1LWFA

Crystal structure of a mutant hiv-1 reverse transcriptase (rtmq+m184v: m41l/d67n/k70r/m184v/t215y) in complex with nevirapine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwfA05
1WAFA 2F8TA 4RW7B 3RRGA 1U49A 1TV6A 3NGYA 2QKBA 1BQNA 3BGRB 2BGGA 1JKHA 2FLPA 1LWEA 2B5JA 4CHNA 4E7KA 4O3PA 2W9CB 3B6OA 4IG3A 4FLXA 4DEZA 4BACA 5KI6A 1JLAB 4IG0B 4FJGA 1KHWA 2ITGA 4WE1A 3RR8A 1CXQA 4B9TA 4AHCA 1RT7B 5FDLB 3PV8A 2V0NA 3QGIA 1ZBFA 4KAIA 4HCCA 5J2MB 4FJ8A 2HHTA 1C0MA 4GVMA 1RTJA 1HQEA 1VSHA 1KFDA 4JRPA 4NLPA 1S1VB 1EX4A 3I5BA 3S3NA 4ZPBA 1JKHB 1BI4B 4K8XA 1JXEA 4F4YA 4NLWA 1K1QA 2B5JB 4YQWA 5HRSA 1VSIA 1QHTA 1VRTA 4W5RA 3TAEA 5L1IA 3CVKA 4W5QA 2BR0A 1HYSB 3U6FA 4NCAA 3DI6B 4DTPA 3OY9A 4DL3A 5DK5A 5FRNA 3MEGB 2HWIA 4J9RA 5HROA 3BSCA 3QIPB 3H2LA 4B9NA 5F8GA 1JIHA 4E0DA 4CF2A 1RT3A 1REVA 5HBMA 1HQEB 4DL5A 1S6QA 4GMJB 4KB0A 4J9PA 1S48A 2YKMB 2X6NA 3MXMA 2C28A 4M3XA 1NKEA 1QSLA 3KK2B 5KFMA 3I5CA 3ITHB 1L3VA 2D7SA 3EY1A 3G6YA 1MU2A 4GC6A 2DPIA 3WNEA 2ZE2A 1T03B 1S1XA 4WXOA 2JEJA 1ASUA 3HP9A 1S1UB 5KFRA 2A1RA 4K4WA 3FFIA 4KB7A 1N5YA 3GILA 2BE2B 4TQRA 2HMIA 2HHVA 1EP4A 3GV5B 5HBMB 1S6QB 3H5UA 1WNSA 3SPZA 4KV8A 2D41A 1ZETA 1I6JA 4FJIA 2B43A 4TLRA 1RA7A 3KK3A 1S4FA 2J6UA 5EWFA 2VG6B 1NNDA 1TL1A 2VG5B 3KNAA 2RN2A 4QW8A 3K5MA 1CXUA 1QAIA 4I2QB 1CLQA 2YKNA 1ZTTA 1QTMA 3T19A 4NRUA 3PW0A 4J2DA 4CCHA 3LAKA 3VQPA 4KHUA 4O4GA 3EZ5A 2W9BA 1UAXA 4M3RA 2IBKA 2FBYA 1RDCA 3AA5X 3V81B 4M3WA 1XHZA 4IH5A 3CDUA 4BWMA 2FBXA 4BE1A 1WSFA 1DTQA 4RW8B 4ELUA 3RWUA 5KT2A 4LQ3A 1HJRA 1SL2A 2EX3A 2R2RA 3B6PA 3S3OA 1U4BA 2BDPA 3V1QA 3T5LA 5KFKA 3JSMB 5JS1A 2IA6A 4J9NA 4RUAA 5KG4A 3GQCA 3IG1B 2XC9A 1J54A 2J6SA 2E4LA 3DLEA 3TARA 4ECXA 1TL3A 3G6XA 3UIQA 3DOKA 4N5SA 3SNNA 2W9BB 2VWJA 1KLMA 1QAJA 4I2PA 1TKXB 3LP2A 4TSXA 1XHXA 4Y1CA 3PO5A 3BQ1A 3CYMA 3MEEB 5KFCA 1Z4UA 1VSKA 4K8ZA 1CSJA 4CK3A 1J5OB 4MK9A 4XPEA 1FKPB 5F8JA 4XPCA 5HLFB 4DF4A 4O5BA 5D3GB 3DMJB 2ZKUA 1X9WA 1FK9A 4KTZA 1ZYQA 4DS4A 3MEDB 2IC3A 1D1UA 4WFZA 2DTUA 4IRKA 4NLTA 3CO9A 5DQHA 3RB3A 4GC7A 1RT5B 1VRUA 4YR0A 3ULDA 3NFAA 5I42A 3KLGB 5KFVA 4FCYA 3PHEA 2AJQA 1Q9YA 1NKBA 4Z0UA 2P5GA 4CEAA 2OYQA 1LWCA 3SJJA 3MFHA 1TKDA 2FJWA 1JL2A 4FJXA 4AHSA 5KFFA 1L5UA 2AU0A 3VN5A 3HXMA 4CJSA 3MR3A 2FJXA 3OHBA 3DRSB 3AO1A 4CK1A 3MECA 4O44A 4ZVEA 1SUQB 1WAJA 1DTTB 4PQUB 4ECTA 4DFMA 4J9LA 3DRPA 1L3TA 3NMAA 4CF0A 4B8CA 4Z4GA 4LSNA 1RCHA 4MKBA 3DLBA 1RTHB 2WOMA 1R0AA 3HVTA 2R8KA 4ECSA 4FLUA 1HMVA 1NK6A 3FRZA 4ECUA 2C2DA 3D45A 2OZMA 3CFOA 3QO9B 3GIKA 3I8DA 4ELVA 4DG1A 4CEZA 1J9AA 2O4GA 4FLYA 4E7LA 2XHBA 3QNOA 2WK4A 4NYNA 1N48A 3TI0A 4L8RB 5F8LA 4CIGA 1NK4A 4E1NA 4UQGA 3I0RB 2B4JA 2HHXA 3ALYA 3CDWA 4LSNB 4KFBA 2B6AA 4RW4A 2WOMB 4ZHRB 1RDAA 1RA6A 5HRNA 1B9FA 4NLGA 2R8GA 2JGUA 4PWDA 2I5JA 3EPIA 1HNIA 3V9UA 4PUOB 5J1EB 2V4RA 2PYJA 4CK2A 2PY5A 4DG1B 4KREA 1IKXB 1RTDA 1S9GB 3CG7A 3RRHA 3SQ2A 1LV5A 2HNZB 4DFPA 1S6PB 4IFVB 3PW2A 3H4BA 4ZVGA 3SYZA 1NJZA 4QWCA 4F4ZA 2F8SA 4KFBB 1S9EB 1C0UB 4J9MA 2R2TA 1KRPA 3H5SA 3U3YA 4DFKA 4FJHA 2I5JB 1S0OA 3O3HA 2W7OA 2WONA 3KK1A 1HPZB 4F3OA 5J2NA 1SKWA 3KHRA 3K2PA 4K4SA 1RT6A 1T05A 4O0JA 3SI8A 2BQRA 1HARA 3UPFA 4IDKB 4NYZA 1KLNA 3PUFA 4CECA 2JEGA 3T5KA 4EBCA 5EDWA 4OJRA 3I5AA 4IQXA 5C42B 1S1WB 2Q3SA 4B3OA 3VQ5A 2AWZA 4O4RA 3AVLA 2C2RA 5K14B 1SV5B 4FBUA 1QUVA 2IS3A 3HL8A 3M8QB 3LP3A 2CJQA 1C1AA 2BRKA 2XY5A 3AVGA 2OPQA 3GIJA 3I0SA 4KHWA 3KHLA 2J6TA 4CGJA 4J9KA 4FJ5A 3VQ9A 3OYIA 4U7CA 1GX6A 4CHQA 4X2BA 3VA0A 3IAYA 4TXSA 4JLHA 1SH3A 3N6MA 3C6TA 1J53A 1YTUA 1W0HA 1C0TB 1TKTB 3OYDA 4F8RA 4FBTA 4O3RA 3WNFA 5L1KA 2VG7B 3ASMA 2X74A 3BREA 2PYLA 4WYWA 4NLOA 1WNEA 2XY7A 1TVRA 1SKRA 2WTFA 5J2PA 4O0IA 4QCLA 2PZSA 5C24B 1LAWA 3OYAA 4KAZA 3VQCA 2GIRA 1RT1B 4W5TA 4FS2A 4RW7A 1GOCA 2XCPA 3LP0B 1KTQA 3QESA 3BGRA 4DSKA 5KT7A 2EHGA 3K57A 1VSLA 2ASLA 3MR5A 4MIAA 3QEVA 3VQEA 3KJVA 2W9CA 3PJWA 1F21A 2YNHB 1JLAA 4IG0A 2E9ZA 5SZTA 1D8YA 3PR5B 3OS0A 2RDJA 5KFUA 4CJEA 5KRTA 5I3UB 4MK8A 4ZVHA 4FLTA 3UQSA 1RT7A 5FDLA 4EO8A 3RAXA 4ED0A 4EEYA 2BQ3A 1EXQA 5J2MA 3NH0A 3QEWA 2WRMA 4KHQA 3V9ZA 1S1TB 3RMAA 1S1VA 4H54A 4OPKA 2DPJA 3NGZA 4IH6A 2KQ2A 5KFXA 3RB4A 1BI4A 4BE2A 3PW7A 4CEDA 1ZBHA 2X78A 4E89A 4LH5A 2G8FA 3LP1B 1WSJA 3KJVB 2W8LA 1IKYB 3PX4A 4B9SA 4MK7A 1HYSA 4FJMA 4MFBB 4KTQA 2HHUA 3DI6A 1QSYA 4RNHA 1Z25A 3MEGA 1SKSA 3EZUA 1RBUA 4QAGA 3ZCMA 3QIPA 3RMDA 2ILYA 3HPHA 1N56A 4CGDA 3H5XA 3OYHA 2BRLA 2YKMA 2IM1A 4KO0B 4CFDA 1XR5A 3M8PB 4M95A 3HSTB 5KT4A 3KK2A 3HPOA 1TQLA 4KPYA 1BCOA 4CJLA 4DU1A 3HO1A 4C8LA 3ITHA 3A2FA 1A5WA 4RW6B 4Q43A 1B9DA 4CEBA 2FLLA 4IFYB 1BCMA 1T03A 3CJ0A 3RMCA 4W5OA 3OYMA 5KT3A 4FZYA 1S1UA 2D0AA 4IKFA 2LSNA 3CJ4A 3V6JA 3PX0A 5SWMA 3KLEB 4DSJA 4WZQA 2XO7A 3SFUA 3KMSA 3M8RA 1NJYA 2BE2A 2YHAA 4BDYA 1IO2A 4DQQA 2G8KA 4M41A 1Z26A 2YNIA 4DTXA 4OLAA 1JLCB 5EWEA 3D0PA 1XC9A 3BJYA 4FM0A 4JUZA 1D0EA 1NKCA 3V9XA 3TAMB 2VG6A 4KHMA 2VG5A 4N76A 5KG1A 3OL7A 2RF2B 4IH7A 4I2QA 3MTKA 1WSIA 2OPSB 3HK2A 4DLEA 1NK8A 4FVMA 4N41A 1VSFA 3C6UB 5F9NA 3NF9A 4DQSA 1VSEA 2ZD1B 4BDZA 2KW4A 4RZRA 3HM9A 3BR9A 2W8KA 4HTUA 3V81A 4Y1DA 3Q8RB 4E19A 2QXFA 1IG9A 3RBEA 4H4OB 1QSSA 1TAQA 4I7FB 5CZ1A 2YNIB 4HCBA 1S9FA 1C1CB 3T5JA 4RW8A 3M8SA 4FLZA 1T8EA 3D5MA 4HVJA 5KFNA 4CJQA 1RT2B 3JSMA 3S3MA 4EZ9A 1NHVA 4EZ6A 2KZMA 1IKVB 3IG1A 1KCFA 1UOCA 1TKZB 3FDSA 5KFGA 1EETA 3GV7B 1HYVA 3NGDA 1A5XA 1CZ9A 4CFBA 2HHSA 3CJ5A 4DWIA 4AHTA 4FLWA 4E7JA 1K1SA 2WCXA 1LW2B 5JUMA 1XR6A 5DQGA 3OSPA 4Q44A 1TKXA 1RTIB 4JS4A 4BDPA 1S5JA 3OHAA 2AQ4A 3TAPA 1T7PA 4ZP9A 2E9TA 3MEEA 4NLSA 3CWJA 1BL3A 2GV9A 1YVUA 5J2QB 4KSEB 3TR8A 1J5OA 3Q8SB 2Y1IA 3LPUA 2G8VA 1VSJA 1FKPA 3ZSRA 1D9FA 5HLFA 2IAJB 3PR4A 5D3GA 3HPGA 3DMJA 1CZBA 4EYHB 3MEDA 4H4MA 1BHLA 3ZT1A 3QYYA 5KFBA 3LDSA 3NBPB 4B08A 5C25B 1EETB 3OS1A 3TABA 3BSAA 1RT5A 3HKWA 4YFUA 4LSLB 3TAGA 3NL0A 4CGGA 3S9HA 1RBRA 4MKAA 3KLGA 5HRRA 1IH7A 5KG2A 4FJKA 2UUWA 2G8HA 4B9VA 2WB4A 3V6KA 3DRSA 3T1AA 3THVA 3LAMA 3QERA 3P1GA 1SUQA 2HAIA 1DTTA 3OSNA 4E3SA 4PQUA 2VA2A 3VQBA 5EWGA 4OVLA 2W7PA 1ZTWA 4H4MB 4KKOB 2HNDB 2HNYB 1HRHA 3JYTB 4OL8A 4TYAA 1ASWA 4B9UA 4MIBA 4WYLA 4OGEA 1RTHA 4MQ3A 3SCXA 2AGQA 3CM5A 3L8BA 3DOLB 3H5YA 3MXJA 4NYFA 4CJPA 4C8MA 1GX5A 2XGPA 1LAVA 3P5JA 3ZSOA 1W9HA 4Z4EA 3NAIA 2R8HA 4RW9A 2AX0A 4TY8A 1YTAA 4CJ4A 2I1RA 3QETA 4NZ0A 5F9LA 3DRRB 3P83D 3L2QA 3CFPA 3QO9A 1GOBA 2FJVA 1RILA 3NF7A 4JS5A 4Y2AA 3QZ7A 3UDLA 3VQDA 4F3TA 4XIUA 5KFAA 3HVWA 4RNMA 4NLXA 3I0RA 1JLBB 3SV4A 4F4XA 3QGHA 4Z4IA 1FKOA 4H8KA 4ELTA 4KI4A 1KSPA 4ZHRA 3KLHB 5KG3A 3DM2B 2D5RA 4ICLB 4DTMA 4ZPAA 2UVVA 4RW9B 1U48A 5KG6A 4TY8B 4PUOA 3DLRA 5J1EA 3K5LA 3H98A 3QLHB 3NE6A 4CJ5A 3TWHA 1IKXA 4QWBA 3L3VA 1S9GA 2HNZA 5F8HA 4KI6A 4DMNA 4C8OA 2IM3A 1S6PA 4IFVA 3FSIA 3WNHA 1RBVA 4CF9A 3DLHA 4M3TA 3OVNA 2KZZA 4ECZA 1FKOB 1S9EA 1B92A 1C0UA 3HT3A 3DLGB 2G8UA 3ZT3A 4CJRA 1RAJA 2DFFA 2BANB 2GIQA 4CIFA 5KFYA 3KD5E 2R2SA 3OYCA 2RPIA 4CJVA 5KFJA 3DDKA 4FJ9A 3OYBA 1C6VA 1HPZA 2IM2A 4EP5A 3PZPA 2G8IA 2YNFB 3MR2A 1HYZA 4Z4HA 3KLVA 4PA1A 3OYLA 5T14A 4N56A 1JLGB 1HQUB 4IDKA 1NJXA 1RT4B 5KG0A 4AHUA 1X9SA 1UWBB 3NF8A 4J2EA 4DTNA 4NLVA 3KD1E 3EYZA 1NK0A 4TN2A 4NCBA 4RNFA 5DG9A 3SV3A 4J9SA 3IS9B 5C42A 1S1WA 3IN5A 4DTSA 1RNHA 3FQKA 1IKWB 2C2EA 4LQ9A 3SQ0A 1LW0B 2IDOA 2IJFA 1C1BA 5K14A 4CHYA 1SV5A 3NDKA 3M8QA 2FVPA 1D9DA 3KIOA 3DLKB 3AVAA 3V6DB 4YR3A 1LWFB 2OA8A 2P1JA 3OLBA 2X6SA 3ISNC 5HRPA 3SI6A 3QEXA 2AGPA 4CHPA 3PO4A 4AILC 5CYQB 1BISA 4CIEA 1C0TA 1TKTA 3VQ7A 3LWMA 4CGFA 2HW3A 3NAEA 4R0EA 3IRXB 4E7IA 2VG7A 1N6QA 2QKKA 3SUNA 1C1BB 1U47A 3G0ZA 4J2BA 4E1MA 1XI1A 5L9XA 4ZTJA 4F2SA 3AO4A 4OKJA 1QE1B 3VQAA 2R8IA 5C24A 1HNVB 1VK0A 4CJ3A 1RT1A 3GV8B 4OGCA 4DF8A 3LP0A 3EPGA 3AA3A 4R5PB 4FJLA 5F8IA 5DLGA 1TGOA 4FK2A 3NKYA 3QZ8A 2OPRB 4QPXA 4O3QA 4CHZA 4FM1A 5KTQA 2YNHA 5CYMB 3SQ4A 1N6QB 3PJXA 3BQ0A 5CZ2A 3K59A 2O4IA 4DQPA 5DMRA 5I3UA 2EC0A 1RYSA 2V9WA 4DU3A 3DYAB 3PX6A 2XGQA 4DL2A 3RB0A 2D0CA 4R8UB 2XCAA 3SUQA 1S1TA 1KVAA 3M9OB 1XR7A 4Q45A 1KVBA 5C5JA 2QE5A 1JLFB 3ZSYA 4Q5VA 2OH2A 4DQIA 3SUPA 3VQ6A 3IGNA 3LP1A 4CESA 3OYJA 4DTJA 1IKYA 4ED7A 1X1PA 1JLEB 4MFBA 4K4ZA 1DLOB 4IR9A 4CFAA 1TK0A 2RDIA 4ID5B 3ZSZA 3KLIB 3NCIA 3UR0A 4EO6A 5KRSA 4FK4A 1EKEA 3BDPA 1L3SA 1I39A 4URSA 2ATLA 3OJUA 4Z4FA 3CDEA 4DTRA 1JLQB 3AO2A 2F8EX 3AVBA 5L1LA 4KO0A 2IOCA 2OPPA 3G86A 4DTUA 1S49A 3K58A 3M8PA 4F50A 4IRCA 4C8KA 4FZXC 3AVMA 1RYRA 4RW6A 4Q0BB 4ZMMA 3V4IB 5KG7A 2UVRA 4DL4A 2IGIA 4IFYA 1YT3A 5JXSA 2GBZA 2FLNA 4MH8A 1WSEA 3OLAA 2D0BA 3HJFA 4ZPDA 3KLEA 2Y1JA 3OYKA 3BSOA 3V1RA 3PW5A 3T3FA 2UVUA 1TP7A 1IM4A 4FLVA 5HP1A 4ZVFA 4U6PA 5DG7A 1S0NA 3K5NA 3SQ1A 3KLFA 4CEEA 1JLCA 2OPPB 3IGVA 4B8AB 2ZQBA 3TAMA 3AVNA 2FVQA 4ECVA 4QWEA 2JLEA 4ED1A 4KE5A 1ASVA 4RNNA 2ILZA 4N47A 2RF2A 1T3NA 1TV6B 3ZT0A 3KHHA 2OPSA 5KFEA 3SFGA 1BQNB 4CHOA 3OYFA 3RBDA 3C6UA 3LALA 3NHGA 1Q9XA 4M94A 1LWEB 5JS2A 3SPYA 2ZD1A 4ZP8A 4JV0A 3OL9A 4IOBA 1RDRA 2AX1A 3HHKA 4IG3B 4DU4A 5HP1B 3OL6A 4ED8A 2FBVA 4FJNA 3L2WA 4F2RA 4H4OA 3KLFB 1G15A 4I7FA 4WE1B 1C1CA 3G10A 1W25A 1SH2A 1UA1A 1A5VA 4TQSA 1RT2A 2R2UA 4EBDA 1RTJB 3CFRA 1IKVA 2HVHA 2KFZA 3O4NA 4CJKA 1TKZA 3OJSA 4AHRA 1NJWA 3OYEA 3AA2A 4CGHA 1RBTA 3WNGA 5KFWA 1LW2A 1SH0A 3L2VA 2FBTA 4FJ7A 2BQUA 4M45A 4K4VA 1VRTB 2E6LA 1RTIA 1L3UA 3D28A 2F96A 4Y34A 2FVCA 2P51A 5J2QA 4RU9A 5KG5A 4O3SA 5HROB 2IAJA 1WSHA 1SL1A 4HUEA 4ECWA 4URQU 4ED3A 3MFIA 4ZP6A 2JEFA 1RT3B 3KTQA 1REVB 1U04A 3GIIA 5KFPA 3NBPA 5C25A 3CM6A 3ZT4A 4J2AA 4LSLA 3C94A 4LY7A 2HWHA 4K4XA 2XI2A 4WXWA 1MU2B 2HB5A 2NUBA 5F8NA 3C95A 2JC1A 2ZE2B 4URGA 3ZT2A 1KFSA 3AVFA 1S1XB 3G6VA 4KTWA 3RTVA 3QEPA 5KT6A 4ID1A 4FXDA 3FFIB 4TY9A 2GUIA 2XI3A 3KKSA 1N5YB 3MXIA 4QWAA 3OYNA 2HMIB 3QNNA 1EP4B 1C2PA 4QOZB 3K5OA 2RKIA 4KKOA 2HNDA 3LWLA 2HNYA 1U45A 2AGOA 4J9OA 3JYTA 5EU7A 4KV8B 4ZP7A 3OYGA 1OS5A 3CJ3A 5DG8A 3V9WA 1ZBIA 4KRFA 3GYNA 3O3FA 2YHBA 3KK3B 2QV6A 3SZ2A 4AHVA 1TL1B 3TAQA 3DOLA 3AO5A 1TK8A 4KHNA 1X9MA 4Y2CA 3OL8A 2VA3A 2YKNB 3PW4A 4G3IA 1QQCA 4CE9A 4HHTA 4XO0A 3PY8A 2D3UA 3HVAA 4FW2A 4Z4CA 3DRRA 2ALZA 2XRIA 4O4GB 3HVRA 3MAQA 2R8JA 4RNOA 2KTQA 4YR2A 4JRQA 2HHQA 2Z1GA 4F4WA 2RKIB 2IMWP 4OKEA 2P5OA 5F8MA 2FVSA 1DTQB 3MR6A 1JLBA 1O1WA 3O3GA 3ZSVA 2O5DA 4YP3A 5L1JA 2E6MA 4CF8A 3KLHA 4LD0A 5CY4A 3DM2A 4ICLA 3BQ2A 2FVRA 1XWLA 3DLEB 4DFJA 4DL7A 5E41A 4HUGA 1TL3B 2ASDA 4KHRA 3KOAA 3VQSA 3DOKB 3QLHA 4O55A 3H08A 1KLMB 3Q8PB 3QIDA 4I2PB 2UUTA 3VQ8A 4DLGA 3LP2B 2C22A 5KFQA 2ETJA 4B9LA 5KFDA 4GW6A 3L2UA 4CFCA 4CEQA 3HP6A 3O4QA 2XY6A 1D5AA 3ZSXA 3DLGA 3M9MB 4IR1A 2R7YA 1FK9B 2BANA 4FM2A 1WLJA 2IC3B 2E9RX 3E01A 3ICLA 4OKKA 4NLDA 4CGIA 2W9AA 1TK5A 4CEFA 4JV2A 5KFHA 4KBIA 4YNQA 1FXXA 2A1SA 1VRUB 4O3NA 5I42B 2YNFA 2G8WA 4ECRA 3AVKA 1RDDA 1JX4A 1JLGA 1LWCB 1HQUA 5DGAA 4OLBA 4K4UA 1RT4A 1UWBA 5DGBA 3H59A 3F73A 1K6YA 3MECB 4KB1A 4O44B 4FS1A 4QW9A 3IS9A 4EYIB 4CERA 1BQMA 3M9NB 5KFOA 3DRPB 1IKWA 1LW0A 3E01B 3L2RA 4OPJA 3E51A 4EP4A 4NRTA 3AV9A 1NK7A 1SL0A 4K4TA 2CKWA 1GOAA 3H4DA 1NK9A 1BGXT 3FQLA 3DLKA 4ED2A 1R0AB 3HVTB 3V6DA 4KHSA 4FYDA 1LWFA 4IBNA 3RB6A 5KFLA 1HMVB 3VA3A 4Q8EA 1KHVA 4BWJA 4EBEA 2HHWA 1JXLA 3AVJA 1VSDA 3AO3A 5CYQA 4DSFA 1NHUA 2Z1HA 4ECQA 4DS5A 4ED6A 4KHYA 4E7HA 1BQMB 4I9LA 3CJ2A 4JV1A 3IRXA 3F9KA 4NLYA 4NCGA 4TYBA 3QEIA 4DTOA 4BE0A 1QE1A 3MF5A 3U3GA 3TAFA 1HNVA 2JC0A 2B6AB 4RW4B 3L3UA 3NH1A 3SUOA 3N6NA 1Y97A 4R5PA 4HYKA 4DSIA 4K50A 4PWDB 4AH9A 1QS4A 4ZPCA 3AA4A 1UA0A 3ISND 4ZTFA 1HNIB 2XWYA 4M42A 2QK9A 4LH4A 3LZIA 1NK5A 2OPRA 4F4KA 2YNGA 3QINA 2ATQA 2IJNA 1RTDB 4HUFA 4J9QA 3RR7A 3AVHA 5CYMA 3OS2A 1MMLA 2D3ZA 3Q8QB 4CJWA 4NCGB 4NLRA 3HYFA 1VSMA 1TAUA 3RAQA 2GC8A 3DYAA 3AVCA 4I9QA 2DFEA 4DSLA 4R8UA 3GIMA 4NLUA 2ASJA 4M3UA 3AVIA 3KHGA 1NOYA 4K4YA 3VQ4A 3NH2A 4RG8A 3H40A 4YMEA 1JLFA 4FZZA 4WFXA 1S97A 5KGXA 2WONB 5KFTA 3KK1B 4DSEA 1ZBLA 1T94A 2FC0A 5J2NB 4CJTA 4FK0A 2YV0X 2YNGB 1S10A 1KVCA 5KFZA 2W42A 4CEOA 2HVIA 2V4QA 1RT6B 1JLEA 1T05B 3CQ8A 1DLOA 3QGGA 4ID5A 3KLIA 3LZJA 5T7BA 4FJJA 3TVKA 3PVXA 4G1QA 3TANA 3T5HA 4O3OA 3V6HA 4B3OB 4WZMA 3NF6A 1BIUA 1JLQA 3TQ1A 1Q8IA 4QWDA 3NAHA 2UVWA 3LANA 3LPTA 5KFSA 4Q8FA 3V9SA 3KKRA 3RMBA 3VQQA 4NLQA 4Q0BA 3V1OA 4W5NA 3V4IA 4HKQA 2OPQB 4B9MA 4Y3CA 3I0SB 5KT5A 2VWKA 4IKAA 5DQIA 2IM0A 3N6LA 3BSNA 4RUCA 2DY4A 1NOZA 3QIOA 4PY5A 4ECYA 2JEIA 1N4LA 1S0MA 1RDBA 2WHOA 4G1QB 1ITGA 3ZSQA 3C6TB 5KFIA 2DFHA 2XY8A 1U09A 2Z1IA 5DLFA 4CF1A 5EUHA 1JL1A 1BIZA 1WSGA 3ZSWA 3NGIA 5KGWA 1JXBA 5FRMA 1ZBUA 1WN7A 2KFNA 5FROA 3KMQA 4C8NA 1I3AA 4DQRA 4DL6A 4IRDA 4FW1A 4M3ZA 1TVRB 5J2PB 4CJUA 4M3YA 2Z1JA 1RBSA 1YVFA 3CIZA 4CJFA 2OZSA 4WFYA
chains in the Genus database with same CATH superfamily
1D09B 4JAXA 5HOOA 2QKBA 4OI4A 1V5VA 5D15A 2BMBA 5E3QA 2FLPA 2QLWA 2W40A 4E7KA 3O6QA 3AY0A 5A2QO 3LUYA 1VDHA 4IG3A 2RMLA 4DEZA 4F3MA 4BACA 3CGIA 3J7ZT 3EGWB 4OI3A 3ZZPA 3O9SA 1KHWA 2ITGA 3RR8A 1CXQA 4B9TA 3DLLQ 2YKQA 5FDLB 4FJ8A 2ADBA 2AJFE 1U24A 3MTJA 3ATVA 1YITS 1SZ2A 5AQTA 3DXMB 3IBCB 1KVIA 1EX4A 3OFHA 1NH8A 3S3NA 2K3IA 2GEMA 4F4YA 4NLWA 2PA3A 3RZAA 2GTDA 4RBVA 4IQMA 5TKWA 4ETXA 1QHTA 1VRTA 3DDNA 5L1IA 4W5QA 3TTCA 4DV7K 4JHDB 4NCAA 2GO8A 4JI3F 3SCLE 2JWKA 3FJ2A 5FRNA 4IWVA 2N82B 5HROA 3H3NO 1LKZA 4AE5A 1X4AA 4CF2A 3FZFA 1RAIB 1REVA 1HQEB 1LQ9A 4KB0A 4J9PA 2ZBIA 1U2VB 3OFGA 3BGLA 2C28A 5H1SV 1Q4RA 5LXYA 1QSLA 3BEGB 4GKJJ 1U1PA 4YHHK 2ZJRL 3ITHB 1L3VA 2D7SA 3C15B 1MU2A 2V2QA 2BJDA 2ZE2A 1HBMB 4BG9A 5M1KA 1JMTA 4WXOA 5C10A 1JWWA 3THYB 5E33A 2ZJQL 1R59O 4H5RA 3B4MA 4BRKA 3RBZA 2I6WA 3GV5B 2ZGYA 1YITN 3H5UA 1PJ7A 4LFCJ 2D41A 1R8PA 3QB0A 2VDHA 2V9KA 4DUZJ 1YUWA 8ATCB 1DARA 1NNDA 2VG5B 2KHCA 3L4QA 2MQMA 3K5MA 3MWPA 3QFHA 1CJVB 2O8CA 2BJ7A 3GFYA 5G0RA 1QTMA 4QIEA 4FSVA 5L8RC 2YWGA 3LAKA 1EO1A 2XLIA 4OX9J 4Y2MA 4JV5K 1JJCB 4M3RA 3CD0A 3E3XA 2FBYA 1RDCA 4OI2A 4M3WA 2P9SA 4BWMA 1YZ7A 5DZ7A 3SXLA 4DUTA 4ELUA 3UR3C 4FF2A 2BDPA 2H5JB 3PIPL 3PNIA 5KFKA 4WK1A 2RB7A 1Q1KA 5AZJA 4ES2A 4X65K 3FZBA 1VK3A 3KJFB 3R97A 4FWPA 3DLEA 2YVSA 2L9DA 3TARA 4ECXA 1TL3A 2VZ9A 4JK7A 2BH1A 3TU5A 4USKA 1BG3A 3DOKA 4N5SA 3M1VB 5FLXY 2FJAB 2VWJA 1KLMA 2DJWA 3LP2A 4TSXA 2U2FA 3BQ1A 1WC4A 4USIA 2F9TA 5KFCA 2WUSA 1PO6A 1R0CB 1YX2A 1UCNA 4MK9A 4XPEA 1WKKA 3W64A 4XPCA 1SC4B 4DL0C 4LRDA 2XMTA 3BEXA 1WC6A 1ZYQA 3KWMA 4DR3F 3BR8A 3BPDA 1H7WA 5DQHA 3RB3A 2E5LJ 4YR0A 4B9QA 4I68A 5ETTA 5I42A 4FCYA 3PHEA 1Q9YA 4KGVB 5DM6Q 4Z0UA 2QLXA 1TKDA 2FJWA 4FJXA 1L5UA 2AU0A 3HXMA 4CJSA 3MR3A 4CLZA 3NLCA 3UFCX 3DRSB 5HVHA 1U1RA 4DX8H 3MECA 4O44A 4ED5A 1Y7PA 5IXUA 1S76D 1EKSA 3K2YA 1L3TA 2NXEA 4I6AA 1EAYC 4CTAA 2VD3A 4LSNA 4WU3A 1RDWX 2E1RA 4FYVB 2AJ2A 4GNIA 1RTHB 1WD6A 3N9UC 2Y8YA 2WOMA 3OPKA 1ROFA 4L75A 4KJIA 4AQYK 3IMQJ 1HMVA 1NK6A 3SSRA 4CT9A 1R8CA 1OO0B 2YWHA 4ELVA 3MZIA 4KC5A 2O4GA 3R7NB 1RADB 4E7LA 3CCWA 3G71S 1M1HA 2BM1A 2IVYA 3I55S 3TI0A 3VMFB 1NK4A 2ASMA 3FE1A 2HHXA 3GG4A 4K7QA 3ZZOA 4P6QA 5CABA 2PEBA 2YPYA 2B6AA 4RBUA 3D4JA 5AQHA 1RA6A 4G1PA 2AT1B 4UOGA 5HRNA 1B9FA 1IN0A 2Q1LA 2H3EB 4ZLLA 5CCMA 4IOCQ 3EPIA 3W61A 4NXMK 3V9UA 2XSFA 2DH8A 1PYOB 1SQGA 4C97A 3S1TA 1IKXB 1Q8LA 3CG7A 3RRHA 4A62A 2HNZB 1RAAB 1K47A 4DFPA 1S6PB 4RR5A 3CCVS 3JQMA 4QWCA 4DR1J 2F8SA 4KFBB 1S9EB 3AARA 3ZZ0A 3NY0A 1R3NA 2DRDA 3H5SA 3NRBA 1S0OA 2F3JA 3O3HA 4BR5A 3KK1A 3WIVA 1HPZB 5H9EK 4F3OA 2RNEA 2XTJP 3KHRA 3VEYA 3G71N 1Q82T 5D6GA 3CW2C 2V67A 4YDUC 4O0JA 3SI8A 4IDKB 2DY9A 2BZ2A 3WUHA 4B1ZA 1U1QA 4ZVQB 3VF4A 1T9UA 5EDWA 4DQ8A 1DJ0A 1WB9A 4IQXA 3O9TA 1ACMB 4BCAA 1NMEB 1K8AT 3TEHB 3WC2A 4OJ3A 1P9YA 1XMQK 2J0SD 2IS3A 3NGUA 1UVIA 4DN9A 1XK8A 3H1VX 2BRKA 2XY5A 1CC7A 5AE2A 1W2IA 1C4AA 4KHWA 4CGJA 4GVLA 3VQ9A 2E8AA 3OYIA 4U7CA 3IWLA 3CCVN 3M2RB 4JLHA 1LNQA 4JKBA 1SH3A 1YTUA 5F2RA 3OYDA 1N36F 1TMMA 3NCQA 2VIHA 2FD2A 1BA0A 3SDEA 2OTJS 3ASMA 2PYLA 2WSFC 2XY7A 1WOQA 1TVRA 3NEKA 4NO7A 5J2PA 5GMEA 3EX7B 3CSKA 1WC5A 4A5AA 3R27A 1WDTA 3MEKA 1R89A 1NGJA 1RT1B 4V19J 1CPZA 4RW7A 1F3VA 3BGRA 3K57A 1U7LA 4ED4A 2ZM6F 1A7GE 2CJ9A 4M5LA 5IT4A 3J81Y 1M1KT 3BPSP 4LFBF 1HWUA 4KH6A 4QR2A 1V6HA 3PJWA 3BKTA 2AYBA 3R5JB 1LFPA 1JLAA 1V9OA 4X84A 1G6BA 3PR5B 3OS0A 3EKSA 5JVGQ 5KFUA 5HATA 1G3OA 5BYSA 4ES1A 4IOAL 5J2MA 1DBDA 3FCWA 1O0PA 3RMAA 2EW9A 3FCHA 1VQPS 2G2OA 3UNGC 3CXCR 1S1VA 4M5MA 5HMXA 3VAFA 4IH6A 2KQ2A 3PSFA 4OYPA 3PW7A 3BH7B 3CEDA 4X4OA 4HLBA 5GAEI 1WELA 2VB6A 2W8LA 2E5IA 4JI7K 2CJXB 3PEJA 2DGOA 4HTIA 3PIOL 4UOHA 3DI6A 2OTJN 2DGSA 3M8YA 1FW6A 4ILRA 3IAS9 5GIOA 1Z25A 2W2OP 3EZUA 4C98A 3ZCMA 1XNRJ 2OMOA 3RMDA 4K43A 1C4CA 2ILYA 4OYBA 1SBRA 3HPHA 1RWKB 3R1LA 2RQCA 3T69A 2BRLA 4PWUA 2YKMA 2IM1A 1B0VA 4KO0B 5CH7B 3A5MC 1TZ0A 4ITSA 1EQMA 2F65A 3HPOA 1Y64A 1S12A 1BCOA 3WX4A 4CJLA 1HBNB 3A2FA 3DAWA 3D68A 4J37A 4TVAB 2RJZA 4KH0B 3SMSA 5HANA 4IFYB 4HH0A 1T03A 3LH2S 3RMCA 3QSYB 1YJWS 5KT3A 2KXFA 1NGCA 2MHEA 4CO1A 2XO7A 4DV3J 2MGZB 1MA9B 4O23A 2BE2A 2MQ8A 1ZM2A 4DJBA 3K7RA 2FJDB 5EX3A 2OJ3A 4GVBB 2HBJA 4M41A 1VQPN 3T6JA 1VQNS 1JLCB 5IV3A 5EWEA 1FX2A 1CVJA 2B4VA 1YDLA 3VEXA 4QIVA 3THXA 2EXUA 1IBMF 5F0WA 1HNZJ 4KHMA 1KAYA 2OAUA 1RDUA 3JB9k 5KG1A 2DXEA 4ZIVA 4I2QA 1VAZA 5AR0A 2OPSB 3RAMA 3HK2A 2F9WA 4BREA 3CC2S 1VSFA 3C6UB 1KC8T 1FWKA 3C66A 3CF5Q 4BC5A 1GMWD 1FEHA 4DQSA 5AQPA 3VETA 2KW4A 4RZRA 2W8KA 2UUBF 3V81A 5EGYA 2OEMA 3Q8RB 1KOOA 4I7FB 5CZ1A 2QG9B 2WVFA 1C1CB 4RW8A 3MUTP 2JH3A 4PZVA 1T8EA 2ZGZA 3A4TA 1Q86T 4F26A 3RGIA 3UKRA 3JSMA 1SJ3P 2GGPA 1KCFA 3KFWX 2QFIA 2AMCB 1TKZB 2NZCA 4YOEA 1YJWN 1EETA 4G6VB 1A5XA 1CZ9A 4KH1B 1G1XA 1BU6O 3DXSX 4DV7F 5EN1A 1WF1A 1YI2S 3SBTA 5HMZA 2QYCA 1WJ9A 5DQGA 4QYZJ 4FF4A 3IKMA 2LQ9A 1RTIB 4JI1F 3OHAA 1TUVA 3WQPA 3EMTA 2V8PA 3LPUA 1VSJA 1NH7A 3DOMA 1Q95G 1IUJA 1CZBA 4EYHB 3MEDA 4H4MA 5KFBA 4YHHF 3BKFA 3CC2N 4B08A 4ZJQA 3KYLA 2VF3A 2VPWB 3TABA 1RT5A 3X3UA 4YFUA 5K5MA 2HURA 2ZOFA 4OI1A 5C7PA 5E26A 3TPQA 3NCRA 4CGGA 2B4OA 1FFGB 3IO1A 2JNJA 2YWWA 4L76A 4DPUA 3VGMA 2DR7A 2UUAK 3T1AA 2CZ4A 2CGJA 3QERA 3P1GA 1DTTA 1TR0A 2VA2A 5EWGA 4OVLA 1ZTWA 2A6OA 4KKOB 2HNDB 2BA9A 1VRQC 1IR1A 4OZ1A 3CDAA 2ZHOA 2HAFA 1YHQS 1YI2N 2CQGA 5CQGA 1NNEA 4HHUA 5F3TA 4GO7X 3UCUP 4CJPA 1QAXA 3OBIA 1LAVA 1ZXOA 3G87A 1RAFB 2ZOGA 1W9HA 4Z4EA 2WVDA 1FWLA 4TY8A 1YTAA 3CHWA 4PKIA 4B3TK 2O67A 3CFPA 3P83D 3QO9A 2FF6A 3MM9A 3NF7A 2VJUA 1U25A 2W2MP 3VQDA 2J9DE 2AW0A 3KZBA 2DYAA 3HVWA 3TJ8A 3OR1B 2NREA 1RQ0A 4Z4IA 2XNRA 3IA0A 4OZLA 1NGIA 4X65F 2OEKA 4DV2K 3KLHB 3U4LA 5BYRA 1FTCA 3KNGA 1X3NA 1RHKB 3PKMA 4PUOA 1HWIA 4IYQA 1Q7YT 3QLHB 4CJ5A 2Q0RA 3C7NA 3L3VA 1S9GA 1F9HA 5A8WB 2RD5C 2MQPA 2V94A 2BJ3A 2ERRA 1N32J 1RBVA 4K0KJ 2MKHA 1CJUB 4YB5A 3LGNA 1YHQN 3DLGB 3PFOA 2G8UA 1ZS6A 4DR6F 1RAJA 2DFFA 2VFUA 5AQVA 3OYCA 2RPIA 4FJ9A 1C6VA 4CZHA 3MCNA 1B99A 2IM2A 1AW0A 4OPAA 3NOGA 4WK3A 1K0VA 1R6YA 2VPYB 2YNFB 1HYZA 2A3ZA 3KLVA 3OYLA 5T14A 1OYEA 4N56A 3MN5A 1HQUB 5KAKA 4WP9A 1RT4B 3ELHA 1X9SA 1KD1O 3D2FA 2CH5A 2E7WA 4NCBA 3KHYA 5AXKA 3IS9B 4CT8A 5C42A 4CH1A 4ZJLA 4DV1F 5KPRA 3EWGA 1FJEB 1FRJA 1FRXA 1SV5A 2GUPA 4LVNP 3S41A 3VEVA 2M70A 4H0XB 3UKUB 2RH3A 4UT4A 4AQYF 4BR4A 2FVPA 1T9YA 3KIOA 2EG2A 2FF3B 2RS2A 5ETPA 4BC7A 2GWJA 2O1PA 2E2NA 3FK4A 3OLBA 1RCXB 1WACA 2AGPA 4CHPA 4YOVA 1X4CA 4P2MA 2DHGA 4CIEA 1J2VA 2PFUA 3QICA 3MOZA 4CGFA 3NAEA 2FHOB 3H2UB 4R0EA 4E7IA 1GAOA 2QKKA 1YXQA 3SUNA 1U2FA 4JI5F 4E1MA 1FXRA 5L9XA 3I56S 1QE1B 2EPIA 1FRLA 1HNVB 1VK0A 4CJ3A 1WEXA 4DF8A 3LP0A 1RU1A 4FJLA 3RW7A 3JXUA 5CAAA 3HSCA 2DO4A 5DLGA 3CULA 2MKSA 2P6SA 4YOWA 4X66K 2HQDA 2N7CA 5M1QA 1WF0A 4FM1A 5KTQA 2YNHA 1CS4A 3L4IA 3SQ4A 2NSCA 3UN2A 3K59A 2R7UA 4DQPA 4HTLA 2EC0A 2V9WA 3CCTA 2AEMA 3PX6A 1KONA 2XGQA 4A61A 3R2CJ 2XCAA 2V34A 4PXDA 1SJ4P 4L74A 3GYXB 1KVBA 1HI1A 2QE5A 5AQUA 1U0HB 4JKHA 1NMDA 3W62A 2OH2A 1QVFR 1CQMA 3GFXA 3DRYA 1PJ6A 2V6AA 4DQIA 3SUPA 3IGNA 3LP1A 3CJKB 4RCHA 4MFBA 1RWWB 4K4ZA 1DLOB 1TK0A 3ZSZA 4ID8A 3UR0A 4EO6A 5KRSA 2EC2A 3I56N 1YK9A 3Q7CA 2FXUA 1XMQF 2O8FB 6FDRA 5HAOA 4URSA 3RYLA 3CDEA 3CNQP 4UUXA 1K73T 4DV5K 3D3BJ 3AVMA 1VQ6S 1RE1B 4RW6A 4CVNE 4ZMMA 4CYUA 3H1QA 3DU6A 2J9CA 2FYXA 2IGIA 4KH4A 4MDBA 2FLNA 1WSEA 3QT6A 5A8RA 1BUXA 2E44A 4WF9Q 4ZPDA 2HRYA 4QIGA 5JICA 2Y1JA 5IT9O 3V1RA 2BX6A 2VKRA 2UVUA 3WHIA 1IM4A 4FLVA 3M6XA 4V19S 5DG7A 4JNEA 3BV8A 1UFLA 2DVIA 3TAMA 2UU9F 1X5OA 1QD1A 3HF5A 3L6QA 4X4VA 4OZJA 4NMXA 4N47A 2CVEA 1TV6B 1VQYA 3UN5A 3RBDA 4WFAQ 4Q7AA 1LWEB 3SPYA 2ZD1A 2FSJA 2IRXA 3OL9A 1BDGA 4LVOP 1WUAA 5BR8F 1RDRA 1U1LA 3OL6A 3THWA 4YS2A 2EG1A 3KLFB 4ILMA 4WE1B 4K8RA 4H5TA 1UP1A 3BBFA 1W25A 4TQSA 1VQ6N 4L3NA 2OI2A 2CQPA 1WC0A 1ZA1B 5D0HA 4OQJA 2R2UA 3CFRA 1IKVA 2CPIA 4DU7A 3S7RA 3OJSA 3QT8A 3OYEA 3AA2A 3F5TA 2HHHK 1YRUA 4CGHA 4JI7F 1NXIA 5KFWA 2KH9A 2BQUA 2XMMA 2E6LA 3MM5B 3B6BA 2F96A 4Y34A 3D54A 2VV5A 3JAMO 1DZ5A 1ICEB 3OXLA 2EBGA 3ET6A 4LIRA 4O3SA 4X4TA 3E2EA 5LMNK 4HUEA 4ZOSA 2B9YA 4ZP6A 5ETNA 3MFIA 1RT3B 3KTQA 2QLJB 4YY3K 3I4HX 1JCGA 1N5VA 4BR7A 3BO4A 3IBFB 4LSLA 1X7VA 3THTA 3M32B 2WTUA 2C3MA 5DZ6A 1E6YB 3KJQB 2XMKA 3AVFA 4KTWA 6FD1A 1ZPWX 2ALYB 1YBTA 1KQFB 4QWAA 2BKNA 3OYNA 2HMIB 3QNNA 4DX6A 4CZLA 4MKVA 3MMAB 4J9OA 2K7KA 2ZBQA 5EU7A 4ZP7A 2CNOB 4KRFA 2RHSB 5FIIA 2HF4A 1W26A 3TAQA 1KTVA 5HJXA 1AUDA 5IWAJ 5A0YA 2PBDA 2CNNB 5B0EA 3ID6A 1QY7A 2OFHX 3VCDA 4IO1A 2RQ4A 3PY8A 3P49B 1YJTA 2J9DA 4Z4CA 3ZTQA 4O4GB 3R6GB 4W4MA 1LEOA 3MAQA 2MKKA 3ZZYA 4RNOA 2Z1GA 3TEGA 1NDPA 4DCHA 3MR6A 1JLBA 4I6MA 1E6VB 1RWPB 4YP3A 2E6MA 2R7RA 2C1EB 4CF8A 2FZGB 1EWRA 1Y11A 2LEPA 3BQ2A 2VU5A 9ATCB 3PHTA 5D0GA 4HUGA 3U7JA 3KOAA 3VQSA 4O55A 2F4VK 1XNQJ 3QIDA 4C11B 5DM6L 5KFDA 3HSZA 1DEJA 1HX1A 3O4QA 2E20A 1D5AA 3ZSXA 5GAEP 3M9MB 2WB1D 2M4MA 4DV4J 2JSXA 2BANA 4FM2A 3E01A 4OKKA 4NLDA 3MMBA 4JKAA 2WVCA 1HKCA 4YNQA 2A1SA 4GV3A 1VRUB 5ETQA 4ECRA 1UJ6A 2UUAF 2EFVA 4JI4J 4WQ5A 1JLGA 2XMVA 5DGAA 4OLBA 1FRKA 2Z57B 1SB6A 4HI2A 3ILJA 1K6YA 1U2RA 4KH5A 3JSBA 3ZEUB 4FS1A 4QW9A 2H1YA 2KVIA 4EYIB 4A8MP 1WG1A 2QEXS 1IKWA 1LW0A 3CJAA 3E51A 4IZ9A 2NRHA 1NK7A 2QM1A 5AQMA 3SAGA 2HK3A 1R0AB 3V6DA 4B3TF 2OO4A 3N4PA 4BRLA 3VA3A 3O8WA 1CULA 5GAGU 1MWYA 3JSRA 4EBEA 1OVYA 4USJC 1NHUA 4ED6A 3J7Z5 1BQMB 2XSJB 4JV1A 3IRXA 2BE9B 2DB1A 3MMVA 4NCGA 1QJHA 4O8KA 1CBKA 3L7UA 5LXRA 3QEIA 3MUMP 4DTOA 1VIXA 3UVJB 1HNXJ 2JC0A 5A2QU 2QA4G 2MSSA 4J90A 4R5PA 5SUHA 4DSIA 4K50A 4PWDB 4ZPCA 3KUEA 1LOTB 2RRBA 3ZNUA 3ZTSA 2MXYA 3LDLA 4GVEA 1NK5A 2YNGA 4J9QA 4LF5J 3RR7A 3IP0A 2D3OR 4B3MJ 3BS9A 2QEXN 2LXIA 1MMLA 3CCQS 3FC9A 3WIUA 1TAUA 2CYYA 3W5XA 3K5PA 3NWGA 3HT0A 3QFPA 1YWXA 3AVCA 3W9HA 1VQLS 3WXKA 4R8UA 3GIMA 2UXBK 1XIQA 4DUZK 4M3UA 3H20A 1NOYA 2DCLA 3NH2A 4RG8A 3Q8VA 2WONB 4DSEA 3HSDA 2G13A 3TZXA 4CJTA 4RBTA 1KQSM 5L38A 1MWMA 5EOYA 4RUBA 2YHXA 2V4QA 2PA8D 1RT6B 2NLWA 2J8SA 1FJCA 4OX9K 4I64A 4A8QA 1VQMS 4ID5A 4GRSA 2HBRB 4ALZA 2J7WA 4FJJA 4OZ0A 5KQ8A 2P9IA 3CJ7A 1DFDA 4CO5A 1MWZA 1I51B 3TO8A 1Q8IA 4QWDA 1G4CA 5E3PA 4L72B 2ZHBA 4JKFA 3LANA 2XO6A 4NLQA 4F3QA 5JMVA 4U7UK 1Q53A 2YPZA 4W5NA 3V4IA 4HKQA 2P9CA 4LRCA 3I0SB 2VWKA 3M30B 3ZETA 3N6LA 1M5KC 3AH6A 3CCQN 3QIOA 2ZOMA 1OKJA 1KQGB 1VQLN 2DRBA 4A8OA 2CJAA 2XY8A 1U09A 2Z1IA 3GG0A 5EUHA 3ZSWA 3P38A 2AEJA 4QOTA 3DJCA 4C8NA 4DQRA 1I3AA 4CJUA 4BC9A 2BUNA 3M1FA 3CIZA 2CQ4A 4CJFA 2RIJA 1WAFA 5FPEA 3RRGA 4L6V3 4KQZA 1M5HA 1VQMN 4X66F 3EJMA 4GKKF 2B5JA 3PTWA 4JI8F 4Y0WA 4CHNA 2M2BA 2ZDOA 4O3PA 3G9CA 1SI9A 3P45B 2NZ4A 1MMNA 5KI6A 3N4QA 3Q22A 1RGIA 4IG0B 1WBBA 4JI6J 2UUCJ 4NA2A 2CFXA 1RT7B 2M5YA 2V0NA 3QGIA 2XB2D 1ZBFA 4U7BA 1AZSB 2HMPA 4HCCA 4ETZA 2HHTA 5FPMA 2WVBA 1Q7LB 1FWPA 2DIUA 4NLPA 4I1TA 3ENQA 4ZPBA 1FVSA 1BI4B 3UWTA 4EHUA 5HJYA 2M88A 4RWXA 2XS5A 2IBOA 3DHXA 1NSPA 3I6PA 4M63A 3WX8A 2AYMA 1J27A 3AAQA 3TAEA 3CCMS 5JLHA 1HYSB 3OUYB 3OBYA 3LPEA 3OY9A 4Z2XA 3D3CJ 5DK5A 1QVGM 4K25A 1DKGD 3QIPB 5F8GA 1JIHA 2L3MA 2XLKA 1DAXA 5GADI 1NDCA 1S59A 5HBMA 4DL5A 1S6QA 2MZQA 4DV5F 3BO3A 1QQOA 2E1CA 4WCEL 1NKEA 5KFMA 3EDRB 1CEZA 1ITPA 2LA4A 1DT9A 1MROA 3M2VA 5DRKA 2HZAA 4GC6A 3GZ7A 4CLLA 1R6VA 1S1XA 4NPOA 3HP9A 1S1UB 3T1YK 1MN9A 2A1RA 5EHHA 1TFYA 3CF5L 5B0CA 3HZEA 4AM6A 3GDQA 4D3HA 2HHVA 4DR7J 4BRQA 3W5YA 1VC6A 2GMJA 4DR1K 4B3SJ 3SPZA 1RJJA 4C0OC 3H0PA 4DHVA 3HRGA 2QWRA 1HBUB 2J6UA 3EUNA 1TL1A 3KNAA 4QW8A 4A8WA 4P2FA 1QAIA 3CCMN 1CLQA 2YKNA 1ZTTA 5IC6B 2BJ9A 2FB0A 1KVJA 2C3PA 1M90O 2H9ZA 3QT7A 3EZ5A 2E2OA 3D0HE 1OQ6A 2IBKA 5IM0B 3AA5X 2CQ0A 3AFGA 2BTFA 1XHZA 2D0PA 4ANDA 4U67Q 1EQ0A 2FHJA 1T9XA 3VEOA 3RWUA 1H98A 4FYWB 5KT2A 1HJRA 1SL2A 3R5CA 1VLOA 4TU7A 2HIYA 2EX3A 3B6PA 3S3OA 3O1BA 1YJUA 2LQ8A 2Q1NA 4E1JA 5JS1A 2GAGC 4MAKA 2HHHF 2O8CB 3O8MA 5KG4A 3GQCA 5G0RB 5AQSA 4C4WA 2E4LA 4PKDB 3G6XA 4UUWA 4ZPVR 4I2PA 2V51B 1TKXB 1BQXA 1GLDG 4M7XA 2P9SB 3BN4A 2EK6A 5K8OA 4Y1CA 2AZ3A 5LMNF 5CZXA 3MEEB 3C0BA 1Z4UA 2UXCK 2JDJA 4YY3F 1FKPB 5HLFB 1QAYA 5BR8J 4O5BA 3DMJB 2ZKUA 5K8NA 1RWUA 4LRAA 2IC3A 2EEYA 1D1UA 4WFZA 4C3LA 3GP9A 6AT1B 4V19X 4GC7A 2HHPA 4PXEA 1KXPA 1I94J 3PYGA 5J1NA 2O66A 1VJWA 3KLGB 5HQ8A 3UB5A 5KFVA 3M6WA 1IG8A 1Y9OA 3VAMA 4GV9A 1CJKA 2P5GA 2EKNA 4CRJA 3SJJA 4A8SA 4LF9F 2RU9A 4K2XA 1GLEG 4AHSA 3SQOP 4F0MA 1NUEA 3AO1A 4CK1A 3TRGA 4X62F 1VFJA 3QMLA 1SUQB 1WAJA 2CAJA 4DFMA 3AGRA 4J9LA 1VS3A 2GO9A 4CZFA 3T9ZA 5F1XA 4PABA 1QZ5A 1TELA 3BYPA 1P6TA 2CQIA 3AQPA 1HKBA 2CQBA 3QFUA 4ECSA 3VZIA 5THWA 1T3VA 1U02A 2PIIA 2WAQD 4FWNA 2WW4A 4N8NA 4FPBA 5AJ3F 3FMBA 5M2UA 3SSSA 3TX0A 2R7OA 2AHOB 4QBUA 4ECUA 3FUYA 3PKYA 4FWQA 3GIKA 4DG1A 3ZX3A 3CD7A 3SJHA 1XQIA 4WFNL 2H48B 2R7TA 2WK4A 1F6TA 3F41A 1N48A 4X64J 3EE9A 1AB8A 3I0RB 3PFEA 3M7VA 3GTYX 3CDWA 4LSNB 2APOA 5C15A 3MK6A 1BC6A 4RW4A 2WOMB 4ZHRB 1RDAA 4V1Ak 2A0FB 4YORA 1NGGA 3QFWA 2KT5A 4KR0B 2F4VF 3RJMB 4WQ5C 1HNIA 3H2VE 2V4RA 1WHWA 1DY3A 3SQGA 4HDHA 4CK2A 1LXJA 3ETMA 4M1KA 1RTDA 1P9QC 4BRPA 1SC1B 4DV3K 1X4EA 4DR2J 2MZTA 2JLGA 3DWLA 3LQVA 3OD2A 2MQOA 3G4SS 2O8DB 3PW2A 3JTOA 3H4BA 4AF1A 1E4FT 1GXTA 2O8BB 3SYZA 1TL7B 5IOLA 1C0UB 3L4BC 4JI0F 2VFTA 2XG8A 2E1MC 4AM7A 4JI2J 1OH7A 4P9SA 4AD6A 4FJHA 2CJKA 4ZLJA 2B9EA 4BS2A 3EM1A 1SKWA 5CD4H 1RK8A 2KM8C 3K2PA 4ZS6A 2NZTA 1T05A 1RAHB 2P2CB 4AYBD 2G1HA 2XM3A 3MX2A 5JMNA 4EBCA 3ULEA 2HSEB 3I5AA 2X51A 2K2PA 5AQNA 3VQ5A 3W2WB 1X0FA 2C2RA 2CZ9A 1X4GA 3CUNA 1KDNA 3E9OA 3M8QB 2HF3A 4NOHA 1C1AA 4I6YA 1ZH5A 4BRCA 3GIJA 4N7TA 4WJBA 2Y0BB 4FJ5A 4OZ2A 1GX6A 3G4SN 4PPDA 3NCPA 2Y1LB 3NOCA 1W0HA 2VBZA 2G2ZA 3A8KA 4A8FA 4F8RA 4FBTA 2VG7B 2L9WA 5DDRC 3BREA 3UDCA 1O8BA 1SKRA 2H5EA 1EB0A 4GKJF 2LYVA 1NSQA 4O0IA 1CG2A 5C24B 4KAZA 3VQCA 2YKPA 3CCSS 2WFBA 3EE3A 4P2SA 2XCPA 2W25A 1VSLA 1SCJB 2QGFB 3MM8B 3N5BA 2XYGB 1J6ZA 5H9FJ 3KJVA 2HGNA 1F21A 4BGBA 1D8YA 4LFCF 4MK8A 2Q36A 4ZVHA 4DUZF 4DX5A 5FDLA 2MQNA 4EO8A 5BPMA 3RAXA 4YN3B 4JI3K 2WRMA 2AYEA 3A13A 3L0QA 3PLAA 2MPUA 4OV6A 1GLBG 3DXMA 3VF0B 3CIMA 5A8KB 3NGZA 4P10A 4Y00A 3RB4A 1ZBHA 1V4TA 3IR6B 3JS6A 4OX9F 4LH5A 4ENOA 2G8FA 1HBOB 3M2UB 4B9SA 4MK7A 4FJMA 3BF4A 4X4QA 3HSGA 3P4UB 4RNHA 4LF1A 1UETA 1SKSA 1RBUA 2FQQB 4QAGA 2KRBA 2OANA 3IAM9 1V5IB 4F04B 3CCSN 4CGDA 3I9V9 4LF6J 3M5RA 1U2VA 3UD3P 2Y1RI 3UD5A 3M8PB 2M0GB 4M95A 2P9NB 4C8LA 3ITHA 3PEHA 3C15A 4Q43A 2WC9A 3CJ9A 1B9DA 1HBMA 2FLLA 3CJ0A 3Q23A 1P8GA 5L39A 3A3OB 3OYMA 3J80O 5T7LB 3V5RA 4FZYA 3NNHA 3CJ4A 2LXFA 3THYA 3SFUA 3CT9A 3MAAB 3GMGA 5GAHI 1N32K 4FVCA 4K0KK 3DHWC 3HHEA 4CW7B 2QJ3A 4DQQA 1MWKA 2AZ1A 3P8BB 1Z26A 5D4NA 4DTXA 3UE5A 2NPIA 1XC9A 3HMJG 4JUZA 1NKCA 2E5LF 1H2TZ 2VG5A 2PO4A 4C1NK 2GJFA 1CJVA 4C9DA 2RF2B 4IH7A 4M63C 1RAEB 4CZMA 1FERA 2XMWA 3CI5A 2BW2A 3A8IA 1UJ4A 2Y3YA 3I4PA 5F9NA 1NGDA 3ZX0A 1VSEA 4BDZA 1BE4A 4HTUA 4DBQA 1R31A 1H7XA 1Q82O 1IG9A 4H4OB 1TAQA 5CD4A 3QAEA 4WQ4A 4M5IA 2IIRA 1SJQA 4FLZA 4K5RA 2NUHA 2DNZA 4OYWA 1QDUB 2IA0A 3D5MA 4HVJA 3KUHA 1ZBTA 3IM9A 3DC2A 2YHYA 4EZ6A 2KZMA 2ZH1A 4DR4J 4BQZA 3FDSA 5KFGA 2Q31A 2XULA 5E2QA 4Z94A 3M6GA 4AHTA 4DCOB 4E7JA 1U2CA 2Q2RA 5JUMA 3M1VA 2BKPA 5M1PA 3OSPA 2LCWA 2KI2A 2G0IA 5AE1A 4F4AA 2DT9A 3IBWA 3TAPA 3P6YC 4NLSA 1H73A 3CWJA 5HK4A 5J2QB 4KSEB 3Q8SB 2Y1IA 3ZSRA 2RRNA 4PYAA 5DM7L 2IAJB 5BRHA 3G8TA 2GVDB 1OY8A 1Q79A 4FWSA 3NBPB 1EETB 4ZVRB 1JJ2R 1KBRA 3HKWA 2ROPA 3TAGA 1Z6RA 1WBDA 1RBRA 1UPPA 1ZPVA 4HDGA 4ZCLA 4PHTX 1NJIT 4FJKA 2UUWA 2MZRA 4ZCIA 4B9VA 2Y8WA 3V6KA 3DRSA 1F60B 3THVA 3Q24A 2XHCA 3LAMA 4DR1F 1M1KO 4E3SA 2HBYB 2W7PA 4H4MB 2VCPA 4CO2A 3HDSA 2HNYB 1VI7A 1YBUA 1KKHA 3J7YI 2AD9A 4MIBA 3FBFA 5BN8A 1J5EJ 4OGEA 1RTHA 2Z30B 4MQ3A 1MNEA 1YSJA 4LT6A 1S3XA 3B54A 4NLBA 3DOLB 1T9TA 5M2RA 1H0HB 3BH6B 2XGPA 2JHEA 2MMYA 2Z2ZA 1PCAA 3CTRA 4F67A 3ZSOA 3OR2B 3NAIA 4NEYA 4RW9A 4DV0J 1GFWB 2EKYA 1GOBA 2K06A 1F5BA 5LSLA 2DITA 4Y2AA 1OY9A 4ZLPA 4F3TA 4XIUA 3GJRB 2ZH9A 4CZGA 1GQEA 4RNMA 4NLXA 2V8VA 2QMXA 3CJRA 3SV4A 2H51B 1FKOA 4H8KA 1APSA 2V7ZA 5KG3A 2A5XA 2W24A 4DR5J 4ICLB 4DTMA 1WC3A 4FOEA 2WBRA 4HACB 4TY8B 5AQIA 3DLRA 3MCSA 3VEZA 1N5QA 3HJVA 3TUPA 3QWPA 2VQEJ 3NE6A 1IKXA 4QWBA 1RFQA 2HNZA 2CG4A 4A2BA 1KWMA 4C8OA 1S6PA 4K2JA 2NS1B 2FHKA 4NZ6A 2KZZA 4ECZA 1Z1ZA 1S9EA 4NI2A 5HVGA 4W92B 4CJVA 5KFJA 3DDKA 4LSZB 2J0XA 1QM9A 1U1KA 3A5LC 1HPZA 2GMLA 4I0WA 3MR2A 5GADP 4IDKA 5KG0A 4AHUA 1UWBB 4J2EA 4DTNA 1RXOB 4AXIA 3LDPA 5DG9A 3CB4A 1XEZA 3LW5C 3IN5A 1NGHA 1VQSA 1AYEA 3FQKA 3SQ0A 3I9ZA 2IJFA 3SCIE 1C1BA 3OHRA 3VGVA 3NDKA 1N36K 5D77A 4YEAA 3MOJB 1Y00A 2MZ1A 5IT9U 3DLKB 1FJGF 1LWFB 4DU8A 3ISNC 5HRPA 2I7PA 3M2RA 4JV5J 4BLGA 4D3GA 4BR2A 3JTPA 2IJRA 2ZHAA 3PO4A 2ZM6K 1XNRF 1HHQA 1IR0A 3VQ7A 3LWMA 2HW3A 4MYTA 2KKZA 2M52A 1IBCB 1O51A 3H25A 1N6QA 1W2BM 1NLKL 3HHDA 2DGWA 4EIAA 1VQ8S 1K8KB 2Z2YB 4ZTJA 4F2SA 1NRKA 2JVOA 3ADAC 4ZN1A 4DCPB 1RT1A 3R3LA 2HQFA 1HLWA 1DRZA 2M8DB 3AA3A 4ZVOB 5F8IA 2VBXA 3WXLA 1GMVA 4DV3F 3K8WA 2NUUG 2VOPA 3KG4A 2F5GA 2P9PA 3AOAA 1MWQA 2NXNA 3D6MB 1QHAA 3BN7A 1BHNA 2YY3A 3BQ0A 5CZ2A 2EFPA 1UZHA 5D0RA 5DMRA 1GLLO 2HIQA 4BC2A 3R8YA 3FSXA 4DU3A 3DYAB 4UOCA 2A42A 3TR5A 1HNZF 2P9UB 2D0CA 3SUQA 2B8PA 2IPOB 2Z8QA 4U7UD 4Q45A 3KJNB 3O5TB 4DX7A 1VBKA 5IWAK 3SBGA 3D7SB 2GHWA 1HUXA 2X7IA 1IV0A 4IJAA 4PYDA 3JAMU 3OYJA 1NAQA 1F0XA 2QIFA 3WC0A 1JCFA 3Q2SC 5HO4A 2YQ0A 1JLEB 2QXLA 4IR9A 2MLZA 2HQ3A 4CFAA 2RDIA 3KLIB 3NCIA 3RVCA 1VQ8N 4FK4A 1EKEA 4Y2IA 2EFOA 2YXLA 4OFZA 3BDPA 3MMJA 4EU0A 3CPEA 4M5DB 4H0VB 2VASA 1I39A 2ATLA 2BEFA 4Y28C 1JLQB 3AO2A 2HQGA 3NNCA 2F8EX 3AVBA 2IOCA 4KO0A 4DTUA 1S49A 3K58A 3H42A 2UV8G 1HBNA 3OTCA 4Q0BB 4ZPWR 5I3QA 1GT8A 4DL4A 4IFYA 1IBMK 1RHQB 4EFAC 3A8JA 3GYGA 3SSQA 2V4JB 3HJFA 4B1XB 2MGZA 2K1RB 3BSOA 3PW5A 5DDOC 1B3TA 5HP1A 5A6WA 2LQJA 1S0NA 4GVBA 4JEPA 3SQ1A 3QBCA 4CEEA 1JLCA 1RWNB 2UUBK 1ZM3A 3BKUA 4E98A 4NYPA 4ECVA 2QSWA 2JLEA 1FRIA 3FLCO 4KE5A 1ASVA 1PAUB 4RNNA 4NXMJ 2OGUA 1IM6A 2OPSA 1BQNB 4CHOA 3VV2B 1UVKA 3C6UA 3F56A 1Q9XA 4M94A 1V3RA 4NB4A 5JS2A 4JI4K 4ZP8A 2VFRA 3O5BA 3HHKA 3QJLA 4DU4A 1HKGA 1GMWA 2FBVA 4FJNA 3L2WA 4F2RA 4I7FA 4OHWA 3A0IX 1C1CA 3MN6A 2LMIA 1FFSB 1R8HA 3IFRA 3G10A 2ZJRQ 3CCJS 4JI1K 2HFSA 3D9BA 4OPHA 1RTJB 2MZSA 2VGNA 1TKZA 1KD1T 1LK7A 3IWNC 1X4FA 3O6WA 4NWBA 2ZJQQ 3GR0A 3IWXA 1RBTA 4IDHA 4ILJA 1RISA 3A5NC 1NGAA 2GVZB 4FJ7A 3L2VA 2FBTA 4K4VA 3CXCM 3VEWA 1RTIA 3BM7A 4I69A 4C3KA 1L3UA 4OHXA 2UV8A 3PJ9A 4DPWA 1JCEA 3W2VB 4ECWA 3POTB 1IJEB 1U04A 1WSVA 2ABYA 1FRMA 4GV6A 1KVKA 2PD1A 2CNLB 4LY7A 2HYIB 3CPWM 4K4XA 2GHPA 5HMYA 2D74B 2W6LA 3IUCA 2VUGA 3S01A 1KFSA 3OBWA 3W3SA 3G6VA 1N32F 5HVFA 4K0KF 3QEPA 4LF5K 4FXDA 3FFIB 4TY9A 4B3MK 3CCJN 3PIPQ 4CD3A 5BYQA 4WQ4C 3EGNA 2ZH2A 1N5YB 4MDAA 1VHXA 5C0YA 1EP4B 3NGKA 1X60A 4QOZB 3OXGA 4KKOA 2HNDA 2AGOA 1GLJO 1F9EB 2AA4A 2QYGA 4KV8B 3RU0A 3EL2A 3OYGA 1OS5A 1ZBIA 8RUCA 4YB6A 3G82B 3KK3B 2QV6A 2ZWHA 5D4OA 1Q81T 5HI7A 1TK8A 3MURP 1ZA2B 1TL4A 2GQ2A 1WDDA 2G0JA 3OL8A 2CJBA 5AQXA 1SS6A 3PW4A 2AP6A 3E9LA 1QQCA 4XO0A 1EIYB 2D3UA 3H90A 3HVAA 4YOXA 1FJ7A 3SEOA 4PG4A 1NM1A 5BJRA 3HVRA 2DGUA 1N0VC 4JRQA 2HHQA 4F4WA 3C14B 3R6LB 1SKUB 2LU1A 5AQYA 1U6ZA 3NS7B 1DTQB 3BZKA 3PRBA 2KDOA 3J81j 3KLHA 3D2EB 4LD0A 2GHVC 1NZAA 5A0YB 5F3ZA 1UAWA 2O8EB 2DHHA 3AD8C 4DR6K 1Z05A 3C6HA 4PEOA 5AQRA 3VAGA 4BR0A 1VQ5S 2YCHA 3QLHA 4J9VA 3JS9A 5JVHL 2ZZMA 3H08A 2OUGA 4A48A 5A76A 2DNHA 2RHKA 2UUTA 3VQ8A 5A8WA 1IQZA 1SQFA 5KFQA 2F7TA 4CEQA 1HD0A 1TMJA 1CJUA 1PG5B 3WQUA 1S72S 2XY6A 5BN9A 3DLGA 2J0WA 4IR1A 2UXDJ 2R7YA 1FK9B 1RLDA 4NZ7A 2OKQA 2CZVC 2V2ZA 1WLJA 1YRXA 1MMDA 2IMOA 4CEFA 4CNZA 4JV2A 1WKJA 1F1BB 4DV1K 5RUBA 3C2PA 3QPIA 3VGSA 3FZHA 3K8VA 1AFJA 2YNFA 1HIYA 4UW2A 4OX7A 2LDYA 2QT7A 1LWCB 1HQUA 1RT4A 3QJJA 4IEEA 3OVSA 3F73A 3WEEB 3L95X 1VHFA 4JI6K 4KB1A 3VHQA 2UUCK 3IS9A 4RU2A 3L9ZA 4XDCA 4Y65A 4DV6J 3HI9A 3M9NB 3OTEA 5KFOA 1KQSR 3DRPB 2IHR1 2E5GA 3CC7S 3E01B 4DCJB 2VYPA 4OPJA 1M0SA 2NXJA 3ENOA 3OW2R 4OLPA 3UKUA 2CKWA 3H4DA 2ASOA 1VQ5N 2FSNA 3TVZA 3FQLA 4ES3A 5GAHP 4JI5K 3HVTB 1PJ5A 4FYDA 2VH7A 3UDEA 5KFLA 1JK9B 4Q8EA 3TTFA 1VK8A 1RGVA 2OLWA 2CPXA 1N54B 4AL7A 3IM8A 1S72N 4ECQA 1S6UA 4DS5A 2RDDA 5ETLA 2D9OA 4TU9A 1GLFO 5BXIA 2RVJA 3F9KA 3I33A 3VR1A 1QE1A 3MF5A 1H38A 1HNVA 3VALA 2GJIA 3SUOA 2BACA 4DOZA 2I2YA 1UA0A 4ZTFA 2Y0SD 2YQ3A 2JX2A 4CLKA 4M42A 1N5TA 3UW1A 2GELA 1M5VC 2LXUA 3C46A 4YDXA 3AVHA 3D1HA 3KVGA 2AJ0A 3CC7N 2CNKB 2D3ZA 1VMBA 3Q8QB 4NCGB 3HYFA 4DR7K 4WPAA 1HA1A 2NSBA 3T9NA 5LJ3Y 1EKRA 3C16A 2CWKA 2GS8A 1UVMA 2ROGA 3ATUA 5IT9Y 4K59A 2GX9A 3KHGA 1IWAA 4ATNA 4P72A 1U0HA 2E2PA 5D4LA 1N34F 4FXWA 1S97A 5KFTA 2Q3PA 4I56A 1NBEB 5J2NB 4UY8O 3UN3A 2YNGB 1LXNA 1S10A 1KVCA 5KFZA 2W42A 4CEOA 1ATSA 2FUG9 3CJKA 3C3LA 2DPNA 3CQ8A 1DLOA 2W2NP 3ENAA 5B8HA 3ILLA 5T7BA 3LZJA 4LF4J 2P9EA 1IJJA 3TVKA 2FJBB 4ILGB 5IFMA 1H74A 2O8FA 1A9NB 3V6HA 4B3OB 5A6PA 3NF6A 1IBLJ 2F9JA 2NPFA 2QWOA 4FPAA 4LFAJ 3AXMA 5AQFA 2UVWA 4G65A 4Q8FA 2C2OB 3RMBA 3S8SA 1QVGR 3KXDA 2OPQB 4B9MA 1T9VA 4Y3CA 5KT5A 4IKAA 2UU9K 2HVEA 4YUDA 2MKCA 5LL6Z 2Z4PA 4PY5A 2JEIA 4H0YB 4IOAQ 1RDBA 4USUA 4Y6IA 1ITGA 3NG8A 3C6TB 3MPYA 2DFHA 5AT1B 3LO3A 3JQKA 1BIZA 3GSIA 5KGWA 3NWRA 5FRMA 5BR8K 2GA7A 5FROA 4Z37A 3WXIA 4DV2J 4KGKA 5HN0A 4IRDA 3OV7A 2Z1JA 1RBSA 4WP3A 2E7XA 3JAMY 2QZ8A 2C2KB 1TV6A 3NGYA 1DHMA 2BVZA 1JKHA 2AYGA 1LWEA 1NGFA 4PPZA 3VOVA 3A8YA 1G7CB 1RWXB 2KJWA 1AT1B 3MPWA 2X3DA 5DO2A 2W9CB 1SC6A 3WZ0A 1NB7A 4AXJA 3DGPB 1HNWJ 1FJGJ 2R3VA 4WE1A 3EZWA 2DNLA 5IQ6A 3MM6B 3DDIA 4IO9L 3QDKA 1GNKA 5AQZA 3PV8A 4AHCA 3QBXA 4OI0A 4KAIA 2WSEC 5IWAF 1O6XA 4H5NA 3TX8A 2RQKA 2R7VA 1KFDA 5LJVA 4JRPA 1N8RO 3DXKB 4RPFA 4K8XA 2B5JB 2PMZD 4YQWA 5HRSA 2CQDA 1HR0J 1QQNA 1QZ6A 4C8YA 3MM5A 2BR0A 5AQKA 2F8MA 4XH1A 3U6FA 5E0OA 1QVFM 2F1FA 3C65A 3J7AN 4DTPA 4OHYA 1H6KX 2HFUA 3GE1A 3W63A 3MEGB 4X64K 4UTGA 3FEYB 3BSCA 4ZJOA 3H2LA 4B9NA 3UCZP 1RT3A 4OI6A 4MO4A 1HI8A 4GMJB 5IT0A 3TA0A 3MXMA 5KOWA 1VLYA 1NGEA 2XMAA 3KK2B 2XZWA 4BROA 4P71A 3I5CA 4NXNJ 2P9GA 1XNQF 3M32A 1M5SA 4OYIA 4WIIA 2DNRA 5LT5A 2JEJA 1ASUA 3RUBL 5KFRA 4C0HA 2QC3A 3W5ZA 3H6EA 4DN0A 1S7HA 2E66A 1I1GA 2OTLS 2KU7A 3GILA 2HMIA 2V8DA 1U26A 4DV4F 2CWXA 1UL3A 1T44A 5EX0A 5HBMB 1S6QB 3MMAA 1WTBA 1WNSA 2YH1A 2GMHA 4QJVA 1EARA 1I6JA 2DNGA 4JI2K 4FJIA 2B43A 1RA7A 1S4FA 3TNVA 2LLZA 2VG6B 5EWFA 3R1HA 4NYOA 2RN2A 1N33J 1CXUA 3EVWA 1H2UX 4JI4F 4NA3A 1WG4A 3BZQA 2BJ8A 2ZNZA 3FBBA 7FD1A 3I31A 2FY1A 3PW0A 4J2DA 4HHHA 1AUSL 2E7VA 3DCAA 4KHUA 4O4GA 3VTHA 1QUPA 1FXDA 2W9BA 2KFYA 2P9LA 2DKOB 2ATCB 4IH5A 4RX6A 2FBXA 1UKUA 1D9AA 1OYDA 1E6VA 1KAZA 5KPZA 1LOUA 2KLAA 4CBUA 3VZHA 3UDVA 2R2RA 1U4BA 2FZKB 3TW0A 2IA6A 4J9NA 3IG1B 4U8YA 1J54A 5ELZA 2OSQA 1X5SA 3ILIA 2B0GA 4I4BA 2OTLN 3SNNA 4PXCA 2RQMA 2MQQA 1QAJA 3HLUA 4C11A 1XHXA 2XZDB 3PO5A 1WSRA 3P5TL 1Y0HA 1NSKL 2ACYA 3OVAA 4CK3A 1J5OB 1OMSA 3MCPA 1YQHA 2A41A 1HNXF 5F8JA 1OIAA 4DPYA 4P7VA 5D3GB 1X9WA 4KTZA 4DS4A 4LF8J 2ZJPQ 2DTUA 4IRKA 4NLTA 4H5WA 3CCRS 2QL9B 1VRUA 3ULHA 3HHLD 4NEZA 2RE2A 2VC1A 4LF5F 4B3MF 2HFNA 4CEAA 4C23A 5MLCQ 1FESA 3MFHA 2GQCA 1JL2A 3HHLB 5K9FA 8AT1B 2JVRA 4KIAA 2MLYA 2CIMA 4ZVEA 2EK1A 3NMRA 3EO3A 4PQUB 2CPJA 4GO5X 2CXEA 3MWTA 3VGTA 4CF0A 4C48A 1TU0B 1MG7A 4B8CA 4Z4GA 5B0FA 4L73A 4QPTA 2CPEA 1RCHA 4DKWA 4MKBA 5B0DA 3DLBA 3Q8YA 3ZTPA 3SAHA 1S5ZA 1R0AA 3FEXB 2QA1A 3R8EA 1F2HA 2MKJA 4AL5A 3FRZA 1FD8A 3AD9C 2C2DA 2OZMA 2DH7A 3ENWA 4FF3A 1XC3A 4ISFA 1J9AA 4FKXA 2LP4A 4FLYA 4HR2A 3MX5A 2XSJA 3R7BB 4NYNA 4F0KA 4L8RB 2LEBA 4CIGA 4FWRA 4E1NA 3VF2A 2B4JA 4HH1A 1VQ4S 3CCRN 3ALYA 4YOTA 4RWWA 4LF6K 2DGXA 3UVJA 4WBFA 2GWKA 4LC9B 1UTAA 2RUGA 1YJ9S 2BJEA 4NLGA 2R8GA 3LGHA 2JGUA 5CE3A 4RKUC 4PWDA 4PL8A 2I5JA 2J76E 5KQDA 3MI7X 5CCLA 3R5BA 5J1EB 1UEUA 5HL7L 2PYJA 2SXLA 5J1PA 4YDUA 4DG1B 4KREA 2VWBA 1SQEA 3SQ2A 2RS8A 2ROEA 4IFVB 2HBZB 1OSCA 3US5A 3M6UA 1AFIA 5IC4B 3HKZD 4UF4A 1SAZA 4J9MA 1BWFO 2R2TA 1P1TA 1Z2ZA 3U3YA 2QWLA 4CJ7A 4KHPJ 1S77D 2WONA 3MM7B 4OHZA 2ZBPA 4JK8A 4RTFD 1UVNA 2ADCA 3MPDA 5AQOA 3N5FA 1RT6A 4JI6F 2QWQA 2UUCF 2BQRA 1HARA 3UPFA 4NYZA 3G25A 3PUFA 1VQ4N 4CECA 1HKAA 1VC5A 3QRPA 3T5KA 4R79A 1PIEA 4OJRA 3R6MA 2RUSA 4B1YB 1S1WB 2Q3SA 3MWBA 1YJ9N 2ZC4A 3RW6A 4E2FB 4O4RA 3CIPA 4BRIA 5K14B 4FBUA 2W1BA 1QUVA 3HL8A 1RI7A 1M90T 1HI0P 4ZCMA 3J80U 4DR4K 3FZKA 3FZ2A 5FD1A 1JNZB 4PAAA 3HFVA 4MKYA 4FF1A 3I0SA 3U1LA 3M30A 3KHLA 2J6TA 5HMWA 2OHDA 3W60A 3L7OA 4X2BA 3VA0A 2CA9A 3IAYA 2MHNA 1UFKA 4TXSA 3T1HJ 5CZVA 3N6MA 2DR9A 1B7YB 3RG6A 2EI5A 1UW4A 3F44A 2HWTA 4M5GA 1C0TB 1TKTB 4XH4A 4GKKK 4JI8K 2QSFA 4FYXB 1SC3B 4O3RA 1X9JA 5CA5A 4EAHD 3ETOA 3D66A 4R0JA 4WYWA 4NLOA 2OMLA 3MMCB 3R5AA 2W4PA 2XS2A 5FPNA 1UWAA 2M7SA 1RWMB 3HD2A 3HI0A 1LAWA 3OYAA 3CJCA 2GIRA 4W5TA 1D8ZA 1K9MT 1GOCA 5GIPA 1KTQA 1YLXA 4X4SA 5KT7A 2EHGA 2MQLA 3HFZB 5ETMA 1WTFA 1XERA 1Y3KA 3TOQA 5AXNA 4X4UA 3D1OA 3QEVA 4A8KA 1KQKA 3B4DA 1RWVB 4DR7F 2B51A 4CLTA 3CCZA 4IG0A 2E9ZA 5GVQA 4B3SF 5DETA 3QRRA 1CJTB 4LR9A 2W2PP 5KRTA 4X4PA 5I3UB 4FLTA 3UQSA 3VVTA 1RT7A 4W90B 1S6OA 4EEYA 2BQ3A 2VONA 3NH0A 3QEWA 3BF1A 2NRRA 4LF7J 1J5EK 3V9ZA 1S1TB 3CD5A 4CD1A 3GJTB 4OPKA 4M5JA 1UVJA 4BGAA 1BI4A 4CEDA 2X78A 4E89A 4A2AA 4DV0K 3KJVB 4K5SA 2B8QA 2QO3A 1IKYB 1TYQB 1NWKA 1HYSA 3OUYA 4CQ1A 1U6BA 2HHUA 5C2FA 2YI1A 3F2KA 2P9KB 4Y2KA 4IJNA 2V8HA 3QIPA 3D0IE 1N56A 1OH8A 3V2UC 1UPMB 2Q97A 2MEWA 5E3CA 4M8LA 3I32A 4CFDA 3NNAA 2XYHB 3HSTB 4H0OA 4DR5K 4KPYA 3H7HB 4DU1A 3HO1A 3DLLL 1A5WA 3MR7A 1RP5A 4XDDA 4CEBA 2PAVA 2VQEK 1BCMA 4NL5A 2ZH5A 1S1UA 1N34J 2BABA 4IKFA 4WKRA 2LSNA 3PX0A 2PMWA 3KLEB 4WZQA 3ID8A 4W98A 3KMSA 2C3YA 2IVPA 2YHAA 3BZCA 2D1KA 3OXFA 2ZVIA 2G8KA 5LMUJ 2VBYA 4WTYA 2YNIA 3FGVA 1Y10A 5AE3A 2HK2A 1X5TA 3K9JA 3D0PA 3BJYA 4FM0A 1D0EA 1AROP 1EHWA 1HBUA 3V9XA 1I94F 4DPXA 1FDAA 5AZIB 4O5FA 4N76A 2C3UA 4IEIA 3MTKA 1WSIA 4PKHA 1HHSA 2LDIA 3G8SA 3QGPA 2DNMA 4N41A 2XZTB 4KY3A 3PRVA 3A1YG 4ZVTB 2OD4A 4PG6A 5L9NA 2KXHA 4IUFA 5EXWA 2GX8A 5IM0A 3H45C 4C7QA 1VGYA 3A5OC 2CPYA 3RBEA 1QSSA 1S9FA 4F7VA 3T5JA 2UXBJ 4IOXA 4BRFA 4USWA 2CQ1A 5KFNA 1RT2B 2NXCA 3S3MA 4EZ9A 3NGTA 1UOCA 2DIVA 3GV7B 2XEXA 3F0NA 3NGDA 5CHCB 3VAJA 2NRXA 3CJ5A 1R8AA 4JD2B 4FLWA 4P74A 1K1SA 4Z7YA 4J9UE 1LW2B 1XR6A 5I4MA 1TKXA 3O08A 1TUUA 3E66A 3A8EA 3FGUA 4X64F 1BD6A 4BDPA 1T7PA 1X31C 4AUKA 1OY6A 4ZP9A 4ERDA 3MEEA 2ZBRA 3CJBA 3TA2A 1BL3A 3GR1A 1YVUA 2GV9A 3KWGA 3K9KA 3TR8A 3Q83A 1FKPA 1YZ6A 1D9FA 4LF9K 1A6LA 5HLFA 3R2DJ 3DMJA 3ZT1A 4X62K 3A3PB 3QYYA 3K0JA 3DU5A 3D2WA 2MKYA 4QYRA 5C25B 3OS1A 1HFEL 3BSAA 2QWNA 1FT8A 3RRKA 3S9HA 3J7A1 2ZFHA 3KLGA 1DQAA 4MKAA 5HRRA 2K3KA 1PYSB 4ZVSB 2G9OA 3ZTRA 1WEYA 4UZBA 4DR2F 5B0GA 2QL5B 2KL8A 2B4UA 3SBMA 2G8HA 1YJ7A 3O4WA 2WB4A 2V5HG 2KT3A 2AKWB 3DKDA 2KG0A 5CXTA 3CJTA 1SUQA 2DNQA 2HAIA 2DNYA 5AJ3K 4JI2F 1BA1A 1HRHA 2I7NA 3JYTB 4B9UA 1ASWA 2DGQA 4BC4A 2QLBB 3SCXA 3CM5A 5TKYA 2XS7A 5GAEU 4NYFA 4C8MA 1GX5A 2IDEA 5MLCV 1NMNA 2XQCA 3P5JA 2NXUA 4P75A 4DUYF 3QETA 4NZ0A 2GCFA 5F9LA 3DRRB 3L2QA 1WOPA 3D6RA 2FJVA 2IIHA 2DNOA 2HKEA 2VQFF 3UDLA 4M5NA 5KFAA 1SPBP 1FDDA 3I0RA 4ZPTR 2DO0A 4F4XA 4LRBA 2KVQE 4KI4A 1KSPA 4O8UA 4ZHRA 2NRWA 2O01C 4WWSA 3DM2B 3WBZA 3IDHA 4JI0K 2AIRB 4RW9B 2B7BB 2L41A 2UVVA 3CCUS 1U48A 3LA0A 1W2BR 3K5LA 2FC9A 2I38A 4KBOA 1RHJB 3TWHA 4CM2A 3OTOJ 1URRA 2ZH7A 1RLCL 2U1AA 4WP8A 3R9PA 4JKGB 3FVYA 4KI6A 2XMJA 3FSIA 1OH5A 4A5BA 4CF9A 3DLHA 2O8DA 1NPPA 3BGFA 3BY5A 3OVNA 1VYAA 4RLEA 2O8BA 1TL7A 1T95A 3BDEA 2R42A 1WF2A 1FKOB 4WKYA 1B92A 1C0UA 3ZT3A 3Q8UA 4EHTA 3PSIA 1CC8A 2HBQB 4PR6A 1OPIA 2GIQA 5KFYA 3KD5E 3AT1B 3MHYA 2BUPA 4FWLA 3PM9A 2QA4S 2ASYA 3LM2A 4EP5A 3CDBA 3PZPA 4Z4HA 3T1YJ 2VFSA 2QFJA 1JQGA 1SJRA 1KEKA 3P96A 5HSPA 3SIPB 2D69A 2YH0A 3KD1E 2ZZNA 2HS0A 4IOCL 3EYZA 1NK0A 4TN2A 3LGMA 4J9SA 4OLOA 4NI2B 3W2WA 2G1DA 4LQ9A 2E5HA 2Y9HA 1BY9A 5HQLA 4CHYA 3CCUN 3M8QA 1XMBA 4FDFA 1FTRA 3KUGA 4A4JA 1ZZFA 3A3NB 2ZH6A 3AVAA 4GKJK 3I55N 2E5JA 2QWPA 3TQEA 5BR9A 3SI6A 2FTRA 2X1BA 5CYQB 3TZWA 1RBAA 4P7TA 4LF6F 3HD1A 4M7YA 4EGLA 2LFVA 2VG7A 1FXLA 2QA4N 2VBWA 1U47A 1C1BB