 2KZ4A 1AZZA 2JETB 3RXOA 1W7GH 2VIOA 3SI3H 2NU0E 1C4V2 2TGDA 3SNDA 1RD3B 1OWKA 6CHAB 4ZUHA 4MPWA 4Q7YA 3D23A 4ZKSU 2SNVA 1TMTH 1DM4B 4WH6A 1SOTA 4MNXA 3GCNA 4BAQB 1K0HA 1RXPA 3CNRA 2ZHWH 3EYDA 1C1OA 1GVKB 1XXDA 3PO1C 4A6LA 2ZO3H 1Z71A 1F0RA 5A0AE 2UWLA 2J94A 1O39A 1IQLA 1HAHH 1TFXA 1XKAC 1YKTA 1RIWC 3ATKA 2XWAA 3FOAA 4ZXYH 1KXFA 2XCFA 1XUFA 1C2LA 1T8NA 1GBBA 1TMBH 1UCYE 2VWLA 3FO8D 1T7CA 1F92A 4NG9H 3SQEE 3Q76A 1BBRH 2C8YB 1IQEA 1IOEA 1CSOE 1CGHA 4P02A 1TMUH 1VCPA 2YOLA 4ZKOU 5LPRA 2GZ8A 4JZ1A 3DA9B 5CDFE 1VCQA 3MH7A 1O2YA 1O3OA 1AI8H 2ODYB 1P3EA 4KTUA 1FV9A 2VH6A 2ZGXH 3MOCA 4ASUD 1W12U 1GCDA 2H5DA 1ZTLA 1AE5A 3FP6E 3O8CA 2FOGA 4CREA 9LPRA 4JYVH 3STJA 2EI6A 2PP6A 4X8SH 1C2JA 1A0LA 1SGQE 1W3CA 2QV1A 4X1NU 3WWBA 1P9UA 2FOFA 3A83A 2BDGA 1C5WB 1ZOMA 2XTTB 4CRBA 1ABJH 3U69H 3P70B 1GHBG 1NFWA 3ESTA 1TBQH 2K8IA 1BMMH 2F9UA 2QAAA 1SHHB 3TLOA 2ZHEH 1ELAA 2XBYA 4FU8A 3U8RH 4UDWH 3PYHA 2BX3A 1SLVB 2AMQA 1AB9C 1ZMLA 1B0FA 3T62A 3M7TA 1GCTC 3TK5A 1Z8GA 1EKBB 3A8CA 5HGGA 3HPTB 6CHAC 2XBXA 2XYAA 1F5RA 4X2VA 1QA7A 4DT4A 4QT8C 2JH0D 5EODA 2Z7FE 1DUEA 1O31A 1ZGVA 2JKHA 1DY9A 1SVPA 1UTPA 2F4LA 3NCLA 3U9AH 2W3KA 1MQ6A 1ZJDA 3RC6A 3ZVEA 3CP7A 2ILNA 2IPQX 3SUFA 1ELDE 1YCPM 2Z9LA 2FIRH 3QLPH 2ZIQH 2W7SA 1CT2E 1BHXF 1OOKB 3MYWA 3A88A 2AHME 1RJXB 3SZEA 3M5NA 3RC5A 3AAVA 2LP6A 4RT1A 1EZQA 4BAHB 1TNJA 2UUJB 4ZAEA 4TWYA 1O2KA 3U28C 1W13U 5C20A 3MTYA 1DWBH 1S81A 3RXVA 3SHCH 1O2JA 5DO4H 4U30A 4X6OA 5EIYA 1TA6A 1HJ9A 4K2YA 1T8MA 4XFQA 1V3XA 4XBBA 2P3FH 2RA0A 3SOSA 4YT6H 1AQ7A 5HM9A 1A0JA 1WBGB 1SBWA 1BRAA 1MZAA 1T4VH 2DE8A 1BHXB 5C5NA 4DIHH 5DG6A 4U2WA 3TNTA 1UJ1A 2ANMH 4ZHAA 1A5GH 1P2MA 2A5KA 8LPRA 1UTQA 2ODQA 3E3TA 2ODPA 3VG8A 1P09A 3HATH 4B74A 4DCDA 3SI4H 1GMDG 2TGPZ 1BRUP 1ESBA 1EOJA 4HTCH 1O2QA 3GCHB 5EOKA 1W0YH 3C27B 2GCTB 3ZZ8A 3BTME 3SU1A 4NGAH 1HXEH 3S0NA 1YPMH 2KM0A 3A7TA 1ZMNA 4KTCA 3S7HB 3URDA 2UUYA 1EB1H 1GI6A 4MDSA 2WPMS 3SGBE 2GZ7A 4FUIA 2PTNA 2L74A 2G00A 5GPIB 4AG2A 1O38A 1LKBA 3KGPA 1GJBB 9ESTA 5KEDA 3A86A 1C5ZB 1O0DH 1EXFA 2WZQA 4GPGA 5JDUB 3SHAH 4WWYA 3DHKH 2ESTE 1P02A 3ZV8A 1S6LA 2ZFFH 1H8DH 1TOCB 7KMEH 1FY4A 4WMEA 4AB8A 2ZNKH 2XNDD 2JJ1D 4X1RU 1FNIA 5PTPA 1AMHA 1JWTA 3SZNA 4BNRA 1EAIA 1PPHE 4MTBA 1GDNA 3M5LA 4DY7B 2WYJA 1WSSH 1K2I1 2QE7D 4NIYA 2G4TA 5EW1H 5EXNA 6ESTA 1TRYA 2FI5E 3K6YA 3OU0A 2BD2A 1MQ5A 5HIYA 3SN8A 1SGEE 3ZYDA 1A46H 1SQOA 3RXPA 1PQAA 3MU4A 2XBWA 3LGYA 3LGIA 3ENSB 3V13A 4IMQA 2WPLS 2WYGA 1FY5A 6GCHG 1AE8H 4X1SU 2CHAC 3KN2A 3MWIU 4FUFA 2ZTXA 3ZZ4A 1Y5AT 2GV7A 1L4ZA 1HAGE 2OC0A 2EC9H 2J98A 1ZR0A 4Z1MD 4Q7XA 1FI8A 3RXAA 2D1JA 5E2PA 3UY9A 4AFQA 1MU6B 2OCVB 1WCZA 4TPIZ 1GVZA 1IQNA 2O8UA 3W1EA 1ANDA 7GCHF 3N7OA 1T8OA 1FDPA 1EB2A 2Y81A 3BG4B 1O2UA 2PV9B 2ZU1A 1HBTH 4NZLA 1YLDA 2J34A 3GCHC 4ISNA 1RFNA 1OS8A 3BEUA 2Z9JA 3TNSA 1A3EH 2GCTC 4OGYA 1AFEH 3MH6A 1H4WA 2IJD1 1ANCA 1TPPA 3SNCA 2AMDA 1H9LB 4HZHA 1H8ED 1YBWA 1C1NA 1O3CA 4WF8A 3TJUA 3BV9B 5FL7D 2A5IA 1ELGA 2P3TB 4INHA 4NWLA 3MFJA 2BZ6H 3A7ZA 1GMCF 2FODA 1EUFA 1NS3A 1ZSJA 1GG6B 2J5UA 1EAUA 2C4FH 2NU3E 4OS4A 1Z8RA 1FQ3A 2GMTC 1XM1A 2LNCA 3OEHD 1G3DA 1JMOH 2ZWLH 3KQEA 1F7ZA 1UK3A 3MU1A 1TB6H 3GCTG 2FOEA 2RDLA 1COWD 2ZKSA 3ZIAD 1HAOH 2PFEA 1UTOA 4KP0A 1GL0E 2Z9GA 1C1WH 2XRCA 3TK6A 5A0BA 3S7KB 1DICA 4M9FA 1ZPZA 1SGFA 3P95A 1O3JA 2QCYA 2GT7A 1O3KA 1YP9A 1DLKB 5E2OA 3IG6B 4D9RA 1NROH 2ZPRA 1XVMA 3BTKE 2BDIA 1C2EA 1VZQH 2ZPSA 4RKJB 1LHCH 3EE0B 3OEED 3LC3A 2Z6BD 1NU7B 2PUQH 2OP9A 4Y71A 1O2PA 5EJLA 1P8VC 3PRDA 4XDEA 3PMBB 1DWEH 1C2MA 3AASA 3V7TA 4D9QA 2WV5A 1ZZZA 3W94A 2WPJS 3Q3YA 1W7XH 1V2ST 2TRMA 5AF9H 1OWEA 3B23B 2H9HA 2ZQ2A 3BEIB 3L6PA 2F9NA 1HV7A 1WAYB 1EJAA 3M5MA 1KMHB 1FUJA 3SW2B 2ALVA 3OYPA 3Q00A 1N1LA 3UWIA 1LHDH 1ZTJA 2WUBA 1SMFE 4CHAC 2ZQ1A 1KXBA 3S9AA 1NESE 8KME2 3BG8A 5C17A 3VB7A 1TRNA 4ABIA 3PRBA 2V0BA 1GI5A 1TALA 4UFFH 3GY3A 1G3BA 1QL8A 3QGNB 1DVAH 1A3BH 1T32A 2PKSB 3A89A 2RCEA 1AIXH 3RXUA 4AGJA 2R2WU 2FM2A 1OYQA 1V2WT 1XMNB 3MH5A 1MD7A 4UFDH 2R0KA 1TIOA 2ZFPH 4Y7AA 5HKKD 2B8OH 3EQ0H 4YXWD 3A7VA 3U8OH 2BLOA 3KIDU 1CU1A 1TX6A 2VIVA 5C2ZA 1KSNA 1JRTA 2F9OA 1XXFA 4RT0A 3LJOA 1FX0B 2A4OA 3ZZDA 1WYKA 1DOJA 1QL9A 3RXSA 2VVVA 2GP9B 2J98B 5L30H 1HIAB 2G55A 2AGGX 4UONA 8ESTE 5CHAB 3T2NA 2QXJA 2WPIS 1EFRD 1PPZA 3TVJB 3H7OA 2PTCE 1BA8B 1Z6EA 2O8MA 3H7TA 1UCYK 2QXIA 2ZFQH 4A92A 4O3TA 2HVYB 4XD7D 2HPPH 2QIQA 2V3MA 4F55A 1O3BA 2W6JD 5DP8A 2UUFB 1Y3VA 3ZVGA 1AUJA 1KXDA 2IPHA 4JMYA 4ISOA 1J17T 1O35A 3UTUH 2OQ5A 3O8DA 4IGDA 1JOUB 4JCNA 2NWNA 2YMSB 4GCHG 1CA0B 3ZZ7A 1CHGA 1P57B 1ETSH 3NRLA 3U98H 4ABJA 2BYAX 1GBMA 2ZCKP 1O5GH 1QZ8A 1YPLH 2J4IA 3VXEH 4YESB 1ANEA 1KTTB 4B6EA 1SGIB 2ZFTA 3DUXH 3PMAB 1LTOA 1PFXC 1O3MA 3E1XB 1FAXA 1HAYB 1V2NT 5DJ7A 3ZVFA 1LHGH 2FP7B 2AMPA 3VB3A 3ATLA 1NRNH 1ETTH 1H8HD 3FZDA 1FXYA 2R3YA 3FN8A 1KIGH 2OBQA 1DE7H 3I77A 1ZSKA 2HOBA 4NIXA 3AK5A 4HI3A 4UFGH 5A2MH 1NBME 5C67A 4ABEA 4INKA 3RXCA 1C5LH 2ZGJA 2ZPQA 3VGCB 1O5FH 2OC7A 4D8NA 5C0TA 2BXTH 3EE7A 1V2VT 2VWOA 1PYTC 3UOPA 2PKSC 1O3EA 4FUEA 1ZGIA 2QC2A 1C4Y2 1TYNA 2BD7A 3ELAH 1GPZA 4X6PA 1SFIA 1Z8IB 4I7YH 4I8LA 2A2QH 1Q31A 2BTCE 3DSPA 1SGDE 2BM2A 4UEHH 2EEKA 2A45B 2GKVE 1QRZA 2OBOA 1ELFA 1KYNA 1O32A 3MH4A 5L6NH 1OX1A 5DKMA 4JYUH 4Y8YA 1RS0A 1LPKB 1V2UT 2FI3E 2P95A 1BMLA 1CBWB 2IN2A 2QY0B 1UTMA 2OXSA 1MABB 3RM2H 2VGCC 1CHOG 1TABE 1RGQA 3SGQE 1YWUA 1W0JD 1GJ5H 3BTEE 1XVOA 1BCUH 4X8VH 3A85A 3B9FH 4E06H 2UUKB 4AFUA 5C1UA 1UVPA 1MKWK 1N8OB 1FIZA 4Q7ZA 2FLBH 2HRVA 1GMDF 2GVFA 1AVWA 1FAKH 4A7IB 3RXMA 1MTUA 2LPRA 2TIOA 3VFEA 1CA0C 1E37B 1P04A 3OX7U 1GDUA 2FTLE 4AG1A 3UQVA 3SJKA 4ABFA 1FY3A 1LVMA 1HFDA 3BIUH 3DD2H 4OS2A 4IMZA 2J92A 4ZHMU 3SJ8A 5A8XA 2BQ7B 2O8WA 5JBBS 1YF4A 1G2MA 3QDZB 5DPAA 3PM3A 3FFGA 2V35A 3TIUA 3UNRA 2CV3A 2TGAA 2PKAB 1NFXA 1B0EA 3F9EA 1GBJA 1VGCC 1NT1A 1O3FA 1W14U 2H1UA 2A0QB 3SNEA 1GHXH 1TBZH 4UE7H 2EI8A 5F8TA 2A5AA 4CRDA 3TU7H 4JZEH 3R0FA 4A5TS 3C1KA 1JRSA 4ASHA 3LGVA 2B0FA 4UD9H 3KQDA 1O2LA 4HFPB 3RU4D 3TITA 5H4IB 2FESH 3VGCC 1C1PA 1GBEA 3CS7A 1P0SH 4FETA 4WVPE 1BRCE 3TPIZ 1EP5A 5SGAE 1D6RA 2A7CA 5AHGH 1ZRBA 5CHBA 2R9PA 3F9FA 4AFZA 4FUDA 3ATIA 2BXUH 1VITF 1S5SA 3OE7D 2TBSA 1NRRH 4X6NA 3KQCA 2C90B 1BTPA 1QJ1B 5JB8S 3V0XA 1E36B 2G8TA 1AN1E 1TX7A 3GDSA 4I31A 4RI0A 2JETC 2SGQE 1QTFA 1DY8A 6GCHF
chains in the Genus database with same CATH topology
1HGTH 1D3TB 3VXFH 2BOKA 3E90B 2ZGBH 3NXPA 1D6WA 1LHFH 1HPGA 1ZHRA 1O3DA 2H9EH 1WTGH 1AGJA 4CR9A 1OP2A 1A5HA 1O30A 2CMYA 3CENA 3LJJA 1DSUA 3OY5U 2G5VA 2PGBB 3Q3KA 1E38B 4Y79A 4F49A 2OTVA 5DP3A 4B71A 3MU0A 2VVCA 2UWOA 3ODDA 2ZZUH 1Y3UA 2EA3A 7ESTE 1BDAA 1A61H 1N8OC 4YTAA 1XKBC 1K1IA 3SV9A 1DDJA 1E35B 1YCPK 1X7AC 2H5CA 4GVUA 1NU9A 1P2NA 3GY2A 2FZZA 1ZHPA 2BDAA 1UVTH 4Y76A 1GJ8B 3LGWA 4Z0KA 1WU1A 3FP8E 3MO6A 1QB1A 2R0LA 3RLYH 2G81E 1Z1JA 3A84A 5F8ZA 2ANYA 1O2XA 3F9HA 1K28D 2G52A 3NPSA 2GZ9A 1QGFA 1AD8H 1GHWH 1YYY1 4YZUA 3UOUA 3QUMP 4AORA 1A4WH 5AVDA 1P9SA 4J1YA 3I78A 3VPKA 2GCHG 5T6DA 1O2RA 5A8YA 4OS7A 3GY6A 2A1DB 5EG4A 1C5YB 2BLVA 4BANB 1G32B 1GHVH 5ESBA 3MNXA 1ELVA 5K0HA 1S84A 1MTNB 3GCTF 1J9CH 2W7UA 3ATMA 2WINI 3E8LA 1QJ6B 3OTJE 4FUCA 2XXLA 4BAOB 3STIA 2GD4B 5JBCS 4R0IA 1BRBE 1NY22 1ELCA 1P03A 4NCYA 1KLIH 2H9TH 3MO3A 5J4QA 3MNBA 2FX4A 1VR1H 1P01A 1SLXB 1P2JA 4FUJA 3P17H 1G30B 1JXPA 2C8WB 3MU8A 1C2GA 2QGRA 3UIRA 4K1EA 1AO5A 1PJPA 2BD3A 1S6HA 2ZHQH 1EAWA 4OS1A 3A87A 1UHBB 1JIRA 5GWZA 2IOTA 1PPCE 1IQHA 4B2BA 3SJOA 5F6MA 1MKXK 2Q6FA 2BB4A 1P11E 5EXLA 2FEQH 4IN2A 5GCHG 1HAZB 1PQ5A 3LDXH 1MZDA 1V2KT 1W2KH 3ZVCA 1OP8A 5F8XA 3HK3B 3RXTA 3NWUA 3T27A 1FONA 5EQRA 1V2OT 2F9BH 1Z7KA 1OPHB 1LVYA 1ZPBA 5C3NA 1ANBA 1CT4E 3E6PH 3QN7A 2FX6A 2PSXA 2OD3B 3PLBA 1BTWA 1DLEA 1QQ4A 3HKJB 2AYWA 2AEIH 3OSYA 1C2HA 2SFAA 1GBHA 4YM9A 1VITG 1CGJE 1G37A 2Y80A 2PW8H 1UCYH 1YGCH 1TGSZ 4A1XA 1KDQB 2VIDA 4NIWA 5FBIA 2V3OH 4DT7B 1TPOA 5JBAS 2FMJA 3OY6U 1BBRK 2BX4A 1D9IA 2ZG0H 3PV4A 3SU2A 4YOJA 2BVRH 2P3UB 1C1RA 1HIAA 2AERH 1THSH 1ORFA 1GJ4H 3M36A 4B76A 1W11U 2B9LA 3D65E 2FYRA 1N6XA 1TA2A 3LONA 2D8WA 3F1SB 3F6UH 4FVDA 3RXFA 5EU8A 1G3EA 4NIVA 3GICB 4MQAA 2NU1E 2EI7A 4X2XA 4AYVB 5GDSH 1KLJH 1TNGA 1GI3A 4MPVA 2Q6DA 4U01A 4BAKB 3SBKA 1CT0E 3IITA 1EOLA 5A0CA 4INLA 1DPOA 1XUKA 3GDVA 3RLWH 1Y3YA 2VU8E 3U8TH 1O2VA 3P8NA 4GLYA 2J95A 4CBOA 1E34B 2J38A 4GCHF 4X2WA 3G01A 4DW2U 1SFQB 2CN0H 1BTXA 2BMGB 4MNYA 1IAUA 3QK1A 4Y8XA 3PMJA 2HPQH 4ISHH 4YLQH 3S9CA 1Y5BT 1GHZA 2VIQA 1YPEH 5L2ZH 3A82A 2PSYA 3K65B 1GDQA 5DP6A 1S0RA 3F68H 1UTNA 3HGPA 4X8UH 1ZTKA 4VGCB 5E0HA 2AGIX 3P8OA 3RDZA 1J14A 1SGTA 3KNXA 1HYLA 1UK4A 5ABWA 5K7RA 3U1IB 1ZRKA 2QF0A 3A7XA 1TGBA 1AFQB 3GDUA 2Z3CA 1HJAB 4DIIH 1N6YA 1GGDB 1GJ7B 3QO6A 3GCOA 1L4DA 2FOBA 1ABIH 1UVUH 5EGMA 2BVSH 1LO6A 2VIWA 4LK4A 3EGKH 3TH4H 3UWJH 2FOMB 5J4SA 1WV7H 4Y6DA 2K1QA 1SGNE 1UTLM 1MBQA 1SGRE 1H9HE 1BTYA 3V3MA 1O2SA 3M7UA 1FMGA 1AWHB 2WUCA 3HKIB 4SGBE 5C5OA 1MKWH 1O5EH 2PWXA 5EXMA 3EA8A 1GVLA 4ZMAH 3RM0H 1DFPA 1OWIA 1TNLA 2THFB 1ID5H 3SO3A 3RXIA 5FHTA 1TPSA 1A2CH 3FP7E 3GY7A 2G4UA 1C2IA 2BY8X 2B7DH 4JK6A 2BLQA 1SGYE 3LH3A 2A7JA 1F0UA 1TOMH 2V3HH 1G36A 5FCRA 4B2AA 4AZ2B 2Y5GA 4O03A 4JZDH 4MNWA 1TE0A 1GI7B 2M5TA 1BBRE 2STAE 3PWCA 1W10U 1CHOF 3BG4C 4JZFH 3BF6H 4K3JA 1IQIA 3LU9B 3ATWA 1GWAA 1D4PB 1O36A 3I29A 2XC5A 3RXKA 2BY7X 1ELTA 4Z6AH 4CRFA 1QFKH 4K8BA 4H42U 3HK6B 5FPSA 3ZV9A 3A8BA 3SU6A 2PKAA 3O8BA 1TQ0B 5AFZH 2Z9IA 1F5KU 1QBOA 1V2TT 4UFEH 4NZQA 4I8GA 3PLKA 1GG6C 2XCNA 3KHVA 1T4UH 1VJAU 3E16B 3JZ1B 1O3NA 2ASUB 4VGCC 1GBTA 1C4U2 1C5QA 1AUTC 3T28A 1YPJH 1GJDB 2CXVA 1Y3XA 2XW9A 1K9OE 3WY8A 1HUTH 3ZZBA 1EASA 1AVGH 1AFQC 1HCGA 1L1NA 3SU5A 4FUHA 1O2NA 1O5AB 1WUNH 3SU0A 4ISLA 3A80A 1GGDC 1XX9A 1KXEA 3QX5H 5GXPA 2A4QA 2GT8A 1WTHD 4LZ1H 1BITA 1LQDB 1M9UA 1SI5H 1MTWA 1C1QA 3RU4T 3BTGE 3T29A 1PPFE 3PTBA 3FVFB 2ZECA 3AVZA 1O33A 2BOHB 2W3IA 5GJ4B 2QN5T 3SQHE 1Z1IA 2HLCA 1LMWB 2BQ6B 3SJIA 1C5NH 1EP6A 1FIWA 1HNEE 4Y10E 2F91A 1P12E 1YCPH 3ZVAA 4D7FA 2QF3A 1HAIH 2PUXB 1LPGB 2P59A 3M37A 4NFEA 1HXFH 5EPNA 1O2OA 4NA7A 4DOQA 2C8ZB 1GMHG 2ZGHA 4MNVA 2BD9A 4IN1A 1KLTA 1RTFB 3SGAE 5HXFA 1GJAB 4OS6A 2Y82A 4CRCA 3MI4A 3ZZ6A 4X1PU 1KXCA 1Y3WA 1Y8TA 1UTKA 3TH2H 8GCHG 4GSOA 2V6NA 4YO9A 2SGAA 1D3QB 3TK9A 1BB0B 3SNAA 1LKAA 2ZDMA 3SUDA 3QGJA 3SV2H 2I6QA 2O8LA 4WJG2 1FPCH 2NU2E 1XUJA 2SGPE 2W26A 1VCWA 2Q6GA 4DGJA 3ZYEA 3UNSA 1OWDA 2BY6X 5TCCA 3UQOA 5LPEA 3RXQA 1SHYA 1YM0A 3GYLB 1C5TA 4DJZB 3LGUA 1C1TA 5T6FA 5B6OA 1C9TA 1SGPE 2IJOB 4CH8B 4GUXA 4XSKU 4K8YA 1BZXE 1NO9H 4K60A 2R3UA 3PWBA 1NRPH 1XUGA 2ALPA 2BD4A 4WXIA 4NSVA 4IC6A 5EQQA 1D3PB 2YNBA 3IWMA 4KKDA 4AX9H 3EDXB 1RRKA 2A4RA 2A32A 2J9NA 1C2FA 3DT0H 4I33A 2GCHF 2WV4A 1H9IE 1GHYH 2QXGA 4AOQA 2VWMA 2OLGA 5DGJA 3ZZAA 1AKSB 3LC5A 1PYTD 1BQYA 1P05A 4FU9A 3Q77A 3VB5A 2FXRA 1OWHA 1MKXH 1PPGE 1TGNA 4U32A 4O9VA 4XOJA 3B8JA 3V12A 5CHAC 2BQWB 2Y5FA 1SG8B 1D3DB 1VJ9U 4FUGA 1BT7A 1QL7A 2TGTA 2TPIZ 1GCTB 3BIVH 1EJNA 2B5TB 2OC1A 3RXRA 4KTSA 4I8KA 1CGIE 4H4FA 2ZU2A 1J16A 3QZRA 1SOZA 1BJVA 5EW2H 4NFFA 1UVSH 2WPKS 5A09A 1UHBA 2VJ1A 5HYOA 1B5GH 1P3CA 2VIPA 5LH8A 5F03A 1SSXA 5EPYA 3BTTE 1FY8E 1LHEH 1O3PB 1ETRH 3UR9A 1ZYOA 1ACBE 1MCVA 2FWWA 3QTVH 1AZ8A 3EA9A 1O34A 2GDDA 4ZH8A 3M61U 2ZEBA 1F0TA 3PROA 3GYMA 4ZKNU 5GCHF 4MVNA 2SGDE 2AGEX 4NSYA 1IHTH 1QBNA 4B73A 1S83A 2AIPA 1QR3E 4Y0YE 3LIWA 2BDBA 4Y7BA 2OUAA 5ETXA 1CVWH 3A8DA 1EPTB 4JZIA 3SU3A 4TYDA 2XC4A 3O8RA 1JBUH 2BY9X 3RC4A 1MAYA 1SB1H 1ZSLA 3SUGA 1GHAG 4Y0ZE 4Y11E 3NK8A 4ZKRU 1QQUA 2ZGCA 2PLXA 1MCTA 2ZHDA 2HWLB 1KDQA 2VH0A 3RXHA 2ZDNA 4FU7A 3A81A 1LVBA 1O3GA 3FZZA 2PHBA 1BMNH 3RMOH 1TWXB 1E0FD 4F4OC 1UVOA 5IYTA 1A0HB 3TGKE 2F9VA 1TNIA 2Y7XA 1EATA 4ABAA 2SGFE 1HRTH 4ISIH 3VB6A 5FX5A 2P8OB 3UUZA 1TBRH 4B2CA 1G3CA 1UMAH 1ELBA 3EA7A 1ARBA 3ZVBA 1B7XB 1FLEE 3AW0A 5DK1A 4DVAU 2Y6TA 2FLRH 1WQVH 3TJOA 1CBWC 2AS9A 2F3CE 1C1UH 3VEQB 3CS0A 3M35A 4BTUB 1TONA 2A31A 4OGXA 2FOHA 1H1BA 3A8AA 1GJCB 4R8TB 5EQSA 1OWJA 2VB0A 1SGFG 2FYQA 1MD8A 1UTJA 2ZHFH 3DFJA 1HAVB 1C2DA 2QXHA 1O3IA 1DSTA 2ZA5A 3GISB 4FUBA 5E8EH 2A2XH 1JIMA 5FAHA 1GBCA 1SQAA 1BTZA 1YPKH 1G9IE 1QCPA 1TLDA 2R2MB 3BTHE 2BDCA 4HGCA 1K1NA 1U6QA 4AYYB 1O3AA 4BAMB 2Z3DA 3UPEA 1ARCA 1O2TA 1TRMA 4BOHA 6LPRA 5LPFA 3E0PB 3SV8A 1NTPA 2RG3A 1QY6A 1C1MA 5FCKA 5C1YA 2FDAA 3EAJA 4O97A 2KAIB 1MTSA 1KXAA 4RSPA 4GAWA 4I32A 1L0ZA 1Q3XA 2DE9A 1EPTC 1IHSH 1ZPCA 3M3VA 4O3UA 1PQ7A 4B75A 1C1SA 2O8TA 2ZU4A 2XWBI 2HALA 1DANH 1YPHE 4AB9A 4KELA 3F9GA 1CO7E 4NA9H 1ZMJA 2BD8A 4K1TA 2CHAB 4CR5A 1CA8B 3RXJA 3TJVA 1DWCH 1IQMA 3MHWU 4PROA 3UFAA 4A1TA 3S9BA 4GHQA 3S69A 4MLFB 1HAXB 5BPEA 1MUEB 1SC8U 2ANWA 4CRGA 3P8GA 2Z9KA 1C5PA 1V2RT 1TGTA 2P8OC 3M5OA 3L3TA 1GI8B 2ZDVH 4SGAE 4BTIB 1DXWA 1EX3A 2C8XB 4WXVA 4ABHA 2P94A 4LXBH 4WMFA 1K22H 1QHRB 1SR5C 4FVBA 1WOFA 1GBLA 2FPZA 1HLTH 2FI4E 2JH5D 1T31A 1A5IA 1MH0A 1AWFH 4KGAA 1GBAA 1NRSH 1S0QA 3A7WA 2VNTA 4YT7H 1AY6H 4AFSA 1C5UA 1O5BB 4RN6A 1J15A 4ZXXH 2BDYA 4NA8A 2BZAA 1GBFA 3PLPA 4THNH 3HGNA 2CJIA 2BHGA 3GY8A 4E7RG 1FY1A 4Q80A 1EZXC 1ZJKA 5CMXH 3TGIE 1EJMA 4Y8ZA 1K1JA 2A7HA 2P16A 2D2DA 3TJNA 3SUEA 2GMTB 4M7GA 2CGAA 1T8LA 4X8TH 5ESTE 1FN8A 4AGKA 2BD5A 1Z8JB 7LPRA 2HNTF 4XBCA 2ZFRH 2F9PA 1QRWA 3FAOA 1YPGH 4DG4A 2ZU3A 1K1MA 1BIOA 3U1JB 3TGJE 5TJXA 4OS5A 2GTBA 3P6ZB 1SLUB 5HMAA 4CBNA 1UO6A 5FXLA 3SORA 4K1SA 4ABBA 1RTKA 1V2PT 3UREA 2FTMA 1OP0A 1RTLA 1MTNC 1WQSA 1GJ9B 1S6FA 1C5MD 2ZCHP 2AFQB 2C93B 1P2OA 1YPHC 2AH4X 1J8AA 3M7QA 5T3HA 1QNJA 1NM6A 4CRAA 1TNHA 1IQKA 3SV6A 3T5FH 5DP5A 1S82A 2CF8H 3KL6A 3D62A 4IC5A 4XE4A 2A4GA 3BTQE 2VVUA 1MU8B 1HJ8A 2UWPA 2QYIA 3QZQA 4JK5A 3RP2A 5FPYA 3RMLH 2HNTE 1TPAE 3RXDA 3NUMA 1C9PA 4YOIA 5E0JA 3LT3A 4X1QU 1K1OA 1F5LA 3RUOA 1OKXA 3ZZ3A 2BDHA 4BXSA 4CHAB 2Y7ZA 5JYIA 2CF9H 1GMHF 1O2GH 1GBIA 1SPJA 1FZZA 1F2SE 1TQ7B 5DP4A 2BY5X 1DX5M 1EZSC 1OXGA 1QIXB 4TPYA 5JPMH 1GBDA 5AFYH 3AW1A 1GBKA 1S85A 2GV6A 3BEFB 1XUIA 1KY9A 8GCHF 2G51A 5DP7A 2AIQA 1HAPH 1O3LA 2YNAA 1PPBH 3SV7A 2PGQB 1TAWA 1OYTH 3LOXA 5I25A 3E0NB 1HDTH 1K1LA 1MBMA 1VITH 2FS9A 3BN9A 2OC8A 2ZI2H 1AHTH 3QWCH 1NN6A 3BSQA 2O9QA 2GGVB 3ZZ9A 1QBVH 4K5ZA 2ZC9H 1TX8A 3ZVDA 1AU8A 3KQBA 4XBDA 5E0GA 3SJ9A 4E05H 1O2HA 1ESTA 1ESAA 3E91A 4FXGH 4ABDA 1ZHMA 4K69A 3RXEA 2Z94A 1AKSA 4BTTB 1DITH 1TNKA 4WY3A 1NPMA 4X6MA 1DWDH 1LDTT 2NU4E 2ANKH 3ZZCA 3DFLA 3GY4A 5LGOA 1QB6A 1V6DA 1GI0A 1FJSA 1C2KA 2FS8A