1LWFA

Crystal structure of a mutant hiv-1 reverse transcriptase (rtmq+m184v: m41l/d67n/k70r/m184v/t215y) in complex with nevirapine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 144
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwfA05
1S6QA 1SUQB 1LAWA 5KT6A 1XR5A 1RTJB 3L2VA 3V9UA 4OKKA 4ICLB 2W9BA 1J54A 1REVB 4O0JA 4CJEA 1K1QA 3RMAA 4KHQA 4K4UA 3DRRB 2PZSA 4DL3A 1S9FA 3H4BA 4EO8A 1JLGA 2QE5A 4F2SA 4DG1A 2ALZA 4WXWA 5JUMA 4O55A 1TKZA 3HO1A 3QNNA 4ZP6A 3SUQA 3RR8A 2VG5B 3SQ0A 1HJRA 3ZSVA 5I3UA 4KAZA 3OJUA 1U48A 4DQQA 3HSTB 4IG0A 4FLVA 2ASJA 1TK0A 5DGBA 4XPCA 3NBPA 4IBNA 3THVA 1NK9A 4F2RA 1QSYA 4YR2A 2X78A 1J53A 3GIIA 4Q8FA 3UR0A 4ID5B 4RUAA 3LP1B 4CEAA 4CJVA 2G8UA 2EHGA 3M9OB 2P51A 1UA1A 3CM6A 2W8LA 3DOKA 1LWCB 1RT4B 2IA6A 1NK5A 3M9MB 5JXSA 3DI6B 3M8RA 3G10A 3G6YA 3T19A 1U4BA 2BE2A 4Q45A 4X2BA 4ED6A 3DLEA 2B4JA 3I5CA 1S6PA 3LPTA 3HXMA 2YNHB 5KG0A 4CGDA 2RKIB 3LALA 2Q3SA 4K50A 4UQGA 1KVBA 4LSNA 3H5SA 4QAGA 3ITHA 3OYHA 4DL5A 3TAEA 1KVCA 1TKXB 1RT6B 1VRTB 3G0ZA 4IH7A 4QPXA 4RU9A 1ZTTA 5F8NA 1I6JA 4F3OA 3ICLA 2W8KA 1EETB 4Z4HA 5KTQA 2HWIA 1TKTB 2B5JB 1C0MA 1CZ9A 1JL1A 1S9EA 3KK2A 1SL0A 2W9CA 4KTZA 3SJJA 2FVRA 5KFOA 2G8IA 1IG9A 4J9LA 3V9WA 2GIQA 4M95A 3DYAB 4ECRA 1S49A 1S9EB 3P83D 4FLUA 3M8PA 3I8DA 3KLHB 3SCXA 2BGGA 1TL3B 3OYDA 5J1EA 2RDJA 2O4GA 3SUOA 1MU2B 5KFQA 4JV2A 4AHVA 4CF2A 4PWDB 3VQ9A 3GIJA 3OYCA 1NJXA 1NK0A 4CIFA 1DTQB 2R7YA 3VQ7A 2VG6B 4J9PA 2XY6A 2ATLA 1JX4A 3QZ8A 4K8XA 2D3ZA 3EYZA 4PA1A 3IS9B 4J9MA 3HM9A 2BE2B 4O44B 4F4YA 1BIUA 4NCAA 1FKPA 4DEZA 3BQ2A 2J6UA 4BE2A 4FK2A 4KSEB 5KRTA 3NAEA 2QKKA 3KK1A 3GQCA 1JLEB 4YFUA 4CFCA 1RA7A 2XI3A 5C42B 2P1JA 4MK8A 1ZBLA 3QIDA 4N56A 4FJ5A 3NBPB 1BL3A 1RBTA 1KSPA 1QE1B 3OLBA 4DSIA 1S1UA 5I3UB 1LW2B 3PO4A 3QO9A 1QE1A 4E7IA 4ELUA 2E9TA 1TVRB 1HPZB 2XY8A 3MECB 1RT5B 4TN2A 1ASUA 1O1WA 1BI4B 5KFVA 2IM1A 2WCXA 4H4OB 1REVA 3PW5A 1S1WB 5KFRA 3HPOA 5J2NA 1A5VA 4FZYA 3G86A 1RCHA 3C6TA 4WFYA 4FK4A 2OZSA 1QTMA 1EX4A 1HQEB 4TQRA 2F8EX 1XR6A 4EP4A 5KFSA 4JS5A 4LSNB 4J2DA 3T1AA 2NUBA 2GBZA 4IR1A 4O3OA 4TYAA 4B9VA 3I0SA 4ED2A 3RWUA 2OPRB 3KHLA 3DLKB 2W9AA 4IQXA 3HYFA 3U3GA 3PHEA 4CFBA 4U6PA 2KTQA 2ETJA 3KTQA 4M42A 4NLUA 3E01B 3OYMA 2WTFA 4ELTA 4DTSA 1TP7A 2XGPA 4IRDA 4K8ZA 4CF8A 3O4QA 5J2QB 4FK0A 3U3YA 1EP4A 1WSHA 4ZP9A 3AVJA 1NK8A 1JL2A 5SWMA 1DLOA 3CYMA 1BQNA 4DTPA 3TAGA 3L2RA 1L3SA 3PV8A 4WZMA 3SI6A 1WSIA 3C6UA 3JSMB 1FKOA 4ZPCA 5J2MB 3OYAA 1LW0A 4FVMA 4E7KA 1J9AA 5DG8A 3TAQA 3WNHA 1D9DA 5KFBA 1CXQA 4KFBA 1RT3B 5C25B 1NHUA 2IAJA 1ZBUA 4OKEA 2XO7A 3DOLA 1LWEA 3CDUA 2WOMB 1Z25A 4O3NA 4EEYA 4FJLA 4LQ3A 1Y97A 4XIUA 2GC8A 4URQU 3V4IA 3IGNA 3MR6A 3SV4A 4GC6A 1S1TA 1T8EA 2FVQA 3BGRB 4QWBA 3VQ5A 1RTIB 4JRQA 1RDDA 3RAXA 3KD1E 4E7HA 3HT3A 1RTJA 4Z0UA 3OS0A 5SZTA 3DLEB 1JXEA 5F8HA 2B43A 3F9KA 1VRUB 2V9WA 2FVSA 3BGRA 3KMQA 1UWBB 2WONB 4TXSA 3RTVA 3JYTB 4ECWA 3HP6A 4YR0A 1D0EA 2QKBA 5KFGA 1BCOA 2V4QA 2FBVA 3HVAA 3QGHA 3UPFA 3JYTA 1NK7A 2YNIA 4CHPA 1RT1B 1VRUA 2R2TA 1HNVB 2KZZA 1VSHA 2E6MA 3V6DB 1KFDA 1WSGA 4MQ3A 4LY7A 2OH2A 4IG0B 1BCMA 3K5MA 2HWHA 2FLPA 5KFUA 4AHUA 5KT3A 4CJPA 5J2QA 3Q8RB 2D3UA 2X6SA 1S4FA 3KLVA 4C8KA 4DMNA 4TYBA 2AGPA 2WOMA 4RZRA 3L2QA 3EPIA 4Z4FA 3AO3A 2D5RA 4OGCA 4KHRA 3VN5A 3DLKA 4NYZA 3IN5A 1RDBA 2W9BB 2PYJA 1F21A 4B9NA 4ECUA 3BQ1A 3SZ2A 4KKOA 1S6QB 1SUQA 4FJJA 1NK4A 4MH8A 4FJ8A 4FLTA 2YNFA 3D5MA 2HNDB 2CKWA 3CDWA 2P5OA 2Y1JA 5KFHA 4W5RA 4FS2A 4DSFA 4Y34A 4E7JA 1QQCA 5KG7A 2XCAA 1KCFA 1BI4A 1RYSA 1RT5A 1JLFA 1YTAA 3KMSA 4TSXA 3V6HA 5DGAA 1C0UB 4QWDA 3V9SA 3WNEA 4F4XA 2YHAA 5E41A 1LW2A 5F8IA 2Z1HA 3MR2A 4KPYA 5CZ2A 4O3SA 4Y3CA 2DPJA 1RAJA 3SNNA 4EBEA 3PX6A 1XWLA 3GV7B 4RW7A 2R8GA 3H5UA 1S1VB 3V4IB 3OHBA 2G8VA 5J2NB 3SQ4A 5D3GB 4KAIA 1JIHA 4FS1A 4CEDA 3GYNA 1IKVB 4B3OB 4M3ZA 1HMVB 3V81A 4FJHA 3UDLA 4WYLA 3DRPA 1LWFA 2OPRA 5FDLA 2D41A 3T3FA 4ECTA 4B9UA 2DFHA 1RBSA 4C8LA 1C0TA 5L1JA 3IGVA 3QINA 4CJRA 4R8UB 3BR9A 2XGQA 1D8YA 3I0RA 2FJWA 3AO5A 2XY5A 1EKEA 2VG6A 3AA2A 4J9QA 3IRXA 3KLGA 3NH2A 4OJRA 3DRSA 3CDEA 3KOAA 4BDPA 1J5OA 2C28A 3SFUA 1CSJA 4ZVFA 3E01A 4CF1A 4QWEA 1HYVA 5KT7A 4NCGA 1JLAB 2WRMA 5KFEA 3Q8QB 1G15A 1TQLA 1JXLA 4DTNA 3AA3A 1BGXT 3N6MA 1S5JA 3RMBA 1RT7A 2BR0A 5DQIA 4R5PA 3NDKA 3NGZA 3MEEA 1RBRA 4DFJA 3LWMA 4NRUA 1S9GA 5T7BA 3DRPB 3HVWA 2VG7A 1U09A 4B3OA 4URGA 3OYKA 5EWGA 5KG1A 4HUGA 4WFZA 2XI2A 4C8NA 4NLQA 4F4ZA 4MFBB 3CWJA 1S1XA 4CIGA 3RB6A 4E1NA 3RAQA 2Z1GA 2R2SA 2DFFA 3MEEB 3ASMA 3VQCA 3M8PB 3M8QB 2YNGA 3LANA 2HVIA 5J2PA 1TV6A 4DSEA 5HLFB 3GILA 4TQSA 4M3TA 3VQDA 1JKHB 3I5AA 4DWIA 1S48A 2XHBA 4ECQA 4E0DA 2R8HA 2LSNA 3NF9A 2X74A 4Q0BA 5KFFA 4DF8A 1N6QB 3TAMA 2HMIB 4JLHA 2KFZA 4LQ9A 2WB4A 2G8HA 2IJFA 3I5BA 4DLEA 4ED3A 3V1RA 1DTTB 3TAMB 5HBMB 4RW4A 3OY9A 4ZTFA 1XC9A 2XCPA 1RTDA 2DTUA 1JLCB 1XHXA 3HJFA 4DSKA 4RW8B 4FJXA 1HMVA 1QS4A 4Q44A 1ZETA 4NLPA 4CERA 4PY5A 4FW2A 1CZBA 3EPGA 1CLQA 3AVGA 1FK9A 2IM3A 3OYFA 4FZXC 2ZE2B 4NYFA 5EWFA 4XPEA 2P5GA 2YNHA 4ZVHA 3U6FA 3RB0A 5L1IA 4NLRA 2R8JA 1D5AA 1RT1A 4KB7A 3EZ5A 4FJNA 2F96A 1RT7B 2ITGA 2AQ4A 5KFIA 4I2PA 1OS5A 3VQBA 3T5JA 3AVCA 3TI0A 2IDOA 4FM2A 1KRPA 1UWBA 4ED1A 4WZQA 1WAFA 4CECA 3PR4A 3AVNA 5EWEA 4NZ0A 1YT3A 4HTUA 4ICLA 3H59A 4R0EA 1X9WA 4RUCA 5HRRA 3SUPA 4PUOB 4GVMA 2HHVA 3I0RB 1S6PB 3OL9A 4QWCA 4F3TA 2XWYA 2IOCA 1SH0A 4NLSA 3VQ6A 1HYSB 4NRTA 3BSAA 5J2PB 4CF0A 3PY8A 4KHYA 4IFYB 3M8QA 1S1TB 4CJ3A 4ZHRA 4J2BA 1LV5A 4OLBA 4CEZA 3QEXA 4MFBA 3CJ0A 3ZSWA 3DOLB 4CHZA 3RMCA 1QAIA 2IAJB 4RW9B 1L3VA 1KLNA 1S0NA 5F9LA 5D3GA 3OHAA 3PX0A 5J2MA 5C5JA 4CJUA 3PX4A 3QIPB 1S9GB 3AVLA 4E1MA 4AHTA 2I5JA 1XHZA 3V1OA 3O4NA 1UA0A 3GIKA 3D28A 3QEVA 2VG5A 4CEQA 3VQ8A 4FXDA 5L1LA 4AHCA 2KW4A 2HHTA 2FLLA 4H4MB 4MK7A 1RTHB 4ID1A 5L1KA 4FJ7A 3EZUA 4M41A 4CEOA 4YNQA 2AGQA 1HQUB 4CE9A 1B9DA 2KQ2A 5F9NA 3NH1A 2X6NA 1QSLA 3SPZA 3PW0A 2YKNA 5KFMA 3QETA 3MXMA 4NLDA 4CGHA 4CJKA 4EYIB 4GC7A 1ZBHA 1RT2B 2G8FA 5KG5A 1TL1B 4GMJB 4QOZB 1LWFB 1C1BB 1LWEB 5KG2A 2E9ZA 4M3WA 1IKVA 3RBDA 4KE5A 4ZPBA 3S3OA 3AA5X 4CHOA 1U47A 3QO9B 5KFLA 4E89A 3KLIB 2IMWP 2IS3A 4CJWA 4I7FA 1BQNB 2BANA 3PUFA 5KFXA 3IAYA 2IC3B 2KFNA 4EBCA 3QIPA 4NLTA 4KO0A 3KD5E 1EP4B 3MTKA 1HNVA 3OL8A 4WE1B 2RF2A 4DTXA 4J9KA 2YKMB 4OPKA 3V9XA 3OYIA 1CXUA 4CGGA 1NK6A 3C94A 3A2FA 4F8RA 1ITGA 3TWHA 1TL1A 4KI4A 4ECYA 1L3UA 4FCYA 3NF6A 4DTRA 2WONA 5T14A 4IFYA 5HRNA 1Q9XA 2C2EA 2XC9A 4MKAA 3WNGA 1HQEA 3L8BA 4CJ4A 4LH4A 4C8OA 4H54A 3DLRA 3NHGA 3AVMA 2YV0X 2D0AA 1NKCA 3OSPA 3H40A 1ZBIA 4Z4IA 3HVTB 1IKWB 4E7LA 3MECA 3ZSQA 4M3RA 5J1EB 4FJGA 3FDSA 1X9MA 4OLAA 3KLHA 4EZ9A 3OS1A 4AH9A 2FVPA 1A5XA 3MEDA 1ZBFA 3OYBA 2AX0A 3AVBA 2R8IA 4FLWA 3V6DA 2B5JA 4BDZA 4ED7A 4LD0A 4YMEA 1VSDA 4YR3A 4IG3B 5JS1A 4HUEA 2JC0A 4ZP8A 3VQEA 4KHWA 1TKXA 2VA3A 3HVRA 4BE0A 2HB5A 4NLXA 1BISA 3N6LA 4IH6A 4FYDA 1S0OA 1TGOA 1BIZA 4CGIA 2AU0A 1SKWA 2RDIA 3GV8B 2DPIA 1TK8A 5C24A 1NKEA 1IH7A 3NGDA 3IS9A 4CFDA 4TY9A 4DSLA 4B9SA 4PUOA 2ZE2A 3TARA 4CGJA 3MEGB 5I42B 2FJVA 2FBTA 1FK9B 4IRCA 1S1XB 5HBMA 4PWDA 1MMLA 4TY8B 3C6TB 4N41A 4ECZA 2JEJA 3OSNA 1GOCA 1TL3A 3LZIA 3RBEA 4BWJA 3KLEA 2VG7B 5CYQB 1KVAA 4DS4A 4RW8A 4N47A 4FM1A 5DG9A 5DQGA 3OYEA 4DFMA 4B08A 2FBYA 4FLYA 4NYNA 1JLQB 3NFAA 2AWZA 3MXJA 3MEDB 1TV6B 4R5PB 3VA0A 2JEIA 1S1UB 4DQRA 4IH5A 3L3UA 5KG4A 4J2AA 1GOAA 4NCGB 1IKXB 3QIOA 3K5LA 1RT6A 2OPQA 4WYWA 4CJFA 5C42A 4ELVA 1N56A 4KHMA 4ZPDA 3ZSOA 4DQPA 1RNHA 2A1RA 5EU7A 1HARA 3VQ4A 5KGXA 1LAVA 5KFYA 3PW7A 3AVFA 2CJQA 4E3SA 3KKRA 4LH5A 1JLCA 1C0TB 5HP1B 4CHYA 4O44A 1WNSA 2ZD1A 3VQPA 3QERA 5F8LA 3BSNA 4GW6A 4DQIA 2IM0A 3VA3A 3V81B 4I9QA 3LAMA 1QUVA 3PJXA 4K4ZA 4M3XA 3K5NA 2YKMA 2D0BA 1N6QA 1L3TA 4DU4A 3DRSB 4NLOA 1WNEA 4RNOA 1KLMA 3TR8A 3PVXA 2B6AA 2FVCA 4FLXA 4RNMA 4DFPA 5KT2A 1JKHA 4KHSA 2IC3A 1TVRA 5KI6A 4TLRA 4Q8EA 3ZT2A 3SFGA 5DMRA 1U45A 4FJIA 5HRPA 5KRSA 2YNGB 3H2LA 1WSFA 3CQ8A 5L9XA 4HCBA 4N76A 2OA8A 2BQ3A 4RW6B 2XY7A 4M45A 3SI8A 4KTQA 3KLEB 3V6KA 3PJWA 2R2RA 3OLAA 1RT2A 2DFEA 4EBDA 4J9OA 4KB1A 2PY5A 3DM2B 4I2QB 1W0HA 3V1QA 4ZVGA 1TAQA 1VSFA 4NLYA 4IKFA 2HNDA 3D45A 3ITHB 3GIMA 4DS5A 1SV5B 3LP0B 4AILC 2OYQA 4XO0A 4K4VA 1IKYB 2C22A 1RDRA 4CK1A 3L2UA 3DLGA 3VQAA 3OS2A 5DK5A 1JLBA 2BQUA 4BE1A 4DU1A 3KLFA 4B8AB 3ZSRA 4FLZA 1WAJA 3SQ1A 4M3YA 4ECSA 1WSJA 2JLEA 5KFJA 1YVFA 4EP5A 4F4WA 4QW9A 3PW2A 3P5JA 2BRKA 3QEPA 1IM4A 4J9SA 4M94A 4QCLA 4MIAA 4ECVA 3LP1A 1XR7A 4OGEA 3CM5A 5K14A 4I9LA 4CEBA 4N5SA 2BDPA 4DQSA 1NJZA 3F73A 4IRKA 3HPGA 2W7OA 3QEWA 2C2RA 1JLQA 1X1PA 3RMDA 4H8KA 2W9CB 2YNIB 1TKDA 4RW9A 2WHOA 3FQKA 3KK3B 1A5WA 4W5OA 1Q9YA 5CYQA 4BACA 3ZSYA 3AVIA 2G8KA 3HVTA 1VK0A 3RRHA 4J2EA 4RW7B 3ZT4A 2F8TA 2GV9A 2D0CA 1W25A 3MEGA 1XI1A 2E4LA 2RKIA 3L3VA 1NOYA 3HL8A 4DF4A 3DMJA 4Z4EA 3H4DA 1ASWA 1R0AA 4WFXA 4CJ5A 3NH0A 2PYLA 3AVHA 3PO5A 2J6SA 2A1SA 3DOKB 4Y1CA 4HVJA 3TQ1A 3V9ZA 4M3UA 2GIRA 4EYHB 3IG1B 2BQRA 5FRNA 1RT3A 5C25A 1SKRA 2YNFB 4FW1A 4MIBA 4KV8A 2QV6A 1K6YA 5KFKA 5KFWA 2ZKUA 3DLHA 3C6UB 4KHUA 2HHSA 2BANB 1S0MA 3HK2A 1HNIB 5KT4A 5KFDA 4HYKA 1EXQA 4CCHA 3ISNC 3QZ7A 2R2UA 1S10A 4DL7A 2FC0A 5CYMB 3S3MA 3QYYA 4Z4GA 1JLGB 2IJNA 3ISND 3QEIA 4DL6A 3VQSA 4KFBB 4ZMMA 1HNIA 3B6PA 2HNZA 3KLFB 3BREA 3QGGA 1NOZA 4CJSA 4IDKA 3I0SB 3K58A 1N4LA 3JSMA 4O3QA 1BHLA 2YKNB 4KREA 3T5LA 4LSLB 1N5YA 1T05B 3KJVB 5EUHA 1ASVA 1I3AA 3QESA 1HQUA 2JC1A 4Z4CA 5KT5A 2HMIA 2Y1IA 4HKQA 2HHWA 3K59A 5DG7A 3TABA 4H4OA 4I2PB 1HRHA 3AVAA 4DTOA 4O4GB 3O3GA 3KK3A 4FJ9A 2IGIA 4MKBA 1RDAA 2I1RA 3DMJB 1IO2A 4NLWA 4C8MA 2UUWA 3AO2A 3VQQA 2KZMA 3CFPA 2OPPB 4OPJA 4JV1A 2DY4A 4MK9A 3G6VA 1SV5A 3P1GA 4WXOA 4K4YA 1Z26A 1D1UA 4FM0A 4K4XA 2ZQBA 1Q8IA 3LZJA 3KK1B 2VWJA 3OL6A 4FJMA 4KTWA 1WLJA 3SV3A 4O0IA 1GOBA 2ZD1B 1JLBB 1D9FA 1WN7A 1LW0B 4W5TA 4CGFA 1TAUA 3ZSZA 3BSOA 1C6VA 3HP9A 4HCCA 3LP0A 4DTJA 4RW4B 5KFCA 3CG7A 3NE6A 1DTTA 1C1CB 1GX6A 2F8SA 3FRZA 4IFVB 3NGYA 3HPHA 4G1QB 3DM2A 4I2QA 4O3PA 4CHQA 3HKWA 1KLMB 1J5OB 4JV0A 3MFHA 2OPSB 4Q0BB 1VSKA 1JLEA 1RTHA 4QW8A 4G1QA 1VSJA 1HPZA 3BQ0A 5KFZA 1NKBA 3MR3A 1SL1A 1RDCA 1VSEA 4O3RA 3K57A 4FJKA 1VSIA 4KHNA 1RBUA 2RN2A 4QWAA 4CEEA 5F8GA 3CJ2A 3FFIB 5HROA 1IKYA 1T7PA 3CVKA 3S3NA 2ASLA 3QNOA 3AV9A 3KK2B 5KG6A 3LPUA 1RILA 3RRGA 5FROA 2B6AB 4E19A 4Q5VA 1NJWA 2V4RA 1BQMB 1S1WA 4G3IA 3OYGA 5KFNA 4ZPAA 2Z1IA 3H5YA 4J9RA 2OPQB 2HAIA 3ULDA 3ZSXA 4CJQA 4DU3A 4EZ6A 2HHXA 1MU2A 5JS2A 1IKXA 3OYNA 2HHQA 4RW6A 2J6TA 5I42A 2JEGA 3O3FA 2HVHA 3FQLA 1FKPB 3WNFA 1HYZA 4HUFA 3FSIA 4K4TA 3V6JA 3RB4A 4K4SA 5C24B 4OVLA 4KRFA 1JLAA 3NL0A 3N6NA 3DI6A 1KFSA 4Y1DA 1RTDB 4B9TA 3ZT3A 3NF8A 3NAIA 3M8SA 3NF7A 3LAKA 3CJ3A 2QK9A 1TK5A 1VRTA 5DLFA 1GX5A 3B6OA 1C2PA 3MR5A 3NGIA 4LSLA 4BDYA 1UOCA 4ID5A 1U04A 2ATQA 4DFKA 3ZT1A 4FZZA 1NJYA 5FRMA 1VSMA 4YQWA 4W5NA 4CEFA 3OL7A 3DYAA 3AA4A 4CFAA 5FDLB 5HLFA 4RNFA 1Z4UA 5KFAA 2O4IA 3OJSA 2WK4A 2JGUA 2HW3A 3RR7A 3BJYA 3UIQA 3AO4A 1DTQA 3KKSA 2BRLA 4O4RA 2RPIA 4ECXA 1RA6A 1IKWA 2ILZA 3KIOA 1I39A 4TY8A 1B9FA 3AO1A 3DRRA 4EO6A 1X9SA 2GUIA 3H98A 4CIEA 4CHNA 2E6LA 3MAQA 1ZYQA 4URSA 2XRIA 2V0NA 4FBUA 3CJ5A 4Y2AA 4DTMA 1YTUA 4ZP7A 4KV8B 2W7PA 3SUNA 4CJTA 5HROB 3CFRA 1ZTWA 3SPYA 4RNHA 1T03B 4DL4A 4YP3A 1NHVA 3IG1A 1TKTA 3CO9A 4JUZA 1QSSA 4O4GA 3Q8PB 1EETA 2EX3A 4NCBA 3MXIA 4AHSA 2JEFA 3DDKA 4BWMA 1TKZB 1YVUA 4JS4A 2FLNA 1T05A 1N5YB 2OZMA 3RB3A 3NAHA 3OYJA 3PR5B 3G6XA 4OL8A 3IRXB 3KLGB 3K5OA 4IG3A 1KTQA 3CIZA 4JRPA 4DLGA 4DSJA 4CJLA 4KKOB 2FJXA 5KGWA 4IOBA 4J9NA 2UVRA 3DLBA 5CY4A 4Q43A 4IFVA 3HHKA 4KBIA 4B9MA 2UVVA 4IDKB 1QHTA 4CK3A 2HNZB 4R8UA 1RYRA 2QXFA 3NKYA 3KHHA 3K2PA 1UAXA 5CZ1A 4W5QA 2R8KA 1SKSA 2VA2A 3PW4A 1RT4A 1LWCA 4PQUA 2VWKA 4IR9A 4OKJA 1C1BA 3KHRA 3QLHB 1BQMA 3H5XA 1S1VA 3CJ4A 4KI6A 5EDWA 4KO0B 5F8JA 3TAPA 3TANA 2Z1JA 3ALYA 4ED8A 3D0PA 2UUTA 2FBXA 1DLOB 3FFIA 3KLIA 3LP2A 1T3NA 4DL2A 4RG8A 1C0UA 3TVKA 2YHBA 4DG1B 1K1SA 4K4WA 1W9HA 4ED0A 2HNYB 3OYLA 2OPSA 2RF2B 1C1AA 3QGIA 4ZTJA 2W42A 3MF5A 3S9HA 4O5BA 4Y2CA 3KHGA 3LDSA 1RBVA 1U49A 4U7CA 5F8MA 2IM2A 2ASDA 1C1CA 1QAJA 5KG3A 3EY1A 4DTUA 3UQSA 1NNDA 2ILYA 1B92A 3LP3A 4ZVEA 3TAFA 3C95A 3BDPA 1RTIA 3NMAA 1FXXA 3LWLA 5DLGA 3Q8SB 4NLGA 5KFPA 3GV5B 4F4KA 2EC0A 1N48A 4H4MA 4PQUB 5CYMA 1KHVA 3BSCA 3E51A 1L5UA 1SH3A 4WE1A 4NLVA 2IBKA 2AJQA 4HHTA 3LP2B 1KHWA 4L8RB 1FKOB 1JXBA 4RNNA 3H08A 4B9LA 4CF9A 3T5KA 2C2DA 4FBTA 5K14B 1VSLA 4I7FB 2I5JB 3O3HA 2OPPA 3CFOA 3AVKA 1S97A 3ZT0A 2E9RX 3KNAA 5HRSA 2O5DA 4F50A 2AGOA 5DQHA 2HNYA 3QLHA 1JLFB 3ZCMA 1SH2A 1SL2A 5KFTA 2AX1A 2G8WA 3NCIA 2D7SA 3M9NB 3OVNA 2HHUA 2UVUA 4KB0A 4AHRA 1T94A 3L2WA 4IKAA 4ZHRB 3KJVA 4B8CA 3DLGB 3SQ2A 5HP1A 3T5HA 1T03A 2UVWA 3PZPA 1WSEA 1R0AB 4CK2A 3MFIA 1HYSA 4CESA 3SYZA
chains in the Genus database with same CATH superfamily
1UW4A 2M70A 3PYEA 2LLZA 1IXKA 3B4MA 3CCMN 5DS7A 5KT6A 1XR5A 2CJXB 2GVZA 3L2VA 3S8SA 2F4VF 5A6PA 1J54A 5GAGP 1RJJA 4AD6A 2PZSA 4MIWA 1KKHA 1HHQA 2ZDPA 5JUMA 3BDEA 3D68A 2A10A 2W6KA 3QAEA 2AIRB 1OQ6A 3P96A 4DV1K 3RR8A 2W6LA 3CULA 3SQ0A 1HJRA 3ZSVA 2KI2A 3OJUA 1U48A 4TVAB 4OYOA 4FLVA 4Y0WA 4JKCA 5DGBA 4XPCA 5HMZA 2Q0UA 1RDUA 2VU5A 4NO7A 4YR2A 5LMUK 3UR0A 4ID5B 4CEAA 1R8BA 3CSKA 2EHGA 3M2RB 4JKGB 2W8LA 3GYGA 3DOKA 1NLVA 2IA6A 3DU6A 3QWPA 2OEMA 3EICA 3TA0A 3T19A 2BE2A 3CCWA 4IOCL 1S6PA 2LQ9A 2YJEA 2BABA 5AE3A 5KG0A 2RKIB 3LALA 3RRKA 5I9EB 1KVBA 3KG0A 2EWHA 2QFJA 1M0SA 3SK3A 2NPFA 1KVCA 2O8CB 1RT6B 1Q78A 3RSEA 3M1VA 4CO1A 3G0ZA 1LKZA 4IH7A 4C48A 4RU9A 1ZTTA 4ZLJA 4F3OA 2DCUB 2W8KA 4Z4HA 4AT1B 1N33K 2ZOFA 1JNZB 1B99A 4WK1A 4X4QA 1JL1A 1S9EA 3SJJA 2FVRA 2OJ3A 2G8IA 1IG9A 4DDFA 1EZZB 4ECRA 8RUCA 3P83D 3SCXA 3KLHB 2VFVA 2VDIA 3MMAB 3UNYA 3DDIA 3MX5A 3MPWA 3OYDA 5GADI 3VVTA 3FMBA 3W8PA 2DRAA 3W3SA 2Z57B 2YI1A 5EHHA 1Q7YT 3VQ9A 1IG8A 3M8YA 2Z2MA 4CIFA 1DTQB 2BJ1A 4LREA 1TR0A 1R59O 1RK8A 2ZJPL 2L08A 2IVFB 4JBCA 2D3ZA 3J7YU 4PA1A 3GPAA 5K20B 4NCAA 4IQMA 3H2VE 5EVZA 4BE2A 4KSEB 1EKSA 4B3TK 3L7UA 1GT8A 2YWFA 2ROPA 1TYQB 1ZBLA 4JNEA 1HNWK 3NBPB 2R4FA 1BL3A 1RBTA 3RG6A 1VK3A 4H0YB 3MCNA 3D6FB 5LXRA 3ZZTA 3WXLA 1S1UA 1Q16B 2GO9A 1LW2B 1Q5VA 3QO9A 2QL5B 4HLBA 4C11A 2E9TA 1I5OB 2BUNA 1LCUA 1HPZB 2QT7A 1NGAA 1YQHA 3QBXA 3Q2SC 2IM1A 2WCXA 4H4OB 1G1XA 3MMBA 2M88A 5HJYA 1N36J 3G86A 3TOQA 4WFYA 4ZPTR 3GR1A 4FK4A 2CQBA 5ETQA 4I68A 2F8EX 3TPQA 5KFSA 4RBVA 4JS5A 3T1AA 2NUBA 3MM9B 4TYAA 3I0SA 4ED2A 2B4OA 3DRYA 2DIVA 4GV6A 3PHEA 4U6PA 2ZITA 2F9JA 2D9OA 1VQLN 2BKOA 4JI5K 1X4GA 4DTSA 5HK4A 1TP7A 4K8ZA 1OYDA 1QQOA 4P2FA 2ZGYA 4RBTA 3ILIA 4QZVB 1VC5A 5FPNA 4ZVRB 4DN9A 5SWMA 1DLOA 5AQUA 2FPHX 2DNYA 2K3IA 2GWKA 3I9ZA 4DR5K 4E7KA 3TAQA 2G1DA 3OXFA 2ZH2A 4B1UB 3SQGB 4K0KJ 3VHQA 3KDNA 1CXQA 3MCOA 4LF7J 5C25B 4DR6J 2XO7A 2NZTA 3LM2A 3DOLA 5AQIA 1WI6A 2WOMB 5BPNA 4LQ3A 1Y97A 4XIUA 4M7YA 1NU4A 5A2QO 4URQU 2LU2A 1ZZFA 1S1TA 3OPKA 4A46A 5AQRA 3BGRB 1QZ6A 1PBAA 3RAXA 1O13A 4DV7K 3A8KA 3J80O 3KD1E 4KGMA 4YOEA 3OBIA 1CJUB 4GKJK 4MKYA 2MJUA 5SZTA 3UB5A 2MJNA 3QNWB 1VRUB 4KT0C 3ENWA 2C2MB 4GV9A 3I56S 1J27A 3M32B 2OCEA 3HVAA 3UPFA 3JYTA 4ZPWR 1NK7A 4PWUA 2I7NA 4RWTA 4CHPA 1PGZA 3NOCA 1T3OA 4DPOA 1VSHA 3HJVA 1KFDA 5HVGA 3Q23A 2F4FA 2HBRB 3MM8A 5KFUA 4DV6F 3UKUB 3U02A 3O8MA 1KWMA 1MWKA 2BZ2A 2G9OA 2X6SA 1S4FA 4C8KA 2AGPA 4RZRA 1HBUB 4Z4FA 2XLIA 3BPSP 1HNXF 1RDBA 1F21A 4B9NA 4ECUA 1HBMA 5LMUF 1NDKA 4I1TA 4FJJA 2Q31A 4LF8K 2YNFA 3D5MA 3P5BP 2HNDB 5A6WA 1JCGA 3CI5A 2MKYA 2XZTB 4E7JA 1QQCA 2VWBA 3JXUA 5KG7A 2V4JB 2DB1A 2AJ1A 1WBDA 1WC0A 4O23A 1RYSA 4A57A 2LEAA 1JLFA 1NXIA 1YTAA 1OY9A 3V6HA 1C0UB 3QJPA 1WWHA 2Z1HA 1UMJA 3MR2A 3AOBA 4KPYA 2KT5A 3MK6A 2MQNA 2PT0A 2D74B 4YOWA 1RAJA 4KH6A 4WF9L 3HZEA 2HBKA 2KRRA 5C2CA 3V4IB 2G8VA 3JTPA 5J2NB 2XO6A 3M6GA 4FS1A 3GYNA 3CCLS 1HMVB 4FJHA 4G1PA 1CC7A 2AEFA 2AYBA 4KH4A 4DN0A 2OPRA 5FDLA 2D41A 3PEJA 4C0BA 3ZTQA 4JI7J 4WQ5C 2L48A 4C8LA 4QYZJ 2FTRA 2E5JA 1KD1T 1WTFA 1YG0A 5L8RC 3I0RA 2FJWA 3AO5A 5G0RA 5G4DA 5HVFA 2MZTA 3GL1A 4A5AA 2VG6A 1Y5LB 3OA9A 3AA2A 2LXUA 3VGKA 2UXCK 3DRSA 4OYMA 4KHPF 4ILGB 3BKUA 2ZBPA 2AYGA 2XZWA 5KT7A 4NCGA 1RGIA 3AA3A 3BBCA 5HMXA 4CH7A 1O6XA 3RMBA 1VR6A 1RT7A 3NDKA 3NGZA 4NE9C 5DZ7A 4ZKAA 2P9PB 4I0WA 1X4FA 2ZUAA 4PKDB 1S9GA 3E3XA 5HJXA 1EJ7L 2IDLA 2QTDA 1YGYA 2KM8C 2HSTA 1SBRA 4CIGA 3HZGA 3RB6A 3JSYA 2R2SA 2DFFA 5M1PA 4DR4F 2CNOB 3MM6B 5J2PA 4DSEA 4HI1A 1MROB 5D0GA 3SSSA 3M30B 1U0SA 2H5IB 5MLCV 3VQDA 2DNGA 1OO0B 1JKHB 4NXNJ 3AQPA 4FOIA 4ECQA 1VQ7N 1GEHA 2V4JA 4Q0BA 4NXMK 3TAMA 3ILJA 3RUBL 3G82B 5AQQA 2KFZA 2WB4A 4DCJB 3I5BA 1DAXA 1DTTB 4OO1J 2NS1B 2EFQA 4ZTFA 2KJVA 4LF5J 2DR7A 2WFBA 2H4YB 3OFEA 2DTUA 4P7VA 3O9TA 5GAHI 3DOMB 2F65A 4P72A 1XC3A 4FJXA 1HMVA 4B3TF 2IYGA 2LQBA 1QS4A 5M2PA 1ZETA 2P6TA 4QJVA 3N4QA 2FXUA 3TU5A 1BUPA 1W26A 2DXEA 2RRAA 3EPGA 4DV4K 2YHXA 1K0VA 1SIZA 2GQCA 3OYFA 2V63A 2IJRA 1TZ0A 2ZE2B 2OI2A 3TRGA 4CLKA 2P5GA 2YNHA 3CJBA 3LOUA 2CZ9A 5A8RA 4NLRA 3MM5A 3DJCA 2KN4A 3A3NB 2MY7A 2AQ4A 2IDOA 3W0LA 4ED1A 3OTOF 3C7NB 1NM1A 3AVNA 2CH6A 3U9ZA 4NZ0A 1F6TA 2QWPA 4A48A 4LR8A 4EGLA 1X9WA 3IRWP 3SUPA 1RBAA 1S4EA 4GVMA 2HHVA 2ZBCA 4F3TA 2IOCA 4F0HA 4NRTA 2CQPA 1HNZF 1S1TB 3OW2R 4CJ3A 3AJDA 1KP6A 1VS3A 3PEHA 4IEEA 2EFOA 3R2CJ 3DOLB 3IFRA 3U4LA 1TTHB 4XDCA 3CMAN 3R27A 1L3VA 2E1CA 5HL7Q 3GSDA 1OVYA 3QIPB 1KC8T 2PD1A 2X1FA 3S01A 1EARA 4XTTA 2VC1A 3FE1A 1LNQA 3D28A 5C15A 1SIWB 2VG5A 4CEQA 4E8UA 2NXEA 1VOMA 2CDRB 2VQEF 4C23A 2M7SA 3KUHA 3GFYA 3H0PA 4B1ZA 1RE1B 3M6UA 2NXNA 4H4KC 4OZ1A 5F9NA 1QSLA 1RQ0A 2PN6A 1NNEA 1TUWA 2VYPA 2VBXA 2WW8A 4NWBA 3MXMA 2VV5A 5IQ6A 2HEKA 3C16B 4EYIB 1VQ4N 3IFEA 3O6QA 3B8HA 4P75A 1C1BB 3BYPA 3BR8A 2AEMA 4ISEA 2FZCB 1IKVA 3RBDA 3THXA 3I32A 3HX9A 4ZPBA 1U1NA 3S3OA 4C11B 1Q1KA 1U47A 3QO9B 2OMOA 2IMWP 3G87A 1VAZA 3J7Z5 3PCOB 2IS3A 1EKRA 5KOXA 2BANA 3PUFA 3IAYA 4TNOA 2KFNA 2GIFA 4EBCA 3QIPA 1RFQA 2AEJA 3MTKA 2XMTA 4DCHA 3QB0A 4OPKA 4DPTA 1CXUA 3UCUP 3A2FA 2M9KA 3QPIA 3PFOA 4ECYA 3CF5L 2IA0A 5HANA 3H46O 1P1LA 4CTAA 3NF6A 2DH9A 2E5LJ 5HRNA 3JS9A 3QFHA 2V2ZA 2ERRA 1AYEA 4OX7A 2R7VA 3M4XA 4KIAA 3J7A1 1XNRJ 2UXBJ 4H54A 3BGUA 1D8ZA 2YV0X 2D0AA 3H40A 1C0FA 2FLOA 3SJHA 5LJWA 2Z30B 1IKWB 4FP9A 4YY3K 1HQ2A 3W2WA 3KLHA 1ZOTA 2LQ5A 2AJ4A 1A5XA 1Q82O 4H03B 2GMJA 1FDBA 3MMCB 3QT8A 3PSIA 2UXBK 5DDQC 2J4RA 3KUGA 3JXOA 1CEZA 4FLWA 3H8YA 4BDZA 4YR3A 1GXUA 2VBZA 1MWQA 4LRAA 2RE2A 5CE3A 2QMXA 1V6HA 3M1VB 2M3DA 1FD8A 2V6AA 1UJ4A 2VA3A 1DRZA 1VHFA 3H25A 2DGWA 4YOTA 3QRQA 4IH6A 4FYDA 2FD2A 1S0OA 5JMVA 3GV8B 2QYCA 2DPIA 3CD7A 1X4HA 1WG4A 3NGDA 3UE5A 4CFDA 4WFNQ 2E7XA 4B9SA 5KQ8A 4PUOA 2ZE2A 2RVJA 3NVKA 2HIYA 2VZ9A 4CZMA 1YAGA 2FBTA 4IRCA 4JI0F 3SIPB 4A2AA 3MPYA 3IMXA 3D6RA 3SSRA 4RWXA 3MDFA 3L6QA 1E6VA 3RBEA 5CYQB 1G4CA 4CI6A 5A8KB 3O9QA 4N47A 4FM1A 2VASA 4KR0B 4BRNA 4B08A 4HHUA 3WHIA 1V4SA 4CZJA 3MEDB 3AAQA 1OWXA 2DJWA 1U6ZA 1IJEB 3CO0P 3MOZA 2XQCA 4IH5A 3L3UA 4A8QA 4NCGB 1IKXB 5B8HA 4JI3J 1RT6A 2CIMA 1NUEA 2APOA 2CRLA 4WYWA 1EHWA 5C42A 2UUCJ 4ELVA 1H1VA 3ZSOA 4DUZJ 5AR0A 5ADXH 1R8CA 4JI5F 4P52A 2F4VK 5A0YB 1RNHA 1GMUA 3FZKA 2DBBA 1HARA 1LAVA 2CA9A 2VFTA 2ZM6J 3M8ZA 3N5BA 3P8BB 1U6BA 2LKZA 3MXHP 4PZVA 3CD0A 5GAGU 3WZ0A 4LH5A 4LF8J 4CHYA 3P4IA 4L73A 4PYDA 4UOGA 4JK9A 1FJGK 3OUYA 4DR4J 1OYEA 5GMDA 2HOEA 4M3XA 1WELA 1BDGA 4XH1A 2KFYA 3J7ZO 7AT1B 1L3TA 3DRSB 1WNEA 4X64K 4RNOA 1HI8A 3QWUA 3TR8A 2FVCA 2E8AA 1TVRA 4C3KA 4Q8EA 1KQFB 3SFGA 3H2LA 4LBIA 2BA9A 4N76A 3HFKA 2Q43A 1M5OC 4USMA 4B02A 3V6KA 4DPYA 1E6VB 3O9SA 3OLAA 4J9OA 1WD6A 2O8BB 2PY5A 5M2RA 4I2QB 1WG1A 1TAQA 4IKFA 2HNDA 3D45A 1G99A 1EQMA 2GJIA 1HFEL 2HG4A 3GIMA 2FJDB 4AILC 2X3GA 4K4VA 2MQMA 3G4SS 3BM7A 3EKSA 3OS2A 5JICA 4BE1A 1Q95G 4DU1A 3KLFA 3ZSRA 2XMAA 9ATCB 3CJAA 1QJHA 1WAJA 5HN0A 3OR1B 3WIUA 3M5RA 4WF9Q 5AQMA 1HBUA 3RW7A 2C3OA 4F4WA 1RB0A 3PW2A 3GSIA 3P5JA 4W98A 3QEPA 4P74A 1S79A 2GAHC 4V1Ak 4PKHA 2NSBA 3LP1A 5JJBA 3MM8B 1HPMA 2Z2LA 3UN2A 5K14A 3J81O 5ITHA 1WACA 3TO8A 2BDPA 2JVOA 4AFFA 2YQ0A 2ATCB 3F73A 3D1QA 2ZH3A 3HPGA 3AB4B 2WAQD 1JLQA 1X1PA 4LVNP 2W9CB 4F02A 4NOHA 2DNOA 2FQQB 1FE0A 2V8GA 2LYVA 4N8OA 3D3BJ 3TVYA 2G8KA 4CD3A 3KJNB 4JI6K 2C3MA 4RW7B 1XJWB 3CD6S 5D0RA 4AE5A 4LFCK 2D0CA 1W25A 3MEGA 2OFGX 1ZAWA 2P2CB 3L3VA 1HBMB 3HL8A 5TKWA 1CJUA 5HQLA 4TKTA 3DMJA 4Z4EA 3LGNA 4UUXA 1R0AA 4WFXA 4PR6A 2B9WA 1ZA1B 2DR5A 2IMOA 4CTAB 3PRDA 3HCXA 2VKRA 2BJEA 4ZVPB 1NGCA 3VF6A 3TQ1A 2OO4A 5FRNA 3PXGa 5C25A 3DWLA 3TEGA 3VAKA 1G7CB 5KFWA 2CQIA 3DLHA 5THWA 2X1BA 2ZBQA 2HHSA 2BANB 2EFPA 3GJSB 4JD2B 3CJCA 1N36F 2WVEA 3SCLE 1FXLA 1NCLA 1XMOJ 4PKGA 2BACA 3CW2C 1JCFA 1S10A 3S3MA 3QT5A 3QYYA 5AQXA 3ISND 3MUTP 2V2QA 1JK9B 2HNZA 4TU7A 3CMEN 3QGGA 1S3XA 3I0SB 3EM1A 2LFVA 3U9DA 1NGBA 3IAS9 3ZLJA 1G6BA 3B82A 3AT1B 3SEOA 1ULRA 4ZPVR 4FYWB 2C2ZB 3KJVB 2CQ2A 3QESA 2HMIA 2HHWA 2MZQA 5DG7A 4H4OA 2ZEJA 1EQYA 3JTNA 3F2KA 5A76A 2ZJPQ 3J7YI 3W8GA 1CULB 5A2QU 2PFDA 4UY8T 2BM1A 3VQQA 4OJGA 5J1PA 4OPJA 4JV1A 3THWA 2DY4A 4BHQA 1H73A 4WXOA 1FFWB 1TL4A 2NR0A 2UUAK 3RGIA 4K4XA 2ZQBA 4BQLA 2MKCA 4OX8A 4USTA 3LQVA 3EUNA 4IJAA 1XMQJ 4FWSA 3UI3A 1R6VA 2IYIA 5K5MA 2Z2YB 4KQZA 2ZD1B 2KB2A 1WN7A 1MNEA 4IWVA 1HWIA 3O08A 1RWVB 1ZA2B 3VETA 1OVQA 4IFVB 1QVFR 1HBNB 3M8WA 5AXNA 1KLMB 4CYUA 2QWQA 2MQ8A 4JV0A 3HSGA 2X3DA 4L72B 1RTHA 4G1QA 2E2OA 3HHNB 4JYAF 5CR4A 3MM7A 3QMQA 3R7NB 1HPZA 1IJFB 4CBWA 4HHJA 4YOUA 1NKBA 2CQCA 2V8HA 4FJKA 2RN2A 2JFKA 5D6GA 1QHAA 5F8GA 1AW0A 4NASA 3CVKA 2QW9A 1QUPA 3GJRB 2ASLA 1TUVA 2XS5A 3AV9A 3JB9k 2X7IA 3RBXA 2B6AB 3BN7A 5FROA 4E19A 3SMSA 1XMBA 4A5BA 1BQMB 2EBEA 1S1WA 5C7PA 3B8AX 5KFNA 3PFEA 3H5YA 4J9RA 3C3LA 3I96A 3ZSXA 4CJQA 2MZRA 4EZ6A 2HHXA 3GCXP 5JS2A 2VFRA 2HHQA 2LA6A 3HOSA 2D1KA 2VQFK 3FQLA 2WW4A 3FSIA 2BYCA 4QR0A 3V6JA 1VJQA 4CWBA 2M5YA 4L74A 2DXDA 3NL0A 3N6NA 4Z37A 3DLLL 3ZT3A 3A8JA 3OBWA 2KHDA 2QK9A 4CZEA 3B6OA 3MR5A 1GMWA 2FC9A 3G82A 3MMJA 4ID5A 2DO4A 4DJBA 1U04A 3WUHA 2DHXA 4FZZA 1NJYA 5FRMA 4CEFA 2MY8A 4CT9A 3WC0A 3AA4A 4CZIA 2A40A 2ZWPA 5KFAA 1CJVA 3OTBA 1QQNA 4OYAA 4XEIA 4O5FA 4O4RA 1RHQB 2ILZA 1I39A 4AQYK 5F0UA 2HQ3A 1GLBG 2GUIA 5JLHA 2W2QP 1NSPA 1ZYQA 1HBOA 3UN5A 4I6YA 3CJ5A 1HNXK 3EL2A 1QAYA 4CJTA 5HROB 1ZTWA 4XAKA 3IWLA 3SPYA 3TUZC 4DL4A 4YP3A 1ICEB 2EG2A 3IG1A 3LM9A 1JJ2M 4CZLA 3Q8PB 1EETA 1KVIA 1MSWD 4DR4K 4FNHA 4EFAC 4I4BA 3VGMA 1YVUA 1T05A 2OZMA 2HWTA 3BKTA 3OYJA 5F3ZA 1M5PC 2RUSA 5HO4A 3K5OA 4IG3A 4JRPA 3CIZA 4DR2J 4DLGA 4BRKA 3R5GA 4MO4A 4KKOB 3PRBA 1Y7PA 4J9NA 4KGVB 4B9MA 4KBIA 3LA0A 5AJ3J 4IDKB 4CK3A 2FIUA 3GOIA 1EIYB 3NKYA 1UAXA 4P73A 5CZ1A 1YITS 4B3RK 1SKSA 2R8KA 4UY8O 1YJVA 3ID6A 2R7OA 4A62A 2L3MA 3W9JA 1YRUA 3CQXA 5LM7E 3MWTA 4B3TJ 2XYGB 3MCMA 5LMNJ 3TAPA 3R5AA 3TANA 1OKJA 3TZYA 1EX8A 3ALYA 2WVDA 4M5DA 3ATVA 4P2MA 1VDHA 2WUSA 2RD5C 3NGUA 2W7AA 5BR8J 2NLXA 1IVZA 2COLA 3LP2A 4BC9A 5H1SV 1C0UA 2P9UB 4DG1B 5LL6d 1K1SA 2DKOB 1W9HA 4DBQA 1XQIA 4CT8A 1VQNN 1SAZA 2HNYB 3OYLA 3CC2N 4L76A 3LPEA 2OPSA 1HWUA 4F04B 1C1AA 2W42A 4OZ3A 2M4MA 2CNLB 4DV5F 4DR7J 1RBVA 2VH7A 2Y9HA 4U7CA 5LJVA 4CBXA 4RTFD 5LJ5Y 2MKSA 3TAFA 3D54A 4CRJA 3BDPA 3CTRA 2JH3A 4DU8A 3LWLA 1FA0A 1RKIA 4WFBL 4NLGA 1RWNB 5KFPA 1FF2A 4M5MA 4H4MA 1FDDA 1KHVA 3BSCA 3BZQA 1RLDA 4WE1A 1IUJA 5BRHA 2IBKA 4HHTA 1KHWA 4L8RB 1FKOB 5LSLA 4IZ9A 3T5KA 1N32J 1SZ2A 4I7FB 1NRKA 2OPPA 2ROGA 3AVKA 2CGLA 3OT9A 3IKMA 1LEOA 5HRSA 5ETPA 2QWRA 2BOPA 2AGOA 2DGTA 3QLHA 4QPTA 1F9HA 4FKYA 1SH2A 4NB4A 1NDLA 2ZC4A 4A47A 3FRYA 2CQHA 1WJ9A 2BJ9A 3UVJA 3NCIA 3LGMA 3VEVA 2UVUA 4HDHA 4AHRA 1BWVA 1T94A 4IKAA 3D6MB 2W2NP 1T03A 4LF6K 1DBDA 2CPIA 1KN6A 3MFIA 1P8ZA 3TSUA 4F3QA 1SUQB 5HMWA 2BXJA 3CD6N 2ACYA 1I3OB 4HTLA 2JFDA 1CVJA 3IWNC 3V9UA 1UFLA 3PKMA 3H45C 4O0JA 4KHQA 1K1QA 4K4UA 3DRRB 1OY8A 4DL3A 3OXGA 4EO8A 2HVEA 1JLGA 4F2SA 3I6PA 3KHYA 2ALZA 4O55A 1TKZA 2E1PA 5C12A 3BZKA 3QNNA 3JS6A 5AQJA 4FWPA 2H9ZA 5ETRA 4DR6F 1FWKA 1SJ3P 3HSJA 4DQQA 2DVIA 3HSTB 1TK0A 2XMKA 1P6TA 1BE4A 3THVA 1NPRA 5GIOA 3CJ8A 4QIWD 3EXCX 1VQPN 2UUAJ 2X78A 1J53A 4Q8FA 4CO0A 3W1YC 3US5A 4RUAA 2DISA 4DV7F 4CJVA 2HRUA 4JKHA 2YWHA 2P51A 5L9NA 4JHDB 1YJ9N 3BPDA 4EU0A 2OEKA 1LWCB 2HYIB 5RUBA 2N4CA 3BY5A 2QLBB 1NK5A 4EAHD 1YZ6A 5HL7L 1UL3A 2LECA 4BBYA 3M9MB 1UEUA 4FWKA 1IWAA 2B56A 1HUXA 3DLEA 2I2YA 3HXMA 2R9LA 1NB7A 2MHEA 2MDAA 1RISA 2GMHA 4UQGA 3S41A 2W4DA 5AXMA 1JJ2R 3CCQN 3A1YG 3ITHA 4QIFA 3TAEA 3RJMB 2HRYA 1TKXB 3RZAA 1FJEB 1VRTB 3AXKA 3L4QA 1U2RA 1VQ8N 1XMQK 3ICLA 1R89A 2B5JB 3PIPQ 4CZCA 3C0BA 2ZNZA 3FUYA 1X4EA 4J9LA 3I33A 2MGZA 1U8WA 3DYAB 4ZVQB 2E5HA 4X4SA 4ZVOB 5BJRA 3M8PA 3I8DA 1N8RO 1FNMA 4WFBQ 5J1EA 2RDJA 2O4GA 3A8EA 4JV2A 4W92B 5IZHA 1WBBA 4Y65A 3DGVA 5F41A 3TUIC 1IBLJ 3HI9A 2CWXA 3OYCA 4QYRA 5M2UA 2KVQE 5FPDA 1SC1B 2R7YA 1HKGA 3MI7X 3BV8A 2XY6A 1YBAA 2P9GA 2CQ3A 1PJ7A 4J9MA 3HM9A 4O44B 4F4YA 1BIUA 1NO8A 4CO5A 1OMSA 2KM8B 3OFFA 3U27A 3A5MC 4V19S 4ES3A 1ZH5A 6FDRA 2J6UA 2QJ3A 2CNKB 3FCWA 3ZETB 4FF1A 1BC6A 3GQCA 2ZOGA 1JLEB 1VHXA 4CFCA 1RA7A 1VBKA 4DUYJ 1XBWA 4N56A 1T9VA 1Q8BA 4OI3A 1AZSB 1QE1B 3OLBA 2QM1A 1UPPA 4FF3A 2KO1A 1E3MA 2R42A 1YI2N 1S5ZA 4ELUA 2DHAA 2HBJA 2XY8A 1RT5B 3T6JA 2E1YA 1VIXA 4B3SJ 2E66A 1ASUA 1O1WA 1BI4B 3MN9A 4X64F 5KFVA 3LW5C 3PW5A 4C4WA 5ETTA 2F4VJ 3R5JB 1RCHA 3C6TA 2OZSA 4L3QA 1IBKK 1HQEB 5ETOA 1XR6A 4EP4A 4J2DA 2EBGA 4HH1A 3CCSN 2GBZA 1UP1A 4IR1A 4O3OA 5B0CA 1PC4A 2LDIA 3FBFA 3DLKB 3A3PB 2W9AA 3HYFA 3U3GA 1Q0NA 1M5KC 3UVJB 1VQON 1VQ5N 2KTQA 3KTQA 3ENOA 4NLUA 3E01B 1P90A 4JI5J 1R7IA 3NGKA 4NXNK 2XGPA 1NBEB 4CF8A 3O4QA 2F1FA 5J2QB 3M2RA 3U3YA 3HHLA 4ZP9A 4TU8A 2N3LA 2XG8A 1JL2A 3CCTA 1BQNA 1L3SA 3C6HA 4OX9J 4JI4J 5HVHA 1FKOA 2XNRA 4ZPCA 5JMNA 3UKRB 1IBMJ 3OYAA 1LW0A 1WOQA 3H2UB 5DG8A 3WNHA 4WFAQ 1BD6A 4X62J 1FNXH 1NHUA 2IAJA 4A8SA 1F0XA 4OKEA 4F67A 4NYPA 4IEIA 5CHCB 4O3NA 4A8YA 1GTEA 5L39A 4GC6A 3GFHA 3P31A 4BGBA 1RDDA 1S22A 4E7HA 4Z0UA 3OS0A 1W7WA 2GUPA 3VERA 2R3VA 3KKFA 3F9KA 2UXDF 3H7HB 1FJGJ 2WONB 5AQLA 1SQKA 1WEZA 3HP6A 2PSZA 4PCQA 1BCOA 4R25A 4FYYB 4M8LA 2V4QA 2FBVA 1A0OB 5F2RA 1KQKA 3J80Y 3DHXA 2VHGA 1RT1B 3GG0A 2R2TA 4BC3A 3CCQS 2RDDA 2PMWA 2RE1A 5IFMA 5M1FA 1R6YA 2FLPA 3C14B 3Q8RB 1X5PA 2D3UA 1NMNA 2KG0A 3L2QA 3ILOA 1NJIO 3ILLA 3AO3A 1H74A 2PYJA 2W9BB 2HBLA 2VQFF 5D8HB 4JI1K 1Q79A 2KHOA 3NS7B 4KKOA 5IWAF 1BQXA 4Y0FA 2CGKA 1S6QB 2QA4S 1UEKA 5EXWA 5LXYA 4FJ8A 4FLTA 4USKA 4U67L 4OZ5A 4GKKK 5FLXU 3OBYA 3NCRA 3UDCA 1KCFA 3GMGA 4LBHA 4USWA 3VF2A 3KMSA 2C3PA 4HWIA 4QWDA 3V9SA 1WF2A 4F4XA 1NEEA 2MZ1A 4AM6A 2MKKA 1FE4A 3CB4A 4I6AA 4FOEA 1R31A 4Y3CA 2J5AA 3SNNA 4EBEA 3OHRA 2A41A 1XN9A 2B0GA 3O5TB 4FZVA 4KAIA 1VI7A 4CQ1A 2FY8A 4WYLA 1GNKA 3HF5A 1N54B 4RUBA 5DZ6A 1KNZA 2DO0A 4B9UA 2IRUA 1C0TA 3CJQA 4CLLA 3ULEB 3FCHA 4OZNA 4JK8A 4MDBA 4R8UB 3BR9A 1Q82T 1N34J 1TMMA 2XY5A 1SPBP 3CC4N 1ZC6A 1HW8A 2CPEA 1NLKL 3HD1A 3TWZA 3POTA 3AAPA 3IRXA 3NH2A 1BU6O 2VQEK 3CDEA 1JJ4A 2CFXA 4ZVFA 3E01A 4ATNA 3VAMA 2MQPA 1HYVA 2WRMA 5KFEA 3WQTA 1VQ7S 1HHTP 3Q8QB 1F2HA 1BGXT 4DR3F 3AFGA 2C2NA 5H9FK 1ITPA 3MEEA 1SC6A 2CUYA 4G1IA 3WBZA 3MCSA 2BW7A 1QVGR 2IVNA 2H48B 4UZBA 1U09A 4B3OA 3OYKA 3I55S 1MDUB 4C8NA 4NLQA 4F4ZA 1NG9A 2SXLA 4MFBB 4DR5J 1SJ1A 2DRDA 2KXHA 4E1NA 3RAQA 1T9UA 3ASMA 3IO1A 3VQCA 3M8PB 3M8QB 2B3TB 2HIQA 2HVIA 4DR1K 1TV6A 4M3TA 2BJ8A 1MWZA 2GS8A 2XHBA 4C97A 3H3OB 2ZBRA 1GFWB 2R8HA 4BC7A 4FPBA 1DY3A 1N6QB 2RMLA 1FDAA 3OTDA 4GO5X 1YBUA 4ED3A 3V1RA 4OYZA 3PYFA 4OZ2A 3OY9A 3HFZB 2RILA 5EN1A 3VEYA 4YDUC 4BRQA 3LF0A 1S72S 1RABB 4WKYA 3LL3A 4U8YA 4DR7K 3HJFA 2H1YA 3CIMA 1ATRA 1FJ7A 4ZIVA 1CBKA 5CYJA 3W61A 2XHCA 3K0SA 4Q44A 1Q7YO 4JI4K 3L4BC 2GA7A 3CNQP 2CJKA 4FW2A 1APSA 4BG8A 2H65B 4X65K 4RJVA 4C7QA 1CLQA 1DT9A 2P9IB 5ETVA 2IM3A 1WEXA 1VQ8S 4NYFA 4MYTA 2NREA 2B7CB 5C2GA 2XMJA 2VODA 2H3GX 4ZVHA 3RB0A 1D5AA 4KB7A 2NXUA 4LFAK 3EZ5A 2CWKA 4JI2J 4U9RA 4FWQA 4FJNA 2ITGA 1DARA 4CM0A 2AMCB 1RLCL 4YS2A 3VQBA 2NUUG 3TI0A 1NSQA 1CQMA 3DGPB 5ETMA 4X4TA 3J81j 4K42A 2Z56B 4H5TA 2MSTA 2HHHJ 1YT3A 1LFWA 2E88A 1VISA 4R0EA 4E2FB 2RT3A 4RUCA 5HRRA 4FL9A 4C1NI 1AB8A 3Q24A 2Y0BB 2RJZA 2XWYA 1SH0A 4NLSA 3VQ6A 1A9NB 3PY8A 2KT3A 4KHYA 1ZZNA 3M8QA 3VAJA 1U1MA 4O0NA 3AQOA 4PHTX 3QEXA 4B3MK 1GXTA 4MFBA 3ZSWA 4ZS6A 4K8RA 4RW9B 2HLUA 1YDLA 1S0NA 2YKAA 3CF5Q 3I4PA 5J2MA 5C5JA 3AVLA 4ZCLA 1B0TA 4AHTA 4E1MA 4CBUA 1JQGA 3PYGA 3D2WA 2MLZA 3AD9C 3CEDA 1DZ5A 2ASPA 1HKCA 2W4CA 3VQ8A 3FLCO 4PAAA 1X5OA 4AHCA 3VZHA 5BPLA 4G65A 4ETZA 4H4MB 3NWGA 1RADB 1SQGA 1L3KA 3AJ1A 2QZ8A 3EZUA 2DGXA 4CEOA 3UD5A 2HS0A 2GX9A 4YNQA 2WSEC 3FSXA 5FIIA 4CLFA 2KQ2A 3NH1A 2X6NA 1JWWA 2KXNB 5KFMA 5E2QA 1HNZK 2DT9A 1N32F 4CJKA 5EOYA 1GXLA 5CHIA 3A5OC 5T7LA 4GMJB 4QOZB 2RUGA 2YX4A 3IA0A 4M3WA 2E20A 4JV5F 3J7YP 4KE5A 4DV6J 1GMVA 3J7AP 2DY9A 3ZZOA 4CHOA 1R3NA 1T6DA 4DUTA 2FF3B 3VWSA 3OFGA 3NOGA 2VIHA 4CJWA 4I7FA 3TW0A 4JI4F 3ET6A 2AJ2A 4NLTA 2J9EA 4WE1B 1NM2A 3PKYA 5HOOA 2PEHA 3OVAA 1X0PA 4TLQA 2QLXA 3OYIA 3SBTA 2FF6A 3C94A 4RX6A 1ITGA 3OR1A 3TWHA 1TL1A 4IO1A 4DTRA 2WONA 3O5BA 3R6GB 1N0VC 4MKAA 3WNGA 1B4SA 2ZH7A 1NKCA 4BRLA 1FJCA 1HJOA 4H0PA 1UW9A 2XHWA 4CZGA 4GVBA 4HI2A 3C15B 3ZSQA 4FJGA 1X9MA 1MA9B 1O8BA 1X9JA 1Y5NB 3K8VA 4DV4F 4AH9A 2FVPA 1ZBFA 4M5DB 4WFNL 3AVBA 3W64A 3UKRA 2CJ9A 4ZLLA 4YB5A 3E1YA 1VQLS 1C0GA 1KR4A 4IG3B 5JS1A 2NYIA 2JC0A 2OSRA 4HR2A 3G25A 5BN8A 2POKA 4BE0A 5KOWA 1BISA 4OFZA 5IV3A 4ES1A 1CJVB 1CQNA 4CO2A 3N4PA 3CQYA 4AUKA 5JVGL 4ANEA 1IH7A 3FJ2A 3TZWA 2RHSB 1F60B 3VESA 4LF4K 4CGJA 3TEHB 1H2UX 2QGFB 2G4BA 5HBMA 2ZFHA 4DUZF 1KBRA 4PWDA 1ESVA 4YB1P 2BE7D 2BKNA 5H9EJ 3C6TB 4N41A 3D2EB 2JEJA 4OYXA 5AQYA 5CD4A 5DJBA 4DX5A 3MR7A 1TL3A 1UAWA 4BWJA 3KLEA 2EPIA 2VG7B 1KVAA 2K7JA 5EY4A 5DQGA 2HF4A 2AWZA 4FPRA 1YJNN 3MXJA 3FZMA 1HNZJ 3VA0A 1AT1B 3NCQA 5CZVA 1MG7A 3V2UC 4HVZA 3LDQA 3L7PA 4C3MA 2JDJA 1W97L 4DUYF 5KG4A 4J2AA 3OV7A 1GOAA 3K5LA 1OSCA 3O1LA 4DZ6A 3MUVP 4CJFA 1SC4B 3DXMA 2H3EB 4DQPA 4IJNA 3PDNA 5EU7A 2YKPA 4B3SK 3PW7A 2CJQA 3AD7C 3KKRA 1JLCA 5HP1B 5M1OA 4O44A 4PABA 5K8PA 3VQPA 2F9DA 3QERA 4GW6A 4DL0C 2YWWA 4DQIA 2C2OB 4I9QA 4L3KA 3LAMA 3WT0A 2EFGA 3PJXA 2ZNYA 3K5NA 2D0BA 3WX8A 4IOXA 1KLMA 4CYUB 2QC3A 2B6AA 2J7WA 4FLXA 4DFPA 5KT2A 4KHSA 4TLRA 2XEXA 3ZT2A 5HRPA 4CD1A 2F40A 5C2FA 1VQOS 5KRSA 2YNGB 3BF4A 1WSFA 5L9XA 1RWOB 4WBFA 1AZSA 1QLNA 2XY7A 5IWAK 3SI8A 4NZ7A 1FESA 2C3YA 4EBDA 4Y28C 5EX3A 4NLYA 4E98A 3PIPL 1XNRF 5L38A 3ITHB 3QJLA 4XDDA 1DEJA 1IBLK 2OMLA 1CS4A 4OX9F 3THWB 1ZM9A 4CK1A 3L2UA 3DLGA 4WWSA 4B8AB 3O9RA 8AT1B 3HSCA 3SQ1A 4M3YA 1RAOA 3GCWP 2BW2A 5MAOA 2HFVA 4U96A 1Q8KA 3HHDA 3VZIA 3VAFA 4QW9A 4HTJA 1G3OA 3C46A 2QLFB 1Y0HA 4HEA9 3OTEA 1EWQA 3CM5A 4G9ZA 1B0PA 2OD4A 4I9LA 2RHKA 3T9NA 4N5SA 4N7TA 3NMRA 2P9LA 4OV6A 3Q89A 2XLKA 2MGZB 1S57A 2E2QA 1UFWA 3RMDA 4H8KA 2EG1A 4LIRA 3FQKA 4RW9A 4W5OA 4OX9K 4H0OA 2BOAA 1IBLF 8ATCB 4BACA 4LVOP 3AVIA 3OFHA 2C1EB 3CCVN 3VQTA 3VPZA 3ZT4A 1NSAA 3EEQA 2F8TA 4QS9A 2OSQA 1XI1A 1BWFO 4DUYK 4HH0A 4WP8A 1P27B 1N5QA 4QBUA 4NA3A 4LF6F 1ASWA 2CQ1A 2G2OA 3DRXA 4CJ5A 3TJ9A 3CIPA 3NGRA 2FSKA 3PO5A 2J6SA 4Y1CA 3CMES 2WVCA 4AL7A 2GVDA 4EYHB 1IV0A 2BH1A 4JI3F 2L9DA 1FXDA 3VF4A 4MIBA 4KV8A 1K6YA 1JCEA 2OTLN 2NRXA 3C6UB 1UVMA 4KHUA 3W5ZA 3J7AN 1Q5YA 2AHOB 1S0MA 1N5SA 4ZOSA 5KT4A 5KFDA 4HYKA 4CCHA 4CH1A 1PG5B 4AQYF 4PKIA 2E1ZA 2E7VA 2FC0A 4DL7A 5LL6Z 2J8AA 3J81U 2O8EA 1JLGB 2IJNA 2PIIA 1H38A 3QEIA 1FRHA 1RSCA 2HS3A 1M1KO 3VQSA 4ZMMA 4DR1F 3B6PA 2NRZA 1NOZA 2UU9K 4CJSA 1N33J 1N4LA 4LFBJ 4H4KA 1OH7A 4O3QA 3DXKA 3TZZA 2YKNB 1DQ9A 1QM9A 1FRXA 2RS2A 4LSLB 4ZITA 1NAQA 1I3AA 4Z4CA 1H72C 2Y1IA 3TABA 1R43A 4FJ9A 3N01A 4MKBA 3L0QA 4ZVUB 1RDAA 5E0OA 3DMJB 4UUWA 3R9PA 3VEXA 2UUWA 1OSDA 2KZMA 4FYVB 2OPPB 2HSEB 4D3GA 1NB2A 3G6VA 4BRIA 2MKIA 3VGUA 3WX4A 4FF4A 4ILHA 3WXIA 4FM0A 3X1LB 1Q8IA 4KGXB 3KK1B 2OGUA 3F0NA 3DC2A 4CO4A 4KTWA 1WG5A 1WLJA 3A13A 3E9PA 2K7KA 3IC1A 2XSJB 1GOBA 1U2FA 1YIJS 1D9FA 2XTJP 4BVPA 3HP9A 4HCCA 1WC6A 5FLXO 1XTZA 3NE6A 1DTTA 3B4DA 5E3QA 5DDOC 4OI1A 1WC1A 2G0JA 3HPHA 2QRRA 4HDGA 3H1QA 2JZ5A 2D9PA 4I2QA 4O3PA 4CHQA 3HKWA 1NJIT 4DCOB 4PYAA 2HFNA 3FFKB 4Q7AA 2OPSB 1VLOA 5FPEA 4Q0BB 3POTB 1FTCA 1VSKA 1PCAA 3B6BA 4MKVA 2ZH9A 2VGMA 2J7UA 2P9UA 1XNQK 5KFZA 3SMZA 2LQ8A 2NYHA 2O3DA 1SL1A 1RDCA 3K57A 1VSIA 1RBUA 4CEEA 2CPFA 3CJ2A 5IT9O 5HROA 5D15A 1T7PA 3S3NA 1U1PA 3CCRN 3LPUA 3GE1A 2OFHX 4M5GA 1NJWA 1ZM2A 2GEMA 1H2TZ 2W24A 4G3IA 3OYGA 3D2EA 4P7TA 4PG7A 5AE2A 3HSDA 3EE9A 3ULDA 4DU3A 5D78A 3NP5A 1MU2A 1IKXA 1U1RA 3OYNA 1N8RT 2J6TA 4USHA 3R9LA 3CJKA 3WNFA 1FKPB 3BO4A 1HD1A 1VBYA 1UVIA 1KOOA 4K4SA 3KWMA 5CQGA 1BO5O 2LEPA 3HHLC 3T7ZA 1KFSA 2OIHA 3C2PA 3NAIA 3LAKA 4CW7B 1TK5A 1RU2A 3T1YF 5DLFA 1GX5A 3CJ9A 3VV2B 2KJWA 4DV0J 3DLJA 1WSVA 2GO8A 3ZT1A 3IR6B 2AJFE 2ZZTA 1VSMA 4YQWA 2J9DA 4XH5A 4LF7K 4Y2KA 3OL7A 3FBCA 4CFAA 5FDLB 3BF1A 3R5DA 3CJ1A 5HLFA 3OJSA 2GJ2A 2WK4A 2JGUA 3HDSA 3BJYA 3FCVA 4ILRA 4WQ4C 3O2IA 4MYUA 1RA6A 3KIOA 1B9FA 3AO1A 2EKNA 1HHSA 3PACA 5IXUA 6AT1B 3RYLA 4CHNA 2DNQA 4GNIA 2MHNA 3JAMU 1MN7A 5EGYA 1GLEG 4URSA 2P9CA 2XRIA 1OH5A 4FXVA 2PA8D 2UUBJ 3P45B 1YTUA 2W7PA 1IQZA 2ACMA 1M1KT 5F0WA 1W2BR 1TKTA 3CO9A 3PIOQ 3EGNA 4O4GA 2P9NA 2EX3A 4Z7CA 2V8DA 2RQCA 1NPKA 1AFIA 4YB6A 5E33A 1OPIA 1TUGB 3DDKA 1K73O 1N5YB 3Q7CA 1U7LA 3LO3A 2EI5A 3RAMA 1WKJA 3G6XA 3KLGB 4ZJLA 4DSJA 1D9AA 2FJXA 3DLBA 2UVRA 3DAWA 4IFVA 3HHKA 2J9DE 1YJWS 4FKXA 2CG4A 2DGQA 4HACB 2WVBA 2A6MA 2IRXA 4BCAA 3K2PA 1KQSR 5B0EA 4Y2IA 3PW4A 2JRSA 2XZDB 1RT4A 4PQUA 2RRBA 3KWGA 3HHEA 3N28A 3P5TL 2IIRA 1S6UA 4I6MB 4IR9A 3NWRA 1SCJB 2DNMA 1GQEA 4LRFA 5IQQA 5DO2A 5AXKA 1BQMA 2G1HA 2ZJQL 3H5XA 2MPUA 1S1VA 4KI6A 1GLJO 4NXMF 1UVKA 4DXLA 4ED8A 3D0PA 2FBXA 3CXCR 1RKJA 3ZZRA 3HZ6A 3W2WB 4DL2A 1AUDA 5H9EK 2YXLA 2PMZD 4C3LA 5LJ3Y 1DURA 3MM7B 1FEHA 5B0FA 4DR2K 2GAGC 1HX1A 4K4WA 2DNNA 3G9CA 4ED0A 1WC4A 2HFSA 1ZBTA 4ZTJA 3MD3A 4QS7A 3S9HA 4DV5K 4B1XB 1U49A 3CC4S 1HBNA 2XYHB 4WU2A 3W9IA 2ASDA 1QAJA 3EY1A 4DTUA 3T6BA 3UQSA 2B4UA 2ILYA 1S77D 4B3RF 3LP3A 5U47A 4MTPA 3NS6A 3FC9A 4NPOA 3C95A 3NMAA 1FXXA 5DLGA 1VK8A 1LXJA 3UWTA 1U0HB 3L3CA 2OUGA 2YQ1A 4F4KA 2EC0A 2VKZG 2QL9B 4L75A 1Q81O 2PFUA 1PILA 2FJEB 3R6MA 4RNNA 1FRIA 4OV1A 4JD2A 1W2IA 2YWGA 4FBTA 4DX6A 3MPVA 1YJTA 1Q86T 2O5DA 4F50A 4IOAL 5DQHA 3DGPA 4HL9A 4JP8A 4X4NA 1N5VA 2PI5A 3FEZA 2D7SA 3M9NB 1I94K 2RU9A 3SAFA 1U1KA 3L2WA 4B8CA 3KJVA 3SQ2A 1PIEA 2Y8WA 3T5HA 1WSEA 1R0AB 4EUVA 3FZHA 4IXCA 4CK2A 1FFGB 2OD6A 2QSWA 1OJ4A 1BHNA 4LFBF 1LAWA 2F8HA 4JI7F 4ZVSB 1RTJB 2HZAA 4OKKA 3M7VA 1UKUA 4CJEA 1RAHB 3J8AA 2YWKA 2QE5A 4X62F 5GADP 3HO1A 3MD1A 1RAEB 2VG5B 2CQDA 1N34K 2OHDA 4JKAA 3FBEA 1RCXB 1U2VB 4IG0A 2ASJA 1SQFA 4F4AA 4CLZA 2P9SA 3NBPA 1NK9A 2QWNA 3I55N 4N77A 5A8WA 4F2RA 1QSYA 1TYQA 4LF2A 5D0HA 4ZJQA 2BTFA 3LP1B 4JI3K 2NZ4A 1AA1B 3M9OB 2ZVSA 3CM6A 2HHHF 2GQQA 1RT4B 1X4BA 4IO8A 4H0XB 3P6YC 1FJGF 3HMJG 5JXSA 3DI6B 1XNQF 3M8RA 3G6YA 1RWXB 2J9CA 1J6ZA 3EJMA 4ED6A 4BR7A 1UJ5A 1VIOA 3I5CA 3LPTA 4X4OA 2YNHB 1LQ9A 4CGDA 3CCJS 2Q3SA 4DHYA 1UZDA 2W01A 4LSNA 2BX6A 3SAHA 4OQJA 3H5SA 1Y3JA 2G0CA 3OYHA 4DL5A 3C7NA 5T41A 2C42A 3P4UB 4QPXA 3D1HA 5F8NA 2CJBA 1I6JA 2E7WA 4LFBK 2P9NB 4KH5A 4P10A 2HWIA 2WSCC 4X84A 3JQKA 1TKTB 3VGLA 4JOUA 1C0MA 5AQHA 3KK2A 2W9CA 1U24A 4AXIA 2HKEA 3CT9A 5KFOA 1P9YA 3CXCM 3V9WA 2Y1LB 2KH9A 3K7RA 4M95A 4LF9F 2V50A 1S49A 2YHYA 1S9EB 2VPYB 4PL7A 4FLUA 4H5RA 2D4WA 3HBTA 2JWKA 3FNNA 1FT8A 2BGGA 1VQSA 4H5WA 4C1NK 4K43A 2DNRA 4BRAA 2UZAA 4DV5J 4DR7F 4ID8A 3MGJA 2XS7A 4AL6A 2EWSA 2YKOA 4X4PA 2PMHA 3VQ7A 5E3CA 2ZHBA 3OUYB 2ATLA 1JX4A 3QZ8A 1CJKA 3M30A 3EYZA 3IS9B 3NNAA 3ULEA 2BE2B 2GHVC 3AHPA 4DEZA 3CHWA 2VBYA 4ZA1A 1UVNA 3BQ2A 4C0HA 1D3WA 4KHPJ 1KD1O 5KRTA 5C2DA 1PKUA 4JKEA 2DR8A 4YN3B 3O3LA 3TVZA 4YFUA 2QA1A 2XI3A 4DI6A 4U8VA 5C42B 2P1JA 4MK8A 3QT7A 1T95A 2P9PA 2LCWA 4B3MJ 4DSIA 3ZYYX 1TMJA 3PO4A 3D6HB 3FSYA 4USJC 4E7IA 4ILMA 2LXIA 4UZCA 1TVRB 1JMTA 3K9JA 3MECB 4B1YB 4TN2A 5A8KA 3G71S 2AKWB 1B70B 4M7XA 2KDOA 5B0BA 2XMWA 3FR0A 5GINA 5J2NA 4FZYA 3EVMA 5KAKA 4DUZK 1K0TA 2DHGA 4LF5K 2Q3PA 2LEBA 4B9VA 4E1JA 1T11A 2BBEA 4A8WA 2OPRB 1FKAF 4PXBA 3KHLA 2A2DA 3ZTPA 4H5VA 2ETJA 2H5JB 2Q1NA 2QEXN 3OYMA 2ZVIA 4ELTA 2DEJA 2R7QA 3QFPA 2CADA 1HD0A 3K17A 1EP4A 1WSHA 2JX2A 4DR3K 5G0RB 3CYMA 3TAGA 4DTPA 4UT4A 1D4XA 1RHMB 3L2RA 3PV8A 4WZMA 4YOXA 4LSZB 4GRSA 4W90B 1WSIA 2OLWA 3JSMB 2RRNA 2DGOA 4FVMA 2QXLA 3I87A 1D9DA 3VR1A 3T1YK 1R0CB 4KFBA 1Q86O 2ZC3A 1RT3B 4Z94A 1N36K 4LF5F 1ZBUA 1LWEA 3CDUA 1Z25A 5ETLA 4EEYA 3A8YA 4A59A 3V4IA 5AQVA 2YKQA 1T8EA 3VQ5A 3M6XA 2PI4A 3X3UA 4D3HA 5H1SQ 3HT3A 4MDAA 2FHKA 3R5BA 3GFXA 3ZNUA 3H20A 1NBWA 2NRTA 2LXFA 3CGIA 3PM9A 4OIXA 1YJWN 5F8HA 1X4DA 2B43A 2V9WA 3R6LB 2O1PA 3THPA 1CG2A 3KMQA 3QFWA 2FZKB 3WXJA 1UWBB 4TXSA 2EC2A 3RTVA 3JYTB 4JN4A 4DR1J 2CQGA 3MAAB 4O8UA 1XMQF 3QGHA 3M2UB 2YNIA 1RHUB 2N4DA 4MLEA 1RWWB 2WSFC 1VRUA 1VQ9N 3MTJA 3QMLA 3SCKE 2KZZA 3KYLA 5BREA 2K1RA 4C98A 3E66A 2OH2A 4IG0B 3GTYX 3K5MA 1SVDA 3HRGA 2E29A 2HWHA 5BYSA 2FY1A 4CJPA 5J2QA 4CNYA 3DLLQ 4DMNA 2UV8A 2WOMA 3EPIA 1FFSB 1QZ5A 4OGCA 4KHRA 2VPWB 2ZBIA 3T41A 1OH6A 3DLKA 4NYZA 3IN5A 3M05A 3H90A 3R5CA 1T9WA 3GG4A 1YBTA 3BQ1A 2ZH6A 4J90A 3I56N 5LOQA 5GMEA 1NK4A 2DCLA 3QQCD 4MH8A 4ZK7M 2GX8A 2DHHA 4Z7YA 3TUPA 3L4IA 3CDWA 2P5OA 3C65A 4DSFA 5GAEP 1JNRB 1BI4A 3NNHA 1VBXA 4ZCIA 2HGNA 1RT5A 2GHWA 2GQ2A 4TSXA 5DGAA 3SQGA 3CC2S 4JB8B 4USVA 3WNEA 4U7BA 5LSRA 2YWEA 1YX2A 4YHHK 5CA5A 2O8DA 4O3SA 2Q79A 4QR1A 1LWXA 2DPJA 4ENOA 3PX6A 3CCJN 3GV7B 1X7VA 3NCPA 1PJ6A 1RBLA 1BLUA 1K73T 3H5UA 1TL7A 3DKDA 3OW2M 3OHBA 4B3SF 3SQ4A 4DCPB 1O0PA 2OTLS 1IKVB 4M3ZA 3V81A 3M6VA 3UDLA 3H1VX 3DRPA 4BC2A 1FO1A 2ALYB 3C16A 3CCRS 1RBSA 3KDOA 5L1JA 4USUA 4CJRA 4YDDB 1ELOA 1D8YA 1R8HA 1X60A 1URNA 4WYBA 3HKZD 2HAFA 5JVHL 5D0EA 4J9QA 2VPXB 4OJRA 1VHIA 3CCEN 3WIVA 1CSJA 4CF1A 4QWEA 3SQOP 4PL8A 4AM7A 1JLAB 1UJ6A 1TQLA 4DTNA 1YSJA 3N6MA 1S5JA 2XMVA 2O8FA 3G8TA 5GVQA 1QY7A 3IM8A 5I3QA 5DQIA 3BS9A 3I9V9 2PFFB 4R5PA 3EDRB 4NL5A 3MM5B 1YJ9S 1WEYA 3TTDA 1CS4B 2BEFA 1IBMF 1IQTA 4JYAK 3BBBA 1YIJN 5T7BA 3DRPB 3PTWA 3HVWA 1T44A 3EWGA 2YY3A 2RSQA 5KG1A 4HUGA 1WUUA 2HURA 4WFZA 1V5IB 3TTFA 1XQSC 4I6MA 3VEZA 3THYB 1OH8A 3CWJA 1S1XA 3D4JA 4RBUA 1R27B 1T6CA 5IT9Y 1IBKF 4J9UE 5KPRA 2YNGA 4NMXA 3LANA 4DR3J 4C0OC 4C6AA 2YX7A 4TQSA 1Z1ZA 1RI7A 3I5AA 1J5EF 4DWIA 1S48A 5ADXA 2EK6A 4RWWA 3GZ7A 3R1HA 2LSNA 5AQKA 2VOOA 2X74A 1KDNA 2QG9B 1TELA 3DNCA 3GLJA 2HMIB 4EK2A 4JLHA 3TTCA 3RSEB 3MN6A 4P2SA 2IJFA 4DLEA 2CPZA 3TAMB 1HWJA 2WB1D 4RW4A 2VPZB 3MMAA 3UD3P 2CAJA 1Y64A 1RTDA 3ZXWA 2L9NA 1RZMA 1JLCB 4V19J 2ROEA 3IBWA 1GLDG 1XHXA 2CZVC 5A8RB 2VC0A 2R7UA 4DSKA 4RW8B 3IR7B 2MMYA 4DPWA 1Q4RA 4QU7A 4IO9L 3DXMB 3K9KA 3SAGA 1VRQC 1R0BG 3OVBA 4PY5A 1FERA 2OANA 3ELHA 2YX6A 4DV3F 2OTJS 1FK9A 2G2ZA 1NH8A 1GLLO 2D3O1 5EWFA 4KRWA 4LRDA 3AXMA 1QAXA 3DOMA 1FCAA 3U6FA 2HBMA 5L1IA 2R8JA 2MXYA 1KQSM 2NLWA 2GNKA 2F96A 1RT7B 4OHXA 3ZNJ1 3VCDA 1OS5A 2A5XA 3H6EA 2E2NA 2VUGA 4KHPK 4FM2A 1VFJA 1UWBA 1FW6A 4WZQA 2RB7A 2UXCF 1IM6A 4CECA 4HTUA 5K8OA 3H59A 2HK2A 5IWAJ 1MLAA 5C10A 5IM0A 1N33F 3I0RB 1S6PB 2U2FA 3BSAA 5J2PB 1Y4ZB 1TFYA 3D6TB 3AH6A 4IFYB 3Q83A 3NVMA 2QEXS 4CLTA 1FRJA 1LV5A 4OLBA 3MHYA 2PC6A 3AA8A 3CJ0A 4JKGA 4CHZA 3RMCA 1QAIA 2V69A 4BR5A 4BLGA 5F9LA 3OHAA 1FI4A 3FVYA 4CM2A 4K0KF 2GVZB 2B8PA 1YWXA 1S9GB 2HVDA 4LJMA 4X65J 1VYAA 4B3MF 1KC8O 1XHZA 1KOHA 3W5XA 1YK9A 1UA0A 2QA4G 2XM3A 4FXDA 2GMLA 2HHTA 2R7WA 2KW4A 4GVBB 2ZUGA 3T1YJ 1GLAG 5L1KA 4FJ7A 1VQ6S 4M41A 5AQOA 2VD3A 4ETXA 3DXBA 3K5PA 1HQUB 2QIFA 4FDFA 4CE9A 1J5EJ 2XMUA 3D0GE 2HK3A 1N34F 3SPZA 2X1AA 1YTYA 3QRPA 3QETA 2IVMA 1IJJA 2GGPB 1UWAA 1FRLA 4CGHA 2XSJA 1YJ7A 4GC7A 4P6QA 2G8FA 1TL1B 4BROA 3N5FA 5AZJB 2E9ZA 1LWEB 3W60A 2RHQB 3MDQA 3L9ZA 1RHKB 2QWMA 3UR3C 3OTOK 3KXDA 4C9DA 4E89A 3CE8A 2GTDA 2KG1A 5ETNA 3JQJA 3D2FB 1RXOB 2V67A 4KO0A 1EP4B 3FK4A 2AD9A 2WZ1A 3W9HA 1QDUB 3OL8A 2LMIA 1NDPA 4DTXA 2K8GA 2D0PA 1QD1A 2NQPA 2HS4A 3BH7B 5T7LB 3UN3A 4FCYA 5T14A 4IFYA 2C2EA 5MLCQ 2HRTA 3CJ7A 3TUJC 4DR2F 1H3DA 2DD8S 2HHPA 5C0YA 1WI8A 4C8OA 3DLRA 2P8IA 2UXCJ 3NHGA 3OSPA 3HFVA 4FPIA 1N52B 3TQEA 2AP1A 4X4UA 1VJWA 3HVTB 4ZN1A 2QN6B 3MECA 1K9MT 4S0MA 3W62A 3S1TA 5ADZA 4M3RA 5IT9U 4NA1A 3FDSA 3OR2B 3E9LA 3UKUA 4BRGA 3MPDA 4EZ9A 3OS1A 1BUXA 3T9ZA 3MEDA 3HHLD 2FUG9 2BE9B 3OYBA 4J91A 1WHVA 1HA1A 1HI0P 3TR5A 2AX0A 1SS6A 5IM0B 2R8IA 3F9MA 4ED7A 4LD0A 4YMEA 5B7WA 1VSDA 2JNJA 2E5LK 1URRA 2MYFA 2YH1A 4LF1A 1IWGA 3SLCA 4W4MA 4AL5A 2D3OR 2HB5A 4F9OA 1P1TA 3BH6B 1BIZA 3MN5A 4CGIA 3HOTA 2UXDJ 2C2KB 1TK8A 2AJ0A 3OVSA 3IS9A 4TY9A 2DRBA 4RO0A 3TARA 1IBMK 5CAAA 1FK9B 1S1XB 5LMNF 2HZCA 3LDOA 2PO4A 2V68A 1MMLA 2E5GA 9RUBA 3M2VB 4OYPA 4ECZA 3T1HJ 4QR2A 3LZIA 3PJ9A 4DS4A 4RU2A 4RW8A 4DFMA 4FLYA 4NYNA 3Q8VA 4R5PB 2JEIA 3L09A 1S1UB 4DQRA 1U2CA 2HF3A 5DRKA 2P9IA 1GAOA 3QIOA 3HD2A 3T1HF 2UU9F 1YHQS 1F2GA 2OPQA 3ZFVA 2V7YA 4ZPDA 2GW8A 1RU1A