1LVMA

Catalytically active tobacco etch virus protease complexed with product
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
229
structure length
229
Chain Sequence
b'GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMDKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATALYTIC DOMAIN OF THE NUCLEAR INCLUSION PROTEIN A (NIA)
publication title Structural basis for the substrate specificity of tobacco etch virus protease.
pubmed doi rcsb
source organism Tobacco etch virus
molecule tags Viral protein
total genus 50
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvmA02
1XXFA 4D9QA 1MU8B 1MTNB 4H4FA 1C1OA 2FZZA 2WPMS 1TNKA 2I6QA 4SGAE 1C1MA 1CT4E 1ZRBA 4UFEH 1NO9H 2P94A 2BY9X 5JB8S 4CRAA 1HB0B 1TRMA 2NU0E 5AFYH 3FZZA 4RKJB 1S6FA 4JCNA 3K9XB 1CO7E 1LKAA 1TBQH 3LGVA 3SU3A 1ZOMA 2F9NA 2A7CA 1A0HB 3MNXA 3LH3A 2BD7A 1O2XA 1YC0A 4NA8A 3HK6B 1P11E 2G4TA 3VB5A 4FXGH 3SGBE 3ZZ3A 1NZQH 2OINA 1EZSC 1ZZZA 2FI3E 2GDEH 1SFQB 5A8ZA 1THPB 2H1UA 3KQCA 1B0EA 1QTFA 2V35A 3PO1B 1TB6H 1NROH 2FODA 1WTHD 2FP7B 5JBTA 3NZIA 4GPGA 2FOGA 2C8XB 1MH0A 2BDGA 4GLYA 5TCAA 3RMOH 5GCHF 1AUJA 4ABGA 3RMNH 3AW1A 4BTTB 4K1TA 1KXEA 4DIHH 1O3FA 2QN5T 3E3TA 4I8LA 2GZ8A 1AZZA 4FUBA 1G3CA 1K1JA 1L1GA 1LQDB 1MKWK 1GVLA 2Z9IA 1IHSH 4TY7A 4LK4A 1OWDA 1MBMA 4WXIA 1E36B 2VJ1A 1WAYB 3C27B 1ABJH 1BQYA 1TA6A 2QIQA 2K1QA 3VXFH 3ZYEA 1GBJA 1GJ4H 3SNDA 1CA0B 1DWEH 1BRBE 1IQJA 1C1NA 1PYTD 4Q2KA 1AMHA 2O8UA 3IWMA 1PQ8A 5C3NA 1NESE 3PMBB 3U69H 1MKXK 1QB6A 1O37A 1OOKB 3VB6A 4X6MA 1SGEE 4INHA 1Q2WA 1LPKB 2A2XH 1CHGA 1C4V2 2WPIS 5LGOA 1HXEH 1UTNA 3A8DA 4I32A 1FDPA 1IAUA 1TRNA 4K5ZA 1ZHMA 3T29A 1W8BH 3K2UA 4OS2A 1SG8B 1FXYA 1YF4A 2FX4A 1EAWA 3GY8A 1KXDA 3ZVFA 1GI4A 1H9HE 1H8DH 2ZP0H 3VB7A 4OS6A 1S85A 2OP9A 1OWIA 3UR9A 2GMTB 2QXGA 1GJ8B 1MAXA 1YPMH 2XYAA 3B23B 4X6NA 3SNBA 1NRPH 3L6PA 2GCHG 1AN1E 2BYAX 1C1PA 3FVFB 4AGJA 3MU5A 2IOTA 5BPEA 3SHAH 1SOTA 5ETXA 4K8BA 2EI8A 3U1IB 2GVFA 4YTAA 1C1TA 4O3TA 1GPZA 4R0IA 2A7JA 2J38A 5ABWA 1O32A 2Z6BD 3QGNB 1QJ1B 3ODDA 1KLIH 1EOLA 1ELVA 5TJXA 2FXRA 1SGCA 3QLPH 4UFDH 4X8SH 1SC8U 2GDDA 2Z3CA 3VGCC 2FPZA 2EEKA 3LPRA 4MPUA 5DO4H 2HLCA 1GJ7B 3RXGA 3E1XB 2OC1A 2THFB 4GHTA 3SUEA 2OC7A 1IQNA 2OTVA 1YLDA 3BTME 3TH3H 3VB4A 1BRCE 2G00A 1HFDA 1HBTH 1CBWB 3A7YA 1C5YB 5A0BA 3SJKA 1H1BA 1HV7A 1JBUH 3MTYA 5FCKA 2OQ5A 1VITH 2G5VA 2UWOA 4B2CA 3F9EA 1SPJA 3ZZBA 2XTTB 3HK3B 5L6NH 2J95A 2ILNA 4E05H 3SJ8A 1UTMA 1IQHA 1F0RA 1VCWA 5C1XA 1UVPA 1J14A 6CHAB 2V3OH 1IQEA 2BXTH 4U32A 1A3BH 1Z1JA 1AQ7A 1FQ3A 1GHVH 2F9PA 2OLGA 1NC6A 1HLTH 2HRVA 1BMMH 3SNAA 2BOHB 1ZLRA 1ANDA 1GHAG 3CS0A 3GCHB 1S5SA 1MD7A 1CU1A 1J9CH 4IN2A 3SU5A 1AKSB 3MNCA 1EJAA 2XBVA 1UK3A 1ELBA 9ESTA 3PM3A 2JH5D 2XBXA 1GJ9B 4WMEA 5HMAA 4UD9H 2R3YA 1PPBH 1WV7H 2SNWA 2PR3A 5AF9H 1TNJA 1Z8JB 1SQAA 4X1RU 2Y81A 1O3LA 1KXCA 3RC6A 1VITF 4X2VA 1DWDH 1TPSA 2ANMH 3PMHB 4K1SA 1THSH 4FUJA 5C20A 1FIZA 3F1SB 5F8XA 1ZSJA 1SL3A 1Z71A 4RN6A 1GBEA 3FAOA 3RM2H 3DHKH 1A2CH 2RG3A 2BVXH 2TGAA 5T6FA 4A1TA 1A61H 2QGRA 3LGTA 3AASA 1FUJA 3TU7H 1GHYH 1DOJA 1GMDG 3LU9B 3M7QA 1YBWA 2BQ6B 2NU3E 2A1DB 5C5NA 1P01A 2WV5A 1MCTA 2A4RA 2FESH 2BMGB 1NS3A 2R2WU 3K6YA 1Y59T 3TH4H 3BTDE 1SQTA 2ZFSA 3RXTA 3ZV8A 1P9UA 1TPPA 1ABIH 5GDSH 2C8WB 1X7AC 2ZHWH 1DVAH 2UWLA 1O2MA 4FUGA 1A5HA 3M5NA 4MDSA 2ZHQH 1P0SH 1UHBB 2PLXA 1GBIA 1QA7A 2DE8A 4J2YB 2VVCA 1AO5A 1UCYK 1CGHA 3GCOA 1PJPA 1SMFE 1EUFA 1P2JA 5FXLA 2BD8A 1IQGA 2OD3B 1GI8B 3M7TA 2SGQE 4NIWA 1IQIA 4H42U 3BSQA 4X1SU 1EZUC 3A8AA 1BRUP 4IC6A 4U01A 5DP3A 1C9TA 4AFSA 4U2WA 3TITA 3I29A 1W7GH 1AVGH 4YLUA 1P2KA 2FOMB 8KME2 2J92A 4ISOA 2ZO3H 2F9UA 1DPOA 1GMHF 1GJAB 2V6NA 3U9AH 2Y6TA 2OQUA 4K60A 6LPRA 1GMCF 1AIXH 4DT7B 3EDXB 1V3XA 4HFPB 2VGCB 2ZFPH 3A88A 1UVOA 1TQ0B 1T8OA 4TWYA 5EPNA 1XUGA 3HATH 1C5XB 2A32A 1P10A 2F3CE 1XUHA 1L4ZA 3NCLA 1KDQB 2TGPZ 4Y7BA 1Q3XA 4FVDA 1AKSA 4MNWA 1PFXC 3A8CA 1YPKH 2UUFB 4JYTA 3SI3H 1N6YA 4AFZA 1QBVH 2BDAA 4NSYA 3BG8A 5A8YA 2AEIH 3ZVBA 4E7NA 1Y3YA 1O5BB 4Y7AA 2SGPE 4A6LA 3RXQA 2AYWA 4VGCC 4H6SB 1GWAA 3EYDA 1PPHE 1YM0A 3RXKA 1EPTB 1O2KA 5ESTE 1AVXA 1F7ZA 1GHZA 1K22H 3TJNA 1LHEH 1O5CB 2ZF0H 5GPIB 3SN8A 3PB1E 4RSPA 2P95A 3GCTF 4Y0ZE 5A0AE 5C1UA 3LC3A 3LGYA 1BTHH 4LOYH 1Z7KA 4DIIH 2BDBA 2A5IA 3LH1A 3A83A 4JZFH 4JZDH 1ZTJA 1K1LA 1LVOA 2AMQA 7GCHG 4TWWA 3A7VA 4NCYA 2XBWA 1OSSA 1H4WA 1NT1A 1OYQA 2TGDA 1AZ8A 4X1QU 4ISHH 5I25A 5L2YH 1EAUA 4B73A 2O8MA 4CR5A 1CGIE 4E7RG 5GJ4B 1VGCC 1C5PA 2VIWA 2CMYA 1Z8RA 4I33A 2CF8H 1HAGE 4F49A 2ZDAH 2A0QB 1WBGB 1OXGA 4K1EA 1EZQA 5L30H 3QZQA 2ZU3A 4NG9H 1MKWH 1S81A 4KTCA 4HTCH 3TGIE 1O2SA 2BY6X 4Y10E 4NIVA 5DP6A 4UONA 2FI5E 2VNTA 2ZU2A 1TPAE 5TCCA 4HI3A 1MKXH 1N8OC 8GCHG 4JZEH 5A0CA 4JK5A 1RTLA 3BN9A 1AVWA 3BTQE 4B2AA 2C93B 3E6PH 1O2UA 2V0BA 4MPWA 1AY6H 2P3TB 3K65B 5EXNA 1WUNH 3OY5U 2F83A 3RLWH 1CVWH 3M5LA 3SU4A 3BTTE 1IQKA 3ZZ4A 5F8ZA 1LHCH 1HAVB 1SVPA 2BDYA 4NA9H 1O5FH 3T27A 4DG4A 1O3CA 1PQ5A 2BQWB 4NGAH 1GI7B 1UCYE 4THNH 4BOHA 5T6DA 3TGKE 2RA0A 1V2RT 3ELAH 4B76A 5AFZH 1KTTB 3M61U 1Y5BT 1BBRE 4NWLA 5FPSA 3IITA 4K69A 1DY9A 1C9PA 1GDUA 2XWAA 4ZROA 4Y6DA 1BT7A 2H9HA 1F92A 1QRXA 1CHOG 1YPGH 3TK6A 3GY6A 1LVYA 2PKSC 2CGAA 1IQLA 2QCYA 3SI4H 3A86A 1C4Y2 3TNSA 1ELCA 5EGMA 5EG4A 4YESB 5DG6A 2G52A 3AAUA 3E0PB 1SGIB 3UOPA 1S84A 1V2VT 5HYOA 5K0HA 4X6OA 3QZRA 1J8AA 1Y5AT 4JYUH 3DUXH 3NUMA 2AGIX 5GIBA 1UTLM 4B2BA 4Y8ZA 1QBNA 5EOKA 1V2TT 4IS5A 1FAXA 5FX6A 4CBOA 4KTSA 1D3PB 4ABDA 1XM1A 5F03A 1E0FD 1SGQE 2VIVA 4DGJA 1A7SA 4GHQA 5L2ZH 3D23A 3SBKA 2KAIB 3DA9B 2ZFFH 3I77A 1TA2A 2FOFA 3STIA 1TFXA 1BUIA 4LXBH 4UDWH 1MU6B 1FN6A 4KKDA 5T3HA 1O33A 1NFWA 1V2JT 1QNJA 5CHAB 3Q3YA 1A4WH 3BIVH 2P59A 1NN6A 4OGXA 2A7HA 1QB1A 2W7SA 1LHGH 4NFEA 3DFJA 1P8VC 2AIQA 2P8OC 4B71A 1TGTA 2ZDNA 1F5RA 2D8WA 1GBMA 1Z8IB 4I8KA 1GBDA 3BTEE 4AYYB 1UMAH 1YP9A 1DSTA 1GCTC 1XKBC 5EPYA 2OC8A 1LTOA 2EI7A 2PKAA 1N8OB 1EJNA 1SGDE 1Z1IA 1ETRH 1SQOA 3RMLH 4ABAA 1H9IE 1O3IA 1EOJA 1TBRH 4BAOB 1XUFA 5J4QA 4FUCA 4K2YA 2TPIZ 3ATKA 4FUDA 2HNTC 2ZWLH 3MYWA 2D26C 1AB9C 2ZECA 4JZ1A 3GY4A 2BLOA 2WPJS 2F9BH 1M9UA 3DD2H 2ZCKP 3NPSA 1HJ8A 1GHBG 2ZCLP 1DWCH 1O3KA 4ESTE 5CMXH 1YCPK 2LNCA 1UVSH 4CRDA 1HIAA 9LPRA 1CT2E 5DK1A 2HNTF 1S0QA 2Z9KA 5JBAS 5JB9S 1DLEA 1TIOA 3D62A 2ZU5A 4CHAB 2WYGA 1BTZA 2XCFA 2BD5A 2VVUA 1NRQH 4U30A 1ZTKA 1O2IA 2QA9E 1AFQC 1QL9A 2WPHS 3RLYH 3W94A 1TMTH 3P8NA 4OS4A 2BX4A 3VFEA 1Y8TA 1AWHB 1GI3A 1QR3E 1PQ7A 1D9IA 2JKHA 3BF6H 1QJ7B 1ZPCA 1WYKA 3RXSA 2TIOA 1TMBH 2F91A 2XXLA 2PKSB 1FZZA 5C67A 3M3VA 3SJ9A 2GD4B 1C5SA 3UNQA 2ZDVH 2SGFE 3RXAA 4I7YH 1D3QB 4UFGH 1F5LA 1C2IA 1EAXA 1HPGA 3QX5H 1J16A 3RU4E 3VB3A 2SFAA 1TX7A 2JH6D 1B7XB 5FPTA 2F9VA 4Z0KA 1YPHE 1BHXF 1RIWB 4KGAA 1O2VA 3RXBA 3T28A 3ZYDA 3SQHE 4A5TS 5EQQA 4XOJA 5EQSA 3A7XA 1MZDA 4INKA 4YOGA 2BLQA 2Z9JA 3UFAA 1ZHPA 2BD2A 1SGNE 3RXPA 3OU0A 3EA9A 4MNXA 3MI4A 5FCRA 1NRNH 3T25A 3E16B 1UTKA 1XUIA 2KAIA 1O3BA 5HGGA 1O2NA 4X0WU 3LC5A 2VU8E 5LPRA 2G4UA 2GKVE 1F2SE 1CA8B 4XSKU 2SGDE 1FV9A 2BVRH 2ZKSA 3F6UH 3SV9A 1OKXA 1OWKA 1B5GH 3VEQB 5BRRE 4O97A 4CREA 1GHWH 1TABE 1HAYB 4XBDA 2BB4A 2XW9A 1V2LT 2VWOA 2WV4A 3P6ZB 3VPKA 1C1RA 1V2UT 2P8OB 1ELAA 1GG6C 5CE1A 3UIRA 3CENA 2EC9H 1GGDC 1GCTB 3BIUH 3HKJB 3TJOA 3EE0B 1OS8A 4IN1A 2FTMA 3PTNA 1BIOA 1P03A 1HJ9A 1QJ6B 2ZNKH 3H7TA 4JMYA 1C2KA 4MQAA 3SV2H 1LPZB 1PPFE 4ISNA 3ZZ5A 2PTNA 1O5AB 2SGAA 2A5AA 5IDKA 1WCZA 3BG4C 3SV7A 3PMJA 3STJA 3URDA 3M3TA 2GZ7A 3A85A 4HZHA 4I8GA 1ELEE 5FPYA 2ZEBA 3O8RA 3PV4A 3U8OH 3RXOA 5AHGH 1GL0E 5HM9A 4ZMAH 4MNYA 1GBLA 3BTWE 3HKIB 3U8RH 1DE7H 1L1NA 2Y5FA 3RDZA 3Q76A 4O03A 1EAIA 1JRSA 2A4OA 4D7GA 3MO3A 1OP2A 1DS2E 2LPRA 1AFQB 1K21H 7GCHF 1O2PA 2XWBI 5EW1H 3KIDU 1OWHA 3A81A 4PROA 3A8BA 3U8TH 3V12A 3OSYA 1HRTH 3GDUA 5ESBA 2DUCA 3SV6A 2PUXB 3ZZ6A 1PQAA 1NFYA 2ZGJA 1DXWA 3ATIA 1TQ7B 1O3JA 3RXFA 5EODA 4YT7H 4WH6A 4WMFA 3I78A 4ZKRU 3KQDA 1TOCB 1D4PB 3U98H 1NPMA 3S69A 4CRFA 3M37A 3T62A 1TGSZ 1TYNA 1O3HA 1P9SA 3PLPA 4D7FA 3QK1A 1SOZA 1JOUB 1GI9B 3BEUA 4ISLA 4JZIA 7ESTE 1LQEA 3H5CB 2O8WA 2ZZUH 1C2GA 5FX5A 1IQMA 6GCHG 2ODQA 4FUIA 1W0YH 1FY3A 1WQVH 4RKOB 4YZUA 1TX6A 5GCHG 1XX9A 1CE5A 1ARBA 4QT8C 4TPIZ 1TE0A 2VH6A 5JBBS 4BTIB 1EQ9A 2ZQ2A 3AAVA 1SHHB 5JYIA 1F0UA 1QRZA 2ZCHP 5DP8A 1TBZH 1W12U 3LDXH 1T32A 4BNRA 1MZAA 1P57B 1XMNB 1YPJH 3Q3KA 1O2ZA 2ZU4A 5JPMH 3ODFA 3SU6A 1KLTA 5DP5A 1Y3XA 4IMZA 2STAE 3ZZ8A 2BZ6H 4FUHA 3WY8A 1GDQA 1TRYA 2Z94A 2FOBA 2BM2A 3DT0H 1E34B 1XUJA 2H5DA 1ZTLA 5DP9A 4IC5A 2H2ZA 2VIQA 1D3DB 1GBAA 3RUOA 1C4U2 4WWYA 3VGCB 1DUAA 2WUBA 2H9EH 4Q7YA 1QRWA 1LKBA 1GG6B 1L1JA 1BMNH 1QBOA 5GWZA 1C5LH 1E35B 2C90B 1L2EA 4X2YA 1HAIH 3TH2H 4CH2B 5FAHA 3P95A 1LHDH 1BCUH 1HYLA 4NSVA 3S9BA 2BD4A 1UO6A 1UTOA 3GICB 3GOVB 2ULLA 1O3NA 4XBBA 5AVDA 3SU0A 1C1VH 1Q31A 1BBRK 3LKWA 1QY6A 3SUFA 1JIRA 3O8BA 4ISIH 2UUKB 3V0XA 1RJXB 2ZPQA 1Y5UT 3PWBA 4R8TB 2BD9A 1FAKH 3SHCH 1OP0A 2BXUH 4JYVH 2PTCE 1QCPA 2VVVA 2A5KA 1G32B 1QURH 4B75A 4BTUB 2F9OA 4DY7B 3ZZ9A 3FP6E 2RA3A 3LGWA 1GBTA 1YKTA 1ETTH 3MU0A 4IW4E 1ANBA 3A80A 3M35A 2GT7A 3MWIU 3Q00A 1QQUA 5C5OA 1ACBE 3T26A 1ZMJA 1TPOA 3QN7A 2TGTA 1AE8H 1ESBA 5DP4A 3LGIA 2JETC 2Y7ZA 2QYIA 1ANCA 4ZHLU 1UJ1A 1ESTA 4ZUHA 1TAWA 1EP6A 2BDCA 1CSOE 2YNAA 2ZPRA 4CR9A 3RXLA 2QXJA 1J15A 2WPLS 1XXDA 1FLEE 1FIWA 5E2OA 1NFXA 2O8LA 1O2OA 1V2MT 3TK5A 1SGFG 1N1LA 2ZTYA 5DGJA 1XKAC 4K8YA 3H7OA 1SLVB 1JIMA 4X8VH 4DOQA 1QIXB 1G2MA 1S82A 3LONA 1TMUH 1SGPE 3KN2A 3ZZDA 1AWFH 3S9CA 3GDSA 1SSXA 2I6SA 2RDLA 1L0ZA 4Q7XA 3KQEA 1DXPA 2ANWA 2D1JA 4DVAU 2W5EA 1RTFB 2Z3DA 3KCGH 2BVSH 2ZGBH 1PPGE 4K3JA 1ORFA 2ZC9H 1Z8GA 1QHRB 2HPPH 3QGJA 1O3MA 1QFKH 3EAJA 3RM0H 1O0DH 1LVBA 1FY8E 1OP8A 1TWXB 1K1OA 4YO9A 2ZDMA 1SGTA 1ELDE 1C5ZB 4JK6A 2ZFTA 3OY6U 1T4VH 4KTUA 1HJAC 1HAZB 4GCHG 1YYY1 3MNSA 1ZMLA 1GHBF 1LVMA 4AFUA 1SGFA 4GUXA 3SORA 4Y11E 1G3EA 2R2MB 1P09A 3TJUA 3LIWA 4BAQB 1UHBA 3F9FA 2GT8A 1BMAA 2Y7XA 4Y79A 1BDAA 4Q80A 3P8GA 3ZVDA 1W7XH 3RC4A 1GBFA 2V3HH 2A45B 2ZU1A 1TNLA 1VITG 4ZKSU 1O2HA 1EZXC 1F0TA 1P12E 2FOAA 1SR5C 1ZSLA 3BV9B 5E8EH 5FBIA 3E91A 1DANH 2VINA 1FI8A 4YOJA 1SGRE 3MH7A 1T8LA 2BDHA 2QY0B 4BANB 1ARCA 4I8JA 3TK9A 1T8NA 1THRH 2Q1JA 4MPVA 4Z6AH 3PMAB 1MTWA 1K1IA 4GSOA 3R0FA 4X2WA 1E38B 2PGBB 1TGCA 3RP2A 1LCYA 4AOQA 2CXVA 1H9LB 1VJAU 3LOXA 2FOCA 1HAHH 3PO1C 1IQFA 3KNXA 2WINI 1C5UA 2OC0A 1SB1H 2OBOA 2BQ7B 2D2DA 2Y80A 1VJ9U 3NWUA 1RTKA 2TRMA 1C2DA 1KDQA 3PLBA 4O9VA 1BJUA 1UVTH 1V2ST 3A87A 1GI1A 1PPZA 3A89A 3TVJB 2GCHF 2UUYA 2ODPA 1MUEB 1F0SA 2C3SA 5E0HA 1FPHH 3BEIB 3S7KB 2G81E 3JZ1B 3ZVCA 1T7CA 3MOCA 4OS1A 4VGCB 4WH8A 1JXPA 4DURA 1ZJDA 4YT6H 1EPTA 1V2QT 3RU4D 1WTGH 5E0GA 1OWEA 3GDVA 4XE4A 3RXHA 1B0FA 1W10U 3FANA 4ABJA 2NU1E 4Y8YA 1CA0C 2J2UA 1YPEH 1NY22 4A1XA 4BAMB 2ZDKA 3QO6A 1AI8H 1NRRH 2H6MA 3LT3A 1HAPH 1C2MA 1GMHG 3CS7A 1O35A 1BTYA 3QWCH 3SUDA 3SU1A 1GMCG 1C5NH 3P70B 3ZV9A 3MU1A 2FLRH 1Z6EA 4WXVA 1P2QA 3MH5A 5T6GA 1NU9A 1WSSH 3A84A 3MU4A 1S6HA 4Y8XA 1EATA 2O9QA 3NK8A 3ZVAA 1A0LA 4NWKA 4XDEA 1VGCB 1VZQH 2XC0A 3UUZA 5SGAE 2ESTE 3PWCA 3W95A 2GMTC 3R3GB 3UWIA 1KSNA 2QAAA 3QTVH 1D3TB 2Q6DA 2JH0D 3EA8A 3FP8E 1BOQA 2Z9GA 3MO9A 1VCPA 2WYJA 4WY3A 4IBLH 4AORA 1DUEA 2B8OH 3A7TA 3RXCA 2FWWA 5A09A 2AERH 3HGPA 1GHAF 1NRSH 3UWJH 7LPRA 1GI0A 1ZHRA 3GY3A 4NA7A 1GJBB 1LDTT 3GCTG 2FIRH 3SQEE 1OWJA 1DSUA 3TPIZ 1A0JA 1FNIA 1P04A 1WQSA 2G8TA 3GY5A 3V7TA 4ABFA 4WJG2 1ID5H 3MHWU 2GCTC 2GTBA 3SOSA 2IN2A 1GBBA 1GJDB 3SNEA 2ZFQH 1OYTH 5LPEA 7KMEH 1SLWB 3P92A 2A2QH 2ZI2H 1K1NA 1MMJN 5B6OA 1ELFA 1RGQA 1O30A 3UTUH 1CBWC 1ZYOA 1ZJKA 1A1RA 3M5MA 4ZXYH 1HAVA 1BMLA 5HM2A 3SO3A 1NM6A 1O3EA 3BEFB 1SHYA 3M3SA 4LZ1H 1P2OA 3RXEA 4BAHB 4MTBA 3O8DA 3SJOA 4MVNA 3V13A 1FPCH 3ZVGA 1MBQA 2ZGXH 6GCHF 2C8ZB 2FOHA 4MPXA 3ENSB 2UUJB 2ZHDA 1TX8A 2HGTH 3RU4T 6CHAC 1AD8H 5GXPA 2ZG0H 1C5MD 3OYPA 1A3EH 1TOMH 2J94A 2GP9B 4AFQA 1KY9A 1ZPBA 3QUMP 1LPGB 5G4BA 1K1MA 1RXPA 1MCVA 2O8TA 1TLDA 3EGKH 3SV8A 5JBCS 1GMDF 3P17H 3RXUA 3JZ2B 3V3MA 1C1WH 3ZZAA 1U6QA 4B1TA 1P05A 1HDTH 3GCHC 4ASHA 1P2MA 3HPTB 1C2LA 4M7GA 1O3GA 1GHXH 1TNIA 1Y3WA 2GX4A 2CJIA 1K1PA 1DY8A 3SGQE 2NWNA 3U1JB 2ZA5A 2AGEX 1V6DA 3UPEA 1UCYH 2XRCA 4O3UA 4DCDA 3BTFE 1G30B 3KQBA 2IPHA 4WMDA 4AGKA 4ZKOU 4OS7A 3G01A 2C4FH 1BITA 2B0FA 1GI2A 4AZ2B 1C5OH 2ZGHA 5DPAA 5A2MH 3PYHA 2ZFRH 1DITH 1K2I1 1BBRH 4FUFA 1G37A 5PTPA 1O2QA 1O2YA 1EASA 1TNHA 5H4IB 1O2WA 5LH8A 2J9NA 1NTPA 1SLXB 3TNTA 2CF9H 2P16A 3UR6A 1HAXB 1MQ5A 2ODYB 1LHFH 4F4OC 2ASUB 1QGFA 3M5OA 3MNBA 3K6ZA 2BDIA 2HVXA 1G36A 2GGVB 3LJJA 3UREA 3E8LA 2BLVA 4NZQA 2VB0A 1CQQA 3URCA 3CP7A 1C1QA 1JRTA 1QL7A 3UNSA 4WVPE 2VH0A 1BRAA 1W0ZU 5K7RA 1T8MA 1KIGH 1O5GH 1UTPA 2STBE 4TY6A 1GBHA 1O36A 1GI6A 1OPHB 1E37B 3F9HA 1HXFH 3FP7E 1GBCA 2PWXA 4A1VA 1XVMA 1DX5M 3TLOA 4AB8A 4J1YA 1ESAA 1ELGA 1GJ5H 2GCTB 1LMWB 5C1YA 1D6RA 1P02A 4AG2A 1ZSKA 4Y71A 1AB9B 1C1SA 4Y76A 1O5EH 2CV3A 3ITIA 4A7IB 1AGJA 1OX1A 1KYNA 2AMPA 3BTHE 1PPCE 2XBYA 2OUAA 2FI4E 2VWLA 4CRCA 3MH4A 4KELA 3SUGA 2XCNA 1C5QA 1W3CA 2AH4X 5E2PA 1FONA 1QA0A 2W26A 3RXDA 1DDJA 1MTVA 2QC2A 1HAOH 1GJ6A 4AB9A 4NIXA 3SZNA 3PROA 3T2NA 2R0KA 1RS0A 2EI6A 3D49H 4OS5A 4ZH8A 2FTLE 5I46H 1O2RA 2HWLB 4NIYA 2J4IA 2FOEA 2VGCC 1O31A 1TONA 1KTSB 2A4GA 1L4DA 4AG1A 2PUQH 3GISB 1BHXB 2SNVA 1SFIA 1GVZA 2G51A 1H8IH 1MD8A 1G3DA 4FU9A 2QV1A 4X1NU 1YGCH 3GYMA 4GCHF 2ALPA 2VIDA 4E06H 1WOFA 5J4SA 3UY9A 2ZQ1A 3B9FH 1HCGA 2FO9A 2RCEA 1AU8A 2XC5A 1DM4B 1EJMA 1IOEA 4FU8A 2NU4E 4ABIA 1EPTC 2R0LA 2FLBH 1O2LA 1EXFA 5DJ7A 1YPLH 2G5NA 3S0NA 1AHTH 3L33A 5EU8A 1FN8A 2FMJA 8GCHF 5HXFA 4BXWA 3SJIA 2YOLA 1KXFA 1WU1A 2FEQH 3FFGA 3N7OA 1XVOA 3VXEH 1BTWA 1UTQA 1K9OE 3Q3XA 2BTCE 1DWBH 2OBQA 1ZRKA 2BHGA 2ANKH 1C5RA 2NU2E 3EA7A 1S0RA 4ZKNU 1A46H 2TBSA 1EKBB 4MLFB 1P2NA 1QL8A 2FYQA 2OXSA 1O2GH 1NFUA 2VWMA 3D65E 1FMGA 5C2ZA 1PPEE 5EQRA 1BTPA 4AN7A 1GGDB 1V2NT 2J34A 1T4UH 2H9TH 1NU7B 4GAWA 3PLKA 4GVUA 2PV9B 1VCQA 2BLWA 1SI5H 4AX9H 4FU7A 1AFEH 1DICA 2R3UA 2A4QA 4MNVA 4X6PA 2Y82A 2AMDA 3M7UA 2ZHEH 3ZZ7A 4WF8A 3BG4B 2A31A 3RXJA 1ZPZA 5A8XA 3GY7A 3TJVA 1TGNA 1P06A 1W13U 3MO6A 1CHOF 1UTJA 1C5WB 3F68H 1UK4A 3EQ0H 2Z3EA 4AYVB 1O38A 2FDAA 3T5FH 1O5DH 4ABBA 4BXSA 4UEHH 1G2LA 2CN0H 3OTJE 1BA8B 1YPHC 4YLQH 2Q6GA 8ESTE 1FY4A 1C2FA 5IYTA 1GCDA 1C5TA 1V2WT 2AIPA 3GYLB 3E90B 2VIOA 3RXVA 5F8TA 2BY8X 1FY1A 1C2JA 4TYDA 4CBNA 2ZTZA 2GV6A 1MQ6A 2Z7FE 3KF2A 4UFFH 2PFEA 1O2TA 1BTXA 3IG6B 3DFLA 3F9GA 4UE7H 1Z6JH 3OX7U 3SNCA 4B74A 4ABEA 5EXMA 1JMOH 3QDZB 1C1UH 5FBEA 2BD3A 1AUTC 2IJOB 1C5VA 2AGGX 4X8UH 1MAYA 3B8JA 5FHTA 3S9AA 1SBWA 1TGBA 8LPRA 2HNTE 2CHAC 4I8HA 1W11U 1LO6A 2BY5X 1BZXE 4YM9A 3UQVA 3UOUA 2FX6A 2FS8A 1YCPM 3LJOA 1CT0E 2P93A 4ZXXH 2ZDLA 5EW2H 1ELTA 1QQ4A 2PHBA 1Y3VA 2ZGCA 2GV7A 4X8TH 2HPQH 3C1KA 4XFQA 6ESTA 3E0NB 2R9PA 1HGTH 4FVBA 1DFPA 1G9IE 3SGAE 2UWPA 1EB2A 3UQOA 2EA3A 1YCPH 2Q6FA 4I31A 1F5KU 2AS9A 1V2PT 4D9RA 4H6TA 2HOBA 3HGNA 1O3PB 2W3KA 1A5IA 3KHVA 4ZAEA 1S83A 2QXIA 4IGDA 2B7DH 3MMGA 1GL1A 3QTOH 2C8YB 1HUTH 2FYRA 3KEEA 1GDNA 2BOKA 1BB0B 4CH8B 2WUCA 2VIPA 1N6XA 1SGYE 3AW0A 3AVZA 5E0JA 1MTNC 2QF0A 1O3OA 2VWNA 1ZGIA 1ETSH 3LGUA 2WPKS 3RXMA 1P3EA 3ATLA 1V2OT 3RXIA 4ZHAA 1MTUA 2P3UB 5LPFA 2ANYA 2HALA 5CHAC 1BJVA 1KLJH 4OGYA 3ESTA 1BTUA 3RC5A 4IMQA 1ZGVA 4DJZB 3A7WA 3RXRA 3P8FA 1MTSA 2ZPSA 3O8CA 1O39A 1UVUH 1GBKA 1QB9A 1T31A 1GJCB 2BY7X 2PKAB 1O3DA 1K28D 4Q7ZA 1W14U 5JDUB 2B5TB 3L3TA 1HNEE 4NZLA 2Z9LA 2GZ9A 4BAKB 2Y5HA 3KL6A 1PYTC 1FY5A 4X1PU 3GCNA 1ZR0A 1EB1H 1DT2A 4TPYA 3ZVEA 1DLKB 2B9LA 3FZDA 2ZHFH 4SGBE 2JETB 1V2KT 4FUEA 2P3FH 1RRKA 3SU2A 1VR1H 1HIAB 5DP7A 1CGJE 4D76A 2FS9A 1JWTA 1EP5A 2QXHA 3NKKA 4KP0A 4CHAC 3MFJA 1J17T 4XBCA 4ZHMU 5DKMA 3BTKE 1TNGA 3A7ZA 5EXLA 2ZTXA 5F6MA 1YLCA 1O34A 3KGPA 2PW8H 4DW2U 1XUKA 3MU8A 1AE5A 4MG3A 2ALVA 2H5CA 3NXPA 4D8NA 3P8OA 2XNIA 3TGJE 2PGQB 4X2XA 1TALA 1D6WA 1KXAA 1RD3B 1W2KH 1O3AA 4INLA 1EX3A 1C2EA 2PSYA 1O2JA 1FJSA 4LZ4B 2CHAB 3RMMH 2Y5GA 3ZZCA 4YOIA 1P3CA 1A5GH 1ANEA 1GVKB 3MH6A 2PSXA 4CRGA 3ATMA 2G55A 2SGEE 2OCVB 1Y3UA 4ABHA 2ZIQH 1P2IA 4A92A 2BZAA 1C2HA 3A82A 2W3IA 4NFFA 3BTGE 2YNBA 3S7HB 3ATWA 3PTBA 3SW2B 1RIWC 1SLUB 2AFQB 2XC4A 3TIUA 2M5TA 2FM2A 4HGCA 1HJAB 1G3BA 2BX3A 1GI5A 1UK2A 1ZMNA 3UNRA 3Q77A 2W7UA 2DE9A 1RFNA 3GY2A 3M36A 2QF3A 1INCA 1KXBA 4CRBA 1IHTH 4Y0YE
chains in the Genus database with same CATH superfamily
1XXFA 4D9QA 1MU8B 1MTNB 4H4FA 1C1OA 2FZZA 2WPMS 1TNKA 2I6QA 5DSFA 4SGAE 1C1MA 1CT4E 1ZRBA 4UFEH 1NO9H 2P94A 2BY9X 5JB8S 4CRAA 1HB0B 1TRMA 2NU0E 5AFYH 3FZZA 4RKJB 1S6FA 4JCNA 3K9XB 1CO7E 1LKAA 1TBQH 3LGVA 3SU3A 1ZOMA 2F9NA 2A7CA 5CHBA 1A0HB 3MNXA 3N7DA 3LH3A 2GJGA 2BD7A 1O2XA 1YC0A 4NA8A 3HK6B 1P11E 2G4TA 3VB5A 4FXGH 3SGBE 3ZZ3A 1NZQH 2OINA 1EZSC 1ZZZA 2FI3E 2GDEH 1SFQB 5A8ZA 1THPB 2H1UA 3KQCA 1B0EA 1W0KD 1QTFA 2V35A 3PO1B 1TB6H 1NROH 2FODA 1WTHD 2FP7B 5JBTA 3NZIA 4GPGA 2FOGA 2C8XB 5EIYA 1MH0A 2BDGA 3CNRA 4GLYA 5TCAA 3RMOH 5GCHF 1AUJA 4ABGA 3RMNH 3AW1A 4BTTB 4K1TA 1KXEA 4DIHH 1O3FA 2QN5T 3E3TA 4I8LA 2GZ8A 5C17A 1AZZA 4FUBA 1G3CA 1K1JA 1L1GA 3WWBA 1LQDB 1MKWK 1GVLA 2Z9IA 1IHSH 4TY7A 4LK4A 1OWDA 1MBMA 4WXIA 1E36B 2VJ1A 1WAYB 3C27B 1ABJH 1BQYA 1TA6A 2QIQA 2K1QA 3VXFH 3ZYEA 1GBJA 1GJ4H 3SNDA 1CA0B 1DWEH 1BRBE 1IQJA 1C1NA 1PYTD 4Q2KA 1AMHA 2O8UA 3IWMA 1PQ8A 5C3NA 1NESE 2QF5A 3PMBB 3U69H 1MKXK 1QB6A 1O37A 1OOKB 3VB6A 4X6MA 1SGEE 4INHA 1Q2WA 1LPKB 2A2XH 1CHGA 1C4V2 2WPIS 5LGOA 1HXEH 1UTNA 3A8DA 1S6LA 4I32A 1FDPA 1IAUA 1TRNA 4K5ZA 1ZHMA 3T29A 1W8BH 3K2UA 4OS2A 1SG8B 1FXYA 1YF4A 2FX4A 1EAWA 3GY8A 1KXDA 3ZVFA 1GI4A 5EJZA 1H9HE 1H8DH 2ZP0H 3VB7A 4OS6A 1S85A 2OP9A 1OWIA 3UR9A 2GMTB 2QXGA 1GJ8B 1MAXA 1YPMH 2XYAA 3B23B 4X6NA 3SNBA 1NRPH 3L6PA 2GCHG 1AN1E 2BYAX 1C1PA 3FVFB 4AGJA 3MU5A 2IOTA 5BPEA 3SHAH 1SOTA 5ETXA 4K8BA 2EI8A 3U1IB 2GVFA 4YTAA 1C1TA 4O3TA 4P00A 1GPZA 4R0IA 2A7JA 2J38A 4XRNA 5ABWA 1O32A 2Z6BD 4HG6A 3QGNB 1QJ1B 3ODDA 1KLIH 1EOLA 2J97A 1ELVA 5TJXA 2FXRA 1SGCA 3QLPH 4UFDH 4TSFD 4X8SH 1SC8U 2GDDA 2Z3CA 3VGCC 4B6FA 1E79D 2FPZA 2EEKA 3LPRA 4MPUA 5DO4H 2HLCA 1GJ7B 3RXGA 3E1XB 2OC1A 2THFB 4GHTA 3SUEA 2OC7A 1IQNA 2OTVA 1YLDA 3BTME 3TH3H 3VB4A 1BRCE 2G00A 1HFDA 1HBTH 1CBWB 3A7YA 1C5YB 5A0BA 3SJKA 1H1BA 1HV7A 1JBUH 2KX4A 3MTYA 5FCKA 2OQ5A 1VITH 2G5VA 2UWOA 4B2CA 3F9EA 1SPJA 3ZZBA 2XTTB 3HK3B 5L6NH 2J95A 2ILNA 4E05H 3SJ8A 1UTMA 1IQHA 1F0RA 1VCWA 5C1XA 1UVPA 1J14A 2JJ2D 6CHAB 2V3OH 1IQEA 2BXTH 4U32A 1A3BH 1Z1JA 1AQ7A 1FQ3A 1GHVH 2F9PA 2OLGA 1NC6A 1HLTH 2HRVA 1BMMH 3SNAA 2BOHB 1ZLRA 1ANDA 1GHAG 3CS0A 3GCHB 1S5SA 1MD7A 4P02A 1CU1A 1J9CH 4IN2A 3SU5A 1AKSB 5HIZA 3MNCA 1EJAA 2XBVA 1UK3A 1ELBA 9ESTA 3PM3A 2JH5D 2XBXA 1GJ9B 4WMEA 2WSSD 4UD9H 5HMAA 2R3YA 1PPBH 1WV7H 2KFWA 2SNWA 2PR3A 5AF9H 1TNJA 1Z8JB 1SQAA 4X1RU 2Y81A 1O3LA 1KXCA 3RC6A 1VITF 4X2VA 1DWDH 1TPSA 2ANMH 3PMHB 4K1SA 1THSH 2J98B 4FUJA 5C20A 1FIZA 3F1SB 5F8XA 1ZSJA 1SL3A 1Z71A 4RN6A 1GBEA 3FAOA 3RM2H 2RFKC 3DHKH 1YY3A 1A2CH 2RG3A 2BVXH 2TGAA 5T6FA 4A1TA 1A61H 2QGRA 3LGTA 3AASA 1FUJA 5GNDA 3TU7H 1GHYH 2V7QD 1DOJA 1GMDG 3LU9B 3M7QA 1YBWA 2BQ6B 2NU3E 2A1DB 5C5NA 1P01A 2WV5A 1MCTA 2A4RA 2FESH 2BMGB 1NS3A 2R2WU 3K6YA 1Y59T 3TH4H 3BTDE 1SQTA 2ZFSA 3RXTA 3ZV8A 1P9UA 1TPPA 3W1EA 1ABIH 5GDSH 2C8WB 1X7AC 2ZHWH 1DVAH 2UWLA 1O2MA 4FUGA 1A5HA 3M5NA 4MDSA 2ZHQH 1P0SH 1UHBB 2PLXA 1GBIA 1QA7A 2DE8A 4J2YB 2VVCA 1AO5A 1UCYK 2W6ID 1CGHA 3GCOA 1PJPA 1SMFE 1EUFA 1P2JA 5FXLA 2BD8A 1IQGA 2KCAA 2OD3B 1GI8B 3M7TA 2SGQE 4NIWA 1IQIA 4H42U 3BSQA 4X1SU 1EZUC 3A8AA 1BRUP 4IC6A 4U01A 5DP3A 1C9TA 4AFSA 4U2WA 3TITA 3I29A 1W7GH 1AVGH 4YLUA 1P2KA 2FOMB 8KME2 2J92A 5EJLA 4ISOA 2ZO3H 2F9UA 2JJ1D 1DPOA 1GMHF 1GJAB 2V6NA 3U9AH 2Y6TA 2OQUA 4K60A 6LPRA 1GMCF 1AIXH 4DT7B 3EDXB 1V3XA 4HFPB 2VGCB 3FO8D 4OM9A 2ZFPH 3A88A 1UVOA 1UW7A 1TQ0B 1T8OA 4TWYA 5EPNA 1WXRA 1XUGA 3HATH 1C5XB 2A32A 1P10A 2F3CE 1XUHA 1L4ZA 3NCLA 1KDQB 2TGPZ 4Y7BA 1Q3XA 4FVDA 1AKSA 4MNWA 1PFXC 3A8CA 1YPKH 2UUFB 4JYTA 3SI3H 1N6YA 4AFZA 1QBVH 2BDAA 4NSYA 3BG8A 5A8YA 2AEIH 3ZVBA 4E7NA 1Y3YA 1O5BB 4Y7AA 2SGPE 4A6LA 3RXQA 2AYWA 4VGCC 4H6SB 1GWAA 3EYDA 1PPHE 1YM0A 3RXKA 1EPTB 1O2KA 5ESTE 1AVXA 1F7ZA 1GHZA 1K22H 3TJNA 1LHEH 1O5CB 2ZF0H 5GPIB 3SN8A 3PB1E 4RSPA 2P95A 3GCTF 4Y0ZE 2QF4A 5A0AE 5C1UA 3LC3A 3LGYA 1BTHH 4LOYH 1Z7KA 2J98A 4DIIH 2BDBA 2A5IA 3LH1A 4Z1MD 3PV2A 3A83A 4JZFH 4JZDH 1ZTJA 1K1LA 1LVOA 2AMQA 7GCHG 4TWWA 3A7VA 4NCYA 2XBWA 1OSSA 1H4WA 3WWFA 5KGOA 1NT1A 1OYQA 2TGDA 1AZ8A 4X1QU 4ISHH 5I25A 5L2YH 1EAUA 4B73A 2O8MA 4CR5A 1CGIE 4E7RG 2XOKD 5GJ4B 1VGCC 1C5PA 2VIWA 2CMYA 1Z8RA 4I33A 2CF8H 1HAGE 4F49A 2ZDAH 2A0QB 1YWUA 1WBGB 1OXGA 4K1EA 1EZQA 5L30H 3QZQA 2ZU3A 4NG9H 1NBME 1MKWH 1S81A 4KTCA 4HTCH 3TGIE 4ACBA 1O2SA 3FOAA 2BY6X 4Y10E 4NIVA 5DP6A 4UONA 2FI5E 2VNTA 2ZU2A 1TPAE 5TCCA 4HI3A 1MKXH 1N8OC 8GCHG 4JZEH 5A0CA 4JK5A 1RTLA 3BN9A 1AVWA 3BTQE 4B2AA 2C93B 3E6PH 1O2UA 2V0BA 4MPWA 1AY6H 2P3TB 3K65B 3F2HA 5EXNA 2OK5A 1WUNH 3OY5U 2F83A 3KYGA 3RLWH 1CVWH 3M5LA 3SU4A 3BTTE 1IQKA 3ZZ4A 5F8ZA 1LHCH 1HAVB 1SVPA 2BDYA 3DSGA 4NA9H 1O5FH 3T27A 4DG4A 1O3CA 1PQ5A 2BQWB 4NGAH 1GI7B 1UCYE 4THNH 4BOHA 5T6DA 3TGKE 2HLDD 2RA0A 1V2RT 3ELAH 4B76A 5AFZH 1KTTB 3M61U 1Y5BT 5CDFE 1BBRE 4NWLA 5FPSA 3IITA 4K69A 1DY9A 1C9PA 1GDUA 2XWAA 3NRLA 4ZROA 4Y6DA 1BT7A 2H9HA 1F92A 1QRXA 1CHOG 1YPGH 3TK6A 3GY6A 1LVYA 2PKSC 2CGAA 1IQLA 2QCYA 3SI4H 3A86A 1C4Y2 3F0OA 1ELCA 3TNSA 5EGMA 5EG4A 4YESB 5DG6A 2G52A 3AAUA 3E0PB 1SGIB 3UOPA 1S84A 1V2VT 4I86A 5HYOA 5K0HA 4X6OA 3QZRA 1J8AA 1Y5AT 3FN8A 4JYUH 3DUXH 3NUMA 2AGIX 5GIBA 1UTLM 4B2BA 4Y8ZA 1QBNA 5EOKA 1V2TT 4ASUD 2EQNA 4IS5A 4ZCNA 1FAXA 5FX6A 4CBOA 4KTSA 1D3PB 4ABDA 1XM1A 5F03A 1E0FD 1SGQE 2VIVA 4DGJA 1A7SA 4GHQA 5L2ZH 3D23A 3SBKA 2KAIB 3DSPA 3DA9B 2ZFFH 3I77A 1TA2A 2FOFA 3STIA 2KR7A 1TFXA 1BUIA 4LXBH 4UDWH 1MU6B 1FN6A 4KKDA 5T3HA 1O33A 1NFWA 1V2JT 1H8ED 1QNJA 5CHAB 3Q3YA 1A4WH 3BIVH 2P59A 1NN6A 4OGXA 2A7HA 1QB1A 2W7SA 1LHGH 4NFEA 3DFJA 1P8VC 2AIQA 2EY4C 2P8OC 4B71A 1TGTA 2ZDNA 5B6LA 1F5RA 2D8WA 1GBMA 1Z8IB 4I8KA 1GBDA 3BTEE 4AYYB 1UMAH 1YP9A 1DSTA 1GCTC 1XKBC 5EPYA 2OC8A 1LTOA 2EI7A 2PKAA 1N8OB 1EJNA 1SGDE 1Z1IA 1ETRH 1SQOA 3RMLH 4ABAA 1H9IE 1O3IA 1EOJA 1TBRH 4BAOB 1XUFA 5J4QA 4FUCA 4K2YA 2TPIZ 3ATKA 4FUDA 2HNTC 2ZWLH 3MYWA 2D26C 1AB9C 3F2GA 2ZECA 4JZ1A 3GY4A 2BLOA 2WPJS 2F9BH 1M9UA 3DD2H 2ZCKP 3NPSA 1HJ8A 1GHBG 2ZCLP 1DWCH 1O3KA 4ESTE 5CMXH 1YCPK 2LNCA 1UVSH 4CRDA 1HIAA 9LPRA 1CT2E 2L74A 5DK1A 2HNTF 1S0QA 2Z9KA 5JBAS 5JB9S 1DLEA 1TIOA 3D62A 2ZU5A 4CHAB 2WYGA 1BTZA 2XCFA 2BD5A 2VVUA 2K8IA 1NRQH 4U30A 1ZTKA 1O2IA 2QA9E 3OEHD 1AFQC 1QL9A 2WPHS 3RLYH 3W94A 1TMTH 3P8NA 4OS4A 2BX4A 3VFEA 1Y8TA 1AWHB 1GI3A 1QR3E 1PQ7A 3KYFA 1D9IA 2JKHA 3BF6H 1QJ7B 1ZPCA 1WYKA 3RXSA 2TIOA 1TMBH 2F91A 2XXLA 2PKSB 1FZZA 5C67A 3M3VA 3SJ9A 2GD4B 1C5SA 3UNQA 2ZDVH 2SGFE 3RXAA 4I7YH 1D3QB 4UFGH 1F5LA 1C2IA 1EAXA 1HPGA 3QX5H 1J16A 3RU4E 3VB3A 2SFAA 1TX7A 2JH6D 1B7XB 5FPTA 1MABB 2F9VA 4FOUC 4Z0KA 1YPHE 1BHXF 5T1VA 1RIWB 4KGAA 1O2VA 3RXBA 2F43B 3T28A 3ZYDA 3SQHE 4A5TS 5EQQA 4XOJA 5EQSA 3A7XA 1MZDA 4INKA 4YOGA 2BLQA 2Z9JA 3UFAA 1ZHPA 2BD2A 1SGNE 2L6OA 3RXPA 3OU0A 3EA9A 4MNXA 3MI4A 5FCRA 1NRNH 3T25A 2HVYB 3E16B 1UTKA 1XUIA 2KAIA 1O3BA 5HGGA 1O2NA 4X0WU 3LC5A 2VU8E 5LPRA 2G4UA 2GKVE 2AHME 1F2SE 1CA8B 4XSKU 2SGDE 1FV9A 2BVRH 2ZKSA 3F6UH 3SV9A 1OKXA 1OWKA 1B5GH 3VEQB 5BRRE 4O97A 4CREA 1GHWH 1TABE 1HAYB 4XBDA 2BB4A 2XW9A 1V2LT 2VWOA 2WV4A 3P6ZB 3VPKA 1C1RA 1V2UT 2P8OB 1ELAA 1GG6C 5CE1A 3UIRA 3CENA 2EC9H 1GGDC 1GCTB 1W0JD 3BIUH 3HKJB 3TJOA 3EE0B 1OS8A 4IN1A 2FTMA 3PTNA 1BIOA 1P03A 1HJ9A 1QJ6B 2ZNKH 4FETA 3H7TA 4JMYA 1C2KA 4MQAA 3SV2H 1LPZB 1PPFE 4ISNA 2YMSC 3ZZ5A 2PTNA 1O5AB 2SGAA 2A5AA 5C94A 5IDKA 1WCZA 3BG4C 3SV7A 3PMJA 3STJA 3URDA 3M3TA 2GZ7A 3A85A 4HZHA 4I8GA 1ELEE 3WW7A 5FPYA 2ZEBA 3O8RA 3PV4A 3U8OH 3RXOA 5AHGH 1GL0E 5HM9A 4ZMAH 4MNYA 1GBLA 3BTWE 3HKIB 3U8RH 1DE7H 1L1NA 2Y5FA 3RDZA 3Q76A 4O03A 1EAIA 1JRSA 2A4OA 4D7GA 5C0UA 3MO3A 1OP2A 1DS2E 2LPRA 1AFQB 1K21H 3VG8A 7GCHF 1O2PA 2XWBI 2W6JD 5EW1H 3KIDU 1OWHA 3A81A 4PROA 3A8BA 3U8TH 3V12A 3OSYA 1HRTH 3GDUA 5ESBA 2DUCA 3SV6A 2PUXB 3ZZ6A 1PQAA 1NFYA 2ZGJA 1DXWA 1KMHB 3ATIA 1TQ7B 1O3JA 3RXFA 3OAAD 5EODA 4YT7H 4WH6A 4WMFA 3I78A 4ZKRU 3KQDA 1TOCB 1D4PB 3U98H 1NPMA 3S69A 4CRFA 3M37A 3T62A 1TGSZ 1TYNA 1O3HA 1P9SA 3PLPA 4D7FA 3QK1A 1SOZA 1JOUB 1GI9B 3BEUA 4ISLA 4JZIA 7ESTE 1LQEA 3H5CB 2O8WA 2ZZUH 1C2GA 5FX5A 1IQMA 6GCHG 2ODQA 4FUIA 1W0YH 1FY3A 1WQVH 4RKOB 4YZUA 1TX6A 5GCHG 1XX9A 1CE5A 1ARBA 4QT8C 4TPIZ 1TE0A 5DN6D 2VH6A 5JBBS 4BTIB 1EQ9A 2ZQ2A 3AAVA 1SHHB 5JYIA 1F0UA 1QRZA 2ZCHP 5DP8A 1TBZH 1W12U 3LDXH 1T32A 4BNRA 1MZAA 1P57B 1XMNB 1YPJH 3Q3KA 4RI0A 1O2ZA 2ZU4A 5JPMH 3ODFA 3SU6A 1KLTA 5DP5A 1Y3XA 4IMZA 2STAE 3ZZ8A 2BZ6H 4FUHA 3WY8A 1GDQA 1TRYA 2Z94A 2FOBA 2BM2A 3DT0H 5FL7D 1E34B 1XUJA 2H5DA 1ZTLA 5DP9A 4IC5A 2H2ZA 2VIQA 1H8HD 1D3DB 1GBAA 3RUOA 1C4U2 4WWYA 3VGCB 1DUAA 2WUBA 2H9EH 4Q7YA 1QRWA 1LKBA 1GG6B 1L1JA 1BMNH 1QBOA 5GWZA 1C5LH 1E35B 2C90B 2M2AA 1L2EA 4X2YA 1HAIH 3TH2H 4CH2B 5FAHA 3P95A 1LHDH 1BCUH 1HYLA 4NSVA 3S9BA 2BD4A 1UO6A 1UTOA 3GICB 3GOVB 2ULLA 1O3NA 4XBBA 5AVDA 2KZ4A 3SU0A 1C1VH 1Q31A 1BBRK 3LKWA 1QY6A 3SUFA 1JIRA 3O8BA 4ISIH 2UUKB 3V0XA 1RJXB 2ZPQA 1Y5UT 3PWBA 4R8TB 2BD9A 1FAKH 3SHCH 1OP0A 2BXUH 4JYVH 2PTCE 1QCPA 4B6EA 2VVVA 2A5KA 1G32B 1QURH 4B75A 4BTUB 2F9OA 4DY7B 3ZZ9A 3FP6E 2RA3A 3LGWA 1GBTA 1YKTA 1ETTH 3MU0A 4IW4E 1ANBA 3A80A 1QZ8A 3M35A 2GT7A 3MWIU 3Q00A 1QQUA 5C5OA 1ACBE 3T26A 1ZMJA 1TPOA 3QN7A 2TGTA 1AE8H 1ESBA 5DP4A 3LGIA 2JETC 2Y7ZA 2QYIA 1ANCA 4ZHLU 3GS9A 2YMSD 1UJ1A 1ESTA 4ZUHA 1TAWA 1EP6A 2BDCA 1CSOE 2YNAA 2ZPRA 4CR9A 3RXLA 2QXJA 1J15A 2WPLS 1XXDA 1FLEE 4F55A 1FIWA 5E2OA 2IPQX 1NFXA 2O8LA 1O2OA 1V2MT 3TK5A 1SGFG 1N1LA 2ZTYA 5DGJA 1XKAC 4K8YA 3H7OA 1SLVB 1JIMA 4X8VH 4DOQA 1QIXB 1G2MA 1S82A 3LONA 1TMUH 1SGPE 3KN2A 3ZZDA 1AWFH 3S9CA 3GDSA 1SSXA 2I6SA 2RDLA 1L0ZA 4Q7XA 3KQEA 1DXPA 2ANWA 2D1JA 4DVAU 2W5EA 1RTFB 2Z3DA 3KCGH 2BVSH 2ZGBH 1PPGE 4K3JA 1ORFA 2ZC9H 1Z8GA 1QHRB 2HPPH 3QGJA 1O3MA 1QFKH 3EAJA 3RM0H 1O0DH 1LVBA 1FY8E 1OP8A 1TWXB 1K1OA 4YO9A 2ZDMA 1SGTA 1ELDE 1C5ZB 4JK6A 2ZFTA 3OY6U 1T4VH 1FX0B 4KTUA 1HJAC 1HAZB 4GCHG 1YYY1 3MNSA 1ZMLA 1GHBF 2LP6A 1LVMA 4AFUA 1SGFA 4GUXA 3SORA 4Y11E 1G3EA 2R2MB 1P09A 3TJUA 3LIWA 4BAQB 1UHBA 3F9FA 2GT8A 1BMAA 2Y7XA 5F53A 4Y79A 1BDAA 2K0QA 4Q80A 3P8GA 3ZVDA 1W7XH 3RC4A 1GBFA 2V3HH 2A45B 2ZU1A 5C0TA 1TNLA 1VITG 4ZKSU 1O2HA 1EZXC 1F0TA 1P12E 2FOAA 1SR5C 1ZSLA 3BV9B 5E8EH 5FBIA 3E91A 3PV5A 5EJ1A 1DANH 2VINA 1FI8A 4YOJA 1SGRE 3MH7A 1T8LA 2BDHA 2QY0B 4BANB 1ARCA 4I8JA 3TK9A 1T8NA 1THRH 2Q1JA 4MPVA 4Z6AH 3PMAB 1MTWA 1K1IA 4GSOA 3R0FA 4X2WA 1E38B 2PGBB 1TGCA 3RP2A 1LCYA 2PP6A 4AOQA 2CXVA 1H9LB 1VJAU 3LOXA 2FOCA 1HAHH 3PO1C 1IQFA 3KNXA 2WINI 1C5UA 2OC0A 1SB1H 2OBOA 2BQ7B 2D2DA 2Y80A 1BMFD 1VJ9U 3NWUA 4TT3D 1RTKA 2TRMA 1C2DA 1KDQA 3PLBA 4O9VA 1BJUA 1UVTH 1V2ST 3A87A 1GI1A 1PPZA 3A89A 3TVJB 2GCHF 2UUYA 2ODPA 1MUEB 1F0SA 2C3SA 5E0HA 1FPHH 3BEIB 4F48B 3S7KB 2G81E 3JZ1B 3ZVCA 1T7CA 3MOCA 4OS1A 4VGCB 4WH8A 1JXPA 4DURA 1ZJDA 4YT6H 1EPTA 1V2QT 1E1RD 3RU4D 1WTGH 5E0GA 1OWEA 3GDVA 4XE4A 3RXHA 1B0FA 1W10U 3FANA 4ABJA 2NU1E 4Y8YA 1CA0C 2J2UA 1YPEH 1NY22 4A1XA 4BAMB 1EFRD 2ZDKA 3QO6A 1AI8H 1NRRH 2H6MA 3LT3A 1HAPH 1C2MA 1GMHG 1SQRA 3CS7A 1O35A 1BTYA 3QWCH 3SUDA 3SU1A 3UAIC 2V3MA 1GMCG 1C5NH 3P70B 3ZV9A 3MU1A 2FLRH 1Z6EA 4WXVA 1P2QA 3MH5A 5T6GA 1NU9A 1WSSH 3A84A 3MU4A 1S6HA 4Y8XA 1EATA 2O9QA 3NK8A 3ZVAA 1A0LA 4NWKA 4XDEA 1VGCB 1VZQH 2XC0A 3UUZA 3F3BA 5SGAE 2ESTE 3PWCA 3W95A 2GMTC 3R3GB 3UWIA 1KSNA 2QAAA 3QTVH 1D3TB 2Q6DA 2JH0D 3EA8A 3FP8E 1BOQA 2Z9GA 3MO9A 1VCPA 2WYJA 4WY3A 4IBLH 4AORA 1DUEA 2B8OH 3A7TA 3RXCA 2FWWA 5A09A 4DT4A 2AERH 3HGPA 1GHAF 1NRSH 3UWJH 7LPRA 1GI0A 1ZHRA 3GY3A 4NA7A 1GJBB 1LDTT 3GCTG 2FIRH 3SQEE 1OWJA 1DSUA 3TPIZ 2IJD1 1A0JA 1FNIA 1P04A 1WQSA 2G8TA 3GY5A 3V7TA 4ABFA 4WJG2 1ID5H 3MHWU 2GCTC 2GTBA 3SOSA 2IN2A 1GBBA 1GJDB 1K0HA 2RDEA 3SNEA 2ZFQH 1OYTH 5LPEA 7KMEH 1SLWB 3P92A 2A2QH 2ZI2H 1K1NA 1MMJN 5B6OA 1ELFA 1RGQA 1O30A 3UTUH 1CBWC 1ZYOA 1ZJKA 1A1RA 3M5MA 4ZXYH 1HAVA 1BMLA 5HM2A 3SO3A 1NM6A 1O3EA 3BEFB 1SHYA 3M3SA 4LZ1H 1P2OA 3RXEA 4BAHB 4MTBA 3O8DA 3SJOA 3EE7A 4MVNA 3V13A 1FPCH 3ZVGA 1MBQA 2ZGXH 6GCHF 2C8ZB 2FOHA 4MPXA 3ENSB 2UUJB 2ZHDA 1TX8A 2HGTH 3RU4T 6CHAC 1AD8H 5GXPA 2ZG0H 1C5MD 3OYPA 1A3EH 1TOMH 2J94A 2GP9B 4AFQA 1KY9A 3FKSD 1ZPBA 3QUMP 1LPGB 5G4BA 2VBCA 1K1MA 1RXPA 1MCVA 2O8TA 1TLDA 3EGKH 3SV8A 5JBCS 1GMDF 3P17H 3RXUA 3JZ2B 3V3MA 1C1WH 3ZZAA 1U6QA 4B1TA 1P05A 1HDTH 3GCHC 4ASHA 1P2MA 3HPTB 1C2LA 4M7GA 1O3GA 1GHXH 1TNIA 1Y3WA 2GX4A 2CJIA 1K1PA 1DY8A 3SGQE 2NWNA 3U1JB 2ZA5A 2AGEX 1V6DA 3UPEA 1UCYH 2XRCA 4O3UA 4DCDA 3BTFE 1G30B 3KQBA 2IPHA 4WMDA 4AGKA 4ZKOU 4OS7A 3G01A 2C4FH 1BITA 2B0FA 1GI2A 4AZ2B 1C5OH 2ZGHA 5DPAA 5A2MH 3PYHA 2ZFRH 1DITH 1K2I1 1BBRH 4FUFA 1G37A 5PTPA 1O2QA 1O2YA 1EASA 1TNHA 5H4IB 1O2WA 5LH8A 2J9NA 1NTPA 3H09A 1SLXB 3TNTA 2CF9H 2P16A 2KM0A 3UR6A 1HAXB 1MQ5A 2ODYB 1LHFH 4F4OC 2ASUB 1QGFA 3M5OA 3MNBA 3K6ZA 2BDIA 2HVXA 1G36A 2GGVB 3LJJA 3UREA 3E8LA 2BLVA 4NZQA 2VB0A 1CQQA 3URCA 3CP7A 2F4LA 1C1QA 1JRTA 1QL7A 3UNSA 4WVPE 2VH0A 1BRAA 1W0ZU 5K7RA 1T8MA 1KIGH 1O5GH 1UTPA 2STBE 4TY6A 1GBHA 1O36A 1GI6A 1OPHB 1E37B 3F9HA 1HXFH 3FP7E 1GBCA 2PWXA 4A1VA 1XVMA 1DX5M 3TLOA 3OFND 4AB8A 4J1YA 1ESAA 1ELGA 1GJ5H 2GCTB 1LMWB 5C1YA 1D6RA 1P02A 4AG2A 1ZSKA 4Y71A 1AB9B 2KCOA 5IK2D 2JIZD 1C1SA 4Y76A 1O5EH 2CV3A 3ITIA 4A7IB 1AGJA 1OX1A 1KYNA 2WZQA 2AMPA 3BTHE 1PPCE 2XBYA 2OUAA 2FI4E 2VWLA 4CRCA 4RT0A 3MH4A 4KELA 3SUGA 2XCNA 1C5QA 3DSOA 1W3CA 2AH4X 5E2PA 1FONA 1QA0A 2W26A 3RXDA 1DDJA 1MTVA 2QC2A 1HAOH 1GJ6A 4AB9A 4NIXA 3SZNA 3PROA 3T2NA 2R0KA 1RS0A 2EI6A 3D49H 4OS5A 4ZH8A 2FTLE 5I46H 5HIYA 3PRDA 1O2RA 2HWLB 4NIYA 2J4IA 2FOEA 2VGCC 1O31A 1TONA 1KTSB 2A4GA 1L4DA 4AG1A 2KCYA 2PUQH 3GISB 1BHXB 2SNVA 1SFIA 1GVZA 2G51A 1H8IH 1MD8A 1G3DA 4FU9A 2QV1A 4X1NU 1YGCH 3GYMA 4GCHF 2ALPA 2VIDA 4E06H 1WOFA 5J4SA 3UY9A 2ZQ1A 3B9FH 1HCGA 2FO9A 2RCEA 1AU8A 2XC5A 1DM4B 1EJMA 1IOEA 4FU8A 2NU4E 4ABIA 1EPTC 2R0LA 2FLBH 1O2LA 1EXFA 5DJ7A 1YPLH 2G5NA 3S0NA 1AHTH 3L33A 5EU8A 1FN8A 2FMJA 8GCHF 5HXFA 4AC9A 4BXWA 3SJIA 2YOLA 1KXFA 1WU1A 2FEQH 3FFGA 3N7OA 1XVOA 1COWD 4Q63A 3VXEH 1BTWA 1UTQA 1K9OE 3Q3XA 2BTCE 1DWBH 2OBQA 1NBMD 1ZRKA 2BHGA 2ANKH 1C5RA 2NU2E 3EA7A 1S0RA 4ZKNU 1A46H 2TBSA 1EKBB 3OTPA 4MLFB 1E1QD 1P2NA 1QL8A 2FYQA 2OXSA 1O2GH 1NFUA 2VWMA 3D65E 1FMGA 5C2ZA 1PPEE 5EQRA 1BTPA 4AN7A 1GGDB 1V2NT 2J34A 1T4UH 2H9TH 1NU7B 4GAWA 3PLKA 4GVUA 1VKYA 2PV9B 2WV9A 1VCQA 2BLWA 1SI5H 4AX9H 4FU7A 1AFEH 1DICA 2R3UA 2A4QA 4MNVA 4X6PA 2Y82A 3OE7D 2AMDA 2YMSB 3M7UA 2ZHEH 3ZZ7A 4WF8A 3BG4B 2A31A 5KEDA 3RXJA 1ZPZA 5A8XA 3GY7A 3TJVA 1TGNA 1P06A 1W13U 2KCPA 1CHOF 3MO6A 1UTJA 1C5WB 3PRBA 3F68H 1UK4A 3EQ0H 2Z3EA 1WDIA 4AYVB 2WHXA 1O38A 2FDAA 3T5FH 1O5DH 4ABBA 2XNDD 4BXSA 4UEHH 1G2LA 2CN0H 3DCLA 3OTJE 1BA8B 1YPHC 4YLQH 2Q6GA 8ESTE 1FY4A 1C2FA 5IYTA 1GCDA 1C5TA 1V2WT 2AIPA 3GYLB 3E90B 2VIOA 3RXVA 5F8TA 2BY8X 1FY1A 1C2JA 4TYDA 4CBNA 2ZTZA 2GV6A 3AK5A 1MQ6A 2Z7FE 1OHHD 3KF2A 4UFFH 2PFEA 1O2TA 4Q4LA 1BTXA 3IG6B 3DFLA 3F9GA 4UE7H 5HKKD 1Z6JH 3OX7U 3SNCA 4B74A 4ABEA 5EXMA 1JMOH 3QDZB 1C1UH 5FBEA 2BD3A 1AUTC 2IJOB 1C5VA 2AGGX 4X8UH 1MAYA 3B8JA 5FHTA 3S9AA 1SBWA 1TGBA 8LPRA 2HNTE 2CHAC 1YLNA 4I8HA 1W11U 1LO6A 2BY5X 1BZXE 4YM9A 3UQVA 3UOUA 2FX6A 2FS8A 1YCPM 3LJOA 1CT0E 2P93A 4ZXXH 2ZDLA 5EW2H 1ELTA 1QQ4A 2PHBA 1Y3VA 2ZGCA 2GV7A 4X8TH 2HPQH 3C1KA 3F0PA 4XFQA 6ESTA 3E0NB 2R9PA 1HGTH 2QE7D 4FVBA 1DFPA 1G9IE 3SGAE 2UWPA 1EB2A 3UB0A 2EA3A 3SZEA 3UQOA 1YCPH 2Q6FA 4I31A 1F5KU 2AS9A 1V2PT 4D9RA 4H6TA 2HOBA 3HGNA 1O3PB 2W3KA 2WPDD 1A5IA 3KHVA 4ZAEA 1S83A 2QXIA 4IGDA 2B7DH 3MMGA 1GL1A 3QTOH 2C8YB 1HUTH 2FYRA 3KEEA 1GDNA 2BOKA 1BB0B 4CH8B 2WUCA 2VIPA 1N6XA 1SGYE 3AW0A 3AVZA 5E0JA 1MTNC 2QF0A 1O3OA 2VWNA 1ZGIA 1ETSH 3LGUA 3N99A 2WPKS 4YXWD 3RXMA 1P3EA 3ATLA 3N7EA 1V2OT 3RXIA 4ZHAA 1MTUA 2P3UB 5LPFA 2ANYA 2HALA 5CHAC 1BJVA 1KLJH 4OGYA 3ESTA 1BTUA 3RC5A 4IMQA 1ZGVA 4DJZB 3A7WA 3RXRA 3KQ5A 3P8FA 1MTSA 2ZPSA 3O8CA 1O39A 1UVUH 1GBKA 1QB9A 1T31A 4ACAA 1GJCB 2BY7X 2PKAB 1O3DA 1K28D 3MQKC 4Q7ZA 1W14U 5JDUB 2B5TB 3L3TA 1HNEE 4NZLA 3F2FA 2Z9LA 2GZ9A 4BAKB 2Y5HA 3KL6A 1PYTC 1FY5A 4X1PU 3GCNA 1ZR0A 1EB1H 1DT2A 4TPYA 3ZVEA 1DLKB 2B9LA 3FZDA 2ZHFH 4SGBE 3ZIAD 2JETB 1V2KT 4FUEA 2P3FH 1RRKA 2J5UA 3SU2A 5KECA 1VR1H 1HIAB 5DP7A 1CGJE 4D76A 2FS9A 1JWTA 1EP5A 2QXHA 3NKKA 4XD7D 4KP0A 4CHAC 3MFJA 1J17T 4XBCA 4ZHMU 5DKMA 3BTKE 1TNGA 3A7ZA 5EXLA 2ZTXA 5F6MA 1YLCA 1O34A 3KGPA 2PW8H 4DW2U 1XUKA 2LELA 3MU8A 1AE5A 4MG3A 2ALVA 2H5CA 3NXPA 4D8NA 3P8OA 2XNIA 3TGJE 2PGQB 4X2XA 2JDID 1TALA 1D6WA 1KXAA 1RD3B 1W2KH 1O3AA 4INLA 1EX3A 1C2EA 2PSYA 1O2JA 1FJSA 4M9FA 4LZ4B 2CHAB 3RMMH 2Y5GA 3ZZCA 4YOIA 1P3CA 1A5GH 1ANEA 3U28C 1GVKB 3MH6A 2PSXA 3SYJA 4CRGA 3ATMA 2G55A 2SGEE 2OCVB 1Y3UA 4ABHA 2ZIQH 1P2IA 1SKYE 4A92A 3OEED 2BZAA 1C2HA 3A82A 2W3IA 4NFFA 3BTGE 2YNBA 3S7HB 3ATWA 3PTBA 3SW2B 1RIWC 1SLUB 2AFQB 2XC4A 3TIUA 2M5TA 2FM2A 4HGCA 1HJAB 1G3BA 2BX3A 1GI5A 1UK2A 1ZMNA 3UNRA 3Q77A 2W7UA 2DE9A 1RFNA 3GY2A 3M36A 2QF3A 1INCA 1KXBA 4CRBA 4RT1A 1IHTH 4Y0YE 2CK3D
chains in the Genus database with same CATH topology
1XXFA 4D9QA 1MU8B 1MTNB 4H4FA 1C1OA 2FZZA 2WPMS 1TNKA 2I6QA 4SGAE 1C1MA 1CT4E 1ZRBA 4UFEH 1NO9H 2P94A 2BY9X 5JB8S 4CRAA 1HB0B 1TRMA 2NU0E 5AFYH 3FZZA 4RKJB 1S6FA 4JCNA 3K9XB 1CO7E 1LKAA 1TBQH 3LGVA 3SU3A 1ZOMA 2F9NA 2A7CA 1A0HB 3MNXA 3LH3A 2BD7A 1O2XA 1YC0A 4NA8A 3HK6B 1P11E 2G4TA 3VB5A 4FXGH 3SGBE 3ZZ3A 1NZQH 2OINA 1EZSC 1ZZZA 2FI3E 2GDEH 1SFQB 5A8ZA 1THPB 2H1UA 3KQCA 1B0EA 1QTFA 2V35A 3PO1B 1TB6H 1NROH 2FODA 1WTHD 2FP7B 5JBTA 3NZIA 4GPGA 2FOGA 2C8XB 1MH0A 2BDGA 4GLYA 5TCAA 3RMOH 5GCHF 1AUJA 4ABGA 3RMNH 3AW1A 4BTTB 4K1TA 1KXEA 4DIHH 1O3FA 2QN5T 3E3TA 4I8LA 2GZ8A 1AZZA 4FUBA 1G3CA 1K1JA 1L1GA 1LQDB 1MKWK 1GVLA 2Z9IA 1IHSH 4TY7A 4LK4A 1OWDA 1MBMA 4WXIA 1E36B 2VJ1A 1WAYB 3C27B 1ABJH 1BQYA 1TA6A 2QIQA 2K1QA 3VXFH 3ZYEA 1GBJA 1GJ4H 3SNDA 1CA0B 1DWEH 1BRBE 1IQJA 1C1NA 1PYTD 4Q2KA 1AMHA 2O8UA 3IWMA 1PQ8A 5C3NA 1NESE 3PMBB 3U69H 1MKXK 1QB6A 1O37A 1OOKB 3VB6A 4X6MA 1SGEE 4INHA 1Q2WA 1LPKB 2A2XH 1CHGA 1C4V2 2WPIS 5LGOA 1HXEH 1UTNA 3A8DA 4I32A 1FDPA 1IAUA 1TRNA 4K5ZA 1ZHMA 3T29A 1W8BH 3K2UA 4OS2A 1SG8B 1FXYA 1YF4A 2FX4A 1EAWA 3GY8A 1KXDA 3ZVFA 1GI4A 1H9HE 1H8DH 2ZP0H 3VB7A 4OS6A 1S85A 2OP9A 1OWIA 3UR9A 2GMTB 2QXGA 1GJ8B 1MAXA 1YPMH 2XYAA 3B23B 4X6NA 3SNBA 1NRPH 3L6PA 2GCHG 1AN1E 2BYAX 1C1PA 3FVFB 4AGJA 3MU5A 2IOTA 5BPEA 3SHAH 1SOTA 5ETXA 4K8BA 2EI8A 3U1IB 2GVFA 4YTAA 1C1TA 4O3TA 1GPZA 4R0IA 2A7JA 2J38A 5ABWA 1O32A 2Z6BD 3QGNB 1QJ1B 3ODDA 1KLIH 1EOLA 1ELVA 5TJXA 2FXRA 1SGCA 3QLPH 4UFDH 4X8SH 1SC8U 2GDDA 2Z3CA 3VGCC 2FPZA 2EEKA 3LPRA 4MPUA 5DO4H 2HLCA 1GJ7B 3RXGA 3E1XB 2OC1A 2THFB 4GHTA 3SUEA 2OC7A 1IQNA 2OTVA 1YLDA 3BTME 3TH3H 3VB4A 1BRCE 2G00A 1HFDA 1HBTH 1CBWB 3A7YA 1C5YB 5A0BA 3SJKA 1H1BA 1HV7A 1JBUH 3MTYA 5FCKA 2OQ5A 1VITH 2G5VA 2UWOA 4B2CA 3F9EA 1SPJA 3ZZBA 2XTTB 3HK3B 5L6NH 2J95A 2ILNA 4E05H 3SJ8A 1UTMA 1IQHA 1F0RA 1VCWA 5C1XA 1UVPA 1J14A 6CHAB 2V3OH 1IQEA 2BXTH 4U32A 1A3BH 1Z1JA 1AQ7A 1FQ3A 1GHVH 2F9PA 2OLGA 1NC6A 1HLTH 2HRVA 1BMMH 3SNAA 2BOHB 1ZLRA 1ANDA 1GHAG 3CS0A 3GCHB 1S5SA 1MD7A 1CU1A 1J9CH 4IN2A 3SU5A 1AKSB 3MNCA 1EJAA 2XBVA 1UK3A 1ELBA 9ESTA 3PM3A 2JH5D 2XBXA 1GJ9B 4WMEA 5HMAA 4UD9H 2R3YA 1PPBH 1WV7H 2SNWA 2PR3A 5AF9H 1TNJA 1Z8JB 1SQAA 4X1RU 2Y81A 1O3LA 1KXCA 3RC6A 1VITF 4X2VA 1DWDH 1TPSA 2ANMH 3PMHB 4K1SA 1THSH 4FUJA 5C20A 1FIZA 3F1SB 5F8XA 1ZSJA 1SL3A 1Z71A 4RN6A 1GBEA 3FAOA 3RM2H 3DHKH 1A2CH 2RG3A 2BVXH 2TGAA 5T6FA 4A1TA 1A61H 2QGRA 3LGTA 3AASA 1FUJA 3TU7H 1GHYH 1DOJA 1GMDG 3LU9B 3M7QA 1YBWA 2BQ6B 2NU3E 2A1DB 5C5NA 1P01A 2WV5A 1MCTA 2A4RA 2FESH 2BMGB 1NS3A 2R2WU 3K6YA 1Y59T 3TH4H 3BTDE 1SQTA 2ZFSA 3RXTA 3ZV8A 1P9UA 1TPPA 1ABIH 5GDSH 2C8WB 1X7AC 2ZHWH 1DVAH 2UWLA 1O2MA 4FUGA 1A5HA 3M5NA 4MDSA 2ZHQH 1P0SH 1UHBB 2PLXA 1GBIA 1QA7A 2DE8A 4J2YB 2VVCA 1AO5A 1UCYK 1CGHA 3GCOA 1PJPA 1SMFE 1EUFA 1P2JA 5FXLA 2BD8A 1IQGA 2OD3B 1GI8B 3M7TA 2SGQE 4NIWA 1IQIA 4H42U 3BSQA 4X1SU 1EZUC 3A8AA 1BRUP 4IC6A 4U01A 5DP3A 1C9TA 4AFSA 4U2WA 3TITA 3I29A 1W7GH 1AVGH 4YLUA 1P2KA 2FOMB 8KME2 2J92A 4ISOA 2ZO3H 2F9UA 1DPOA 1GMHF 1GJAB 2V6NA 3U9AH 2Y6TA 2OQUA 4K60A 6LPRA 1GMCF 1AIXH 4DT7B 3EDXB 1V3XA 4HFPB 2VGCB 2ZFPH 3A88A 1UVOA 1TQ0B 1T8OA 4TWYA 5EPNA 1XUGA 3HATH 1C5XB 2A32A 1P10A 2F3CE 1XUHA 1L4ZA 3NCLA 1KDQB 2TGPZ 4Y7BA 1Q3XA 4FVDA 1AKSA 4MNWA 1PFXC 3A8CA 1YPKH 2UUFB 4JYTA 3SI3H 1N6YA 4AFZA 1QBVH 2BDAA 4NSYA 3BG8A 5A8YA 2AEIH 3ZVBA 4E7NA 1Y3YA 1O5BB 4Y7AA 2SGPE 4A6LA 3RXQA 2AYWA 4VGCC 4H6SB 1GWAA 3EYDA 1PPHE 1YM0A 3RXKA 1EPTB 1O2KA 5ESTE 1AVXA 1F7ZA 1GHZA 1K22H 3TJNA 1LHEH 1O5CB 2ZF0H 5GPIB 3SN8A 3PB1E 4RSPA 2P95A 3GCTF 4Y0ZE 5A0AE 5C1UA 3LC3A 3LGYA 1BTHH 4LOYH 1Z7KA 4DIIH 2BDBA 2A5IA 3LH1A 3A83A 4JZFH 4JZDH 1ZTJA 1K1LA 1LVOA 2AMQA 7GCHG 4TWWA 3A7VA 4NCYA 2XBWA 1OSSA 1H4WA 1NT1A 1OYQA 2TGDA 1AZ8A 4X1QU 4ISHH 5I25A 5L2YH 1EAUA 4B73A 2O8MA 4CR5A 1CGIE 4E7RG 5GJ4B 1VGCC 1C5PA 2VIWA 2CMYA 1Z8RA 4I33A 2CF8H 1HAGE 4F49A 2ZDAH 2A0QB 1WBGB 1OXGA 4K1EA 1EZQA 5L30H 3QZQA 2ZU3A 4NG9H 1MKWH 1S81A 4KTCA 4HTCH 3TGIE 1O2SA 2BY6X 4Y10E 4NIVA 5DP6A 4UONA 2FI5E 2VNTA 2ZU2A 1TPAE 5TCCA 4HI3A 1MKXH 1N8OC 8GCHG 4JZEH 5A0CA 4JK5A 1RTLA 3BN9A 1AVWA 3BTQE 4B2AA 2C93B 3E6PH 1O2UA 2V0BA 4MPWA 1AY6H 2P3TB 3K65B 5EXNA 1WUNH 3OY5U 2F83A 3RLWH 1CVWH 3M5LA 3SU4A 3BTTE 1IQKA 3ZZ4A 5F8ZA 1LHCH 1HAVB 1SVPA 2BDYA 4NA9H 1O5FH 3T27A 4DG4A 1O3CA 1PQ5A 2BQWB 4NGAH 1GI7B 1UCYE 4THNH 4BOHA 5T6DA 3TGKE 2RA0A 1V2RT 3ELAH 4B76A 5AFZH 1KTTB 3M61U 1Y5BT 1BBRE 4NWLA 5FPSA 3IITA 4K69A 1DY9A 1C9PA 1GDUA 2XWAA 4ZROA 4Y6DA 1BT7A 2H9HA 1F92A 1QRXA 1CHOG 1YPGH 3TK6A 3GY6A 1LVYA 2PKSC 2CGAA 1IQLA 2QCYA 3SI4H 3A86A 1C4Y2 3TNSA 1ELCA 5EGMA 5EG4A 4YESB 5DG6A 2G52A 3AAUA 3E0PB 1SGIB 3UOPA 1S84A 1V2VT 5HYOA 5K0HA 4X6OA 3QZRA 1J8AA 1Y5AT 4JYUH 3DUXH 3NUMA 2AGIX 5GIBA 1UTLM 4B2BA 4Y8ZA 1QBNA 5EOKA 1V2TT 4IS5A 1FAXA 5FX6A 4CBOA 4KTSA 1D3PB 4ABDA 1XM1A 5F03A 1E0FD 1SGQE 2VIVA 4DGJA 1A7SA 4GHQA 5L2ZH 3D23A 3SBKA 2KAIB 3DA9B 2ZFFH 3I77A 1TA2A 2FOFA 3STIA 1TFXA 1BUIA 4LXBH 4UDWH 1MU6B 1FN6A 4KKDA 5T3HA 1O33A 1NFWA 1V2JT 1QNJA 5CHAB 3Q3YA 1A4WH 3BIVH 2P59A 1NN6A 4OGXA 2A7HA 1QB1A 2W7SA 1LHGH 4NFEA 3DFJA 1P8VC 2AIQA 2P8OC 4B71A 1TGTA 2ZDNA 1F5RA 2D8WA 1GBMA 1Z8IB 4I8KA 1GBDA 3BTEE 4AYYB 1UMAH 1YP9A 1DSTA 1GCTC 1XKBC 5EPYA 2OC8A 1LTOA 2EI7A 2PKAA 1N8OB 1EJNA 1SGDE 1Z1IA 1ETRH 1SQOA 3RMLH 4ABAA 1H9IE 1O3IA 1EOJA 1TBRH 4BAOB 1XUFA 5J4QA 4FUCA 4K2YA 2TPIZ 3ATKA 4FUDA 2HNTC 2ZWLH 3MYWA 2D26C 1AB9C 2ZECA 4JZ1A 3GY4A 2BLOA 2WPJS 2F9BH 1M9UA 3DD2H 2ZCKP 3NPSA 1HJ8A 1GHBG 2ZCLP 1DWCH 1O3KA 4ESTE 5CMXH 1YCPK 2LNCA 1UVSH 4CRDA 1HIAA 9LPRA 1CT2E 5DK1A 2HNTF 1S0QA 2Z9KA 5JBAS 5JB9S 1DLEA 1TIOA 3D62A 2ZU5A 4CHAB 2WYGA 1BTZA 2XCFA 2BD5A 2VVUA 1NRQH 4U30A 1ZTKA 1O2IA 2QA9E 1AFQC 1QL9A 2WPHS 3RLYH 3W94A 1TMTH 3P8NA 4OS4A 2BX4A 3VFEA 1Y8TA 1AWHB 1GI3A 1QR3E 1PQ7A 1D9IA 2JKHA 3BF6H 1QJ7B 1ZPCA 1WYKA 3RXSA 2TIOA 1TMBH 2F91A 2XXLA 2PKSB 1FZZA 5C67A 3M3VA 3SJ9A 2GD4B 1C5SA 3UNQA 2ZDVH 2SGFE 3RXAA 4I7YH 1D3QB 4UFGH 1F5LA 1C2IA 1EAXA 1HPGA 3QX5H 1J16A 3RU4E 3VB3A 2SFAA 1TX7A 2JH6D 1B7XB 5FPTA 2F9VA 4Z0KA 1YPHE 1BHXF 1RIWB 4KGAA 1O2VA 3RXBA 3T28A 3ZYDA 3SQHE 4A5TS 5EQQA 4XOJA 5EQSA 3A7XA 1MZDA 4INKA 4YOGA 2BLQA 2Z9JA 3UFAA 1ZHPA 2BD2A 1SGNE 3RXPA 3OU0A 3EA9A 4MNXA 3MI4A 5FCRA 1NRNH 3T25A 3E16B 1UTKA 1XUIA 2KAIA 1O3BA 5HGGA 1O2NA 4X0WU 3LC5A 2VU8E 5LPRA 2G4UA 2GKVE 1F2SE 1CA8B 4XSKU 2SGDE 1FV9A 2BVRH 2ZKSA 3F6UH 3SV9A 1OKXA 1OWKA 1B5GH 3VEQB 5BRRE 4O97A 4CREA 1GHWH 1TABE 1HAYB 4XBDA 2BB4A 2XW9A 1V2LT 2VWOA 2WV4A 3P6ZB 3VPKA 1C1RA 1V2UT 2P8OB 1ELAA 1GG6C 5CE1A 3UIRA 3CENA 2EC9H 1GGDC 1GCTB 3BIUH 3HKJB 3TJOA 3EE0B 1OS8A 4IN1A 2FTMA 3PTNA 1BIOA 1P03A 1HJ9A 1QJ6B 2ZNKH 3H7TA 4JMYA 1C2KA 4MQAA 3SV2H 1LPZB 1PPFE 4ISNA 3ZZ5A 2PTNA 1O5AB 2SGAA 2A5AA 5IDKA 1WCZA 3BG4C 3SV7A 3PMJA 3STJA 3URDA 3M3TA 2GZ7A 3A85A 4HZHA 4I8GA 1ELEE 5FPYA 2ZEBA 3O8RA 3PV4A 3U8OH 3RXOA 5AHGH 1GL0E 5HM9A 4ZMAH 4MNYA 1GBLA 3BTWE 3HKIB 3U8RH 1DE7H 1L1NA 2Y5FA 3RDZA 3Q76A 4O03A 1EAIA 1JRSA 2A4OA 4D7GA 3MO3A 1OP2A 1DS2E 2LPRA 1AFQB 1K21H 7GCHF 1O2PA 2XWBI 5EW1H 3KIDU 1OWHA 3A81A 4PROA 3A8BA 3U8TH 3V12A 3OSYA 1HRTH 3GDUA 5ESBA 2DUCA 3SV6A 2PUXB 3ZZ6A 1PQAA 1NFYA 2ZGJA 1DXWA 3ATIA 1TQ7B 1O3JA 3RXFA 5EODA 4YT7H 4WH6A 4WMFA 3I78A 4ZKRU 3KQDA 1TOCB 1D4PB 3U98H 1NPMA 3S69A 4CRFA 3M37A 3T62A 1TGSZ 1TYNA 1O3HA 1P9SA 3PLPA 4D7FA 3QK1A 1SOZA 1JOUB 1GI9B 3BEUA 4ISLA 4JZIA 7ESTE 1LQEA 3H5CB 2O8WA 2ZZUH 1C2GA 5FX5A 1IQMA 6GCHG 2ODQA 4FUIA 1W0YH 1FY3A 1WQVH 4RKOB 4YZUA 1TX6A 5GCHG 1XX9A 1CE5A 1ARBA 4QT8C 4TPIZ 1TE0A 2VH6A 5JBBS 4BTIB 1EQ9A 2ZQ2A 3AAVA 1SHHB 5JYIA 1F0UA 1QRZA 2ZCHP 5DP8A 1TBZH 1W12U 3LDXH 1T32A 4BNRA 1MZAA 1P57B 1XMNB 1YPJH 3Q3KA 1O2ZA 2ZU4A 5JPMH 3ODFA 3SU6A 1KLTA 5DP5A 1Y3XA 4IMZA 2STAE 3ZZ8A 2BZ6H 4FUHA 3WY8A 1GDQA 1TRYA 2Z94A 2FOBA 2BM2A 3DT0H 1E34B 1XUJA 2H5DA 1ZTLA 5DP9A 4IC5A 2H2ZA 2VIQA 1D3DB 1GBAA 3RUOA 1C4U2 4WWYA 3VGCB 1DUAA 2WUBA 2H9EH 4Q7YA 1QRWA 1LKBA 1GG6B 1L1JA 1BMNH 1QBOA 5GWZA 1C5LH 1E35B