1LWFA

Crystal structure of a mutant hiv-1 reverse transcriptase (rtmq+m184v: m41l/d67n/k70r/m184v/t215y) in complex with nevirapine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
542
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwfA05
4RNNA 4EEYA 4KV8B 3SI6A 1U45A 4ECZA 5KRSA 2AQ4A 5F8IA 1JXLA 4CEQA 4TQRA 3IGVA 4BE1A 1JLEA 4DQRA 2VA3A 1FKPA 3OS0A 3FSIA 2IA6A 1I3AA 1IKYA 4TY8B 2Y1JA 5KFEA 5KG6A 1RYSA 3KIOA 1BQNB 3PX4A 1JXBA 3ULDA 4DTXA 2P1JA 3SPYA 4DG1B 3NAHA 5KFYA 1EXQA 4F4ZA 2WB4A 4RUAA 3PJXA 3UDLA 4JV2A 2OPRB 1SL2A 2OPSB 1ZTWA 1VSFA 4CJPA 3AVGA 4IKAA 3RMAA 4I2PA 4O3RA 3SUNA 1KHWA 4CJVA 5KFJA 4F3OA 2FVSA 3L3VA 4OJRA 4FM2A 2CJQA 4HYKA 4OGCA 4FJ7A 1NHVA 1KLNA 4M41A 3OSPA 1ZBUA 4CEFA 3KLFA 1REVA 3V9WA 3CJ4A 2BRLA 4ED0A 2UUTA 1IM4A 1Y97A 3FQLA 5C42B 4URQU 3I0RB 4DS4A 1X9SA 3PO4A 4ED6A 2VWJA 4WYLA 1TAUA 5HLFA 1EP4B 3BSOA 4Q0BA 3LAKA 4KHMA 2PYLA 4TY9A 1TQLA 5EWEA 3PJWA 1VSIA 5CYQB 4YFUA 3CDEA 4KHQA 3CM6A 4MFBB 2IM2A 4AHUA 3OJUA 4BE0A 4IG3A 2HVIA 3KLIB 3PHEA 2FVRA 3CFPA 2QE5A 3OS2A 1JLBA 1OS5A 4CGJA 3M8QA 3KHRA 1DTQA 4E7IA 2VG7B 4NRTA 4J2DA 3KHLA 2ITGA 5JUMA 2B5JA 1SH3A 4WFZA 3CJ0A 5KFGA 4DTMA 4OLBA 4CJWA 3AVJA 2R8GA 2HNYB 4QWEA 2V4RA 3TAEA 1N48A 1FKOA 1S6QA 5J2MA 1LAWA 1T3NA 2QK9A 4CF9A 4CJ3A 1RYRA 1J53A 2G8UA 1RT1A 2HAIA 3PR4A 4M94A 2IGIA 1ZBHA 1ITGA 4W5QA 2GBZA 4HCBA 2RKIA 3DRSA 3AVKA 4C8OA 5FRMA 3QLHB 4E19A 1JKHA 4ZTJA 1HQEB 2C2DA 5KFDA 2HWIA 2E9RX 3T1AA 4YR2A 1KFDA 1NOYA 1Q8IA 3MXJA 4KAZA 4CF8A 5FDLB 2X6SA 4YQWA 2G8VA 3LP0A 3SJJA 4FLTA 2OA8A 2HHWA 4ZP8A 2HWHA 4ICLA 1A5WA 3CIZA 3IN5A 2HHQA 3DLBA 4NLPA 1GOAA 3DMJA 4R5PB 3H5SA 4NLYA 1HNIB 4RW9A 1BIZA 3OL7A 4DEZA 3KK2A 4DL4A 1IKVB 3C6TB 1W25A 3DYAB 2B43A 3O3HA 3I0SA 4WE1A 3TAMB 4OKJA 3RBEA 3UIQA 5I42B 1TAQA 3IG1B 5HP1A 3QEIA 4ED7A 3DDKA 4O5BA 3U3YA 4H4MA 4NRUA 3BSNA 3H2LA 2BQ3A 1T05B 3KK3A 1IKXA 1RT7B 2J6UA 4BWJA 1S0MA 4CEDA 3HKWA 5KFVA 5F9LA 5KGWA 4B8CA 4CFAA 4OL8A 2ATLA 4RG8A 2ZD1B 1U49A 4KFBA 1ZYQA 3E01A 3OLAA 1L3SA 5I3UB 4M3UA 4DU1A 1QE1A 3M9OB 3RB3A 3NL0A 3WNFA 1SKWA 4DL5A 5L9XA 2DTUA 4HKQA 2HNZB 3NGIA 1T94A 3ZSOA 3ALYA 5KFHA 3DLKB 2E6LA 3BSCA 3OSNA 3SYZA 1NJZA 3NMAA 1EX4A 3NBPB 1J5OA 5HBMA 1S4FA 1K1SA 4W5RA 1RT6A 1RBSA 2AGQA 4Z4IA 3PW4A 1JLQB 5CY4A 2LSNA 3SFUA 2HMIA 5DG7A 2C28A 3T5LA 3RMBA 3QGIA 1N4LA 2GV9A 3VA0A 1C0MA 2ILZA 1LW0B 4E3SA 4G1QA 1MU2A 2G8FA 3NHGA 2YNIA 5KFOA 5CZ2A 3MECB 2WOMB 4IG0B 4K4UA 1HNVA 4O4GB 2D5RA 5J2PA 2IS3A 3OHBA 4IFVB 3SFGA 4NCGB 3QERA 3OJSA 1QSLA 1S1TA 1S6PA 1HPZB 1S9EA 2WK4A 3ICLA 4CK1A 3HL8A 4W5NA 5C25B 2VG6B 1TKZA 1XHXA 1D5AA 3KD5E 4MQ3A 4KHWA 1T03A 1DLOB 3MEGB 3GIMA 4CGIA 1JL1A 4CCHA 5EU7A 1JX4A 4B9LA 2HVHA 3QESA 4FW2A 2D3ZA 4WXOA 4O0IA 4ELVA 3ZSQA 3GQCA 1QSSA 4M3YA 3TABA 3JSMA 1N6QA 4AH9A 3I8DA 3RBDA 5J2QB 4K50A 4ZHRB 3IRXB 5KFSA 4EYIB 3VA3A 4MIBA 1QUVA 3GV7B 3AVBA 1XR7A 1SH0A 1HQUA 4KTZA 1HARA 2W8KA 5SZTA 2C2RA 4XIUA 4KO0B 5T14A 1N56A 4LSLB 4M3WA 4KHSA 2WRMA 2CKWA 3VQ8A 1NNDA 4FS1A 1K6YA 1TK5A 3GIKA 1LWFA 3OVNA 3DLGB 3BQ2A 4WFYA 4YNQA 3S9HA 4DS5A 1SKSA 3KLEA 1QSYA 4KBIA 4KHUA 3K58A 1RILA 1TK0A 1RT5B 3SQ0A 4DTJA 4RNFA 1W9HA 1HYVA 3VQ9A 4F2RA 1KCFA 3HT3A 4FM0A 1RBUA 1UA0A 1S97A 3ZT1A 4XO0A 3V1OA 3DM2A 3TVKA 2R2SA 3TWHA 3AO3A 3NF6A 5EUHA 3O4NA 4Y1CA 2J6TA 3V4IA 4OPJA 5F8LA 1NJXA 2ASDA 2RF2B 1VRTA 5KFUA 1RAJA 3SQ1A 1VRUA 1BISA 5KG0A 2ZQBA 4FVMA 3LAMA 2W9BA 4IFYB 3H98A 4Z4EA 5F8GA 3LP1A 1C0TB 4EZ6A 4FZYA 5C24A 1ZETA 1ASWA 4J9PA 1EETA 3NF7A 1RT4B 1WSHA 2Z1HA 3SNNA 1KTQA 1BI4A 5KT5A 1XC9A 2AWZA 3CDWA 3N6LA 4ED1A 2BANB 4QOZB 3L3UA 2W9AA 2QKKA 4XPEA 2YNGB 3OYIA 3L2QA 2ZE2B 4IH5A 4Z4CA 3TAQA 1LV5A 5C5JA 1FK9B 3KLGA 3K2PA 5L1KA 4C8MA 3KD1E 2YKNA 3BJYA 5JS1A 3O3FA 4CFCA 2JEGA 3P1GA 2XC9A 3SPZA 3AA4A 1S9GB 1RTJB 4ZVHA 3GIJA 3KHGA 1RTHB 3FFIB 1Q9YA 3D45A 2JEJA 2W7OA 3O3GA 5CYMA 1C2PA 4F3TA 4I2QA 4CHYA 2HW3A 3F73A 4O44A 1SUQA 3RMDA 3NF8A 4ELTA 4PY5A 4RZRA 4Z0UA 3FQKA 3NFAA 3LANA 4DTRA 2YNHB 4C8NA 5J1EA 5KFWA 3ZSRA 3HPGA 4ECYA 1HRHA 2KZMA 4CJ5A 3LDSA 4IH6A 4GVMA 3LWMA 3E51A 4F8RA 3RB6A 2W9CB 4DTUA 3PX0A 1RA6A 4KV8A 3DOLA 4NYZA 2ETJA 4B3OA 5F8JA 4GC6A 2DFEA 4DU3A 2OZMA 2YKMA 2KQ2A 5K14B 4DQSA 1G15A 4CK3A 4O3SA 2V0NA 4TY8A 3V81A 3OYJA 4FJ9A 3G6YA 3TARA 4KI4A 4I9QA 4DG1A 3NKYA 3NF9A 4FLWA 4BE2A 3JYTB 3SUQA 3H4BA 4KTWA 2OPSA 3VQDA 2OPPB 1Z25A 2DFHA 5KG3A 3GV5B 3NAIA 2FVPA 4BDYA 4K4XA 4CK2A 4QPXA 3OYKA 3UQSA 4KKOB 3G6XA 3RTVA 3MEEB 1FXXA 3LZJA 3OYAA 4IOBA 3L2WA 1TKTA 4RW8B 1HMVB 2FVCA 2ASJA 1BQMB 3ZSYA 4Z4GA 1X1PA 4FLUA 4Y2CA 3HSTB 1RT3B 3DRRA 2AGPA 4DSJA 3ZT2A 1NOZA 3AO1A 3VQQA 4NCBA 4I9LA 1TL1B 3CJ2A 4GW6A 4IRCA 3NH0A 1RBTA 2G8WA 3OYBA 1RTIA 5EDWA 2X74A 4OGEA 4CECA 4Y2AA 3MXIA 4FJXA 4NZ0A 1C1AA 1TL3A 4M3ZA 4H4OB 4DSFA 1IKWA 1YVFA 2XY6A 4K4VA 5EWGA 5F8MA 2I5JA 4MFBA 4FLZA 4DFMA 3QO9B 3VQ5A 4RU9A 2KZZA 3KLIA 1WSEA 3QGGA 5HRNA 4LSNB 4J2EA 1EKEA 3QINA 1B92A 4ELUA 1NK8A 3BSAA 3H5YA 4IR1A 4NLWA 4CJEA 4KHNA 1ZBLA 4NLGA 4J9LA 4I7FA 3WNHA 2VG7A 1NK0A 2WONA 3KLHA 5KG1A 1L3TA 4DTNA 4CEZA 4ID5B 4HVJA 1C1BB 4K4TA 3NGYA 5DLFA 3P5JA 3AVLA 3C6UA 4TLRA 1KRPA 3QIPB 4URSA 4R8UA 4YP3A 2Y1IA 3PV8A 3T5KA 4O3PA 4B9TA 2XCPA 4TYAA 3AO5A 1JLEB 4KB0A 1FKPB 1JLAA 4IR9A 1HQEA 1NK7A 4AHSA 4N41A 5KFMA 3T5JA 2GIRA 4O3QA 1RBRA 1RDDA 2G8HA 4ZMMA 4OKKA 3HVTB 3ZT4A 2DPIA 3OS1A 4R5PA 4Q43A 1HNIA 4KAIA 3RAXA 4EP4A 1UWBB 1WAJA 3C6TA 3DYAA 1JLFB 3TAMA 2G8IA 3WNGA 3AVIA 1K1QA 2GIQA 1GOBA 4B8AB 1GX6A 1UOCA 2FBTA 2WTFA 2UUWA 3IG1A 2OZSA 4ECQA 4O4RA 4GMJB 4E1MA 2ASLA 2PZSA 3KLFB 4CHZA 3DOKB 1REVB 1QTMA 1WSJA 1DTTB 5KG4A 2DFFA 1T05A 3L2UA 2P5OA 4ZPAA 2Z1GA 4EBDA 1RT7A 2ZKUA 4R0EA 3ISND 1WSGA 4CESA 1B9DA 2IC3B 1X9MA 1S1XB 4RW4B 5I3UA 2HHVA 4CJKA 1YT3A 4ZTFA 4DL6A 2HNZA 3SI8A 4Q5VA 4DTSA 4HUEA 3AO4A 2UVVA 3NBPA 3KLVA 1F21A 3OL8A 1TP7A 2FLPA 4NLSA 3LP3A 1WN7A 1JLQA 5EWFA 4FCYA 2HB5A 3LWLA 2VWKA 1L5UA 2RN2A 1LW0A 1NK9A 3NGDA 1TV6B 3Q8RB 1BCMA 4PA1A 2FVQA 1QS4A 5E41A 1CLQA 1KFSA 3H40A 1W0HA 1R0AA 3MECA 2WOMA 4O4GA 4TSXA 3LPUA 3N6MA 3H5XA 3T19A 4IFVA 4CHOA 2XI3A 3UR0A 4NCGA 2B5JB 4E0DA 3KK1B 1S48A 4ED3A 5JXSA 1LWCB 4KHYA 2OYQA 1VSLA 1FKOB 2W7PA 1IH7A 3MR3A 4DLEA 4EBCA 4NLVA 3CDUA 2OPQB 4RW6B 1NKEA 4CJ4A 4U6PA 3M9MB 4IRDA 4PQUB 1DLOA 1JLCA 1RT1B 3BGRB 4IBNA 4BACA 1IO2A 3TQ1A 2WHOA 4JRPA 2ALZA 4FK4A 4DFKA 3CVKA 3NDKA 4EZ9A 4Y3CA 3V6KA 4LH5A 1ASVA 3EYZA 2R2UA 4KB1A 5J2QA 4B9UA 3CJ5A 3U6FA 4ZHRA 5DQIA 3IRXA 1TKXB 4YR0A 3LP0B 4ZP6A 4KPYA 3VQ6A 3H08A 2X78A 4NLQA 3G86A 1I39A 1GX5A 3DMJB 2EHGA 3TAGA 4KO0A 4LSLA 2FLNA 4J2AA 3KK2B 2QKBA 1NJWA 2VG5A 4FJMA 1O1WA 2IMWP 3T5HA 4IRKA 4NLUA 3K59A 4DL3A 3AVFA 3DLGA 3G0ZA 2YNFA 4MKBA 3EPIA 4CGGA 3HM9A 4Y34A 4PUOB 1WLJA 4ECVA 3LP2A 2UVWA 1VSMA 3M8PB 3QZ8A 4H4MB 1S0NA 3AO2A 4FJ5A 3N6NA 2F8TA 5T7BA 1A5XA 3AA5X 5KFNA 1U48A 3Q8PB 3V6JA 1C1CA 3VN5A 1KSPA 1YTAA 3DRPA 2IAJA 3KKSA 2QXFA 4FJIA 3VQBA 3MTKA 2RF2A 2O5DA 2XWYA 4EO6A 2BQUA 1SV5A 5KFFA 3RAQA 1XWLA 1RBVA 3QZ7A 4FJJA 4CJUA 2R8IA 5KGXA 5HBMB 3G10A 1RT6B 4M3XA 3ZSZA 3ZSWA 4NYNA 1CSJA 5J2NB 3KTQA 3I5BA 1S0OA 1QAJA 4CERA 3CYMA 1RT4A 4ECUA 3D0PA 4FK2A 4K4WA 1WNEA 4IDKB 5F9NA 1S1UB 4O0JA 2YNGA 1HNVB 2ZE2A 3AVMA 5J2PB 3OYMA 2B4JA 3DLEB 2FJWA 2RPIA 1CXQA 1FK9A 1JIHA 4BDZA 3IS9B 3NH2A 4E7JA 1KLMB 3L2RA 1S1TB 3ZT3A 2IM1A 1WAFA 3WNEA 4N5SA 1S9GA 1RTJA 3PUFA 1S9EB 4DSKA 3V9ZA 1RTHA 3FFIA 5KFCA 2V4QA 1KVCA 3HVAA 1T03B 4Y1DA 4ECTA 5HRSA 2F96A 4F2SA 3MR5A 1JL2A 3RB4A 2Z1IA 3KJVB 4JS4A 2E9TA 3S3OA 1ZTTA 2FJVA 2YNHA 2RDJA 5KI6A 1QAIA 3BR9A 5HROB 1ZBIA 4NLXA 3QIOA 2W9CA 3KNAA 3GIIA 4YMEA 3HYFA 4OVLA 2IJNA 4DQPA 3PW2A 3MFIA 5L1IA 4AHTA 3MEDA 4YR3A 4F4XA 1TVRB 2HHSA 4QWAA 2JGUA 3HXMA 3U3GA 5DQGA 5KG2A 3HJFA 2W8LA 3DI6B 2HNDB 4B9MA 4K4ZA 3PX6A 1LW2B 2B6AB 4FW1A 2C2EA 1RTDB 2RDIA 2R2RA 4Z4FA 3JYTA 4RW7A 4DL2A 4F4YA 2IOCA 2OPPA 3VQ7A 4QAGA 3VQCA 3CJ3A 4QW9A 1S49A 3EZ5A 1HYSA 4EBEA 2GC8A 1TK8A 4FBTA 3BQ0A 4EP5A 1MMLA 2QV6A 4KKOA 1JXEA 4MIAA 3MEEA 4RW8A 1HMVA 4J9NA 1VRTB 1BQMA 4TN2A 4MK8A 4LY7A 3VQPA 3M9NB 1RT3A 3ZCMA 1BIUA 4RNMA 1N5YA 1VSHA 3SQ4A 1J9AA 3V6DB 2W9BB 5CZ1A 1WSFA 3V9UA 3LP1B 2P51A 4JLHA 4KTQA 2A1SA 3OYDA 1BCOA 3S3MA 3KMSA 1NJYA 4N56A 4N47A 4CIEA 4DLGA 2BDPA 5SWMA 1BQNA 1BI4B 4KHRA 3H5UA 3K5OA 5L1JA 4CJSA 1BL3A 3D28A 2DY4A 4J9QA 5D3GB 4ID1A 3M8RA 1HJRA 4NLDA 5JS2A 1S10A 4HHTA 4QWCA 1CZBA 2HHTA 4U7CA 2OPRA 4FK0A 4X2BA 3QO9A 5DG8A 1VK0A 5KG5A 3K5NA 2HHXA 4ZP9A 2XRIA 4PWDB 1RNHA 4LSNA 5DMRA 3EPGA 3AV9A 2P5GA 5KFZA 4J9KA 3AVCA 2KFNA 4CIGA 3SV4A 1CZ9A 4CGFA 3SV3A 3SUOA 1TGOA 4CE9A 5FROA 2UVUA 1LWEB 2D0BA 3OYHA 1NHUA 5C42A 3I0RA 4ID5A 5F8HA 4E89A 1C1BA 2JEFA 4AHCA 3CG7A 1C0UB 4O3NA 4CHPA 4QWDA 4JUZA 4QCLA 3AA3A 3QIDA 5HRRA 1EP4A 5DLGA 4J9RA 3MAQA 5KFLA 2R8JA 1YVUA 1C6VA 2X6NA 4DF8A 3DOLB 4B3OB 3I5CA 3QEXA 1S1VB 3V9XA 1XR6A 1JLGB 2AGOA 3CWJA 2YKMB 5CYQA 1S1WB 2UVRA 1D1UA 4J9OA 3V81B 2BE2B 3PW7A 4FJ8A 3H4DA 1YTUA 2XO7A 2D3UA 4EYHB 3DLRA 3QNOA 1RA7A 4ECRA 3V9SA 2WCXA 4F4WA 4K4YA 3HVTA 3CM5A 2ILYA 1NKCA 2F8EX 3S3NA 3F9KA 3HP9A 3NGZA 1Z4UA 1UWBA 4ED2A 4DL7A 4DWIA 1ZBFA 4Q45A 3QEPA 4K4SA 1JLFA 4JRQA 4OPKA 3NCIA 2R8HA 1TKTB 2HNYA 4H54A 1RT2B 1SKRA 5KFAA 3SUPA 3DRRB 4HCCA 3DOKA 3ITHB 3SCXA 2YV0X 4W5TA 2E6MA 1DTTA 2O4IA 4DFJA 1ASUA 3RRHA 1U4BA 3RMCA 3RR8A 3UPFA 3QLHA 3HVRA 4HUFA 5KFTA 3EY1A 3THVA 1IKYB 3DLHA 2IC3A 1S1XA 4RW4A 1T8EA 4CHQA 1RTIB 2D0AA 2W42A 4KRFA 2XI2A 1TL3B 5FDLA 4FJKA 3HO1A 4FJHA 4FYDA 3SZ2A 1IKWB 3OY9A 1KVAA 1L3VA 3ASMA 4ZPCA 5KFBA 2I5JB 2XY5A 4KI6A 4I2PB 2NUBA 4B9NA 4NLTA 1IKVA 3V6HA 3BQ1A 1SH2A 4O3OA 3K5MA 4L8RB 2XCAA 5I42A 4LD0A 1TV6A 3ISNC 4DF4A 4ZVGA 4FM1A 4WXWA 4I7FB 3C95A 3OLBA 2WONB 3KLHB 2YHBA 3O4QA 3TI0A 4B9VA 2XY7A 4CFBA 1WSIA 4CGHA 3KK1A 4C8KA 2C22A 3LPTA 1LWCA 1NK4A 2ZD1A 4WYWA 3C6UB 3IGNA 4AHVA 5HLFB 4R8UB 2OPQA 4RW6A 4Q0BB 2ATQA 4PQUA 3BGRA 3OHAA 3DLKA 2AX0A 3VQ4A 3IAYA 4DSIA 4WZQA 1JLAB 3AA2A 4ZPDA 4CJQA 4IG3B 4LH4A 4W5OA 3OL9A 3LZIA 4BWMA 1TKXA 2R7YA 4JV0A 4FZZA 2AU0A 3M8SA 3TR8A 2AJQA 1JLBB 4ECXA 4JS5A 3M8QB 2XHBA 4DQIA 1DTQB 3PZPA 3V1QA 4IG0A 1J54A 5KTQA 2JC0A 4HTUA 1X9WA 2O4GA 4DFPA 4K8XA 3ZSXA 1XHZA 4B9SA 4TXSA 3V1RA 3OYGA 3KOAA 4OKEA 3GV8B 4PUOA 1HPZA 1S6QB 5J2MB 1BHLA 2BRKA 3M8PA 4RNHA 1LAVA 5C25A 3MR2A 3GYNA 2VG6A 1D9FA 4M42A 1UA1A 3QETA 3MEGA 4RNOA 4ZP7A 5F8NA 4Q44A 2FBVA 2RKIB 3DRSB 1VSKA 4KSEB 4IQXA 1JKHB 2XGQA 3CO9A 4M95A 1D9DA 4ZPBA 3HPOA 5KFIA 4CF2A 5DGBA 3PR5B 4FJGA 3AVHA 4B08A 1RDAA 4ICLB 4QW8A 4AILC 2G8KA 5L1LA 5KT7A 4M3RA 3QGHA 1SL0A 1UAXA 2AX1A 3PY8A 4BDPA 2JC1A 4Q8FA 1GOCA 4RW9B 3HHKA 3I5AA 5J2NA 3NH1A 3I0SB 4WE1B 5DG9A 1QQCA 3G6VA 4CEAA 4M3TA 3P83D 4CFDA 4CF0A 4E7KA 3OL6A 4IDKA 1VSDA 5HP1B 1S1UA 1R0AB 1RT5A 5KFKA 3DLEA 4DQQA 5DK5A 4O55A 4J9SA 3BREA 3KK3B 1IKXB 3RRGA 3IS9A 1KLMA 1L3UA 4ZVFA 5KT3A 4KFBB 3E01B 2FLLA 3VQSA 5KG7A 1QE1B 2D41A 1CXUA 4WZMA 1KVBA 4KREA 4CJTA 1D0EA 1JLCB 2J6SA 4CF1A 1T7PA 4FXDA 4KE5A 3NE6A 5HRPA 3KJVA 4IFYA 1J5OB 4CHNA 3KMQA 4F50A 3RR7A 1C0TA 4JV1A 2JLEA 2IM3A 3MF5A 3RWUA 2HMIB 2FC0A 3ZT0A 4J9MA 4CEBA 2D7SA 5HROA 3AVAA 4F4KA 4CJRA 4GC7A 2YHAA 4G1QB 1MU2B 4URGA 4ECSA 2BANA 1U04A 3MR6A 1SL1A 2E9ZA 2YNIB 2V9WA 2IM0A 3PVXA 3L8BA 2VG5B 2OH2A 5KFXA 1TVRA 4KB7A 2D0CA 4E7HA 3CFOA 1S9FA 3DI6A 2HNDA 2YNFB 3OYNA 1S6PB 3K57A 2IDOA 1LW2A 2B6AA 3GILA 4IKFA 1D8YA 1RTDA 1RDCA 4QWBA 3LP2B 2JEIA 1NK5A 1KHVA 3QEVA 4CEOA 4IH7A 3PW0A 3HP6A 3MXMA 1TKZB 2A1RA 2IJFA 1VSEA 3D5MA 3VQEA 1TKDA 1XI1A 2PYJA 3PW5A 1C1CB 2I1RA 1RDRA 3PO5A 4LQ3A 3HPHA 3DRPB 4UQGA 3JSMB 2IAJB 1N6QB 5KFPA 3H59A 3SQ2A 4CJFA 1RDBA 3MFHA 3B6PA 1SV5B 4RUCA 3B6OA 3C94A 3OYCA 2F8SA 3QEWA 3V6DA 2Z1JA 2KW4A 1HQUB 3CFRA 4MKAA 3CQ8A 4C8LA 2DPJA 3TAFA 3QYYA 5K14A 4CJLA 2BGGA 1LWFB 1WNSA 1Q9XA 3Q8QB 1RCHA 2FJXA 4DSLA 4H8KA 1XR5A 5D3GA 3KLEB 1U47A 3TAPA 4Q8EA 4E7LA 3T3FA 5FRNA 5KT4A 4FZXC 3LALA 5KT2A 4N76A 2EC0A 3DM2B 4OLAA 4EO8A 4CGDA 4E1NA 2XY8A 2FBXA 3HVWA 5DGAA 4FLXA 4J2BA 5KFQA 4PWDA 5KFRA 3V4IB 2BQRA 3QNNA 4ECWA 3FDSA 4LQ9A 1NKBA 3OYFA 3KKRA 1VRUB 4Z4HA 5KRTA 4ZVEA 2FBYA 2VA2A 4NYFA 4G3IA 1HYZA 1NK6A 1S5JA 1LWEA 2E4LA 2R8KA 1A5VA 5C24B 2HHUA 4M45A 1C0UA 1TL1A 3L2VA 1EETB 4HUGA 4FLVA 3EZUA 4TQSA 3FRZA 4TYBA 3AVNA 3VQAA 4MH8A 3ZSVA 1S1VA 4H4OA 4CEEA 3KHHA 1JLGA 3MEDB 4NCAA 1I6JA 3A2FA 1B9FA 1S1WA 3Q8SB 4K8ZA 3KLGB 3NAEA 5DQHA 5KT6A 2IBKA 3BDPA 2BE2A 2YKNB 2Q3SA 2GUIA 3OYEA 2EX3A 2PY5A 3OYLA 4NLOA 1U09A 4CIFA 2R2TA 4DMNA 2KTQA 1VSJA 4RW7B 1QHTA 2KFZA 5CYMB 4WFXA 4AHRA 4MK7A 4I2QB 4FJNA 4O44B 1SUQB 2BR0A 1HYSB 4NLRA 1IG9A 4FBUA 4DU4A 4XPCA 4FJLA 3RB0A 4DTOA 4MK9A 5J1EB 4FS2A 1Z26A 3TANA 3K5LA 1RT2A 3HK2A 1BGXT 2XGPA 4DSEA 4FLYA 4DTPA 3QIPA 4ED8A 1N5YB 3ITHA
chains in the Genus database with same CATH superfamily
2UUCF 2AEMA 1NU4A 4OI6A 2POKA 1JXLA 4J91A 2E2PA 2EFQA 3MURP 3L95X 4TY8B 2Y1JA 1U7LA 2HURA 4CLFA 1QD1A 1BQNB 3N28A 3PX4A 1NPKA 1JXBA 3SPYA 2MQLA 3NAHA 5KFYA 5HL7L 3AOAA 2P9LB 2PA8D 4RUAA 2RJZA 4LRCA 3UDLA 4OI4A 2XM3A 1UL3A 1VSFA 1K8AO 4IKAA 4LBHA 3RMAA 1X4CA 1UW4A 3SUNA 3M5RA 2MQOA 5BR8K 4PL8A 3EE3A 4AM7A 2FVSA 3L3VA 4OJRA 2CJQA 4HYKA 3BF3A 1U8SA 3QNWB 1NZ8A 5FJ4A 2KN4A 4M41A 3ZXWA 1ZBUA 1KC8O 3V9WA 4QQBA 4JI6J 2NRVA 2BJ7A 1Q5VA 3FEXB 3TEHB 4DXLA 3SMSA 2FD2A 4PG6A 3IC1A 4DS4A 1I94F 3RYLA 2AZ3A 4PXDA 4NA2A 1B7FA 3BSOA 2YH0A 4KHMA 5C12A 4J7CA 1R0BG 1UEUA 5EWEA 3FR0A 2NZTA 4Y65A 4JI3K 3CXCM 5THWA 3MCNA 1OPIA 5BN9A 4KQZA 2NLXA 1VQ6S 2HVIA 3R3TA 4USVA 2QE5A 3ZEUA 1BWFO 4BCAA 2V68A 2VU5A 3OS2A 4EUVA 1OS5A 4DR4K 5M1OA 1SQEA 3VF6A 5JICA 3CIPA 4OX8A 1SQGA 2VG7B 4J2DA 1SAZA 3K17A 4OLBA 3T9ZA 2E66A 4ZJLA 3EEQA 1QLNA 2UUBK 1Y00A 1FEHA 3MX2A 3T6BA 4CJ3A 3HRGA 2ATCB 3KWGA 5HVHA 3U1LA 3CXCR 1RT1A 3SIPB 4HI1A 4L3NA 2IGIA 2B9EA 2XYGB 2DRAA 3DRSA 3R8EA 5DDRC 1HQEB 2C2DA 1EZZB 1YZ6A 2E9RX 3T1AA 4BRPA 4WCEL 1NOYA 2BXJA 2F1FA 1YJVA 3M30A 4KAZA 4HI2A 4CF8A 3OR1A 4BC3A 3LP0A 2HHWA 1OVYA 5BR8J 2FC9A 2HHQA 4NLPA 3MM6A 5C7PA 2GHVC 3H5SA 1HNIB 5IT9U 2QIFA 3OL7A 3CF5Q 1CJUA 3TAMB 2VH7A 4FPIA 3RBEA 1VBXA 4J37A 3G6EN 3QRPA 3MI7X 2ZH4A 2YX6A 3A5MC 1P9YA 3DDKA 1PJ6A 1CJTA 3MM7A 1XTZA 4JI5K 2NUHA 3H2LA 2C3PA 2OD6A 4CLZA 1HR0J 1AW0A 1IN0A 4BWJA 1RAHB 1S7IA 4KY3A 3VALA 4QR1A 3SCIE 2QEXN 5F9LA 5B0AA 3BO2A 1U1RA 4KFBA 3OBWA 1L3SA 2RQKA 1Z6RA 4DU1A 4JKGA 1N88A 3R1XA 3M9OB 3NL0A 2W2NP 1RKJA 4H0OA 4JI3J 1JCEA 2HNZB 2ZUAA 1F6TA 2ZNYA 5M2RA 4A57A 2E6LA 2V2VA 3SYZA 2AJ4A 3NMAA 4BREA 4CLUA 1EX4A 3R7BB 4U9RA 2CH6A 1FCAA 1RT6A 2AGQA 2HMIA 5HMZA 2HBZB 1IVZA 4DR4J 2J7KA 3QGIA 4EMDA 3H1QA 4A47A 1V5VA 2MZQA 5A0YA 3I56S 3S41A 2LEPA 4H0PA 4MAKA 4G1QA 4NX9A 2B4OA 2LDIA 1HHTP 4FNHA 3MECB 2WOMB 1HNVA 2IS3A 3L4IA 3A12A 4DR7J 1ELOA 2UUBJ 3HI0A 1SZ2A 1SC6A 1QSLA 3R8YA 2ZVSA 3N4PA 5CE3A 4RUBA 3LO3A 5LJ3Y 5KOXA 1D5AA 4JI1F 4KHWA 1R59O 5LMNF 1DLOB 3MEGB 3EICA 1JL1A 1LCUA 3QESA 2I7NA 4FW2A 4ZVSB 4O0IA 3GJQB 2EEYA 4M3YA 1N6QA 5HVGA 2GVZA 3I8DA 4LF8K 2DHAA 4OHYA 3KWIA 3IRXB 4EYIB 3GV7B 4NO7A 1XR7A 5I9EB 4AQYK 1I1GA 3VPZA 3S1TA 1KTVA 5T14A 3NWGA 3TSPA 3N4WA 2CKWA 4USWA 2ZJQL 2XSJA 1TK5A 5SUHA 2PSZA 1NB2A 4X65K 2OJ3A 3MMBB 5ETQA 3KLEA 3D6FB 1QSYA 2MMYA 4LF4K 1RILA 4DTJA 1P9QC 1HYVA 3VQ9A 3HT3A 1Y11A 2KT2A 4XO0A 3V1OA 3DM2A 4K0KK 3TVKA 4BC7A 3O4NA 1L3KA 3BM7A 5TKYA 3D1OA 2RH3A 2G0IA 2ASDA 1N33F 1R0CB 4DN0A 2E2QA 1SC1B 3VERA 1VRUA 4BBYA 4LFBF 1SS6A 5KG0A 2ZQBA 4FVMA 2HLTA 3IUCA 1UZDA 5H9FJ 2YI1A 1M90T 3V5RA 1RBAA 1ASWA 4YOTA 3DKDA 2ZJRL 4J9PA 1RSCA 4EI2A 3NF7A 2ZBQA 2DNOA 2A0FB 3NNCA 3JAMU 5KT5A 2AWZA 3TX8A 4RCHA 1FXDA 2W9AA 1NBWA 3LDOA 3OYIA 4ES1A 2ZE2B 1RABB 2H48B 3QJPA 1JNZB 1FK9B 3KLGA 3K2PA 4C8MA 5JLFA 3OT9A 3O3FA 5AQTA 4F02A 2QWQA 4ZIVA 3R6GB 2XO6A 2XC9A 3SPZA 3AA4A 4ZVHA 4ZN3A 2JEJA 1X4BA 5CYMA 1Y64A 4F3TA 1ZPVA 1D4XA 1RZMA 3KG0A 2HW3A 3F73A 5I4MA 1SUQA 4J90A 2XQCA 3NF8A 3RMDA 1FF2A 2B51A 4LF8J 3DU6A 4Z0UA 1VQSA 2R9LA 3ZFVA 1X8DA 5J1EA 1H2VZ 3ZSRA 4ECYA 2YJFA 4AQYJ 4OPHA 1YBAA 3LDSA 4IH6A 4GVMA 1N8RO 3LWMA 1SJRA 4RPFA 3SEOA 3ISZA 1XK8A 4DCPB 4B3OA 3TTCA 1IUJA 2RU3A 3HJVA 2JX2A 4WFBQ 4O3SA 4LF4J 4TY8A 3AOBA 3TARA 1GNKA 3EVWA 3F41A 3F0NA 5DZ6A 3NF9A 4FLWA 1IBKK 1X0PA 4K0KJ 3C8YA 4DKWA 2OPPB 1FKAF 2DFHA 2CPJA 2P9IB 3NAIA 2UP1A 5HVFA 2Q97A 4BDYA 3UQSA 5FPNA 3MEEB 4JI0F 1FXXA 1U6ZA 2FPHX 3D3CJ 1BQMB 3ZSYA 4Z4GA 1X1PA 2CGJA 1W7WA 2CQHA 3HSTB 1C0FA 1M5SA 3D54A 3SQOP 1S59A 2YWEA 4ZCKA 1T11A 2YY3A 5G0RB 1SC3B 3M32A 4A2AA 1LOUA 4OI1A 2E7XA 2ZHBA 1J5EF 1RBTA 1QVGM 2D3O1 4FYXB 4JP8A 3OYBA 4CECA 2X74A 1EKRA 2B56A 4PXEA 3OV7A 4DX8H 1C1AA 1WG4A 4BG8A 4CQ1A 1YVFA 1S6UA 2XY6A 1VISA 2LYVA 1VHXA 2P9GA 5EWGA 5F8MA 2EFGA 4L75A 4ZIWA 2F40A 3BUZB 3QGGA 1HKGA 1O5JA 2QWPA 1FDBA 3JQMA 2OSQA 5BPLA 1B92A 4ELUA 1NK8A 3BSAA 2UXDK 3H5YA 4IR1A 1MA9B 3EM1A 1BUPA 2BX6A 1ZBLA 4WKRA 1FRXA 2VG7A 1VBKA 1QVGR 4CEZA 2Q79A 3Q2SC 4K4TA 1OQ6A 1PC4A 2F4VK 3AVLA 1NLKL 1U2FA 1KRPA 1JJ4A 4R8UA 1VBZA 1Z2ZA 1K8AT 5D8HB 3O08A 3HSZA 3EDQB 4U8YA 1F3VA 4TYAA 1DURA 3GR0A 3QT7A 1IBKJ 4KB0A 4WJBA 1FKPB 1HQEA 2QEXS 3L4QA 1CJKB 3OXGA 1KC8T 2GIRA 3CCQN 2F9WA 4MDAA 1RDDA 2NXUA 4ZMMA 3P39A 2H4YB 1Z1ZA 5EXWA 4B1XB 3R6LB 1X4FA 1LQ9A 3HOSA 4Q43A 1HNIA 5LMUF 1WAJA 3TAMA 3K2YA 2CVEA 3WNGA 4FWMA 2DGOA 4ERDA 2BV3A 3HX9A 3MX5A 4DUYF 2WTFA 1NPPA 4GMJB 4E1MA 3M1FA 2DGUA 4CHZA 4JKCA 3HZ6A 2HFZA 3BV8A 5KG4A 1KAXA 3L2UA 4DV7K 4BRKA 4H5TA 4UY85 3EDRB 1B9DA 3IR7B 1DBDA 1VQKN 3FGVA 4FWQA 2BJ3A 3OD2A 2HNZA 4DUZF 2C42A 1S99A 4DTSA 4HUEA 2QLFB 1X3MA 1M5HA 3QT5A 3OL8A 3CHWA 5BR9A 4K43A 3Q7CA 2A5XA 2A6OA 2UUAK 3LWLA 2O3DA 4WP8A 4Y2MA 5CD4H 3R1LA 1L5UA 1TMJA 3Q8VA 2XLIA 4HDHA 1SQKA 1TV6B 2Q6BA 1BCMA 1K9MT 1CJVB 2E29A 4PA1A 2FVQA 3CJRA 3ZTPA 3CSKA 2WW4A 1W0HA 4I68A 3OFHA 3MECA 2WOMA 4I6AA 2F4VJ 4WF9Q 1MN7A 1SXLA 2YPYA 5AJ3K 2B5JB 4E0DA 2DITA 3NP5A 4ED3A 1JB0C 3BPSP 1ZM2A 1VSLA 3Q22A 4NLVA 2ERRA 3D7EO 3VESA 2OPQB 4U6PA 1SBRA 4LRBA 1DLOA 2HF4A 2H54B 4X4OA 1U1PA 2ALZA 2DNYA 4OX9K 3QWPA 4Y3CA 4QBUA 3EE9A 4IOXA 5IT0A 1ASVA 1BLUA 2KRRA 4DV0F 3D66A 3MUVP 3CJ5A 3TQEA 3IRXA 2WW8A 4BRDA 3VV2B 9ATCB 4OYPA 1RB0A 2CUYA 4X4RA 1PYSB 4NLQA 5DDQC 3G86A 2DEJA 3I8BA 1NHKL 3DMJB 2BJEA 1K73T 4ZVRB 5B09A 2A2CA 3WZ0A 1WF0A 2FHKA 3O4WA 2VG5A 4FJMA 1PJ5A 1O1WA 2IMWP 3T5HA 4LT6A 4KGXB 3R6MA 4CNZA 2VCPA 4OYOA 1JMTA 4KH4A 4DV7J 4E1JA 1N36K 1HNZF 3HOTA 2UVWA 2VJVA 4DV3K 3QZ8A 4ZK7M 4OYIA 1XBWA 1DKGD 2VBXA 3F44A 1KQGB 3N6NA 2ZH9A 2ZJPQ 1W26A 4OPAA 5IC6B 5T7BA 1FRKA 5KFNA 3DDNA 3V6JA 1SCJB 1ZAVA 1C1CA 2MQNA 1YTAA 2IFXA 3CMAS 1IBMK 1HPMA 2QXFA 3R2CJ 3MTKA 1NNEA 3BB5A 2XWYA 5I3QA 5KOWA 1RBVA 3QZ7A 2UUAJ 1QAYA 4LF5F 2R8IA 4YHHK 5KGXA 1YGYA 2FSKA 4M3XA 4NXMK 2WBNA 3KTQA 1GXUA 4PHTX 2D9PA 1QAJA 2DR5A 3LGMA 3B6BA 4FWOA 3D0PA 5AJ3J 1U1QA 1WNEA 2E5IA 3DGPB 5F9NA 3ATUA 4JK9A 2ZE2A 1KQSM 4A8XA 3Q8YA 2B4JA 2W2QP 2V50A 1FK9A 2UU9K 2G0CA 3HSGA 3W2WB 4CT9A 2XS7A 1AYEA 4DV1J 2FZCB 3HZGA 1WAFA 3WNEA 4N5SA 4ZLJA 4FWPA 4DSKA 1RK8A 5LT5A 4B3RK 3QAEA 4O8KA 3HVAA 4CZKA 2UXBK 1T03B 5HRSA 3TX0A 3HHNB 2PDAA 1JK9B 4LF9J 3LPYA 3WXLA 3KJVB 3S3OA 1AT1B 2V69A 4H5VA 3A4TA 1S5ZA 1O51A 5AQQA 1KQSR 3TEGA 5JVGL 4NLXA 2RUGA 1HBNB 3KNAA 2NZ4A 4XK8C 1SPBP 3TU5A 2JDJA 1NEEA 5BREA 3UVJB 3SAHA 3CI5A 3MEDA 2DXDA 2V52B 4F4XA 3J7Z5 1HNXK 1N36J 4JKAA 1OY9A 4QWAA 3DDIA 1VQON 4ZITA 3U3GA 2EXUA 2W8LA 5BXIA 4K4ZA 4FWRA 2G2ZA 4C97A 2DHXA 2V8GA 2RDIA 2DK2A 4Z4FA 1FJGJ 2MDAA 4RW7A 1VQMN 2AD9A 3OPKA 2IOCA 2OPPA 4WFAQ 3VQ7A 3FMBA 2CQ2A 2P9EA 2P9IA 3HHLD 2FZGB 1S49A 1R8HA 1MG7A 2XEXA 3MCAB 3BQ0A 4PEOA 3HHDA 5AQHA 3DC2A 1WOQA 2UXCK 3MEEA 2IVFB 4P2MA 2CZ4A 4YHHJ 4F4AA 1BQMA 4TN2A 4MK8A 4LY7A 4PKGA 3VQPA 3ZCMA 3HULA 1N5YA 3MAHA 3SQ4A 3OQ2A 1J9AA 3V6DB 2ZVIA 1WSFA 3PFOA 3KXDA 2JHEA 3LP1B 2P51A 2HS3A 4ZCIA 4CIEA 3MPYA 4JD2B 3K5OA 4KHRA 1R8PA 2GMLA 2UU9J 1TELA 4XH1A 2GNKA 1S10A 4HHTA 3K8WA 4U7CA 2OPRA 1LK5A 3P6YC 1Q16B 1FT8A 4B3RJ 1QTNB 1N8RT 2UXBJ 3ENOA 1VK0A 5KG5A 4DI6A 1QQMA 5AQSA 1RNHA 3CCQS 2K1RA 4P72A 3BH6B 3EPGA 5IV4A 3AV9A 3K9JA 1WWHA 5KFZA 2LA6A 2KHOA 1YHQN 3AVCA 4USIA 5IQQA 4LFAK 3SV3A 2JOQA 3SUOA 5FROA 1N32K 1LWEB 1MW7A 1N34F 3OYHA 5C42A 1EHWA 3I0RA 4AHCA 4JAXA 2K7KA 3SQGB 3VF4A 3AA3A 3QIDA 4KHPF 3S01A 4J9RA 4MTPA 1HNXJ 1G2EA 1C6VA 3DHXA 3I5CA 2VDHA 3QEXA 3Q2TC 3LDNA 1JLGB 2Z30B 2DXFA 5CYQA 1IJJA 1D1UA 2VC1A 4QIEA 3Q7BA 4USTA 1BA1A 1CJKA 4FJ8A 2W25A 2G1DA 2ZDOA 1VQKS 1YTUA 4ZVPB 4C9DA 4EYHB 1MSWD 3SSRA 1TFYA 4PABA 8ATCB 1UP1A 2ILYA 2F8EX 2UXCJ 2AJ2A 2VPXB 3NCPA 5AZIB 3H3OB 3DLJA 1QM9A 1ZBFA 4C0OC 2RB7A 3MM9A 3NCIA 1VHFA 1UWAA 2ZZTA 2AJFE 4UOGA 2HNYA 3NEKA 3VGMA 5KFAA 2GQQA 3DRRB 4HCCA 1BA0A 1OYEA 4W5TA 2E6MA 4DFJA 1SQFA 1GLFO 2A18A 3U1NA 3RMCA 2B4UA 3RR8A 2RQCA 2BH1A 3UPFA 1TL4A 3A8YA 3TVZA 3THVA 3EY1A 2FHMA 4BQZA 2KJWA 1V3SA 2D0AA 4USKA 2Q43A 4GV6A 4KRFA 2O8BA 4DJBA 4N8OA 2E1AA 3G8SA 2RRNA 2R7WA 4LF7F 3SZ2A 1KOOA 1L3VA 3UKRB 3TUZC 5KFBA 2HIYA 2QLBB 4I2PB 4H4KC 1C4CA 4DR2J 2OANA 1IKVA 2ALYB 4LIWA 1RWNB 1SH2A 2ZGYA 1WG1A 3K5MA 2VV5A 2B9XA 4LFAJ 3H8YA 2LMIA 1TV6A 2MQ8A 1CJVA 1N32J 3D1HA 3EXCX 1JCGA 4Y6IA 5AT1B 2GVDA 1OIAA 4WXWA 3C19A 4I7FB 3C95A 5B7WA 2WONB 1WC1A 3KLHB 2DY9A 3O4QA 2Y0SD 4EK2A 4CFBA 2EFPA 3V4MA 1JJ2M 3U8XA 2AT1B 3LPTA 3ETOA 2CQCA 4DZDA 2ZD1A 3X1LB 3C6UB 4U7BA 4FOEA 5HLFB 4NI2B 2OPQA 4Q0BB 2MSSA 1K0VA 4EHUA 2CA9A 2OLWA 3DLKA 1DQ8A 1Q82T 1MLAA 3FZBA 1PBAA 3GE1A 4IO9L 4CZGA 4WZQA 2ZHAA 1JLAB 3QICA 1TU0B 2M8DB 4ILRA 2VASA 5IT9O 5CHCB 2HWTA 4OYXA 2E1RA 1KN6A 2CVIA 2P9KB 2AHOB 1JLBB 1JJ2R 2HKEA 4A5AA 4JS5A 3PZPA 1WKKA 3PRBA 3C3LA 5KTQA 4HTUA 4QS8A 1X4AA 4DFPA 1F1BB 5T7LA 3ZSXA 4TXSA 4LF6K 3KOAA 3M2RB 3THYB 3GV8B 1FHTA 3PSFA 4M7XA 5C2CA 1S6QB 2XMVA 1T3OA 2HK3A 1WD6A 2CJYB 5J2MB 2BRKA 4X62F 2VG6A 3ZZOA 1D9FA 4M42A 1UA1A 3QETA 2LEAA 1WDTA 2BKNA 4ZJQA 2PT0A 5DM6Q 1V3RA 2Q66A 1JXVA 2ZWOA 4B1UB 2CQPA 3I31A 1KQKA 4BC9A 4M95A 2OFGX 2F9TA 3ETMA 3J81j 3UDEA 3HPOA 4B02A 5AZJB 5GMEA 2GO8A 3AVHA 5LJWA 1KD1O 4FXVA 2BUPA 2MSTA 3MDQA 5L1LA 5KT7A 3PY8A 2JC1A 3EGWB 1BO5O 2YWFA 1DFDA 2MLYA 4WE1B 1F9EB 2N4CA 2IVNA 3DWLA 1QZ5A 2GAHC 3M6XA 4IJAA 3DGPA 3FZLA 4B1WB 1D3WA 5KFKA 2LQBA 5C15A 4PKIA 4M63A 4HLBA 4J9SA 3W2WA 3RSEB 3ZZRA 1VQOS 1L3UA 2NSCA 4QYZK 2ZBRA 4A8OA 3R5BA 4DX5A 3E01B 2FLLA 3ZYYX 4YOWA 2DO0A 3VQSA 5KG7A 4V19S 2D41A 3T6JA 5HATA 1D0EA 3FE1A 1JLCB 4CF1A 3G9CA 5L39A 3KJVA 4IFYA 4CHNA 2YJEA 1HX1A 3QT8A 2LEBA 5B0GA 3CCSS 4YOUA 2ZOFA 4OMFG 1ATRA 1S7HA 3ZO7A 3ZT0A 3C6HA 4J9MA 2W4CA 1TZ0A 1S3XA 4C8ZA 2CNLB 2ABYA 1NSKL 3VVTA 1HBNA 3LF0A 4USMA 2CYYA 4ECSA 4JI5F 1Q5YA 4LF6J 5HO4A 3CQXA 2PN6A 4DV5K 2E9ZA 1E6VB 4L3KA 3PVXA 1OH7A 4D3HA 5JJBA 4KB7A 4GVLA 3E9OA 2QMUB 1T6CA 4MJKA 2YNFB 2AP1A 3GE9A 3BEGB 1D8YA 2W24A 1NK5A 3QEVA 1WHXA 4LSZB 1UVIA 2Z2LA 2XNQA 2AKWB 2VL1A 4CLPA 2KVQE 3O1LA 3R97A 4LQ3A 3HPHA 3DRPB 2Z56B 5KFPA 3HHLB 2RRAA 1XEZA 3PJ9A 3MFHA 3B6PA 3OYCA 2IBOA 5A2QU 4DR5K 3V6DA 2KW4A 2OGUA 2QSWA 2V5HG 3KWMA 3C2PA 3M2VB 1M5VC 1NGCA 3IP0A 3VZHA 2XLJA 1WNSA 2BJDA 1Q9XA 3Q8QB 3MD3A 5AQIA 2CQGA 2FJXA 2VQFF 4JD2A 2GX8A 2HEKA 5HMWA 4H8KA 3ZX0A 1P1LA 2QL5B 5L38A 4A2BA 1KEKA 3TAPA 2AV5A 1HIYA 1U26A 4HEA9 2UUCK 1XMOF 3LALA 2QLJB 4N76A 2EC0A 4EO8A 1U1NA 4FLXA 2NXEA 4DCHA 3FDSA 1IR1A 4RWXA 1NKBA 3W65A 3KKRA 3FLCO 1HA1A 2WVBA 1J2VA 3G4SN 4G3IA 1NMNA 2V94A 4Z37A 1NK6A 1LWEA 2E4LA 3IA0A 5AFUH 3D6MB 4X4NA 4PG7A 2J9DE 2DR8A 2RHKA 3SQGA 2GZOA 4DV5J 2KT3A 1RADB 4JOUA 4TQSA 4ISEA 4I6YA 3AVNA 4A8KA 1UVMA 2XHWA 4LREA 1JLGA 2DNLA 4FKXA 3UW1A 4E2FB 3Q8SB 2NQPA 1SJQA 4ALZA 1YJUA 2DPNA 5DQHA 3MK6A 3NAEA 1NU0A 4YOXA 1X5SA 5GMKa 3VAFA 2EX3A 4JHDB 2QXLA 3P31A 1NMEB 1KQFB 3QBWA 2ZKTA 1QHTA 4WFXA 1GLEG 3G82A 3M6GA 4AHRA 1OSDA 4I2QB 4EAHD 4YDUA 3AY9A 3THXB 2DCLA 4FJNA 2BR0A 2YXLA 2N82B 1GXLA 1QDUB 4XPCA 5D4OA 4DR5J 3PFEA 4FS2A 4XEIA 3TANA 4GVBB 1R31A 2KU7A 3HK2A 4DSEA 1AUDA 1HBOB 4ZVTB 1UVKA 4RNNA 3PEHA 4QS7A 5KRSA 3RW7A 2HRYA 1B99A 4FZVA 4CEQA 3MM5A 4TQRA 1JLEA 1OYDA 2VA3A 3VGSA 1J27A 3FSIA 5K9FA 1I3AA 3WXMB 3MN7A 2OELA 2VFSA 2XULA 1RYSA 2UUCJ 1LFPA 2VGNA 3RGIA 3EGNA 4X4SA 4IYQA 2P1JA 3KK7A 4DG1B 3AT1B 2CPEA 2MLXA 1OSCA 1EQ0A 3H3NO 1SL2A 1ZTWA 1M1GA 3CJSA 1JJCB 3AVGA 2GHPA 4I2PA 3ZZZA 1KHWA 4CJVA 3I32A 1ULRA 1OPZA 4F3OA 2CGKA 3TWZA 4NASA 2GJIA 2HS4A 2VPYB 2FJBB 5AR0A 2IHR1 5LL6d 3KLFA 1REVA 3CJ4A 2BRLA 1WSVA 3AA9A 3OTEA 4URQU 2V8DA 5AQYA 5CQGA 2CG4A 3HD1A 5HLFA 1FO1A 4Q0BA 2CQ4A 5F0XA 3CC7N 2GEMA 1I94J 2M2BA 1VSIA 3OBYA 3CDEA 3QDKA 3AB4B 1RUSA 2FJEB 1YI2S 3OJUA 4BE0A 3KLIB 2Q36A 1BY9A 1HHSA 3I4PA 1QZ6A 1RHMB 2B4PA 2XWXA 2P9KA 4OJ3A 2ZJQQ 1JLBA 3MAAB 4TU8A 2YQ3A 2E7WA 3EMTA 4OHWA 4J8FA 1OH6A 3KHLA 4OHXA 1NO8A 1SH3A 4WFZA 2ZH3A 3CCUN 3M2RA 3THYA 3AVJA 4CZHA 3DJCA 2CQBA 2R8GA 4QWEA 2V4RA 2X7IA 1N48A 1FKOA 1S6QA 1MDUB 1HWUA 5J2MA 3JSYA 1T3NA 4CF9A 3NNHA 4B9QA 1RYRA 3IO1A 3T1YK 3CCES 2O67A 4N8NA 2HAIA 3ILLA 4M94A 1MWKA 2IIRA 2P9PB 3KVGA 4C8OA 1YAGA 4HCBA 4E19A 3CT9A 1R6YA 4A4JA 5KFDA 2HWIA 5H9EK 3TSQA 1GLBG 2C3UA 5AZJA 1Q8IA 4NLCA 2YQ1A 2P6SA 2OA8A 2HWHA 1A5WA 4JI1K 4CP5A 5LMNK 3DLBA 5DRKA 3PXGa 4NLYA 4TVAB 3KK2A 1U1OA 4DL4A 2OIHA 2VODA 3DYAB 2B43A 4WE1A 4NZ6A 4OKJA 3QJJA 1S76D 1JJHA 4JKHA 5I42B 2C2ZB 3IG1B 2KM8C 1RDUA 3MOZA 2M7SA 2GHWA 3BSNA 1QY7A 5GINA 2N3OA 3AARA 1T05B 3RSEA 1S0MA 3GYGA 4CEDA 3JB9k 1RWVB 3HKWA 3RJMB 4B8CA 3TJ9A 3L09A 2ATLA 1U6FA 3E01A 3AHPA 5I3UB 4WU2A 3AH6A 2XG8A 4L76A 3RB3A 1P90A 3UO0A 2FGCA 2E5HA 2DTUA 4HKQA 1T94A 3ZSOA 3AXMA 4IOAL 1XMQF 1VQ5S 3OSNA 1NJZA 2FHJD 1WEXA 1K1SA 5B8HA 4W5RA 3C65A 2ADCA 4BR0A 2AA4A 4FL9A 4Z4IA 1JLQB 4YN3B 5CY4A 2LSNA 5DG7A 4ANEA 3NGUA 3T5LA 3LPEA 5DDPC 5DO2A 3G87A 5M1QA 2ILZA 3R9PA 1LW0B 1N33K 1RWXB 4E3SA 1RU1A 3DXKB 1O6XA 4KGVB 3DAWA 4LFBK 1WF1A 2P9SB 4IG0B 4M5NA 4K4UA 4NB4A 5AXMA 5ETVA 4DPTA 4NCGB 2MHNA 4BGBA 3QERA 4YDXA 2LFVA 1S1TA 4MDBA 4KH5A 1KD1T 5G4DA 4X66F 3M1VB 1S9EA 4CK1A 3HL8A 1LFWA 3IM9A 4W5NA 5IFMA 4FPAA 1WUAA 5EHHA 2PD1A 5H9EJ 4IOCL 5EU7A 2GQ2A 3O5BA 4LR9A 3ZSQA 3GQCA 3CMES 3OW2M 3HHLA 2QZ8A 4LBIA 4OV6A 5LMNJ 3BDEA 3RBDA 5J2QB 4P75A 4OZNA 4DHVA 1HKAA 5KPZA 1SI9A 3QBXA 1HARA 4NXNF 2GW8A 2RNEA 1N56A 4LSLB 4M3WA 2WRMA 4FS1A 1UEKA 5D4LA 1H2UX 4YNQA 3S9HA 3O1WA 4KBIA 4KHUA 1RCOB 1WOSA 3VMFB 5IS2A 1RT5B 1W9HA 3OW2R 4MO4A 4OX9F 3O6WA 1S97A 3QB0A 3ZT1A 5F3ZA 4NE9C 3TWHA 3NF6A 8AT1B 2AYGA 3UE2A 5KFUA 1RAJA 2HFOA 4O23A 2CZ9A 3SQ1A 2V51B 2EW9A 2C2OB 1YX2A 1NWKA 4JK7A 1BISA 4CBXA 3WEEA 2W9BA 3I55S 2CQ3A 1N33J 3ULEB 4FZYA 3RRKA 4HT5A 1SJFA 3OR2A 2HFUA 4YY3F 5HQMA 1XQSC 1RHQB 4LVOP 3GFHA 4UZCA 4LFBJ 4JI0K 1WSHA 4K5RA 1KTQA 1BI4A 1N54B 1XC9A 3CDWA 4ED1A 2BANB 3CJ9A 3H25A 3ELHA 1VHIA 1IBMF 4IO8A 5L1KA 1FXRA 2VB6A 3OTCA 5JS1A 4BS2A 4Q7AA 2IRYA 4JHDA 2JEGA 4CI6A 3P1GA 1J5EK 4UOFA 4KYZA 4FF2A 1RXOB 3PIPL 3O3GA 1FI4A 3ZX3A 6AT1B 2XMAA 4I2QA 1XUPO 3THXA 1H98A 1GLJO 4NXMF 1YJWS 3QQCD 2VPWB 3O3LA 4DTRA 3HPGA 3RAMA 4GVBA 1H7XA 1H74A 4LMZA 3N9UC 4AXJA 1HBOA 4CRJA 2W9CB 3RB6A 2OD4A 2LDYA 4GC6A 1NGIA 2RDDA 2F8HA 2DFEA 1HW9A 2BOAA 2YKMA 2KQ2A 1G15A 2ASOA 3V81A 1Q53A 2WBMA 5CAAA 2CRLA 4FJ9A 3G6YA 4IEEA 5GAHI 3ZX2A 4QU7A 3HFVA 4DG1A 3NKYA 2E2NA 4BE2A 5GVQA 2M0GB 3PCOB 2PI4A 4V1Ak 3JYTB 3W63A 3O9SA 4I56A 3H4BA 5A8WA 5KG3A 2K2PA 3GV5B 3FGUA 3H2UB 3MZIA 1QQNA 1F0XA 4M1KA 1F2GA 1XC3A 3VAHA 2N4DA 3LZJA 4IOBA 1PBUA 4RW8B 1U1KA 1HMVB 2C2NA 3GCWP 2LQ8A 4B1ZA 4Y2CA 2H1YA 4DSJA 1WI6A 2AGPA 2WFBA 2GJ2A 3ZT2A 4DDFA 1VQPN 1NOZA 4JI0J 4JI2K 1KXPA 2KLAA 1VIXA 5LMUK 1EWQA 2FIUA 3SBGA 2WSFC 3VQQA 2A1BA 4I9LA 3CCUS 1TL1B 1K47A 3MMCB 3NH0A 2AYMA 2NRRA 3LGHA 2L9DA 1RTIA 4DUYK 4CLLA 1H72C 4ZJOA 2J0XA 1TL3A 5GAEI 4H4OB 1IBLF 1OH5A 5A8RB 4RUHA 4K4VA 3W61A 2Z58B 2I5JA 4FLZA 5K8MA 1PC5A 2YKPA 2DVIA 1V3ZA 3NNAA 4V19J 4DV2F 4JI6F 3KLIA 4LSNB 4JK8A 4WU3A 1NSQA 3MAAA 4DUZK 1MWQA 3M6WA 1HBMB 1QAXA 3WNHA 2A42A 2M3DA 5KG1A 2W1BA 1FXLA 1NMDA 3LDQA 4DTNA 1PSDA 3EVMA 4M5DB 4PCQA 3P5JA 4JI4F 2XBPA 1Y4ZB 2DXEA 3QIPB 4DBQA 3CQYA 1V9OA 3T5KA 3CC2N 4B9TA 2V63A 2P9PA 1IJFB 3O8MA 4GV9A 1KONA 3J7A1 4IR9A 2IYGA 4N41A 3PKYA 3CCVN 5A76A 1RHJB 4FF4A 2E5LF 1ZA1B 1GMUA 3PYEA 4UUXA 4OKKA 3HVTB 3D2EB 3ZNUA 4DN9A 3OS1A 4ES3A 3OVAA 1VGYA 2JJ4D 3DYAA 1DZ5A 3AVIA 2VBZA 1DARA 2EFVA 4DV0K 5AQLA 3IG1A 2OZSA 4ECQA 4I64A 5LMUJ 2ASLA 2H9ZA 3W64A 3DOKB 2NYHA 4BRAA 1QTMA 4Z2XA 2XYPB 1HUXA 3CUNA 1E3MA 3H46O 4OYMA 3IAM9 1T05A 2MY8A 1GMVA 2ZKUA 4P2SA 4R0EA 3ISND 1WSGA 3CE8A 3CW2C 4PYDA 1VR6A 5I3UA 2ZH6A 5L9NA 2HHVA 4NMXA 4CTAA 1HNZK 3W5ZA 4K41A 1S77D 4Q5VA 5AQOA 3AO4A 2HBJA 3KLVA 1WC0A 3P49B 5LSRA 1JLQA 1Z05A 1NSPA 4FCYA 2HB5A 4MKYA 2EFOA 2VWKA 1VQYA 2LXFA 4OIXA 1LW0A 4R0JA 1NK9A 2KDOA 2CFXA 1HR0F 4R25A 5E41A 1QS4A 3DXKA 1KFSA 3BZCA 3H40A 4LF5K 2CIMA 2P9SA 3NMUA 2QYCA 4TSXA 3N6MA 4CHOA 2DIVA 1RU2A 2XI3A 3UR0A 5DDOC 4NCGA 4M5LA 2VFTA 1JQGA 2DGTA 2JZ5A 3GIRA 1GFWB 1SJ4P 1FERA 3UKUB 5JXSA 2IVPA 4BGAA 2W7PA 4NA1A 3MR3A 3I9V9 4DLEA 3CDUA 1NJIT 1UFWA 2B4VA 1VQ8S 4OLPA 4KT0C 4OYZA 3M9MB 4IRDA 4USJC 1RT1B 4BACA 3FBCA 1AB8A 1T9UA 2WHOA 4UTGA 3KNGA 3O44A 4DFKA 3J8AA 4EZ9A 4LH5A 2GV1A 2NR0A 3EYZA 2R2UA 2OTJN 4KB1A 2HLUA 5J2QA 4B9UA 4M5HA 1Q7YO 5DQIA 4C23A 3LP0B 2PA3A 3AXKA 3VQ6A 3LM9A 3R27A 2HFNA 3M6VA 1KVJA 1EQYA 2QW9A 4LSLA 2FLNA 1VCTA 4DV0J 3O1BA 4DPWA 1H0HB 1NJWA 3CCTA 5B0DA 4IRKA 1RACB 2W41A 4MKBA 3EPIA 3HM9A 3LP2A 1VYAA 3M8PB 4FJ5A 1K44A 1YRTA 5HJXA 1A5XA 3AA5X 1NH7A 2MKIA 1ZXOA 2KT5A 3C46A 1HNZJ 4P2XA 3HM8A 2IAJA 4CH1A 3GFYA 1CEZA 4JKGB 3VQBA 1Q8BA 3T69A 3D7SB 2F3JA 3MMAB 1CBKA 2AIRB 2BQUA 1XWLA 1I5OB 3WQPA 1RBOB 3IAS9 4OI2A 2NXNA 4CM2A 1M5KC 1RT6B 3EKUA 4OZ2A 3ZSZA 3ZSWA 2YKQA 1CSJA 1R7IA 2NSBA 3DHWC 4FK2A 3ENVA 1CS4B 1S1UB 3AJDA 3J81U 1HNVB 5K8OA 4ZPVR 3L7OA 3DLEB 2FJWA 1RWPB 4LF1A 5BJRA 4X4PA 1RISA 4OZJA 2DNNA 2PFUA 2J9DA 4YUDA 1HI0P 3EUNA 1W2IA 4BC4A 1HWIA 2WVFA 4Y1DA 3JSRA 1GH8A 2HYIB 3MR5A 3ONQA 2GWKA 3RB4A 2Z1IA 2BVZA 3JSBA 2FJVA 2PO4A 2VIHA 4U7UK 5AQRA 2RDJA 1W97L 3I33A 3GG0A 3VR1A 2XHCA 4HR2A 2W9CA 3GIIA 2ZHOA 3PW2A 3MFIA 2DD8S 5AQNA 3KJNB 4AHTA 2XMKA 1FJEB 4YR3A 4DUTA 2BMBA 1F5BA 1N34K 2HHSA 3SBTA 2COLA 2WVCA 2CJBA 3HJFA 2J4RA 3DI6B 2HNDB 2OMOA 1UW9A 4KHPK 2BABA 2MKSA 3JYTA 3CIMA 1IG8A 4L73A 3DLLQ 4QAGA 3UI3A 3O9UA 1RJJA 3S6EA 4EBEA 1TK8A 3WXKA 2DNHA 2QV6A 1BDGA 2V6AA 4RW8A 3BBCA 2IA0A 1HMVA 2DJWA 5HANA 2W6LA 1H7WA 3VHQA 3THPA 3SJHA 2H5EA 2IJRA 3IRWP 3E1YA 3M4XA 2WTUA 2HQFA 1BCOA 3S3MA 1Y0HA 2VKRA 3OBIA 1YBUA 2NRZA 3MMCA 2HFSA 1GLCG 4DLGA 3J7YI 1MROB 5SWMA 5JVHL 3H5UA 4CJSA 1H73A 3K9KA 2HQDA 4ES2A 2MKHA 3M8RA 3GP9A 1TL5A 1QJHA 5A8RA 1CZBA 5D4PA 4IFEA 5AE3A 3H7HB 3Q86A 1S6OA 3IFRA 1KNZA 2M70A 4RU2A 1VMBA 3CCVS 4DR1J 3C7NB 4LSNA 1FFSB 1WACA 5GAGI 4OQJA 3BR8A 5K20B 3CCJS 2BA9A 1URRA 1OO0B 4A61A 4LF7K 1HBMA 2D74B 2JSXA 3D4JA 1GAOA 1U1LA 4ZLNA 4CE9A 3FZKA 1R6VA 2UVUA 3QFHA 1S12A 3BO3A 3H20A 3FBFA 3JAMY 4CHPA 4QWDA 3FKBA 3KJFB 4OX7A 2HOEA 3M8YA 1EP4A 5DLGA 2YHXA 1N34J 4B3OB 5AQJA 1Y9OA 3V9XA 3HCXA 1XR6A 2XB2D 2AGOA 3PEJA 4JYAF 4DR6J 1URNA 4J9OA 4PL7A 4KHPJ 2Q0RA 3PW7A 3H4DA 2XO7A 2D3UA 3WXJA 3G8TA 2O8FB 1RLCL 1VQLN 1RA7A 2C3YA 3A3PB 4ECRA 4F4WA 3TOQA 3VEVA 3HVTA 3D2EA 3S3NA 2NPIA 3ILOA 3OFGA 3HP9A 1Z4UA 3J80Y 5EX5A 2OO4A 4LIRA 3LW5C 4K4SA 2QGFB 4OPKA 2HAFA 3IR5B 4CLWA 2V67A 3IWXA 3B4MA 3PM9A 5ETOA 5E26A 4IQMA 4H54A 5MLCQ 4QR2A 3U27A 2O1PA 1ZBTA 3PRDA 3DOKA 3ITHB 3SCXA 2GX9A 2YV0X 3CJBA 2VONA 3RRHA 1TUUA 1Q95G 2PIIA 3MXHP 2QG9B 3K0JA 5LL6Z 3M32B 3QLHA 1M5OC 1ZM4A 4OZLA 3ENBA 1T8EA 3C14B 4CHQA 4U7UD 2FF3B 4WTOB 2VD3A 2V2ZA 5FDLA 4FJKA 4X62K 4ZPCA 2NRWA 5CR4A 2NUBA 3LH2S 3EXYA 5ELZA 4O3OA 2FHJA 2QRRA 3FCWA 5GADI 4ZKAA 4LD0A 3ISNC 1MN9A 2HS0A 2R7RA 4LFCF 3UB5A 4NZ7A 3GYXB 2J8SA 2M8HA 1MWMA 3QMQA 2YHBA 3RU0A 2XY7A 4P2FA 2A40A 1U8WA 3UKUA 2YH1A 4C8KA 2C22A 4KH1B 4L6V3 2J9CA 1NK4A 4CYUB 2C2KB 1F60B 1PGZA 2V34A 3L0QA 3JQJA 2XMWA 4B3SK 1FRLA 1GLLO 1X3NA 1AFIA 4R8UB 3UN5A 2K3KA 1ITPA 2VBYA 3D2FB 2ATQA 1VS3A 4ZDNA 3OHAA 4YOYA 2OUGA 1PKUA 3CPWM 2R7VA 3IAYA 2VYPA 3O2IA 3NXZA 2EI5A 2QWRA 2F7TA 1C4AA 4ZVOB 4CJQA 2DNZA 4IG3B 3KUGA 4FF1A 4DQ8A 2HBQB 2NXCA 2DTJA 3LZIA 4BWMA 2AU0A 3M8SA 3TR8A 1MWZA 2DHGA 1WORA 3M8QB 4OHZA 1DTQB 3V1QA 4HT7A 4YOVA 5KQ8A 4UY8O 5LSLA 1UTAA 1X9WA 4K8XA 4P6QA 4B9SA 3V1RA 1XHZA 3OYGA 3CGIA 1XIQA 3IDHA 4OKEA 1HPZA 3CPWR 2A41A 5JLHA 2LP4A 3OTDA 3M8PA 4RNHA 5C25A 3GYNA 1XNQF 1BUXA 4ZP7A 5F8NA 5D0GA 2RKIB 5ETTA 1JKHB 4X62J 3QBCA 3GFZA 3CO9A 1WTBA 3L3CA 5HMXA 4ZPBA 4H5WA 3MMAA 2J76E 4OJHA 5DGBA 2HGMA 3PR5B 4FJGA 2BJ1A 2AEFA 1RDAA 4QW8A 3FZFA 3H45C 2G8KA 3W66A 4GO5X 1UAXA 5HQ8A 4TKTA 4BDPA 1GOCA 2ASMA 3EE8A 2G0JA 3QRQA 1B70B 1WC3A 1B4SA 2ADBA 2HK2A 3G6VA 5D15A 4M5GA 1YF5L 4M3TA 4C7QA 1X60A 4CFDA 3CDAA 3T1YF 4CF0A 3GG1A 4BLGA 1CS4A 4UW2A 1FVQA 5HP1B 3KDNA 4ZA1A 3DXSX 1S1UA 4GKKF 2NRXA 2HF3A 3DLEA 1YVNA 2UYTA 3BREA 3MWPA 3KK3B 1IKXB 1WOOA 2W2OP 4XAKA 4ZVFA 3W9IA 2VWBA 2VQFK 2K8GA 1NLVA 4JN4A 1QE1B 3H42A 3OTBA 4K59A 4DV4F 4CJTA 4DX6A 3TVYA 1M1KO 4ANDA 1EB0A 4KE5A 4KGMA 3AAQA 4BVOA 3NE6A 1YITS 1M0SA 1XMOK 1J5OB 2GQCA 1PILA 2NRHA 1Q86O 1C0TA 4JV1A 2E2OA 3RWUA 4IUFA 3GPAA 4CLTA 3R5AA 4CEBA 2D7SA 4DZ6A 1HFEL 2IVYA 3AVAA 5B0EA 3G2XA 4DV1F 4URGA 3CEDA 5FLXY 1P8GA 3OXLA 1SL1A 2YNIB 3L8BA 2VG5B 4AD6A 3N4QA 3VAMA 2P9CA 2D0CA 4E7HA 3CFOA 3DI6A 2HNDA 4LF9F 2E5GA 4JI5J 3CERA 1S6PB 3K57A 3ENWA 3GILA 4IKFA 1APSA 2BW2A 1FE0A 4QWBA 3W8GA 4HHHA 1KHVA 4PZVA 4CEOA 3BGUA 3HP6A 3MXMA 5GAHU 2IJFA 3MN6A 4I1TA 2X3DA 1VSEA 4H0YB 3ENHA 3NRBA 1TKDA 1VQNS 1XI1A 2PYJA 3RUBL 1C1CB 5IWAF 1RDRA 3PO5A 3JSMB 1OVQA 3H59A 4MO5A 2FSJA 3OTOF 3VAKA 1RDBA 1NGBA 2BYCA 3WC2A 1UJ5A 4RUCA 3B6OA 3C94A 2CJ9A 2F8SA 1M5PC 5E84A 1DY3A 1H3DA 1BD6A 1TUYA 2C3MA 1HQUB 1G4CA 2DNGA 4MKAA 4CLSA 3K89A 3DGVA 3CCMS 1IM6A 2XMMA 3CQ8A 2HQ3A 4Y0FA 1FJGF 5K14A 3FUYA 4CJLA 2BGGA 3O6QA 1MROA 5D0EA 1RCHA 4WF9L 4WIQA 1RTZA 3BY5A 4BRNA 1XR5A 1U47A 1XNRK 1G1XA 3HSJA 3T3FA 1WJ9A 2EKYA 2DNQA 2VQFJ 1FD8A 5KT2A 5GAEU 2XY8A 2FBXA 2X1GA 3HVWA 2JFDA 3GSIA 2CJKA 5KFRA 3C7NA 3V4IB 3Q89A 1HW8A 4ECWA 1XMOJ 1VQLS 5C2DA 2E44A 2HPUA 1Q8LA 2C2MB 4OYBA 3OYFA 1CPZA 4ZVEA 3W8PA 3J7ZO 1WEZA 1AROP 4PXBA 2VA2A 4NYFA 2NNWA 1MNEA 3J80U 8RUCA 2R8KA 2HHUA 1UCNA 4M45A 4PG5A 4PQAA 4HUGA 1WC6A 3UNYA 3EZUA 2ZH8A 1U0SA 3FRZA 3VQAA 4X65J 1NXIA 3KHHA 4EWTA 3MEDB 2I6WA 1NDPA 4S0MA 2YKNB 2Q3SA 2GUIA 3H90A 1PYTA 4NLOA 2O8FA 4WFNL 1CQMA 1VDHA 2ZJPL 4IO1A 1LEOA 4RW7B 5HN0A 1I51B 2MZJA 2PEHA 3KUHA 3L7UA 4QS9A 4XDDA 3L9ZA 1B0VA 1U2CA 5FIIA 4NLRA 2VFVA 4FBUA 4DU4A 3NCRA 4CT8A 1KP6A 4DTOA 3K5LA 2R42A 2YWWA 2AP6A 2MHEA 3WX4A 2HZCA 2JVRA 5B0FA 4FLYA 5EX0A 4DTPA 1N5YB 5MLCV 3ITHA 4EEYA 4KV8B 3SI6A 4B1VA 4XDCA 4H5NA 1U45A 2HHPA 3CJKB 2BE9B 3ZC4A 4DQRA 1TUWA 3NVMA 3C14A 5KG6A 1YJRA 3OVSA 3BH7B 1WC4A 2BM0A 3ULDA 1N5QA 2ZNZA 3KHYA 3LL3A 5K5MA 3CB4A 4ETZA 3PJXA 3ZTSA 2OPRB 1N5TA 2OPSB 4LF2A 2W7AA 2UV8G 2MGZA 4CJPA 5KFJA 1W7AA 4HL9A 3CJQA 4FM2A 2K1RB 5GIOA 4FJ7A 1NHVA 1SC4B 1N5VA 2N7YA 3FFKB 2GUPA 5BRHA 4CO2A 2I7PA 4MLEA 3MWBA 4PXCA 2DHSA 2UUTA 1IM4A 2F7VA 4DHYA 5C42B 3I0RB 1X9SA 3MHYA 3G6ES 4CYUA 1ZA2B 4OO1J 4IOCQ 2VWJA 2RMLA 1TAUA 3ZNJ1 5EGYA 2QFIA 3UCGA 4P7VA 3D2FA 2VQEF 3SBMA 1TQLA 4PPDA 3GTYX 5FPDA 3FBEA 2L41A 5CYQB 4HHJA 4KHQA 4MFBB 2IM2A 4C8YA 1V4TA 3AB2B 4IG3A 2RE1A 2I2YA 2UZAA 1VC5A 2P8IA 1CLFA 4L3QA 3CFPA 3VENA 3ZTQA 2EWSA 1X5OA 5M1PA 2ROGA 4OFZA 2QYGA 3FZMA 3TTFA 2DRDA 3GJRB 3CD0A 4UOHA 4JI2F 3M8QA 1XMQK 1DTQA 4FYYB 2CDRB 2M88A 4AL7A 4NRTA 4YOEA 3MM9B 1DEJA 4EFAC 5JUMA 1IJEB 3VEZA 3CJ0A 3NG8A 4ILHA 1V5IB 4CJWA 4E8UA 2HNYB 3TAEA 1HLUA 1J53A 3EGVA 2G8UA 2CPHA 1DGKN 3PR4A 1ZBHA 1ITGA 4W5QA 4I0WA 2RKIA 1AZSA 4FWLA 1JKHA 4ZTJA 2LECA 2MQPA 1NAQA 1KFDA 3MEKA 4DPOA 2MKJA 2O8BB 4X66K 4LVNP 2CDQA 1A6LA 5BPNA 4YQWA 2G8VA 2JWNA 3SJJA 1T9YA 4A8MP 3ATVA 3CIZA 1GOAA 3PIOL 1FDAA 4RR5A 3LA0A 5DM7Q 1BIZA 4KBOA 4DEZA 3A1YG 2UXDJ 1IKVB 1Y10A 2ZM6F 3O3HA 4QYRA 5HK4A 4G6VB 4PG8A 3ILIA 4Z7YA 3Q0AA 1NDLA 5HP1A 2VFUA 2GVDB 4O5BA 4H4MA 5D78A 5FLXU 4NXNK 2BQ3A 4NLBA 5LXYA 3KK3A 1IKXA 1RT7B 4CZFA 2J6UA 5KGWA 2JL9A 4OL8A 4CZMA 2ZD1B 1U49A 1ZYQA 1QE1A 2DKOB 3RZAA 2WVEA 2ZF5O 3VETA 4AF1A 4GNIA 4UY8T 3NGIA 3ALYA 3PNIA 5KFHA 3EWGA 3DLKB 3BSCA 4F3QA 3NBPB 1J5OA 5HBMA 5A8KB 1RBSA 3PW4A 2RU9A 3RMBA 2GV9A 1XMQJ 1F2HA 1Q0NA 2YPZA 1FTCA 3LTOA 2G8FA 3NHGA 2YNIA 3WXIA 5KFOA 3UNGC 1P27B 1TUGB 5U47A 3IFEA 5J2PA 1FWKA 1NGFA 4F0MA 4IFVB 3SFGA 5T7LB 2HSTA 2KYZA 3KYLA 1QUPA 3OJSA 4YY3K 1S6PA 3B4DA 4Z94A 4DL0C 1BHNA 2WK4A 3LUYA 3I96A 2VG6B 3KD5E 4I67A 4H0XB 3GIMA 4CGIA 1WEYA 4CCHA 3GBTA 1FX2A 1ZPWX 4HTLA 1JX4A 3CJ8A 4ELVA 2D3ZA 4X66J 2O8EB 1QSSA 2J5AA 3TABA 3JSMA 1VI7A 4AH9A 2MKCA 2B3TB 2ZFHA 1ZZFA 5KFSA 3LOUA 3I87A 1HQUA 2QWLA 5SZTA 2C2RA 4XIUA 1KBRA 2K7JA 2YVSA 2K3IA 1NNDA 3TRGA 1K6YA 2FC8A 3M2UB 4MIWA 2PEBA 3GIKA 3BQ2A 4NXNJ 1CVJA 3DU5A 5T41A 1M90O 2ZH2A 4U67L 4DS5A 1SKSA 2NPFA 3FBBA 5BRDA 3K58A 3J7YU 3MMVA 2ZDPA 4RNFA 4F2RA 1UA0A 5HJYA 4IZ9A 3D1QA 4ZPWR 4X4QA 1RCXB 1FFWB 2L48A 3VAIA 3AO3A 5EUHA 5CD4A 2J6TA 2KHCA 3V4IA 2CQDA 3DXMA 1XN9A 4OX9J 2RF2B 1VRTA 2QA4N 2O01C 3US5A 3I56N 3OUYA 4R79A 2R7QA 5GAGU 3AGRA 2J8AA 3LAMA 1G3OA 4IFYB 4M63C 3H98A 3ZZYA 2DH8A 4OZ3A 5F8GA 2VPZB 2A3JA 2IY5B 4LUBA 3PRVA 5ETPA 1RT4B 4CO4A 3A3OB 3SNNA 1C0GA 1FWLA 3NVKA 2HMPA 3N6LA 1U2VB 4CDIA 2I38A 4ZN1A 4QOZB 1HQ2A 2AYBA 2DBBA 4YY3J 4FN5A 3UN3A 4Z4CA 5C5JA 7FD1A 4DV3J 2YKNA 3BJYA 1KWMA 3P3DA 4USUA 2CPXA 5ADXA 3Q8UA 5HAOA 3TYTA 4UUWA 2ZEJA 1Q9YA 3KHGA 1RTHB 3D45A 1C2PA 1IBMJ 3AOCA 1EX8A 3LGNA 4RO0A 3HT0A 5C2FA 1T6DA 1IBLK 4ELTA 5L46A 4JKFA 3G71N 2YKAA 3UFCX 2G2YA 2EK6A 3FQKA 3NFAA 2YNHB 4C8NA 2C1EB 3QPIA 3ZZUA 1HRHA 4FO0A 1BE4A 4DV2K 4JI6K 1FFGB 4CJ5A 4RTFD 1R89A 3VEWA 3BKUA 4NXMJ 1U2RA 4F8RA 1KDNA 2GFFA 2QWMA 5B08A 1RA6A 2HQIA 4KV8A 3DOLA 2ETJA 3CDBA 5F8JA 4DPUA 3CJKA 5CABA 2ZBPA 3X3UA 4DU3A 2OZMA 3B8AX 4BRHA 2V0NA 1ACMB 4Q2MA 3OYJA 1ZC6A 4KI4A 1Y5NB 4JI4K 1TFWA 3J7ZT 5E3AA 2YHWA 1ZOTA 4U96A 3TA2A 1VJQA 3BF4A 2OPSA 1R27B 3VQDA 1EJ7L 4K2XA 5K8NA 3GL1A 2RE2A 5GIPA 1VFJA 2G9OA 3FZ2A 1Z2LA 2FVPA 3MWTA 2L9WA 4CK2A 2ROEA 4AL6A 3G6XA 5IT4A 3OYAA 3L2WA 1TKTA 3BKFA 2ASJA 5A2QY 4B3MF 2CWXA 3JXOA 1X5TA 4MYTA 2E5LK 2QA2A 2BJ9A 2MQMA 3AO1A 3BF1A 2LCWA 2MJUA 3W0LA 2MKYA 1IWAA 3VQTA 3CJ2A 4GW6A 4IRCA 4TU7A 4BVPA 1RBLA 5AXKA 5EDWA 4OGEA 3MXIA 1S22A 3O5TB 1XQIA 3HZEA 4DSFA 1IKWA 3D0GE 2LXUA 3QJLA 4MFBA 4DFMA 3FEYB 2B9YA 3QO9B 1D8ZA 3TJ8A 1OWXA 3VQ5A 4RU9A 1IBLJ 5HRNA 4FP9A 4FOIA 3G82B 1Q7LB 2DR9A 4CJEA 4KGKA 2NS1B 4C0HA 4DV2J 3IXQA 5AE1A 3PG9A 3D0IE 1FJCA 4ID5B 2AJ0A 3WQTA 1C1BB 4KJIA 1RQ0A 3KFWX 4TLRA 3SCJE 5EN1A 1HR0K 5M2UA 3GONA 5RUBA 5A6PA 4YP3A 4YDUC 3PV8A 5J1NA 3MM5B 4CO0A 4LRAA 4NWBA 3AO5A 4HH1A 1JLEB 4JI4J 1SKUB 1NK7A 2XLKA 4HH0A 4BHQA 5KFMA 4HACB 4BRIA 2ZZNA 3IKMA 5BN8A 2KHDA 5B0CA 2G8HA 1CG2A 3MPDA 3GJTB 3FCHA 3W5XA 3ZT4A 2DPIA 1ZAWA 4AM6A 2WAQD 2VF3A 4CIOA 4KAIA 3RAXA 3WT0A 1UWBB 3A8JA 2E5LJ 3WUHA 1JLFB 2G8IA 2GAGC 2X1BA 1GOBA 2Q31A 4B8AB 1GX6A 1UOCA 2FBTA 2UUWA 4DR7K 2PZSA 3KLFB 1REVB 2ZBCA 4GKJF 1DTTB 3HFZB 4JI8F 1K9MO 4ZPAA 4ZLPA 2Z1GA 4EBDA 1T02A 1RT7A 3C15B 2Z2MA 2FLOA 4CESA 1LOTB 1YIJN 1X9MA 1S1XB 4CJKA 1YT3A 2B0GA 2YWHA 3I6PA 2IPOB 2PGCA 3ZLJA 4ZTFA 3WX8A 4FWNA 2FSNA 3SI8A 1H6KX 3M05A 2W40A 2UVVA 3NBPA 2RHQB 5M1KA 1F21A 4ZPTR 1YTYA 5A8KA 3DOMA 1NB7A 1WN7A 5EWFA 1YJ9N 3P45B 4BRQA 2IVOA 1HWLA 2BE7D 4PWUA 1VBYA 1BWVA 4QU6A 1IXKA 2CPZA 2B8QA 3C16A 3MN9A 1R0AA 4YB5A 3U4LA 3B78A 3LPUA 1NGJA 3T19A 4IFVA 5HSPA 4BROA 3NGRA 2IVMA 3R7SB 3PYFA 3QFPA 2KI2A 5E33A 3ET6B 3KK1B 1S48A 1K73O 2E1MC 2OYQA 3PTWA 1FKOB 3M8WA 2HRUA 3OXFA 3K0SA 4RW6B 2BEFA 4PQUB 4G9ZA 2BOPA 3BGRB 4IBNA 1RHUB 2K06A 3TQ1A 1ZAXA 1PCAA 4FK4A 3M6UA 4KPCA 3CVKA 4L74A 3NDKA 2O8EA 4DR3F 3UD3P 5JMVA 4BRLA 4YDDB 2V4JB 4OJ1A 2QA4S 2NRTA 5H9FK 5D4NA 3H08A 9RUBA 5HMYA 1I39A 1GX5A 4FDFA 2R4FA 5JVHQ 3KK2B 2QKBA 4AE5A 3M2UA 4NLUA 3K59A 4DL3A 4DV6F 4B3SF 4Y34A 4PUOB 2Y3YA 3L7PA 1WLJA 4ECVA 3PDNA 3AO2A 3ULHA 2J7WA 2RIJA 3HD2A 2F8TA 1U48A 1RGIA 1SIZA 3HTVA 3T41A 5KAKA 3NGTA 2WZ1A 3QWUA 2MB0B 2CXEA 3KKSA 4FJIA 2DNMA 4K42A 1RGVA 1YQHA 2RF2A 2O5DA 2QO3A 1O13A 2JWKA 1NH8A 1VQMS 4EO6A 1YJ7A 1SV5A 5KFFA 3VTHA 4ATNA 1Q18A 2CAJA 3WQUA 2KO1A 4EU0A 3G71S 4ER8A 5J2NB 3I5BA 2OEMA 3VEXA 1S0OA 3B82A 2G2OA 1KKHA 3CYMA 1RT4A 1U02A 1K8KA 1KVIA 1T44A 2ZWPA 3M7VA 1U2VA 2M9KA 2KG0A 4F9OA 3O9QA 3AVMA 2RPIA 3T1HF 1F9FA 1YXQA 5HL7Q 3HHEA 3VAJA 1JIHA 4BDZA 1UFKA 3IS9B 3NH2A 3OA9A 3L2RA 1S1TB 1YSJA 3PUFA 1S9EB 2GMHA 3V9ZA 1RTHA 2EWHA 2V4QA 1RE1B 4ECTA 4F2SA 4X64F 4BRGA 1JL2A 4CBUA 1YRUA 2BACA 4JS4A 4G65A 2E9TA 1BOTO 3TP2A 3D67A 2YNHA 5KI6A 3NS5A 1K0TA 5HROB 5D77A 1YHQS 3QIOA 3HYFA 2P9NA 4OVLA 2IJNA 1R8AA 5L1IA 5AQGA 1S72N 3JAMO 4C2MA 4U95A 3HHLC 3HXMA 3SK3A 2F4FA 2UV8A 3FJ2A 4BR7A 4BRCA 5CXTA 3U9DA 5KQDA 3CMAN 3UE5A 1LW2B <