1LVYA

Porcine elastase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-pressure krypton gas and statistical heavy-atom refinement: a successful combination of tools for macromolecular structure determination.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords ELASTASE
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1996-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvyA01
1C1UH 4NIVA 2QAAA 3U69H 2BZAA 1SG8B 3H7OA 2B9LA 2VIWA 1A5IA 1UCYE 2FI4E 2GX4A 3LGIA 4KGAA 1EPTC 3QUMP 1J14A 2DE8A 3EA9A 3K6YA 2W3IA 4JYVH 4X6OA 1ELFA 5EXLA 1GI6A 3EAJA 1P3CA 2HALA 3I78A 2R9PA 2R0LA 1UHBA 3O8RA 1ABJH 2C90B 2ZFRH 1GJDB 5DP8A 1FQ3A 1FNIA 3U8TH 2J38A 3QO6A 1VCQA 1V2VT 1OWKA 3C27B 3IG6B 3CS7A 4YT6H 1QL7A 5LPRA 1GDUA 2QC2A 2A4RA 1JWTA 2JETC 1S0QA 1GI5A 2A7HA 3MNXA 1TYNA 3NXPA 4LOYH 4Y0ZE 1O34A 1FPHH 5A0BA 1NZQH 4HGCA 5FCKA 1C5YB 1TA2A 3A7YA 1MZAA 1W14U 2BY7X 4JMYA 3F9EA 1HJAB 3STJA 5ABWA 1LDTT 1GBLA 2Z9IA 1AFEH 2ZIQH 1BBRE 2ZNKH 1O31A 1QJ1B 2VWNA 4XBBA 2OC0A 1HXFH 1DUAA 1XM1A 1K1JA 1FIZA 3TGJE 1NU9A 3A8BA 3UPEA 3TGKE 4E7RG 3KQEA 1O2GH 4E7NA 1ELDE 1TA6A 3P8NA 1EASA 1LHEH 2GV7A 2SNVA 1GI8B 3B23B 2H6MA 4GVUA 1WQVH 2AEIH 2XBWA 3VXEH 3PLPA 4IN1A 2VVVA 1LKBA 4KTUA 3SHCH 1V2MT 4WMEA 3P6ZB 1SGCA 1JMOH 2W3KA 2XBXA 3QN7A 2ZDNA 1JIRA 3SNBA 2EI8A 1P10A 4XBDA 5F8ZA 1LTOA 1HIAA 3BIUH 1JRSA 2A2XH 1C1QA 1EQ9A 1RRKA 1C4U2 2ZEBA 1G36A 1FAKH 1GMCF 1PYTC 3P92A 1QA7A 3A80A 1DITH 4FUFA 4FUHA 1D6WA 3CP7A 1T8LA 1LMWB 1CSOE 1B7XB 2RA3A 4ZKRU 3E3TA 2ZTXA 4U2WA 1HNEE 2Z7FE 3ZVEA 4NA8A 1M9UA 3GOVB 4X8UH 2A32A 4NGAH 1MBQA 3F9FA 4FUIA 3TK9A 3MU4A 4I8LA 1UK4A 3A86A 1TBRH 2OBQA 4D7GA 1KXAA 3SV8A 3ZVDA 1DXWA 1GBMA 3RXKA 1A3BH 3RXOA 1GG6B 6ESTA 1PPZA 2VWLA 2OCVB 3UOUA 1GBJA 3KL6A 1SMFE 1MD8A 1EOLA 4SGBE 1WYKA 3P95A 2ZPQA 5DG6A 1O3AA 1BUIA 1YPKH 2RA0A 2GT7A 2VH6A 3CENA 4BTTB 1E35B 3OSYA 1ESAA 2Z94A 1GCTC 4Y0YE 2J92A 3VB5A 5K7RA 2Z3DA 2XBYA 1BMLA 2BXUH 2H5DA 1P11E 2BX3A 3U9AH 1GJBB 3PTBA 5DP4A 1L1NA 3RP2A 4D8NA 3S9CA 3A89A 2Z9GA 4AGKA 3E0NB 3RXHA 2K1QA 3M3SA 2ZGJA 2WPMS 3KN2A 3QGNB 1TGSZ 1NPMA 2FDAA 4OS5A 1THSH 1QY6A 1V2QT 4LZ4B 1L1GA 3T26A 4X8VH 3LGYA 3PMAB 1GI0A 1O39A 2P95A 3TK5A 1HDTH 5HXFA 3RMOH 9LPRA 2BY5X 5DGJA 1A2CH 2PKAB 3KCGH 3MMGA 1FY1A 1SQTA 2VINA 3RC5A 2G8TA 2H1UA 1Z6EA 1W11U 1WBGB 3Q3KA 1BOQA 3ZZ5A 1NRSH 2ZHWH 4NG9H 3LKWA 1CGJE 4Q7ZA 1C5MD 1RJXB 1T4UH 4AZ2B 2ZHEH 1SI5H 4YO9A 1GJ9B 2GVFA 1TPSA 2J9NA 1P04A 2ZPRA 3SJ8A 1CGHA 4O9VA 4BAOB 2GCTB 5IYTA 1HFDA 5GIBA 5C20A 1FUJA 2J4IA 4GHTA 1MBMA 2A31A 2GV6A 2CGAA 1HJAC 4WXVA 4YESB 1CHGA 4DG4A 4BANB 2ZDLA 1ZSJA 1SGNE 3RXJA 1D9IA 1RIWC 1GI4A 1FDPA 2GMTB 1DANH 3H5CB 2QF3A 1O2TA 5FBIA 1GHZA 1K1OA 2EI6A 3NCLA 3M61U 3S69A 3E90B 2BVXH 3F1SB 1DX5M 1QR3E 4UFGH 4ABIA 4CRBA 1O36A 5HM2A 1AI8H 1TIOA 5FCRA 3BTQE 2AMQA 1GBDA 1ZHRA 2BD8A 1KXBA 5FHTA 1EPTB 1JBUH 1BTUA 1UTOA 3NKKA 2ZCHP 5EPYA 3RXEA 3RXAA 1TPPA 1O3IA 1GBAA 1W7GH 2WPJS 1FJSA 2BDGA 3QX5H 3M3TA 4K69A 2TGAA 5DPAA 5T6GA 1ZPCA 4ISNA 2QXHA 1TQ0B 1YKTA 4ZKNU 2ZF0H 1EX3A 3TJOA 1OWDA 4YLQH 1ARBA 3F68H 1EPTA 1G30B 1CA0C 1QIXB 2HVXA 1HCGA 1P2IA 1C1MA 4BTUB 1W0YH 1AVXA 1LQDB 2V3OH 2CF8H 2GMTC 1F5RA 2NU1E 1TRNA 1V2OT 3M5MA 1CT4E 1QTFA 2NU3E 1HB0B 4UE7H 2O8LA 4UONA 4U30A 1SGRE 1HPGA 4AX9H 2HGTH 2B0FA 2BZ6H 2VU8E 1VZQH 1OKXA 2P59A 1A4WH 4X8TH 6CHAB 1F5LA 2OQUA 1Q31A 4DURA 4XFQA 1SC8U 3M35A 1IOEA 1BJVA 4BAHB 4MPVA 3K6ZA 1G37A 1HV7A 1GJ4H 3SI4H 1O3CA 4AG1A 5EXNA 1PPHE 3RM2H 1LHGH 7GCHG 1GBHA 3TK6A 4NIYA 5EQRA 1EP6A 4IS5A 1GBBA 2UUKB 3UWIA 4ABEA 5EG4A 1P2MA 3MO9A 3A87A 1EZXC 4IMQA 3GCHB 4K3JA 1T31A 3BN9A 1GL0E 4Q80A 4CR5A 1OXGA 1O5CB 4UFDH 3BTKE 3DUXH 3TJUA 1TONA 1Y5AT 1S84A 5I46H 3NWUA 4CRDA 1HGTH 3B9FH 3I29A 3ZVGA 2H2ZA 1DUEA 1MU6B 2F3CE 1C1RA 3O8CA 1YLDA 3SU4A 5F03A 1ZRKA 3MH5A 3L6PA 5DKMA 4B74A 1OYQA 1SGTA 1QRZA 1SR5C 3C1KA 5HMAA 3M7UA 1O38A 5C5NA 1NO9H 6CHAC 1CT2E 3RXUA 2FLBH 4K5ZA 4B1TA 4JCNA 1P06A 2EC9H 4UDWH 1IQIA 1C1OA 2QXIA 3U8RH 4KKDA 4XBCA 1G3BA 3E16B 5CMXH 5FAHA 4K2YA 1ZZZA 1HAYB 1UVPA 3L33A 1NFYA 1W2KH 1HXEH 1O3LA 4UD9H 2QIQA 2B7DH 3KQCA 1Y5UT 3A81A 1D3DB 1GVZA 3Q77A 3MTYA 1W12U 1SOTA 5JDUB 1LQEA 5GCHG 5E2OA 1E0FD 4YM9A 1MCVA 4JZFH 5A8YA 1UTKA 1ID5H 1SPJA 1ZYOA 4ESTE 3PMHB 1HAVB 1ELCA 2G4TA 1OWHA 1TNIA 1W3CA 1GMHG 1Y8TA 4B2AA 1MAXA 1GBEA 3BV9B 4XE4A 2OC7A 2V6NA 2ZFTA 4YTAA 1GCTB 3HGNA 1TX8A 4F49A 2GZ7A 2VVUA 1LVBA 1FPCH 4ZH8A 5LPFA 4WJG2 3FP7E 1J17T 3U98H 2R3YA 1HAHH 4UFEH 1SGFA 3RLYH 2ZDVH 1GJ5H 3PROA 2VH0A 2WPKS 4YOJA 2KAIA 4ABDA 4INHA 3SV2H 2W5EA 1CO7E 2GCHF 3MO3A 4Z0KA 3SV7A 2FYQA 3AW0A 2BHGA 2O8MA 1J16A 1JRTA 1RD3B 4JZIA 4MNWA 4WMFA 1C2MA 1WTHD 2BVSH 4SGAE 2VJ1A 3MNBA 4AN7A 3UUZA 3SGAE 1QBOA 1SLWB 5EW1H 1TOCB 3P70B 1QB1A 1MKXH 3PB1E 3V12A 1XMNB 3E0PB 4I33A 3A7XA 1ESBA 2H9HA 2SGAA 2G55A 2F9NA 4HI3A 4HZHA 1P2JA 3URDA 1GHAG 2BD3A 3SV9A 2Q6FA 4GPGA 3ZZDA 5TCAA 3EYDA 3RXBA 1DFPA 1PQAA 3BIVH 1RTLA 2C8ZB 2ESTE 5A2MH 2C4FH 1UVTH 3FAOA 2WUCA 3AAUA 4AYYB 3SNEA 4TY7A 1O2LA 5A09A 1TNHA 3QK1A 1S6HA 1AB9C 3U1JB 1F7ZA 3HPTB 1O5BB 3EA7A 3N7OA 1P3EA 2SGPE 2WV4A 2BX4A 4J2YB 5C1UA 1YPLH 1H8IH 3F9HA 1EJMA 1OWEA 1NRQH 1Y3VA 2BD4A 3BF6H 3SU1A 2ZHFH 5FX5A 3H7TA 3TVJB 3HK3B 1SGPE 1DLKB 1YGCH 1RTKA 4MTBA 4I8JA 2CJIA 2TGPZ 4ISLA 1D3TB 1RS0A 5PTPA 1O35A 1OWIA 1THRH 7GCHF 3LDXH 1EJAA 2AYWA 3OYPA 1F0SA 1WUNH 3M7QA 1UJ1A 4AFUA 2BY8X 2P3TB 4ZXYH 4RSPA 1CHOG 1BMAA 2ZP0H 3AASA 5DP3A 1DDJA 2YNBA 1AFQC 1IAUA 4AFZA 2C8WB 4NA7A 1LHCH 1KLJH 2PTNA 2FLRH 3GYLB 2RDLA 5JB9S 2PKSC 3AAVA 3EGKH 2OUAA 4TPYA 1HAGE 2B8OH 3ZVCA 4X6MA 3ZZ8A 1C5WB 1C1VH 3W95A 3A88A 1WV7H 1L4ZA 1AKSB 2OINA 3E8LA 1RTFB 1AFQB 2BD9A 3FANA 4A7IB 1TALA 1DSUA 1O37A 3DT0H 2HOBA 1XKAC 1CBWC 1GBIA 2P3UB 1BTYA 1T4VH 3OY6U 5CE1A 1X7AC 2PW8H 4FVDA 1MQ6A 3SJOA 4GLYA 4DOQA 2FTMA 2Z3EA 5E0JA 2FODA 2ZA5A 1O2XA 1TOMH 4KTCA 2OC8A 4UEHH 3UWJH 1DWEH 2A2QH 5EPNA 3A82A 4LXBH 1W13U 2NWNA 7KMEH 1UTPA 1YPHE 1BHXF 2OP9A 2A5IA 3MFJA 1SGDE 4RKJB 2CF9H 1EATA 3AW1A 1KDQA 4MLFB 4BXWA 1GMHF 3D49H 5DJ7A 4JZDH 4A92A 3Q3YA 4OS2A 1GHVH 1CA0B 1BJUA 4B76A 1UTMA 2ALPA 2PUXB 3QTOH 4TY6A 1A0JA 1KXCA 3FFGA 1NTPA 3ATWA 2GDEH 5EW2H 4DT7B 1ZTLA 7ESTE 1MZDA 1YCPK 1MKWK 1YF4A 1A46H 4WF8A 1TWXB 1HJ9A 2ZTYA 5F8XA 5LH8A 1BTPA 2AIQA 2SFAA 2V35A 2EEKA 3UY9A 1BT7A 1SFIA 3SU5A 1VITG 4MDSA 1JXPA 3M5LA 3GDSA 1TNGA 3F6UH 2QV1A 1AHTH 3M7TA 2G52A 1QJ6B 1N6YA 2AH4X 2J94A 3K2UA 2ZG0H 3LC3A 5AF9H 2HNTC 5GJ4B 5F8TA 3T25A 1SGQE 2R2WU 3HK6B 1GMDF 2NU0E 1AGJA 5L6NH 5IDKA 5K0HA 4AORA 1ZGVA 5EGMA 6GCHF 3FP6E 4IBLH 1O2PA 1VR1H 1O0DH 2G81E 3A7WA 3ODDA 1C5ZB 1D3QB 1GBKA 4Y71A 6LPRA 3TNSA 4F4OC 4MNXA 3QGJA 3LOXA 1CQQA 2STAE 1C1TA 4B71A 1N8OC 1OOKB 1F2SE 1YPJH 4TWYA 2BDAA 2FTLE 2O8UA 1GPZA 2G4UA 2UWPA 4LK4A 2P8OB 3SU6A 1BZXE 1TABE 4MG3A 3ZZCA 2AMPA 2BOHB 1BITA 2FOHA 1ZJKA 2VIVA 2BDIA 3TITA 1SL3A 1TGCA 4K60A 3UOPA 5L2ZH 2PKAA 3M3VA 2FESH 2BB4A 4TPIZ 1ELGA 1ZHMA 3A8AA 4IC5A 1HAVA 2HRVA 2V3HH 3P17H 1EAIA 1BHXB 3I77A 2Y82A 3S7HB 2ZU3A 1FV9A 2Z9LA 4X2YA 3EDXB 4ABJA 1OP8A 1KLTA 1SGIB 1SQAA 3RC4A 3RMNH 1UCYK 2BD5A 1C5XB 1AE5A 3SUGA 3MNCA 2ZU2A 1N6XA 4IGDA 2AGEX 1ARCA 2FM2A 4K1EA 4Y10E 1GJAB 2GKVE 5C3NA 1O2SA 2A7CA 1C1PA 2AGIX 1VITF 2I6SA 1JOUB 3U8OH 3LIWA 1P57B 1K1MA 3UQVA 1TAWA 1O2YA 1P2QA 4ASHA 4IW4E 1N8OB 1HAZB 1O33A 4D9QA 3K65B 2OLGA 1HBTH 1QRWA 2O8WA 4Y8XA 3BTME 1PPFE 2ODPA 2QA9E 1CA8B 1DE7H 3TH3H 5BPEA 3VPKA 3A84A 3GYMA 3MU1A 5EXMA 2CHAB 3A8CA 2J2UA 3QZRA 1S83A 4FVBA 4IMZA 1QGFA 1ELBA 1LPZB 4HTCH 2STBE 2GGVB 3BEFB 1C9TA 1KTSB 2ZWLH 2AGGX 1F92A 7LPRA 1SFQB 3SW2B 4ZUHA 3UREA 1UCYH 2DE9A 1EUFA 5L2YH 3FP8E 5C1YA 1MTUA 4JK5A 1P9UA 2AFQB 3UFAA 1BB0B 2AERH 2BDCA 2TGTA 1TFXA 1TRMA 3SI3H 1KXDA 2G5NA 1KXEA 5T6DA 1THPB 3M5NA 2FIRH 2D2DA 3LJJA 2IPHA 1TX6A 4YLUA 1EZUC 1SVPA 4INLA 1DT2A 2C93B 4X2WA 3MI4A 3KNXA 1J15A 1DWBH 1LVYA 3LPRA 1O2WA 4VGCC 1IQEA 3ZYDA 4A5TS 5I25A 1MAYA 4X6NA 1L0ZA 5JBTA 3EE0B 1KSNA 1O2RA 1LHDH 1TMUH 5DP7A 3GDUA 3OTJE 1YPMH 1H1BA 1P03A 1W8BH 1SLVB 3KIDU 3BTDE 4FUBA 1IQKA 3OU0A 1FY5A 1G32B 3V7TA 1VITH 1C2GA 1W0ZU 3D23A 4BAQB 4VGCB 2FOMB 1TGNA 5J4SA 1SSXA 1ELEE 1SLUB 2A1DB 2JH6D 4YZUA 3DFJA 3ZVBA 3RXCA 1O2ZA 5DK1A 4ABGA 3D62A 5A0CA 4WXIA 3S9BA 2IN2A 4FUGA 4CH8B 4KTSA 3SHAH 1GHAF 2EI7A 1MQ5A 3ZZ9A 4XSKU 5HM9A 1IQMA 5B6OA 1HJ8A 1C4Y2 1AY6H 1ZSLA 2XC5A 1KIGH 4XOJA 1MU8B 4CR9A 1O2VA 1KTTB 1Z8IB 2ZHDA 4B2BA 1GJCB 3RXIA 3GCTF 2Q6GA 1K9OE 1FN6A 2ZGHA 2FS8A 2PKSB 1Y3XA 3ELAH 3CS0A 1SHHB 3KQBA 5C67A 4U01A 6GCHG 1C2JA 4DIHH 2HLCA 1AUJA 2WYGA 2CV3A 2BVRH 5GDSH 4TWWA 2BDHA 1QCPA 2VGCB 3NK8A 8KME2 4NFFA 1WAYB 1O2QA 3P8OA 1GJ6A 4OGXA 2FZZA 4X2XA 4H6SB 1P2OA 2GTBA 4YOIA 3ZZAA 2SNWA 2XWBI 2CXVA 3A7TA 2ZU4A 4AYVB 1NN6A 4NFEA 2VB0A 2J95A 1O2HA 4ABAA 1H4WA 3ZV8A 1IQLA 1YC0A 1TGBA 2BQ6B 3OX7U 1AWHB 4DVAU 2A5AA 3W94A 3TU7H 4I7YH 2P16A 1ZTJA 1GI7B 3Q76A 4OGYA 2TGDA 1K22H 4ZHAA 5GCHF 3T5FH 2ANMH 1C5UA 1SGYE 2TRMA 1V2LT 3TNTA 3M37A 4WY3A 1QBVH 4FU7A 2Y5FA 2C8YB 3BTHE 1MTVA 2NU4E 3RU4T 1YYY1 1T7CA 3K9XB 4KELA 4Y76A 4DW2U 5GWZA 3T2NA 1P8VC 3PWCA 3UTUH 1P05A 1O2OA 1TMTH 1O5EH 1QRXA 3RU4E 3VXFH 1DWCH 1XKBC 3SU3A 5DP5A 2PSYA 1QURH 3ODFA 1F0RA 2Y6TA 4CRGA 1TBZH 4NZLA 1C4V2 3UNQA 1G2LA 2VVCA 3LC5A 4K1SA 1SGFG 5C1XA 1ORFA 2G51A 1ANCA 5E0HA 5AHGH 3ZV9A 2ZU5A 3S0NA 3QTVH 1FI8A 4H4FA 4DGJA 3BTEE 3RMLH 2F83A 2HPQH 1NRNH 1FLEE 4Y7AA 4U32A 1Y3YA 3PTNA 1S5SA 1CT0E 1QL9A 4WH6A 1V2JT 1PFXC 2FI3E 1WTGH 2ZPSA 4YT7H 4JYTA 4ZHLU 4RN6A 1PPBH 1NS3A 1XUIA 3DA9B 1S85A 1GVKB 5TCCA 1AN1E 1XVOA 1C5QA 1FZZA 1SBWA 2SGDE 1AUTC 1B5GH 1MH0A 1FY3A 3E91A 3PWBA 2D8WA 1B0FA 5JBAS 5JPMH 5H4IB 1YM0A 4ISIH 4NCYA 1UVOA 4NWLA 2WPLS 2O8TA 1DLEA 1CU1A 2Q1JA 2A4OA 5G4BA 3UNRA 1GHYH 4X0WU 1BCUH 1C5PA 1BIOA 2FOAA 1QQUA 3ZZ6A 1JIMA 1K1NA 5CHAB 1C2FA 4B73A 1P01A 1K21H 1Z1JA 2VIQA 3GDVA 2ZC9H 1P2KA 1VJ9U 1GI3A 3PO1C 3IITA 3TLOA 1GMDG 3UIRA 3JZ2B 1HAXB 2QGRA 1N1LA 3FVFB 3GCTG 4JZEH 3KHVA 2D26C 1YPEH 1YLCA 1DM4B 1D4PB 2FX4A 1O30A 4DY7B 4K8BA 1YCPH 3F9GA 3GY5A 2BQWB 3HKJB 1U6QA 1ZTKA 1O3BA 1Q2WA 2PV9B 1L2EA 1GWAA 2PSXA 2BDBA 8GCHG 3PO1B 2PGQB 1OS8A 4NSYA 5LGOA 1V2NT 3EQ0H 2XTTB 1VCPA 2C3SA 2G00A 2PWXA 2QN5T 1H9HE 4ABBA 3PMJA 2IJOB 1Q3XA 1UTLM 1QB6A 1DS2E 3SNCA 3M36A 2C8XB 5C5OA 1W7XH 3SZNA 3URCA 4JYUH 5L30H 5ESTE 1OSSA 1QQ4A 1MUEB 4D7FA 1VGCB 1BBRH 2QY0B 1NFUA 1QFKH 1QNJA 3PLBA 2ZCLP 4ZAEA 1FY8E 3VB6A 1K28D 2H9TH 1UK2A 3V3MA 1BA8B 1W10U 1ANDA 1OPHB 2YNAA 2A0QB 4NWKA 1A0HB 2WPHS 1ELAA 1UMAH 5LPEA 1ESTA 3RXGA 2SGFE 2ZCKP 1IQHA 1C5RA 3LGVA 4J1YA 1ZR0A 1VCWA 2BD2A 1O2IA 1C1WH 1O3KA 2Y81A 3UQOA 1NU7B 4LZ1H 2BTCE 1ZLRA 1V2UT 3PYHA 1L1JA 4ISOA 3PMBB 1PPGE 2BD7A 4O3UA 1G9IE 1UK3A 2ZGBH 1BMNH 4A1VA 3TH4H 3RXMA 1BMMH 4CBNA 5F6MA 1EOJA 2JKHA 4MVNA 1O3NA 2QXGA 2A5KA 1AMHA 1PYTD 4ZKSU 2PFEA 2BLOA 1O32A 1EZQA 1XXFA 1XX9A 1ELVA 1LCYA 2H5CA 2XBVA 2ZQ2A 3RMMH 3DHKH 1XUFA 3GY2A 1J9CH 2Y7XA 5EQQA 1AWFH 2UUJB 2Y80A 3RXDA 3LONA 4AOQA 4NA9H 2A45B 2WPIS 1V2RT 3DFLA 1GJ7B 1ZHPA 3KF2A 3LGTA 2PLXA 1C5SA 1T8MA 4GHQA 1FIWA 1MCTA 3ZVAA 2P8OC 1O3FA 3GY7A 3BTTE 3GCHC 3HATH 1BRCE 1A7SA 3RU4D 1IQFA 1F5KU 1FAXA 2I6QA 3LT3A 1O5AB 4BOHA 1C2HA 3A7ZA 3P8FA 3V0XA 3VB3A 1P9SA 2W26A 4WWYA 4CHAB 1F0TA 1TPAE 2VIDA 5FPTA 4HFPB 4Y8ZA 4CREA 2RCEA 5GPIB 1E38B 2ZTZA 2VGCC 1YBWA 1KY9A 2XYAA 3TPIZ 2P94A 3UNSA 3ENSB 1AE8H 2JETB 2M5TA 2OQ5A 1V2ST 2XCNA 1GBFA 1H9LB 1AQ7A 2FOCA 2OD3B 1Z6JH 3Q00A 2FOBA 1F0UA 1NRPH 1ZMNA 1CE5A 2ZDMA 1SHYA 1SGEE 1C5LH 1YPHC 3SNDA 3BTFE 2ODYB 1BTXA 1ANBA 2RG3A 2FI5E 2ZU1A 1GG6C 4GCHF 1TRYA 1SLXB 3A85A 2A7JA 2GCHG 2ZQ1A 3O8BA 2VWOA 3ZYEA 1ETRH 5A8XA 1C5VA 1ZGIA 2ANKH 3OY5U 1ZMLA 3QLPH 1MKWH 4KP0A 1L4DA 1BRUP 2P93A 4ZROA 1DSTA 3ATMA 2BQ7B 4ABFA 2BY6X 1UTNA 1J8AA 3MO6A 1GJ8B 5A0AE 1G3CA 5BRRE 2ZFFH 8GCHF 1P2NA 3R0FA 1XUKA 2BOKA 3GY8A 1GI9B 5EQSA 1TLDA 3S9AA 1AZ8A 1XXDA 4ZHMU 3G01A 4I8HA 3NZIA 1TNLA 1Z8RA 1XUGA 3A8DA 3ATIA 3BEUA 1O5DH 1QL8A 1PQ7A 4D76A 1XVMA 4THNH 1Z7KA 4PROA 3VB7A 1AZZA 1UO6A 3PM3A 2Z9KA 3GY4A 2OC1A 2P3FH 4JK6A 3DD2H 4FU9A 1GGDC 1NFXA 1C2DA 1AVWA 5T3HA 1C5NH 5TJXA 3ZZBA 1Y3WA 1WSSH 2GZ9A 2F9UA 4M7GA 3BTGE 3SBKA 3A7VA 4ZKOU 1LVOA 5AFZH 1AKSA 2OTVA 2ILNA 1E37B 3SQHE 1BRBE 5AFYH 2UUYA 3KGPA 1Y3UA 5HYOA 3BG8A 1PQ5A 3SUEA 4MQAA 2V0BA 1EZSC 1ABIH 2THFB 2FP7B 5DP6A 3GICB 3EA8A 2BM2A 3SN8A 4A1TA 3RDZA 1C2IA 1Z8JB 4AFQA 4K1TA 1ZMJA 1QBNA 1WU1A 2HNTF 2QYIA 4X1RU 1V2KT 1QJ7B 3MOCA 1EAWA 3VFEA 5FBEA 1O5FH 2PGBB 1ANEA 1EJNA 1Y59T 3SGBE 3GCOA 2CMYA 1O2NA 5JYIA 4AB8A 1P09A 1NRRH 3MNSA 4B75A 1O3PB 2ZGCA 4O03A 3UR6A 4GUXA 5FPYA 4A1XA 3RUOA 4NSVA 1OP0A 4K8YA 1GCDA 3LU9B 3Q3XA 1ZOMA 1GVLA 2OBOA 4R8TB 1ZPBA 2FOGA 2PTCE 2R0KA 4NIXA 5DO4H 3GY3A 1OWJA 5T6FA 3T29A 1AIXH 1T8OA 2LPRA 1FMGA 1NROH 2GD4B 1HAPH 2ZDKA 4O3TA 3HKIB 1P12E 5JBCS 5EOKA 3SUFA 2Z9JA 4QT8C 3JZ1B 1DXPA 3BSQA 3NPSA 4MNYA 1T8NA 4CRAA 1Z71A 4X2VA 3MWIU 5ETXA 4Q7YA 1V2WT 2SGQE 1D6RA 4CBOA 1ZPZA 1AD8H 1A5GH 1ZJDA 2DUCA 8ESTE 3E1XB 1IHTH 3VGCB 4D9RA 1MKXK 3BEIB 1K1PA 2VIOA 4Y79A 1TB6H 4CRCA 4GSOA 3V13A 1YCPM 2W7SA 1GMCG 2ANWA 1MMJN 3MH4A 3ESTA 4Y8YA 2FOFA 4UFFH 2FYRA 2IOTA 3RM0H 2F9BH 4FXGH 3SJ9A 1OYTH 1S6FA 2ASUB 3O8DA 5EODA 5DP9A 1V2TT 4RKOB 1LKAA 1DPOA 5FX6A 3SO3A 4AFSA 3MYWA 2XC4A 1CGIE 3GISB 3TJVA 2JH5D 1SQOA 4WVPE 1GBTA 2ANYA 3LGUA 1G2MA 1LHFH 4BTIB 1IHSH 3MU5A 1KYNA 1O5GH 1CVWH 3RXVA 3KQDA 1WCZA 4ZMAH 3RXTA 2LNCA 1AU8A 1CHOF 3FZZA 2GZ8A 4OS4A 4BXSA 1RXPA 4IN2A 5SGAE 1FONA 1BTZA 4NZQA 2TBSA 2OXSA 3T28A 5A8ZA 2ALVA 1SB1H 2QXJA 5GXPA 1UVSH 1DY9A 1BRAA 2UWLA 1GI2A 1ETTH 2ZFSA 1VGCC 4DIIH 2AMDA 4E06H 4FUEA 4Q2KA 1GHBF 3D65E 3QZQA 2R2MB 2AIPA 1NESE 2WINI 1O3MA 1O2UA 3RC6A 3R3GB 1UHBB 2B5TB 1HYLA 5J4QA 2F9PA 1LPGB 3SJKA 4I31A 1V6DA 1GHWH 1C1NA 2HWLB 4B2CA 4TYDA 1GI1A 3TH2H 1LO6A 1C1SA 2A4GA 3PLKA 3SGQE 3RXPA 1EB1H 4CRFA 4MPUA 3RXRA 1CBWB 1WOFA 1EKBB 3ATKA 4WH8A 2F91A 4XDEA 2XC0A 4GCHG 2WUBA 1QHRB 1RFNA 5ESBA 5FPSA 2R3UA 4BNRA 1YP9A 3SOSA 4WMDA 1GDNA 1GGDB 1EB2A 1GBCA 1UVUH 1Y5BT 4OS6A 3ZZ3A 2ULLA 2Q6DA 1MTSA 1GHXH 2VNTA 3RLWH 1HAIH 4Z6AH 4X1PU 2FWWA 1K1LA 3VB4A 3SU0A 1INCA 1T32A 3PV4A 4OS7A 3WY8A 1G3DA 5E2PA 1OP2A 2Y7ZA 4MPWA 3LH3A 2ZFPH 1C9PA 2XXLA 1NY22 1GL1A 2VWMA 1ZRBA 1HLTH 1S81A 2ZI2H 3MU0A 4O97A 1LPKB 2J34A 1NFWA 3FZDA 1O2MA 2ZDAH 4X8SH 2GP9B 1A3EH 2BMGB 4E05H 3RXFA 1FN8A 3E6PH 4FUJA 4CHAC 3U1IB 4ZXXH 1A61H 3T27A 1C2EA 1A0LA 4ABHA 1ETSH 3QWCH 2G5VA 2ZKSA 2GDDA 3SQEE 3SJIA 1C5TA 1YPGH 2FMJA 2FX6A 2AS9A 1E34B 2HPPH 3P8GA 1TNKA 5E0GA 2WV5A 1O3EA 1TPOA 3ZVFA 1O3OA 1BTWA 2BDYA 1V2PT 3B8JA 2ZGXH 5C2ZA 3RXQA 2YOLA 1NC6A 4H6TA 9ESTA 4FUDA 1H9IE 2BXTH 2QF0A 3LH1A 3SORA 2ZHQH 2CN0H 1B0EA 4FU8A 1O2JA 4YOGA 1MTWA 3TGIE 1TNJA 4IC6A 4NIWA 2ODQA 1WQSA 1IQJA 1DOJA 1S0RA 1O3DA 4DCDA 2Z3CA 1QA0A 2FXRA 2ZO3H 3S7KB 3GY6A 1IQGA 1O3GA 1PPCE 1P02A 4Y11E 4CH2B 2XW9A 2JH0D 3SV6A 2FO9A 2VIPA 2SGEE 3M5OA 1RGQA 4BAMB 1AO5A 1P0SH 1Z1IA 2BLQA 3RXSA 2BLVA 2A4QA 2PUQH 3LJOA 2F9OA 3ZZ7A 5AVDA 1D3PB 2ZECA 2H9EH 4X1QU 3UR9A 1DY8A 1EAUA 2NU2E 1HUTH 1NT1A 3MH6A 1TMBH 8LPRA 3BTWE 4A6LA 4MNVA 1C5OH 1MD7A 1DICA 2XCFA 2PR3A 2BY9X 4H42U 1KDQB 2XNIA 4GAWA 1O3HA 1XUHA 5HGGA 1C2KA 1ZSKA 2XRCA 4X1SU 4INKA 1IQNA 1FXYA 2GT8A 2O9QA 1A5HA 3MU8A 1K1IA 3L3TA 1PPEE 1BDAA 1ELTA 1TX7A 2HNTE 1LVMA 3ATLA 1O2KA 2W7UA 1AVGH 1S82A 1KLIH 1VJAU 4X1NU 4DJZB 3AVZA 2TIOA 1TGTA 1EXFA 3BG4B 4AGJA 1H8DH 3RXLA 2ZFQH 1FY4A 4Q7XA 1HIAB 1PQ8A 3GCNA 4BAKB 1EAXA 3T62A 4MPXA 4Y7BA 3TIUA 2FOEA 2D1JA 1GDQA 2Y5HA 3KEEA 2QCYA 2FPZA 1QB9A 1TBQH 3BG4C 4AG2A 2Z6BD 2GCTC 1ACBE 3SUDA 1OX1A 3NUMA 1HRTH 5E8EH 1TQ7B 3SNAA 2F9VA 1UTQA 4Y6DA 2KAIB 2WYJA 1AB9B 2FEQH 2PHBA 3A83A 1KXFA 1O3JA 1MTNC 1E36B 2UUFB 1G3EA 1Z8GA 3IWMA 3VGCC 4I32A 1V3XA 2BLWA 2Y5GA 3ZZ4A 3STIA 1RIWB 4JZ1A 3MHWU 1DVAH 1BBRK 1EP5A 1HAOH 2CHAC 5CHAC 1TE0A 1A1RA 1BTHH 1C2LA 4OS1A 4R0IA 3TJNA 1MTNB 4I8GA 2XWAA 1UTJA 2EA3A 5JBBS 1GHBG 3MH7A 4X6PA 4ISHH 1SOZA 4FUCA 1BQYA 2ZZUH 1K2I1 3SU2A 2TPIZ 5EU8A 3ITIA 2FS9A 5FXLA 2UWOA 1DWDH 3LGWA 4I8KA 3QDZB 1PJPA 3VEQB 3HGPA 1NM6A 4AB9A 5JB8S 2BYAX 1XUJA
chains in the Genus database with same CATH superfamily
1C1UH 4NIVA 2QAAA 3U69H 2BZAA 1SG8B 3H7OA 2B9LA 2VIWA 1A5IA 1UCYE 2FI4E 2GX4A 3LGIA 4KGAA 1EPTC 3QUMP 1J14A 2DE8A 3EA9A 3K6YA 2W3IA 4JYVH 4X6OA 1ELFA 5EXLA 1GI6A 3EAJA 1P3CA 2HALA 3I78A 2R9PA 2R0LA 1UHBA 3O8RA 1ABJH 2C90B 2ZFRH 1GJDB 5DP8A 1FQ3A 1FNIA 3U8TH 2J38A 2KCOA 3QO6A 1VCQA 4ACAA 1V2VT 1OWKA 3C27B 3IG6B 1OHHD 3CS7A 4YT6H 1QL7A 5LPRA 1GDUA 2QC2A 2A4RA 1JWTA 2JETC 5KGOA 1S0QA 1GI5A 2A7HA 3MNXA 4B6EA 1TYNA 3NXPA 4LOYH 4Y0ZE 1O34A 1FPHH 5A0BA 1NZQH 4HGCA 5FCKA 2KR7A 1C5YB 1TA2A 3A7YA 1MZAA 1W14U 2BY7X 4JMYA 3F9EA 3H09A 1HJAB 3STJA 5ABWA 1LDTT 1GBLA 2Z9IA 1AFEH 2ZIQH 1BBRE 2ZNKH 1O31A 1QJ1B 2VWNA 4XBBA 2OC0A 1HXFH 1DUAA 1XM1A 1K1JA 1FIZA 3TGJE 1NU9A 3A8BA 4DT4A 3UPEA 3TGKE 4E7RG 1E1RD 3KQEA 1O2GH 4E7NA 1ELDE 1TA6A 3P8NA 1EASA 1LHEH 2GV7A 2SNVA 1GI8B 3B23B 2H6MA 4GVUA 2JDID 1WQVH 2AEIH 2XBWA 3VXEH 3PLPA 4IN1A 2VVVA 1LKBA 4KTUA 3SHCH 1V2MT 4WMEA 3P6ZB 1SGCA 1JMOH 2W3KA 2XBXA 3QN7A 2ZDNA 1JIRA 3SNBA 2EI8A 1P10A 4XBDA 5F8ZA 1LTOA 1HIAA 3BIUH 1JRSA 2A2XH 1C1QA 1EQ9A 1RRKA 1C4U2 2ZEBA 1G36A 5CHBA 1FAKH 1GMCF 1PYTC 3P92A 1QA7A 3A80A 1DITH 4FUFA 4FUHA 1D6WA 3CP7A 1T8LA 1LMWB 1CSOE 1B7XB 2RA3A 4ZKRU 3E3TA 2ZTXA 4U2WA 1HNEE 2Z7FE 3ZVEA 3VG8A 4NA8A 1M9UA 3GOVB 4X8UH 2RDEA 2A32A 4NGAH 1MBQA 3F9FA 4FUIA 3TK9A 3UB0A 3MU4A 4I8LA 1UK4A 3A86A 1TBRH 2OBQA 4D7GA 1KXAA 3SV8A 3ZVDA 1DXWA 1GBMA 2WPDD 3RXKA 1A3BH 3RXOA 1GG6B 6ESTA 1PPZA 2VWLA 2OCVB 3UOUA 1GBJA 3KL6A 5IK2D 1SMFE 1MD8A 1EOLA 4SGBE 1WYKA 3P95A 4XD7D 2ZPQA 5DG6A 1O3AA 1BUIA 1YPKH 2RA0A 2GT7A 1QZ8A 2VH6A 3CENA 2EQNA 4BTTB 1E35B 3OSYA 1ESAA 2Z94A 1GCTC 4Y0YE 2J92A 2CK3D 3VB5A 2IPQX 5K7RA 4FETA 2Z3DA 2XBYA 1BMLA 2BXUH 2H5DA 1P11E 2BX3A 3U9AH 1GJBB 3PTBA 5DP4A 1L1NA 3RP2A 4D8NA 3S9CA 3A89A 2Z9GA 4AGKA 3E0NB 3RXHA 2K1QA 3M3SA 2ZGJA 2W6JD 2WPMS 3KN2A 3QGNB 1TGSZ 1NPMA 2FDAA 3SZEA 4OS5A 1THSH 1QY6A 1V2QT 4LZ4B 1L1GA 3T26A 4X8VH 3LGYA 3PMAB 1GI0A 1O39A 2P95A 3TK5A 1HDTH 5HXFA 3RMOH 9LPRA 2BY5X 5DGJA 1A2CH 2PKAB 3KCGH 3MMGA 1FY1A 2KZ4A 1SQTA 2VINA 3RC5A 2G8TA 2H1UA 1Z6EA 1W11U 1WBGB 3Q3KA 1BOQA 3ZZ5A 1NRSH 2ZHWH 4NG9H 3LKWA 1CGJE 4Q7ZA 1C5MD 1RJXB 1T4UH 4AZ2B 2ZHEH 1SI5H 4YO9A 1GJ9B 2GVFA 1TPSA 2J9NA 1P04A 2KM0A 2ZPRA 3SJ8A 1CGHA 4O9VA 4BAOB 2GCTB 5IYTA 1HFDA 5EJZA 5GIBA 5C20A 1FUJA 2J4IA 4GHTA 1MBMA 2A31A 2GV6A 2CGAA 1HJAC 4WXVA 4YESB 1CHGA 4DG4A 4BANB 2ZDLA 1ZSJA 1SGNE 3RXJA 1SQRA 1D9IA 1RIWC 1GI4A 1FDPA 2GMTB 1DANH 3H5CB 2QF3A 1O2TA 5FBIA 1GHZA 1K1OA 2EI6A 3NCLA 3M61U 3S69A 3E90B 2BVXH 3F1SB 1DX5M 1QR3E 4UFGH 4ABIA 4CRBA 1O36A 5HM2A 1AI8H 1TIOA 5FCRA 3BTQE 2AMQA 1GBDA 1ZHRA 2BD8A 1KXBA 5FHTA 1EPTB 1JBUH 1BTUA 1UTOA 3NKKA 2ZCHP 5EPYA 3RXEA 3RXAA 1TPPA 1O3IA 1GBAA 1W7GH 3KQ5A 2WPJS 1FJSA 2BDGA 3QX5H 3M3TA 4K69A 2TGAA 5DPAA 5T6GA 1ZPCA 4ISNA 2QXHA 1TQ0B 1YKTA 4ZKNU 2ZF0H 1EX3A 3TJOA 1OWDA 4TSFD 4YLQH 1ARBA 3F68H 1EPTA 1G30B 1CA0C 1QIXB 2HVXA 1HCGA 1P2IA 1C1MA 4BTUB 1W0YH 1AVXA 1LQDB 2V3OH 2CF8H 2GMTC 1F5RA 2NU1E 1TRNA 1V2OT 3M5MA 1CT4E 1QTFA 2NU3E 1HB0B 4UE7H 2O8LA 4UONA 4U30A 1SGRE 1HPGA 4AX9H 2HGTH 2B0FA 2BZ6H 2VU8E 1VZQH 1OKXA 2P59A 1A4WH 4X8TH 6CHAB 1F5LA 2OQUA 1Q31A 4DURA 4XFQA 1SC8U 3M35A 1IOEA 1BJVA 4BAHB 4MPVA 3K6ZA 1G37A 1HV7A 2J5UA 1GJ4H 3SI4H 1O3CA 4AG1A 5EXNA 1PPHE 3RM2H 1LHGH 7GCHG 1GBHA 3TK6A 1MABB 1YWUA 4NIYA 5EQRA 1EP6A 4IS5A 1GBBA 2UUKB 4Q63A 3UWIA 3PV2A 4ABEA 5EG4A 1P2MA 3MO9A 3A87A 1EZXC 4IMQA 3GCHB 4K3JA 2LELA 1T31A 3BN9A 1GL0E 4Q80A 4CR5A 1OXGA 1O5CB 4UFDH 4Q4LA 3BTKE 3DUXH 3TJUA 1TONA 1Y5AT 1S84A 5I46H 3NWUA 4CRDA 4B6FA 1HGTH 3B9FH 3I29A 3ZVGA 2H2ZA 1DUEA 1MU6B 2F3CE 1C1RA 3O8CA 1YLDA 3SU4A 5F03A 1ZRKA 3MH5A 3L6PA 5DKMA 4B74A 1OYQA 1SGTA 1QRZA 1SR5C 3C1KA 5HMAA 3M7UA 1O38A 5C5NA 1NO9H 6CHAC 1CT2E 3RXUA 2FLBH 4K5ZA 4B1TA 4JCNA 1P06A 2EC9H 4UDWH 1IQIA 1C1OA 2QXIA 3U8RH 4KKDA 4XBCA 1G3BA 3E16B 5CMXH 5FAHA 4K2YA 1ZZZA 1HAYB 1UVPA 3L33A 1NFYA 1W2KH 1HXEH 1O3LA 4UD9H 2QIQA 2B7DH 2L6OA 3KQCA 1Y5UT 3A81A 2KCYA 3F2FA 1D3DB 1GVZA 3Q77A 3MTYA 1W12U 1SOTA 5HKKD 5JDUB 5DSFA 1LQEA 5GCHG 5E2OA 2V7QD 1E0FD 4YM9A 1MCVA 4JZFH 5A8YA 1UTKA 1ID5H 4ACBA 1SPJA 1ZYOA 4ESTE 3PMHB 1HAVB 1ELCA 2G4TA 1OWHA 1TNIA 1W3CA 1GMHG 1Y8TA 4B2AA 1MAXA 1GBEA 3BV9B 4XE4A 2OC7A 2V6NA 2ZFTA 4YTAA 1GCTB 3HGNA 1TX8A 4F49A 2GZ7A 2VVUA 1LVBA 1FPCH 4ZH8A 5LPFA 4WJG2 3FP7E 1J17T 3U98H 2R3YA 1HAHH 4UFEH 1SGFA 3RLYH 2ZDVH 1GJ5H 3PROA 2VH0A 2WPKS 4YOJA 2KAIA 4ABDA 2RFKC 4INHA 3SV2H 2W5EA 1CO7E 2GCHF 3MO3A 4Z0KA 3SV7A 2FYQA 3AW0A 2BHGA 2O8MA 1J16A 1JRTA 1RD3B 4JZIA 4MNWA 4WMFA 1C2MA 1WTHD 2BVSH 2KFWA 4SGAE 2VJ1A 3MNBA 4AN7A 3UUZA 3SGAE 1QBOA 1SLWB 5EW1H 1TOCB 3P70B 1QB1A 1MKXH 3PB1E 3V12A 1XMNB 3E0PB 4I33A 3A7XA 1ESBA 2H9HA 2SGAA 2G55A 2F9NA 4HI3A 4HZHA 1P2JA 3URDA 1GHAG 2BD3A 3SV9A 2Q6FA 4GPGA 3ZZDA 5TCAA 3EYDA 3RXBA 1DFPA 1PQAA 3BIVH 1RTLA 2C8ZB 5B6LA 2ESTE 5A2MH 2C4FH 1UVTH 3FAOA 2WUCA 3AAUA 4AYYB 3SNEA 4TY7A 1O2LA 5A09A 1TNHA 3QK1A 1S6HA 1AB9C 3U1JB 1F7ZA 3HPTB 1O5BB 3EA7A 3N7OA 1P3EA 2SGPE 2WV4A 2BX4A 4J2YB 5C1UA 1YPLH 1H8IH 3F9HA 1EJMA 4YXWD 1OWEA 1NRQH 1Y3VA 2BD4A 3BF6H 3SU1A 2ZHFH 5FX5A 3H7TA 3TVJB 3HK3B 1SGPE 1DLKB 1YGCH 1RTKA 4MTBA 4I8JA 2CJIA 2TGPZ 2KX4A 4ISLA 1D3TB 1RS0A 5PTPA 1O35A 1OWIA 1THRH 7GCHF 3LDXH 1EJAA 2AYWA 3OYPA 1F0SA 1WUNH 3M7QA 1UJ1A 4AFUA 2BY8X 2P3TB 4ZXYH 4RSPA 1CHOG 1BMAA 2ZP0H 3AASA 5DP3A 1DDJA 2YNBA 1AFQC 1IAUA 4AFZA 2C8WB 1BMFD 4NA7A 1LHCH 1KLJH 2PTNA 2FLRH 3GYLB 2RDLA 5JB9S 2PKSC 3AAVA 3EGKH 2OUAA 4TPYA 3MQKC 1HAGE 2B8OH 3ZVCA 4X6MA 3ZZ8A 1C5WB 1C1VH 1KMHB 3A88A 3W95A 1WV7H 2YMSB 1L4ZA 1AKSB 2OINA 3E8LA 3U28C 1RTFB 1AFQB 2BD9A 3FANA 4A7IB 1TALA 2LP6A 2XOKD 1DSUA 1O37A 3DT0H 2HOBA 1XKAC 1CBWC 3W1EA 1GBIA 2P3UB 1BTYA 1T4VH 3OY6U 5CE1A 1X7AC 2PW8H 4FVDA 1MQ6A 3SJOA 4GLYA 4DOQA 2FTMA 2Z3EA 5E0JA 2FODA 2ZA5A 1O2XA 1TOMH 4KTCA 2OC8A 1NBMD 4UEHH 3UWJH 3DSGA 1DWEH 2A2QH 5EPNA 3A82A 4LXBH 1W13U 2NWNA 7KMEH 1UTPA 1YPHE 1BHXF 2OP9A 2A5IA 3MFJA 3AK5A 5EJ1A 1SGDE 4RKJB 2CF9H 1EATA 3AW1A 1KDQA 4MLFB 4BXWA 3EE7A 1GMHF 3D49H 5DJ7A 4JZDH 4A92A 3OAAD 3Q3YA 4OS2A 1GHVH 1CA0B 1BJUA 4B76A 1UTMA 2ALPA 2PUXB 3QTOH 4TY6A 1H8ED 1A0JA 1KXCA 3FFGA 1NTPA 3UAIC 3ATWA 2GDEH 3SYJA 5EW2H 4DT7B 1ZTLA 7ESTE 4RI0A 1MZDA 1YCPK 1MKWK 1YF4A 1A46H 4WF8A 1TWXB 2YMSD 1HJ9A 2KCAA 2ZTYA 5F8XA 5LH8A 1BTPA 2AIQA 2SFAA 2V35A 2EEKA 3UY9A 1BT7A 1SFIA 3SU5A 1VITG 4MDSA 1JXPA 3M5LA 3GDSA 1TNGA 3F6UH 2QV1A 1AHTH 3M7TA 2G52A 1QJ6B 1N6YA 2AH4X 2J94A 3K2UA 2ZG0H 3LC3A 5AF9H 2HNTC 5GJ4B 5F8TA 3T25A 1SGQE 2R2WU 3HK6B 1GMDF 2NU0E 1AGJA 5L6NH 5IDKA 5K0HA 4AORA 1ZGVA 5EGMA 6GCHF 3FP6E 4IBLH 1O2PA 1VR1H 1O0DH 2G81E 3A7WA 3ODDA 1C5ZB 1D3QB 1GBKA 4Y71A 6LPRA 3TNSA 4F4OC 4MNXA 3QGJA 4M9FA 3LOXA 1W0KD 1CQQA 2STAE 1C1TA 4B71A 1N8OC 1OOKB 1F2SE 1YPJH 4TWYA 2BDAA 2FTLE 2O8UA 1GPZA 2G4UA 2K8IA 5DN6D 2UWPA 4LK4A 2P8OB 3SU6A 1BZXE 1TABE 4MG3A 3ZZCA 2AMPA 2BOHB 1FX0B 1BITA 2FOHA 1ZJKA 2VIVA 2BDIA 3TITA 1SL3A 1TGCA 4K60A 3UOPA 5L2ZH 2PKAA 3M3VA 2FESH 2BB4A 4TPIZ 1ELGA 1ZHMA 3A8AA 4IC5A 1HAVA 2HRVA 2V3HH 3P17H 1EAIA 1BHXB 3I77A 2Y82A 3S7HB 2ZU3A 1FV9A 2Z9LA 4X2YA 3EDXB 4ABJA 1OP8A 1KLTA 1SGIB 1SQAA 3RC4A 3RMNH 1UCYK 2BD5A 1C5XB 1AE5A 3SUGA 3MNCA 2ZU2A 1N6XA 3FN8A 4IGDA 2AGEX 1ARCA 2FM2A 4K1EA 1EFRD 4Y10E 1GJAB 2GKVE 5C3NA 1O2SA 2A7CA 1C1PA 2AGIX 1VITF 2I6SA 1JOUB 3U8OH 3LIWA 1P57B 1K1MA 3UQVA 1TAWA 1O2YA 1P2QA 4ASHA 4IW4E 1N8OB 1HAZB 1O33A 4D9QA 3K65B 2OLGA 1HBTH 1QRWA 2O8WA 4Y8XA 3BTME 1PPFE 2ODPA 2QA9E 1CA8B 1DE7H 3TH3H 5BPEA 3VPKA 3OEED 3A84A 3GYMA 2JIZD 3MU1A 5EXMA 2CHAB 4AC9A 3OE7D 3A8CA 2J2UA 1K0HA 3QZRA 1S83A 4FVBA 4IMZA 1QGFA 1ELBA 1LPZB 4HTCH 2STBE 2GGVB 3BEFB 1C9TA 1COWD 1KTSB 2ZWLH 2AGGX 1F92A 2J98B 7LPRA 1SFQB 3SW2B 4ZUHA 3UREA 1UCYH 2DE9A 2QF4A 1EUFA 5L2YH 3FP8E 5C1YA 2HVYB 5T1VA 1MTUA 4JK5A 2OK5A 1P9UA 2AFQB 3UFAA 1BB0B 2AERH 2BDCA 2TGTA 1E79D 1TFXA 1TRMA 3SI3H 1YY3A 1KXDA 2G5NA 1KXEA 5T6DA 1THPB 3M5NA 2FIRH 2D2DA 3LJJA 2IPHA 1TX6A 1VKYA 4YLUA 1EZUC 1SVPA 4INLA 1DT2A 2C93B 4X2WA 3MI4A 3KNXA 1J15A 5KEDA 1DWBH 1LVYA 3LPRA 1O2WA 4VGCC 1IQEA 3ZYDA 4A5TS 5I25A 2WZQA 1MAYA 4X6NA 1L0ZA 5JBTA 3EE0B 1KSNA 1O2RA 1LHDH 1TMUH 5DP7A 3GDUA 3OTJE 1YPMH 1H1BA 1P03A 1W8BH 1SLVB 3KIDU 3BTDE 4FUBA 1IQKA 3OU0A 1FY5A 1G32B 3V7TA 1VITH 1C2GA 1W0ZU 3D23A 4BAQB 2K0QA 4VGCB 2FOMB 1TGNA 5J4SA 1SSXA 1ELEE 1SLUB 2A1DB 2JH6D 4YZUA 1UW7A 3DFJA 3ZVBA 3RXCA 1O2ZA 5DK1A 4ABGA 3D62A 5A0CA 4WXIA 3S9BA 2IN2A 4FUGA 4CH8B 4KTSA 3SHAH 1GHAF 2EI7A 1MQ5A 4TT3D 3ZZ9A 4XSKU 5HM9A 1IQMA 5B6OA 1HJ8A 1C4Y2 1AY6H 1ZSLA 2XC5A 1KIGH 4XOJA 1MU8B 4CR9A 1O2VA 1KTTB 1Z8IB 2ZHDA 4B2BA 1GJCB 2WSSD 3RXIA 3GCTF 2Q6GA 1K9OE 1FN6A 2ZGHA 2FS8A 2PKSB 1Y3XA 3ELAH 3CS0A 1SHHB 3KQBA 5C67A 4U01A 6GCHG 1C2JA 4DIHH 2HLCA 1AUJA 2WYGA 2CV3A 2YMSC 3GS9A 2BVRH 5GDSH 4TWWA 2BDHA 1QCPA 2VGCB 3NK8A 8KME2 4NFFA 4Z1MD 1WAYB 1O2QA 3P8OA 1GJ6A 4OGXA 2FZZA 4X2XA 3WWFA 4H6SB 1P2OA 2GTBA 4YOIA 3ZZAA 2SNWA 2XWBI 2CXVA 3A7TA 2ZU4A 4AYVB 1NN6A 4NFEA 2VB0A 2J95A 2M2AA 1O2HA 4P02A 4ABAA 1H4WA 3ZV8A 1IQLA 1YC0A 1TGBA 2BQ6B 3OX7U 1AWHB 4DVAU 2A5AA 3W94A 3OFND 3TU7H 4I7YH 2P16A 1ZTJA 1GI7B 3Q76A 4OGYA 5KECA 2TGDA 1K22H 4ZHAA 5GCHF 3T5FH 2ANMH 1C5UA 1SGYE 2TRMA 1V2LT 3TNTA 3M37A 4WY3A 1QBVH 4FU7A 2Y5FA 2C8YB 3BTHE 1MTVA 2NU4E 3RU4T 1YYY1 1T7CA 3K9XB 4KELA 4Y76A 4DW2U 5GWZA 3T2NA 1P8VC 3PWCA 3UTUH 1P05A 1O2OA 1TMTH 1O5EH 1QRXA 3RU4E 3VXFH 1DWCH 1XKBC 3SU3A 5DP5A 2PSYA 1QURH 3ODFA 1F0RA 2Y6TA 4ASUD 4CRGA 1TBZH 4NZLA 1C4V2 3UNQA 1G2LA 2VVCA 3LC5A 4K1SA 1SGFG 5C1XA 1ORFA 2G51A 1ANCA 5E0HA 3F3BA 5AHGH 3ZV9A 2ZU5A 3S0NA 3QTVH 1FI8A 4H4FA 4DGJA 3BTEE 3RMLH 2F83A 2HPQH 1NRNH 1FLEE 4Y7AA 4U32A 1Y3YA 3PTNA 1S5SA 1CT0E 1QL9A 4WH6A 1V2JT 1PFXC 2FI3E 1WTGH 2ZPSA 4YT7H 4JYTA 4ZHLU 4RN6A 1PPBH 1NS3A 1XUIA 3DA9B 1S85A 1GVKB 3NRLA 5TCCA 1AN1E 1XVOA 1C5QA 1FZZA 1SBWA 2SGDE 1AUTC 1B5GH 1MH0A 1FY3A 1W0JD 3E91A 3N99A 3PWBA 2D8WA 2F4LA 1B0FA 5JBAS 5JPMH 5H4IB 1YM0A 4ISIH 4NCYA 2J97A 1UVOA 4NWLA 2WPLS 2O8TA 2WHXA 1DLEA 1CU1A 2Q1JA 2A4OA 5G4BA 3UNRA 1GHYH 4X0WU 1BCUH 1C5PA 1BIOA 2FOAA 1QQUA 3ZZ6A 1JIMA 1K1NA 5CHAB 1NBME 1C2FA 4B73A 1P01A 1K21H 1Z1JA 2VIQA 3GDVA 2VBCA 2ZC9H 1P2KA 3PRBA 1VJ9U 1GI3A 3PO1C 3IITA 3TLOA 1GMDG 3UIRA 3JZ2B 1HAXB 2QGRA 1N1LA 3FVFB 3GCTG 4JZEH 3KHVA 5C94A 2D26C 1YPEH 3OEHD 1YLCA 1DM4B 1D4PB 2FX4A 1O30A 4DY7B 4K8BA 1YCPH 3F9GA 3GY5A 2BQWB 3HKJB 1U6QA 1ZTKA 1O3BA 1Q2WA 2PV9B 1L2EA 1GWAA 2PSXA 2BDBA 8GCHG 3PO1B 2EY4C 1OS8A 2PGQB 4NSYA 5LGOA 1V2NT 3EQ0H 2XTTB 1VCPA 2C3SA 2G00A 2PWXA 2QN5T 1H9HE 4ABBA 3PMJA 2IJOB 1Q3XA 1UTLM 1QB6A 1DS2E 3SNCA 3M36A 2C8XB 5C5OA 1W7XH 3SZNA 3URCA 4JYUH 5L30H 5ESTE 1OSSA 1QQ4A 1MUEB 4D7FA 1VGCB 1BBRH 2QY0B 1NFUA 1QFKH 1QNJA 3PLBA 2ZCLP 4ZAEA 1FY8E 3VB6A 3WW7A 1K28D 2H9TH 1UK2A 3V3MA 1BA8B 1H8HD 1W10U 1ANDA 1OPHB 2YNAA 2A0QB 4NWKA 1A0HB 2WPHS 1ELAA 1UMAH 5LPEA 1ESTA 3RXGA 2SGFE 2ZCKP 1IQHA 1C5RA 3LGVA 4J1YA 1ZR0A 1VCWA 2BD2A 1O2IA 4P00A 4XRNA 1C1WH 1O3KA 2Y81A 3UQOA 1NU7B 4LZ1H 2BTCE 1ZLRA 1V2UT 2L74A 3PYHA 1L1JA 4FOUC 4ISOA 2J98A 3PMBB 4I86A 1PPGE 2BD7A 4O3UA 1G9IE 1UK3A 2ZGBH 1BMNH 4A1VA 3TH4H 3RXMA 1BMMH 5FL7D 4CBNA 5F6MA 1EOJA 2JKHA 4MVNA 1O3NA 2QXGA 2A5KA 1AMHA 1PYTD 3PRDA 4ZKSU 2PFEA 2BLOA 1O32A 1EZQA 1XXFA 1XX9A 1ELVA 1LCYA 2H5CA 2XBVA 2ZQ2A 3RMMH 3DHKH 1XUFA 3GY2A 1J9CH 2Y7XA 5EQQA 1AWFH 2UUJB 2Y80A 3RXDA 3LONA 4AOQA 4NA9H 2A45B 2WPIS 1V2RT 3DFLA 1GJ7B 1ZHPA 3KF2A 3LGTA 2PLXA 1C5SA 1T8MA 4GHQA 1FIWA 1MCTA 3ZVAA 2P8OC 1O3FA 3GY7A 3BTTE 3GCHC 3HATH 1BRCE 1A7SA 3RU4D 1IQFA 1F5KU 1FAXA 2I6QA 3LT3A 1O5AB 4BOHA 1C2HA 3A7ZA 3P8FA 3V0XA 5EIYA 3VB3A 1P9SA 1E1QD 2W26A 4WWYA 4CHAB 1F0TA 1TPAE 2VIDA 5FPTA 4HFPB 4Y8ZA 4CREA 2RCEA 5GPIB 1E38B 2ZTZA 5EJLA 2VGCC 3KYGA 1YBWA 1KY9A 2XYAA 3TPIZ 2P94A 3UNSA 3ENSB 1AE8H 2JETB 2M5TA 2OQ5A 1V2ST 2XCNA 1GBFA 1H9LB 1AQ7A 2FOCA 2OD3B 1Z6JH 3Q00A 5C0TA 2FOBA 1F0UA 1NRPH 1ZMNA 1CE5A 2ZDMA 1SHYA 1SGEE 1C5LH 1YPHC 3SNDA 3BTFE 2ODYB 1BTXA 1ANBA 2RG3A 2FI5E 2ZU1A 1GG6C 4GCHF 1TRYA 1SLXB 3A85A 2A7JA 2GCHG 2ZQ1A 3O8BA 2VWOA 3ZYEA 1ETRH 5A8XA 1C5VA 1ZGIA 2ANKH 3OY5U 1ZMLA 3QLPH 1MKWH 4KP0A 1L4DA 3FOAA 1BRUP 2P93A 4ZROA 1DSTA 3ATMA 2BQ7B 4ABFA 2BY6X 1UTNA 1J8AA 3MO6A 1GJ8B 5A0AE 1G3CA 5BRRE 2ZFFH 8GCHF 1P2NA 3R0FA 1XUKA 2BOKA 3GY8A 1GI9B 5EQSA 1TLDA 3S9AA 1AZ8A 1XXDA 4ZHMU 3G01A 4I8HA 3NZIA 1TNLA 1Z8RA 1XUGA 3A8DA 3ATIA 3BEUA 1O5DH 1QL8A 1PQ7A 4D76A 1XVMA 4THNH 1Z7KA 4PROA 3VB7A 1AZZA 1UO6A 3PM3A 2Z9KA 3GY4A 2OC1A 2P3FH 4JK6A 3DD2H 4FU9A 1GGDC 1NFXA 1C2DA 1AVWA 5T3HA 1C5NH 5TJXA 3ZZBA 1Y3WA 1WSSH 2GZ9A 2F9UA 4M7GA 2JJ2D 3BTGE 3SBKA 4RT0A 3A7VA 4ZKOU 1LVOA 5AFZH 1AKSA 2OTVA 2ILNA 1E37B 3SQHE 1BRBE 5AFYH 5HIZA 2UUYA 3KGPA 1Y3UA 5HYOA 3BG8A 1PQ5A 3SUEA 4MQAA 2V0BA 1EZSC 1ABIH 2THFB 2FP7B 2GJGA 5DP6A 3GICB 3EA8A 2QF5A 2BM2A 3SN8A 4A1TA 3RDZA 1C2IA 1Z8JB 4AFQA 4K1TA 1ZMJA 1QBNA 1WU1A 2HNTF 1SKYE 2QYIA 4X1RU 1V2KT 1QJ7B 3MOCA 1EAWA 3VFEA 3DCLA 3OTPA 5FBEA 1O5FH 2PGBB 1ANEA 1EJNA 1Y59T 3SGBE 3GCOA 2CMYA 1O2NA 5JYIA 2V3MA 4AB8A 1P09A 1NRRH 3MNSA 4B75A 1O3PB 2ZGCA 4O03A 3F0PA 3UR6A 4GUXA 5FPYA 4A1XA 3RUOA 4NSVA 1OP0A 4K8YA 1GCDA 3LU9B 3Q3XA 1ZOMA 1GVLA 2KCPA 2OBOA 4R8TB 2AHME 1ZPBA 2FOGA 2PTCE 2R0KA 4NIXA 5DO4H 3GY3A 1OWJA 5T6FA 3T29A 1AIXH 1T8OA 2LPRA 1FMGA 1NROH 2GD4B 1HAPH 2ZDKA 4O3TA 3HKIB 1P12E 5JBCS 5EOKA 3SUFA 2Z9JA 4QT8C 3JZ1B 1DXPA 3BSQA 3CNRA 3NPSA 1T8NA 4MNYA 4CRAA 1Z71A 4X2VA 3MWIU 5ETXA 4Q7YA 1V2WT 2SGQE 1D6RA 4CBOA 5GNDA 1ZPZA 1AD8H 3PV5A 1A5GH 1ZJDA 2DUCA 8ESTE 3E1XB 1IHTH 3VGCB 4D9RA 1MKXK 3BEIB 1K1PA 2VIOA 4Y79A 1TB6H 4CRCA 4GSOA 3V13A 1YCPM 2W7SA 1GMCG 5C17A 2ANWA 1MMJN 3MH4A 3ESTA 4Y8YA 2FOFA 4UFFH 2FYRA 2IOTA 3RM0H 2F9BH 4FXGH 3SJ9A 1OYTH 1S6FA 2ASUB 3O8DA 5EODA 5DP9A 1V2TT 4RKOB 1LKAA 1DPOA 5FX6A 3SO3A 4AFSA 3MYWA 2XC4A 1CGIE 3GISB 3TJVA 2JH5D 1SQOA 4HG6A 4WVPE 1GBTA 2ANYA 3LGUA 1G2MA 1LHFH 4BTIB 2QE7D 1IHSH 3MU5A 1KYNA 1O5GH 1CVWH 3RXVA 3KQDA 1WCZA 4ZMAH 3RXTA 2LNCA 1AU8A 1CHOF 3FZZA 2GZ8A 4OS4A 4BXSA 1RXPA 4IN2A 5SGAE 1FONA 1BTZA 5C0UA 4NZQA 2TBSA 2OXSA 3T28A 5A8ZA 3F2HA 2ALVA 1SB1H 3DSPA 2QXJA 5GXPA 1UVSH 1DY9A 1BRAA 2UWLA 1GI2A 1ETTH 2ZFSA 1VGCC 4DIIH 2AMDA 4E06H 4FUEA 2IJD1 4Q2KA 1GHBF 1WXRA 3D65E 3QZQA 2R2MB 2AIPA 3DSOA 1NESE 4RT1A 2WINI 1O3MA 1O2UA 3RC6A 3R3GB 1UHBB 2B5TB 1HYLA 5J4QA 2F9PA 1LPGB 1S6LA 3SJKA 4I31A 1V6DA 1GHWH 1C1NA 2HWLB 4B2CA 4TYDA 1GI1A 3TH2H 1LO6A 1C1SA 2A4GA 3PLKA 3SGQE 3RXPA 1EB1H 4CRFA 4MPUA 3RXRA 1CBWB 1WOFA 1EKBB 3ATKA 4WH8A 2F91A 4XDEA 2XC0A 4GCHG 2WUBA 1QHRB 1RFNA 5ESBA 3F0OA 5FPSA 2R3UA 4BNRA 1YP9A 3SOSA 4WMDA 1GDNA 1GGDB 1EB2A 1GBCA 1UVUH 1Y5BT 4OS6A 3ZZ3A 2ULLA 2Q6DA 1MTSA 1GHXH 2VNTA 3RLWH 1HAIH 4Z6AH 4X1PU 2FWWA 1K1LA 3VB4A 3SU0A 1INCA 1T32A 3PV4A 4OS7A 3WY8A 1G3DA 5E2PA 5HIYA 1OP2A 2Y7ZA 4MPWA 3LH3A 2ZFPH 1C9PA 3N7DA 2XXLA 1NY22 1GL1A 2VWMA 1ZRBA 1HLTH 1S81A 2ZI2H 3MU0A 4O97A 1LPKB 2J34A 1NFWA 3FZDA 1O2MA 2ZDAH 4X8SH 2GP9B 1A3EH 2BMGB 4E05H 3RXFA 1FN8A 3E6PH 4FUJA 4CHAC 2HLDD 3U1IB 4ZXXH 1A61H 3T27A 1C2EA 1A0LA 4ABHA 1ETSH 3QWCH 2G5VA 2ZKSA 2GDDA 3SQEE 3SJIA 1C5TA 1YPGH 2FMJA 2FX6A 2AS9A 1E34B 2HPPH 3P8GA 1TNKA 5E0GA 2WV5A 1O3EA 4OM9A 1TPOA 3ZVFA 1O3OA 1BTWA 2BDYA 1V2PT 3B8JA 2ZGXH 5C2ZA 3RXQA 2YOLA 1NC6A 2XNDD 4H6TA 9ESTA 4FUDA 1H9IE 2BXTH 3F2GA 2QF0A 2PP6A 3LH1A 3SORA 2ZHQH 2CN0H 1B0EA 4FU8A 1O2JA 4YOGA 1MTWA 3TGIE 1TNJA 4IC6A 4NIWA 2ODQA 1WQSA 1IQJA 1DOJA 1S0RA 1O3DA 4DCDA 2Z3CA 1QA0A 2FXRA 2ZO3H 3S7KB 3GY6A 1IQGA 1O3GA 1PPCE 1P02A 4Y11E 4CH2B 2JH0D 2XW9A 3SV6A 2FO9A 2VIPA 2SGEE 3M5OA 1RGQA 4ZCNA 4BAMB 1AO5A 1P0SH 1Z1IA 3KYFA 2BLQA 3RXSA 2BLVA 2A4QA 2PUQH 3LJOA 2F9OA 3ZZ7A 5AVDA 1D3PB 2ZECA 2H9EH 4X1QU 3UR9A 4F55A 1DY8A 1EAUA 2NU2E 1WDIA 1HUTH 1NT1A 3MH6A 1TMBH 8LPRA 3BTWE 4A6LA 4MNVA 1C5OH 1MD7A 1DICA 2XCFA 2PR3A 2BY9X 4H42U 1KDQB 2XNIA 4GAWA 1O3HA 1XUHA 5HGGA 1C2KA 1ZSKA 2XRCA 4X1SU 4INKA 1IQNA 1FXYA 2GT8A 2O9QA 1A5HA 3MU8A 1K1IA 1YLNA 3L3TA 1PPEE 3FKSD 1BDAA 1ELTA 1TX7A 2HNTE 1LVMA 3ATLA 1O2KA 2W7UA 1AVGH 1S82A 1KLIH 1VJAU 4X1NU 4DJZB 3AVZA 2TIOA 1TGTA 1EXFA 3BG4B 4AGJA 1H8DH 3RXLA 2ZFQH 1FY4A 4Q7XA 1HIAB 1PQ8A 3GCNA 4BAKB 1EAXA 3T62A 4MPXA 4Y7BA 3TIUA 2FOEA 3N7EA 2D1JA 1GDQA 2Y5HA 3FO8D 4F48B 3KEEA 2QCYA 2FPZA 1QB9A 1TBQH 3BG4C 4AG2A 2Z6BD 2GCTC 1ACBE 3SUDA 1OX1A 3NUMA 1HRTH 5E8EH 1TQ7B 3SNAA 2F43B 2F9VA 5F53A 1UTQA 4Y6DA 2KAIB 2WYJA 1AB9B 2FEQH 2PHBA 3A83A 1KXFA 1O3JA 1MTNC 1E36B 2UUFB 1G3EA 1Z8GA 3IWMA 3VGCC 5CDFE 4I32A 2JJ1D 1V3XA 2BLWA 2Y5GA 3ZZ4A 3STIA 1RIWB 4JZ1A 3MHWU 3WWBA 1DVAH 1BBRK 1EP5A 1HAOH 2CHAC 5CHAC 1TE0A 1A1RA 1BTHH 1C2LA 4OS1A 4R0IA 3ZIAD 3TJNA 1MTNB 4I8GA 2XWAA 2W6ID 1UTJA 2EA3A 5JBBS 1GHBG 2WV9A 3MH7A 4X6PA 4ISHH 1SOZA 4FUCA 1BQYA 2ZZUH 1K2I1 3SU2A 2TPIZ 5EU8A 3ITIA 2FS9A 5FXLA 2UWOA 1DWDH 3LGWA 4I8KA 3QDZB 1PJPA 3VEQB 3HGPA 1NM6A 4AB9A 5JB8S 2BYAX 1XUJA
chains in the Genus database with same CATH topology
1C1UH 4NIVA 2QAAA 3U69H 2BZAA 1SG8B 3H7OA 2B9LA 2VIWA 1A5IA 1UCYE 2FI4E 2GX4A 3LGIA 4KGAA 1EPTC 3QUMP 1J14A 2DE8A 3EA9A 3K6YA 2W3IA 4JYVH 4X6OA 1ELFA 5EXLA 1GI6A 3EAJA 1P3CA 2HALA 3I78A 2R9PA 2R0LA 1UHBA 3O8RA 1ABJH 2C90B 2ZFRH 1GJDB 5DP8A 1FQ3A 1FNIA 3U8TH 2J38A 3QO6A 1VCQA 1V2VT 1OWKA 3C27B 3IG6B 3CS7A 4YT6H 1QL7A 5LPRA 1GDUA 2QC2A 2A4RA 1JWTA 2JETC 1S0QA 1GI5A 2A7HA 3MNXA 1TYNA 3NXPA 4LOYH 4Y0ZE 1O34A 1FPHH 5A0BA 1NZQH 4HGCA 5FCKA 1C5YB 1TA2A 3A7YA 1MZAA 1W14U 2BY7X 4JMYA 3F9EA 1HJAB 3STJA 5ABWA 1LDTT 1GBLA 2Z9IA 1AFEH 2ZIQH 1BBRE 2ZNKH 1O31A 1QJ1B 2VWNA 4XBBA 2OC0A 1HXFH 1DUAA 1XM1A 1K1JA 1FIZA 3TGJE 1NU9A 3A8BA 3UPEA 3TGKE 4E7RG 3KQEA 1O2GH 4E7NA 1ELDE 1TA6A 3P8NA 1EASA 1LHEH 2GV7A 2SNVA 1GI8B 3B23B 2H6MA 4GVUA 1WQVH 2AEIH 2XBWA 3VXEH 3PLPA 4IN1A 2VVVA 1LKBA 4KTUA 3SHCH 1V2MT 4WMEA 3P6ZB 1SGCA 1JMOH 2W3KA 2XBXA 3QN7A 2ZDNA 1JIRA 3SNBA 2EI8A 1P10A 4XBDA 5F8ZA 1LTOA 1HIAA 3BIUH 1JRSA 2A2XH 1C1QA 1EQ9A 1RRKA 1C4U2 2ZEBA 1G36A 1FAKH 1GMCF 1PYTC 3P92A 1QA7A 3A80A 1DITH 4FUFA 4FUHA 1D6WA 3CP7A 1T8LA 1LMWB 1CSOE 1B7XB 2RA3A 4ZKRU 3E3TA 2ZTXA 4U2WA 1HNEE 2Z7FE 3ZVEA 4NA8A 1M9UA 3GOVB 4X8UH 2A32A 4NGAH 1MBQA 3F9FA 4FUIA 3TK9A 3MU4A 4I8LA 1UK4A 3A86A 1TBRH 2OBQA 4D7GA 1KXAA 3SV8A 3ZVDA 1DXWA 1GBMA 3RXKA 1A3BH 3RXOA 1GG6B 6ESTA 1PPZA 2VWLA 2OCVB 3UOUA 1GBJA 3KL6A 1SMFE 1MD8A 1EOLA 4SGBE 1WYKA 3P95A 2ZPQA 5DG6A 1O3AA 1BUIA 1YPKH 2RA0A 2GT7A 2VH6A 3CENA 4BTTB 1E35B 3OSYA 1ESAA 2Z94A 1GCTC 4Y0YE 2J92A 3VB5A 5K7RA 2Z3DA 2XBYA 1BMLA 2BXUH 2H5DA 1P11E 2BX3A 3U9AH 1GJBB 3PTBA 5DP4A 1L1NA 3RP2A 4D8NA 3S9CA 3A89A 2Z9GA 4AGKA 3E0NB 3RXHA 2K1QA 3M3SA 2ZGJA 2WPMS 3KN2A 3QGNB 1TGSZ 1NPMA 2FDAA 4OS5A 1THSH 1QY6A 1V2QT 4LZ4B 1L1GA 3T26A 4X8VH 3LGYA 3PMAB 1GI0A 1O39A 2P95A 3TK5A 1HDTH 5HXFA 3RMOH 9LPRA 2BY5X 5DGJA 1A2CH 2PKAB 3KCGH 3MMGA 1FY1A 1SQTA 2VINA 3RC5A 2G8TA 2H1UA 1Z6EA 1W11U 1WBGB 3Q3KA 1BOQA 3ZZ5A 1NRSH 2ZHWH 4NG9H 3LKWA 1CGJE 4Q7ZA 1C5MD 1RJXB 1T4UH 4AZ2B 2ZHEH 1SI5H 4YO9A 1GJ9B 2GVFA 1TPSA 2J9NA 1P04A 2ZPRA 3SJ8A 1CGHA 4O9VA 4BAOB 2GCTB 5IYTA 1HFDA 5GIBA 5C20A 1FUJA 2J4IA 4GHTA 1MBMA 2A31A 2GV6A 2CGAA 1HJAC 4WXVA 4YESB 1CHGA 4DG4A 4BANB 2ZDLA 1ZSJA 1SGNE 3RXJA 1D9IA 1RIWC 1GI4A 1FDPA 2GMTB 1DANH 3H5CB 2QF3A 1O2TA 5FBIA 1GHZA 1K1OA 2EI6A 3NCLA 3M61U 3S69A 3E90B 2BVXH 3F1SB 1DX5M 1QR3E 4UFGH 4ABIA 4CRBA 1O36A 5HM2A 1AI8H 1TIOA 5FCRA 3BTQE 2AMQA 1GBDA 1ZHRA 2BD8A 1KXBA 5FHTA 1EPTB 1JBUH 1BTUA 1UTOA 3NKKA 2ZCHP 5EPYA 3RXEA 3RXAA 1TPPA 1O3IA 1GBAA 1W7GH 2WPJS 1FJSA 2BDGA 3QX5H 3M3TA 4K69A 2TGAA 5DPAA 5T6GA 1ZPCA 4ISNA 2QXHA 1TQ0B 1YKTA 4ZKNU 2ZF0H 1EX3A 3TJOA 1OWDA 4YLQH 1ARBA 3F68H 1EPTA 1G30B 1CA0C 1QIXB 2HVXA 1HCGA 1P2IA 1C1MA 4BTUB 1W0YH 1AVXA 1LQDB 2V3OH 2CF8H 2GMTC 1F5RA 2NU1E 1TRNA 1V2OT 3M5MA 1CT4E 1QTFA 2NU3E 1HB0B 4UE7H 2O8LA 4UONA 4U30A 1SGRE 1HPGA 4AX9H 2HGTH 2B0FA 2BZ6H 2VU8E 1VZQH 1OKXA 2P59A 1A4WH 4X8TH 6CHAB 1F5LA 2OQUA 1Q31A 4DURA 4XFQA 1SC8U 3M35A 1IOEA 1BJVA 4BAHB 4MPVA 3K6ZA 1G37A 1HV7A 1GJ4H 3SI4H 1O3CA 4AG1A 5EXNA 1PPHE 3RM2H 1LHGH 7GCHG 1GBHA 3TK6A 4NIYA 5EQRA 1EP6A 4IS5A 1GBBA 2UUKB 3UWIA 4ABEA 5EG4A 1P2MA 3MO9A 3A87A 1EZXC 4IMQA 3GCHB 4K3JA 1T31A 3BN9A 1GL0E 4Q80A 4CR5A 1OXGA 1O5CB 4UFDH 3BTKE 3DUXH 3TJUA 1TONA 1Y5AT 1S84A 5I46H 3NWUA 4CRDA 1HGTH 3B9FH 3I29A 3ZVGA 2H2ZA 1DUEA 1MU6B 2F3CE 1C1RA 3O8CA 1YLDA 3SU4A 5F03A 1ZRKA 3MH5A 3L6PA 5DKMA 4B74A 1OYQA 1SGTA 1QRZA 1SR5C 3C1KA 5HMAA 3M7UA 1O38A 5C5NA 1NO9H 6CHAC 1CT2E 3RXUA 2FLBH 4K5ZA 4B1TA 4JCNA 1P06A 2EC9H 4UDWH 1IQIA 1C1OA 2QXIA 3U8RH 4KKDA 4XBCA 1G3BA 3E16B 5CMXH 5FAHA 4K2YA 1ZZZA 1HAYB 1UVPA 3L33A 1NFYA 1W2KH 1HXEH 1O3LA 4UD9H 2QIQA 2B7DH 3KQCA 1Y5UT 3A81A 1D3DB 1GVZA 3Q77A 3MTYA 1W12U 1SOTA 5JDUB 1LQEA 5GCHG 5E2OA 1E0FD 4YM9A 1MCVA 4JZFH 5A8YA 1UTKA 1ID5H 1SPJA 1ZYOA 4ESTE 3PMHB 1HAVB 1ELCA 2G4TA 1OWHA 1TNIA 1W3CA 1GMHG 1Y8TA 4B2AA 1MAXA 1GBEA 3BV9B 4XE4A 2OC7A 2V6NA 2ZFTA 4YTAA 1GCTB 3HGNA 1TX8A 4F49A 2GZ7A 2VVUA 1LVBA 1FPCH 4ZH8A 5LPFA 4WJG2 3FP7E 1J17T 3U98H 2R3YA 1HAHH 4UFEH 1SGFA 3RLYH 2ZDVH 1GJ5H 3PROA 2VH0A 2WPKS 4YOJA 2KAIA 4ABDA 4INHA 3SV2H 2W5EA 1CO7E 2GCHF 3MO3A 4Z0KA 3SV7A 2FYQA 3AW0A 2BHGA 2O8MA 1J16A 1JRTA 1RD3B 4JZIA 4MNWA 4WMFA 1C2MA 1WTHD 2BVSH 4SGAE 2VJ1A 3MNBA 4AN7A 3UUZA 3SGAE 1QBOA 1SLWB 5EW1H 1TOCB 3P70B 1QB1A 1MKXH 3PB1E 3V12A 1XMNB 3E0PB 4I33A 3A7XA 1ESBA 2H9HA 2SGAA 2G55A 2F9NA 4HI3A 4HZHA 1P2JA 3URDA 1GHAG 2BD3A 3SV9A 2Q6FA 4GPGA 3ZZDA 5TCAA 3EYDA 3RXBA 1DFPA 1PQAA 3BIVH 1RTLA 2C8ZB 2ESTE 5A2MH 2C4FH 1UVTH 3FAOA 2WUCA 3AAUA 4AYYB 3SNEA 4TY7A 1O2LA 5A09A 1TNHA 3QK1A 1S6HA 1AB9C 3U1JB 1F7ZA 3HPTB 1O5BB 3EA7A 3N7OA 1P3EA 2SGPE 2WV4A 2BX4A 4J2YB 5C1UA 1YPLH 1H8IH 3F9HA 1EJMA 1OWEA 1NRQH 1Y3VA 2BD4A 3BF6H 3SU1A 2ZHFH 5FX5A 3H7TA 3TVJB 3HK3B 1SGPE 1DLKB 1YGCH 1RTKA 4MTBA 4I8JA 2CJIA 2TGPZ 4ISLA 1D3TB 1RS0A 5PTPA 1O35A 1OWIA 1THRH 7GCHF 3LDXH 1EJAA 2AYWA 3OYPA 1F0SA 1WUNH 3M7QA 1UJ1A 4AFUA 2BY8X 2P3TB 4ZXYH 4RSPA 1CHOG 1BMAA 2ZP0H 3AASA 5DP3A 1DDJA 2YNBA 1AFQC 1IAUA 4AFZA 2C8WB 4NA7A 1LHCH 1KLJH 2PTNA 2FLRH 3GYLB 2RDLA 5JB9S 2PKSC 3AAVA 3EGKH 2OUAA 4TPYA 1HAGE 2B8OH 3ZVCA 4X6MA 3ZZ8A 1C5WB 1C1VH 3W95A 3A88A 1WV7H 1L4ZA 1AKSB 2OINA 3E8LA 1RTFB 1AFQB 2BD9A 3FANA 4A7IB 1TALA 1DSUA 1O37A 3DT0H 2HOBA 1XKAC 1CBWC 1GBIA 2P3UB 1BTYA 1T4VH 3OY6U 5CE1A 1X7AC 2PW8H 4FVDA 1MQ6A 3SJOA 4GLYA 4DOQA 2FTMA 2Z3EA 5E0JA 2FODA 2ZA5A 1O2XA 1TOMH 4KTCA 2OC8A 4UEHH 3UWJH 1DWEH 2A2QH 5EPNA 3A82A 4LXBH 1W13U 2NWNA 7KMEH 1UTPA 1YPHE 1BHXF 2OP9A 2A5IA 3MFJA 1SGDE 4RKJB 2CF9H 1EATA 3AW1A 1KDQA 4MLFB 4BXWA 1GMHF 3D49H 5DJ7A 4JZDH 4A92A 3Q3YA 4OS2A 1GHVH 1CA0B 1BJUA 4B76A 1UTMA 2ALPA 2PUXB 3QTOH 4TY6A 1A0JA 1KXCA 3FFGA 1NTPA 3ATWA 2GDEH 5EW2H 4DT7B 1ZTLA 7ESTE 1MZDA 1YCPK 1MKWK 1YF4A 1A46H 4WF8A 1TWXB 1HJ9A 2ZTYA 5F8XA 5LH8A 1BTPA 2AIQA 2SFAA 2V35A 2EEKA 3UY9A 1BT7A 1SFIA 3SU5A 1VITG 4MDSA 1JXPA 3M5LA 3GDSA 1TNGA 3F6UH 2QV1A 1AHTH 3M7TA 2G52A 1QJ6B 1N6YA 2AH4X 2J94A 3K2UA 2ZG0H 3LC3A 5AF9H 2HNTC 5GJ4B 5F8TA 3T25A 1SGQE 2R2WU 3HK6B 1GMDF 2NU0E 1AGJA 5L6NH 5IDKA 5K0HA 4AORA 1ZGVA 5EGMA 6GCHF 3FP6E 4IBLH 1O2PA 1VR1H 1O0DH 2G81E 3A7WA 3ODDA 1C5ZB 1D3QB 1GBKA 4Y71A 6LPRA 3TNSA 4F4OC 4MNXA 3QGJA 3LOXA 1CQQA 2STAE 1C1TA 4B71A 1N8OC 1OOKB 1F2SE 1YPJH 4TWYA 2BDAA 2FTLE 2O8UA 1GPZA 2G4UA 2UWPA 4LK4A 2P8OB 3SU6A 1BZXE 1TABE 4MG3A 3ZZCA 2AMPA 2BOHB 1BITA 2FOHA 1ZJKA 2VIVA 2BDIA 3TITA 1SL3A 1TGCA 4K60A 3UOPA 5L2ZH 2PKAA 3M3VA 2FESH 2BB4A 4TPIZ 1ELGA 1ZHMA 3A8AA 4IC5A 1HAVA 2HRVA 2V3HH 3P17H 1EAIA 1BHXB 3I77A 2Y82A 3S7HB 2ZU3A 1FV9A 2Z9LA 4X2YA 3EDXB 4ABJA 1OP8A 1KLTA 1SGIB 1SQAA 3RC4A 3RMNH 1UCYK 2BD5A 1C5XB 1AE5A 3SUGA 3MNCA 2ZU2A 1N6XA 4IGDA 2AGEX 1ARCA 2FM2A 4K1EA 4Y10E 1GJAB 2GKVE 5C3NA 1O2SA 2A7CA 1C1PA 2AGIX 1VITF 2I6SA 1JOUB 3U8OH 3LIWA 1P57B 1K1MA 3UQVA 1TAWA 1O2YA 1P2QA 4ASHA 4IW4E 1N8OB 1HAZB 1O33A 4D9QA 3K65B 2OLGA 1HBTH 1QRWA 2O8WA 4Y8XA 3BTME 1PPFE 2ODPA 2QA9E 1CA8B 1DE7H 3TH3H 5BPEA 3VPKA 3A84A 3GYMA 3MU1A 5EXMA 2CHAB 3A8CA 2J2UA 3QZRA 1S83A 4FVBA 4IMZA 1QGFA 1ELBA 1LPZB 4HTCH 2STBE 2GGVB 3BEFB 1C9TA 1KTSB 2ZWLH 2AGGX 1F92A 7LPRA 1SFQB 3SW2B 4ZUHA 3UREA 1UCYH 2DE9A 1EUFA 5L2YH 3FP8E 5C1YA 1MTUA 4JK5A 1P9UA 2AFQB 3UFAA 1BB0B 2AERH 2BDCA 2TGTA 1TFXA 1TRMA 3SI3H 1KXDA 2G5NA 1KXEA 5T6DA 1THPB 3M5NA 2FIRH 2D2DA 3LJJA 2IPHA 1TX6A 4YLUA 1EZUC 1SVPA 4INLA 1DT2A 2C93B 4X2WA 3MI4A 3KNXA 1J15A 1DWBH 1LVYA 3LPRA 1O2WA 4VGCC 1IQEA 3ZYDA 4A5TS 5I25A 1MAYA 4X6NA 1L0ZA 5JBTA 3EE0B 1KSNA 1O2RA 1LHDH 1TMUH 5DP7A 3GDUA 3OTJE 1YPMH 1H1BA 1P03A 1W8BH 1SLVB 3KIDU 3BTDE 4FUBA 1IQKA 3OU0A 1FY5A 1G32B 3V7TA 1VITH 1C2GA 1W0ZU 3D23A 4BAQB 4VGCB 2FOMB 1TGNA 5J4SA 1SSXA 1ELEE 1SLUB 2A1DB 2JH6D 4YZUA 3DFJA 3ZVBA 3RXCA 1O2ZA 5DK1A 4ABGA 3D62A 5A0CA 4WXIA 3S9BA 2IN2A 4FUGA 4CH8B 4KTSA 3SHAH 1GHAF 2EI7A 1MQ5A 3ZZ9A 4XSKU 5HM9A 1IQMA 5B6OA 1HJ8A 1C4Y2 1AY6H 1ZSLA 2XC5A 1KIGH 4XOJA 1MU8B 4CR9A 1O2VA 1KTTB 1Z8IB 2ZHDA 4B2BA 1GJCB 3RXIA 3GCTF