1LWFA

Crystal structure of a mutant hiv-1 reverse transcriptase (rtmq+m184v: m41l/d67n/k70r/m184v/t215y) in complex with nevirapine
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 144
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwfA05
1RT7A 5FDLA 4E7LA 4QWEA 3T19A 3G0ZA 5KFKA 3BJYA 2HNZB 2HHTA 1VSMA 4B3OB 4DTOA 4ZVEA 3MFHA 4KFBA 2GBZA 3D45A 3MAQA 3CG7A 5I3UA 3HVTB 4ED3A 5C5JA 1RBUA 4MQ3A 2DFHA 3L2RA 3NH1A 2JEFA 4XPEA 3DOKA 5KG1A 5JS2A 3LP2A 4NYZA 5KGXA 4FM1A 3SPYA 3D0PA 2R8GA 3OSPA 2ASJA 3LZIA 5KI6A 4H54A 3KHGA 4CJFA 4IBNA 1SH0A 4HYKA 2FLNA 2D0AA 1RDBA 4NLDA 2HHXA 4C8LA 2C2EA 1SUQA 4I7FB 1D0EA 1CZBA 3TAQA 4N76A 1RCHA 2IMWP 3IS9B 4DQSA 4MFBB 3QESA 2DPJA 2UVVA 1X9WA 5F8HA 4KHYA 4JV2A 2G8WA 2V4RA 4DQRA 2D3ZA 2XGQA 3DRRB 4IH5A 1NHUA 5EDWA 2HNDB 3U3YA 4CIFA 4F3OA 2JEIA 4CGHA 3M9MB 1S6PA 5KG6A 4NCGA 2RDIA 4GMJB 4E7IA 4I2PB 3CM5A 1S9EB 3H2LA 4KE5A 5SWMA 4FM0A 4TY9A 2J6TA 1NKEA 4LQ3A 1RT3B 2X74A 3WNHA 2IAJB 2IGIA 1TKXB 2AX0A 2PYJA 3M9OB 1KRPA 3CDUA 1EX4A 3DYAA 2XHBA 1XC9A 4O3QA 1UAXA 3NGYA 2YNIA 3NHGA 4M42A 1CXUA 5EWFA 5HRSA 4HUGA 3S9HA 3TWHA 4LSNA 1U09A 2AX1A 1CZ9A 3MEEB 3V6DA 1JLQB 4FJNA 2B6AB 3OL6A 1B9DA 3HVRA 3ZSVA 5F9LA 3M8RA 2E9TA 3NMAA 2WB4A 3DM2A 4DL3A 3AVFA 1TKDA 2GC8A 5EWEA 1JLFB 1NK7A 2RDJA 1SL1A 4WFXA 4LY7A 4CJKA 4RW4A 4GVMA 1EP4B 4ZTJA 3FDSA 3S3OA 4B9SA 2ZQBA 4DTNA 1SH2A 2XWYA 3I0SA 3MFIA 4ZHRA 2R2UA 5F9NA 3SUNA 5CZ1A 2VWJA 2IM1A 1WLJA 4Y2CA 1HQUA 2ASLA 3AO1A 2VG6A 5KG5A 4B8CA 2VWKA 1XR6A 2OPPB 1JLAA 5KFRA 4Y1DA 4YQWA 2WK4A 2UUWA 4ED1A 4TSXA 4ED2A 2BRKA 3MXMA 4ICLA 2BE2A 3PZPA 3N6NA 1D9DA 2XY7A 5KFDA 2YNIB 3L2WA 4DTMA 3KLFB 4DSKA 3AO2A 2GUIA 4MK8A 1KLNA 4RW6B 4NRTA 3NGIA 4E1MA 3CM6A 4O5BA 1XI1A 1QS4A 3KNAA 4Z4EA 4KHUA 3NKYA 4OKKA 3OYFA 5KFEA 4QOZB 1CLQA 3LP1A 4RG8A 3SCXA 3H5SA 2W7PA 3RB4A 5J2PB 3HT3A 3QLHB 1DLOA 3OLBA 2IA6A 3MEGA 3MR6A 2F8SA 1S48A 3ZCMA 4CHPA 4CEAA 1MMLA 2XI3A 5KT6A 3PW5A 1GOBA 1YTUA 3PUFA 4MK7A 3AVCA 1T8EA 4WE1A 4RW8B 4ZP7A 3CQ8A 1TKZB 4J9RA 3K5NA 3LP3A 4AH9A 3T5KA 4URSA 3KLGA 3PR4A 5EUHA 3Q8QB 2W7OA 1R0AA 5KFCA 4WZQA 1ZETA 4FM2A 2I1RA 2FBYA 4I2PA 3V1OA 4FLTA 3F9KA 1HMVA 5HLFB 1TKTA 3MR5A 3BREA 3OYGA 3DLEB 4U7CA 1KVBA 2CJQA 3P5JA 3C6TB 1QE1A 1A5WA 2P5OA 1S49A 2F8TA 4B9TA 3EZUA 2IS3A 3KIOA 4DL5A 4O0IA 2G8UA 4BDYA 5FROA 3LWMA 4QW9A 1SUQB 3SQ2A 3KHLA 1ZYQA 5CZ2A 1N48A 4M41A 2RPIA 4CE9A 3K59A 2B4JA 1JLQA 4Q5VA 3OYAA 4DSJA 4O4RA 4CF1A 3QEXA 3T5JA 3SYZA 4CECA 5I3UB 4BWMA 3JYTB 1BHLA 4IDKA 2HWIA 1ASUA 3LWLA 5KFAA 4FJXA 4EBEA 3PW7A 5DG7A 1RT7B 5FDLB 5KFJA 4ED8A 1C2PA 1KHVA 5DQIA 1WSJA 3I5BA 4KREA 3DLRA 1BI4B 3HK2A 4ECQA 2RKIB 1C6VA 1Z26A 4FJMA 1T94A 4AHVA 1SV5B 2YKMB 5KFQA 2FC0A 1C0TA 4G1QB 2OZMA 3TAPA 4IG3B 4F4XA 4CJ3A 3HP6A 2HVIA 1KLMB 3KLHA 1SH3A 2OPSA 2AGOA 4H4OA 3HO1A 3PW2A 4ED0A 4FBTA 3GIKA 3ZSZA 3HPHA 3NBPA 3IAYA 1Z4UA 1TGOA 2XRIA 3OYEA 3D28A 2F96A 4KHSA 3V6KA 4FJKA 4O3SA 4DL6A 2IM3A 2XGPA 3LDSA 4E7KA 2VA3A 2FJWA 4AHTA 2BQ3A 4QWAA 2QKBA 4E7HA 3GIIA 1BIUA 3CJ3A 3I0RB 1RTHB 4EBDA 5DLFA 5DQGA 3CJ5A 1IO2A 4BDZA 4RNNA 4C8MA 4E0DA 2R8JA 4IFVB 3GIMA 4B08A 2WTFA 4JRQA 2W9AA 4FZZA 3KK1B 4KPYA 1KLMA 3KLHB 3KJVA 1BCOA 3KMSA 1S10A 3PO5A 3T5HA 1T03B 4RNFA 2HNZA 3MR3A 3NF6A 1BI4A 1N56A 3NAEA 2HMIB 4MKAA 3SJJA 2VA2A 4ZP9A 4CJTA 1C1BA 1J5OA 5SZTA 3M8SA 2DY4A 1TQLA 4JLHA 1HMVB 3EZ5A 4Z0UA 3FQLA 5JXSA 1D9FA 3TABA 5KFSA 4J9LA 3V6HA 4CJLA 5K14A 2R2TA 4E19A 3LANA 1J54A 3OL7A 1RTIA 2CKWA 4ECRA 4K4XA 1UWBB 1U04A 3HVWA 2W9CB 1WSEA 1RT1A 3V81B 3DLGA 1DLOB 4QW8A 3QEWA 3AO5A 1ZBHA 1NKBA 4Q0BB 3HKWA 5CYQB 1RDCA 4CJWA 3V9ZA 5KFHA 4CEOA 4KB7A 4GC6A 1KTQA 3DLBA 4WYWA 5L9XA 3VQDA 1LWEB 3LP1B 3VQ7A 2E6MA 3SQ4A 1ZBFA 4N47A 4DL4A 1RT6B 1IKVA 2R8KA 3VA3A 4Q43A 3NCIA 1NK0A 1NOYA 1JLBA 2WRMA 1DTTB 2P5GA 1LWFB 1ASWA 1D8YA 3HPOA 3BGRA 3UPFA 1HPZA 3LP0A 4DU1A 5KFPA 4W5RA 4FLXA 1JXEA 2P51A 3O3HA 5KFYA 4NLUA 1VSLA 3VQAA 2W9BB 3GV5B 3EPGA 2FBVA 3DDKA 3KK2A 2FLPA 1SL2A 2G8FA 2BE2B 3PW0A 1T7PA 2OZSA 3MR2A 3PJWA 1RT5A 1REVA 3QGIA 3RB0A 1NK8A 1BQMA 4CK2A 3GYNA 2A1RA 3AVKA 4GW6A 4X2BA 3RR8A 1JKHA 4R5PB 1RTDB 4NCGB 1D1UA 1LWEA 1VSFA 1JLBB 3NFAA 4TYBA 4TN2A 1IKVB 1TK0A 4I7FA 4IQXA 2YNFA 1U48A 2OPQB 2KW4A 2XC9A 2JLEA 2KQ2A 4KHWA 1WN7A 2XY5A 2ZD1A 2HHUA 2D0BA 3QYYA 4RW4B 2ILYA 3OYNA 4CGJA 3Q8SB 4CGGA 3OY9A 1S6QA 4EP4A 4PA1A 2QE5A 4FK2A 5HBMB 2W8LA 1XR7A 4NLWA 4ZMMA 2AGQA 3V6DB 1JLCB 4DFPA 2FJXA 5DGAA 1L3SA 3VN5A 4QWBA 2WONB 5KG0A 1Z25A 3ZSYA 1LW0B 3HL8A 1FKOB 3BGRB 4EZ9A 3SUQA 4M95A 1QQCA 4HCBA 1EXQA 1JXBA 3V9XA 3VQBA 5KT4A 3HSTB 1NJZA 3SUPA 4QAGA 4IH7A 3SI6A 2DFFA 2R8HA 3A2FA 4KRFA 5DQHA 4CERA 5KFIA 5DLGA 2HB5A 3AVNA 4IG3A 3LAMA 1S1UA 3QIOA 3K5OA 4PWDB 3BR9A 3OYHA 1NK6A 5J2MA 1JLEA 3KTQA 1XHXA 1NHVA 4CJRA 2X6SA 5L1KA 1RTHA 3AO3A 3QIPA 1CSJA 1JL1A 4KV8B 3DMJA 1VSJA 1TL1A 1JL2A 3I5AA 4ZP6A 1EKEA 4RUCA 1X9MA 4CFCA 2ZE2A 4DQPA 1S1WB 1OS5A 3JYTA 1NNDA 4B8AB 1JLGB 4IRKA 1WSIA 3QNOA 4YFUA 3K2PA 3AVLA 4CHZA 3QEIA 4KFBB 2VG5A 4H4OB 2ZKUA 4AILC 3QETA 3K58A 4TY8B 4FLVA 3DLEA 4PWDA 5J2NA 3T3FA 4ID1A 3S3NA 4J9OA 5HP1B 3NF7A 4ID5A 3BDPA 2J6SA 3SFUA 2UVRA 3EPIA 2UUTA 2IC3A 3V4IB 1LW0A 4BWJA 1RBSA 3IS9A 4JS4A 1UA1A 3OYLA 4B9VA 2E9RX 3CVKA 1HYSB 1HJRA 1VSEA 3SV3A 3NF9A 1VRUA 3HVAA 4B9MA 2D41A 3LAKA 3PX4A 3G86A 4Z4CA 3O3FA 5KRTA 4ZTFA 2J6UA 1L3UA 1FKOA 3KMQA 2R7YA 4RNMA 1VRUB 2IOCA 1FK9A 3HYFA 4IFYB 1NKCA 4J2BA 1LW2A 3DRPA 1NJXA 4CJVA 5C24A 3BQ0A 3AA4A 2OYQA 3RB6A 4ECYA 3TR8A 1JXLA 2WOMA 2LSNA 4J2AA 3OJSA 1U4BA 1TKTB 5C25A 4CEZA 4FLUA 2YKNB 2JC1A 1IH7A 2IBKA 3C95A 1GOAA 1QE1B 3ICLA 3T1AA 1S1WA 3OL8A 2YNHA 4IRCA 4DFJA 4J9PA 4CFDA 4I2QA 3D5MA 4CHOA 4OLBA 4ZPBA 3AV9A 2RKIA 2NUBA 3RTVA 1S9GB 5J2QB 3KD1E 2F8EX 5KFVA 2GIRA 4RNHA 4EBCA 4J9KA 2HNYB 1T05A 5KG4A 3KLVA 1REVB 1Y97A 4ELUA 4DF8A 1S4FA 5J2MB 1WSHA 4ED7A 1TKZA 5L1LA 4G3IA 2DPIA 1DTTA 4ECVA 4J9MA 4I9QA 4NLXA 3KKSA 2V4QA 2B5JB 2W8KA 4E1NA 3OYCA 5CYMB 1QAJA 4F2RA 4DL7A 5EU7A 3CYMA 4H4MA 2UVWA 1NJWA 4W5TA 3AVIA 4MKBA 2AJQA 1GX6A 3DLKB 1RTDA 3V9WA 3ISND 1U49A 2W42A 5HRPA 3E01A 4M3ZA 4CF9A 4FYDA 3DLHA 4ELTA 3KLFA 4RUAA 3ZSXA 2FVSA 4OPKA 1JKHB 2IM0A 5KFGA 4M94A 3IGVA 1UOCA 5HBMA 1YVUA 1IKXA 2KTQA 4LSNB 4DSLA 1N5YA 3UR0A 3AA5X 2WCXA 1C1CB 1WAFA 3TAGA 3KK2B 1Q8IA 4Q45A 3OYJA 4KKOA 1N5YB 4URGA 3OYKA 5E41A 4RW8A 2YNFB 4BE1A 1VK0A 2D7SA 1HPZB 4ZPDA 5KG7A 2C2DA 1VSHA 3UQSA 4O0JA 4ZHRB 4PQUA 4IG0B 2HVHA 5KT7A 4CJ4A 5C42A 1TP7A 3E01B 1RT6A 3VQQA 3PX0A 4OLAA 1T03A 4KB1A 2HHSA 3H59A 3KJVB 3ZT0A 1QSSA 1S1VB 4OPJA 4WYLA 4HHTA 2I5JB 1IKWB 4M3XA 3RAQA 3PHEA 4R5PA 3LPTA 3M8PB 2B6AA 4YR3A 3AVHA 2BR0A 1NOZA 1S1XA 2ETJA 1NK4A 3B6PA 4RW9B 2YHBA 2Q3SA 3QZ7A 2UVUA 3RMBA 4NCBA 4CHNA 3VQ8A 4ZPAA 2G8VA 3RWUA 1FKPB 5F8IA 4FJIA 4WXWA 2HNYA 1T05B 2ATQA 3FFIB 3LPUA 1TKXA 3M8QA 1S9EA 1HRHA 4HKQA 2VG7A 4K4ZA 4KBIA 1RT4B 4F8RA 2JEGA 3TQ1A 3I0SB 3ISNC 4FCYA 4YNQA 1QAIA 2HMIA 4FW2A 4Y34A 2HNDA 2YNGB 4N56A 4IRDA 2IC3B 2BGGA 3V81A 4E7JA 2O4IA 5DG8A 2EC0A 4CIGA 3L3VA 1I39A 4AHSA 3U3GA 3SFGA 2FBTA 2HAIA 4IR1A 3AVJA 3BSCA 4NLGA 3Q8PB 4NYFA 5KFLA 5D3GB 1MU2B 3KD5E 5F8MA 3OL9A 2FBXA 3MEDA 4KHRA 3DOLB 3NGDA 2W9CA 4KI6A 3NDKA 4IFVA 1KCFA 3I0RA 4FK4A 4FS2A 3G6YA 3TAEA 1S9FA 2JGUA 3RRGA 4OKEA 5K14B 3CWJA 4RZRA 5DGBA 2Y1IA 4FZXC 2Z1HA 3OYMA 4L8RB 1NK5A 1TAUA 3CJ2A 4CF8A 4F3TA 4O3RA 1D5AA 1JX4A 4EZ6A 1RA6A 2XCPA 3RBEA 4HUFA 5KFFA 5J2QA 4TQRA 3H4BA 3IG1B 4ZVFA 5KT3A 1S6PB 1I3AA 2KZZA 5J2NB 3OSNA 2GV9A 4MFBA 3ZT2A 4QCLA 3DI6B 1C0UB 3HM9A 4N41A 2VG5B 4Z4IA 3NE6A 1EETB 1ITGA 1TVRA 1TL3B 3DRSA 3VA0A 4CFAA 4O44A 1BISA 4C8NA 5HROB 4LH5A 2YHAA 4MIAA 3AA2A 1LW2B 4EP5A 1ZBLA 4IFYA 4DQIA 1RBVA 4KTWA 5FRMA 1HNVA 4NCAA 5HROA 2DFEA 3G6XA 3AVMA 5C24B 4CEFA 3EYZA 3DMJB 4KO0B 3KLEB 5KTQA 3F73A 1QHTA 1MU2A 1CXQA 2WHOA 4M3UA 3ZSRA 4B9UA 2C2RA 5KT2A 3E51A 2BDPA 2QK9A 4PY5A 1S1VA 4FXDA 3MXJA 3RMDA 3MEDB 2FVRA 4B9NA 2E9ZA 4J2EA 3NH0A 2Y1JA 4DFMA 4WFZA 3ALYA 3C94A 3O4NA 4RW6A 4FJ8A 1RBTA 4MH8A 4FBUA 1R0AB 3K5MA 1RTJB 3CFPA 4M3TA 4FJLA 4CFBA 4Z4HA 4CK3A 4FLWA 3BSOA 1RA7A 1S5JA 1DTQB 1HQEB 5HP1A 2VG7B 3QINA 3FRZA 2YNGA 4KAIA 3MECB 4K4TA 4IR9A 1JLAB 4FVMA 4UQGA 3QZ8A 4CEQA 2E4LA 2WONA 3ZT1A 3GIJA 1HNIA 1FKPA 3UIQA 3HHKA 1TL1B 3Q8RB 2BQUA 4RW7B 4FLZA 1LWCB 1K1QA 5T7BA 1S6QB 4R0EA 5J1EA 3H4DA 3PV8A 1JLEB 4BE0A 3IGNA 1HNVB 1TK5A 3FFIA 1J9AA 4WE1B 3ULDA 4MIBA 4Y3CA 1VRTB 4CJEA 4CHYA 4N5SA 3TARA 4KB0A 3CDWA 3ITHA 4Z4GA 1TAQA 4FLYA 4O3NA 4O4GA 1RDRA 1S0NA 4K8XA 1VSDA 1L3VA 5FRNA 2R2RA 2OPRA 4DG1A 3P83D 2AWZA 2KZMA 1RT4A 1KSPA 4PQUB 1BQMB 4LQ9A 1HYVA 1N6QA 2G8IA 2RF2A 3IG1A 4F50A 3RBDA 4OL8A 3HXMA 4K4VA 3QIDA 2PY5A 3H5UA 3G6VA 2HW3A 3V9UA 4YR2A 4HCCA 5KFTA 4Y2AA 3DM2B 4EO6A 1C1AA 2BQRA 4F4KA 3AA3A 1LWFA 1RDDA 4JS5A 4NLYA 3VQSA 1U47A 5KG3A 3I8DA 4QWCA 1BQNA 3LZJA 2O4GA 4AHRA 1T3NA 1LAWA 5JS1A 3TAMA 1JLCA 3ZT3A 3BSNA 4DG1B 4KHQA 3NAIA 4WXOA 2YNHB 4EYIB 5CY4A 4FJJA 4CESA 3H5XA 3MEGB 1U45A 3QGGA 4FK0A 3OJUA 3RMCA 5C42B 1N6QB 1RNHA 2R8IA 4NLOA 4XO0A 2V9WA 1F21A 4ECXA 3KK3B 4PUOA 4JUZA 3ZSWA 1RT1B 3EY1A 4KTQA 3SNNA 3SI8A 3VQCA 4K4UA 4WZMA 1L3TA 3N6LA 3KK3A 2QV6A 3L8BA 5KFUA 2VG6B 1HQUB 3GILA 4Q44A 3G10A 3TANA 4RW7A 1S0OA 1LAVA 1VRTA 5I42A 2B43A 2QXFA 5CYMA 2BRLA 1ZBUA 4CGFA 3N6MA 4R8UA 2ILZA 1SL0A 3ASMA 1L5UA 4AHCA 5KGWA 4ECUA 1X1PA 4IH6A 3CIZA 5KFXA 5HRRA 4J9NA 2D0CA 3LP0B 3RMAA 2FVQA 4DMNA 3DRRA 4DTSA 4ECWA 3MF5A 4M45A 2X78A 4O3PA 4CJPA 5T14A 4HUEA 1IKWA 4H4MB 4W5OA 4Z4FA 4F2SA 3OYDA 3S3MA 4DLGA 4J9SA 4F4WA 4Y1CA 4KSEB 4YP3A 4DS5A 4DLEA 4LSLA 2C28A 3L2UA 3LALA 4KO0A 4FW1A 3OS2A 4O3OA 3TVKA 5DMRA 3TAMB 1IKYB 3OYIA 2D3UA 5EWGA 2AQ4A 3NGZA 5J1EB 4CK1A 3JSMB 3SQ1A 3MEEA 3VQ4A 4DSEA 1B92A 1KFDA 4ZVHA 1B9FA 1RAJA 1WSFA 3HPGA 4DSFA 4JV1A 4DU4A 3NBPB 3CDEA 1C0TB 4G1QA 2HHVA 2FVPA 3AVAA 3QEPA 1TL3A 3V1RA 4I9LA 2AU0A 4FJHA 4CHQA 2OPRB 1K6YA 3SV4A 1EETA 3MECA 2P1JA 1RTJA 3RB3A 4NLVA 4NLPA 3HP9A 1WNEA 1RT2A 3MTKA 1RYRA 4K4YA 3QO9A 3AVGA 4CJ5A 4ECZA 3DRPB 3TI0A 3V9SA 1KVCA 3NF8A 1FXXA 3KHRA 3QNNA 1BGXT 4ZPCA 1KVAA 3ZSQA 1S1TA 3KK1A 4IDKB 4OGEA 4QWDA 3O4QA 4NLTA 3KLEA 2O5DA 3C6UB 4DQQA 3DOKB 3M9NB 1RYSA 4F4YA 3V1QA 4BACA 1W9HA 4CCHA 3OS1A 1XHZA 1QTMA 1WAJA 2JEJA 1J53A 5HLFA 4LSLB 3JSMA 3KHHA 4RU9A 3PW4A 2G8KA 3RAXA 4IKAA 1GOCA 5D3GA 4ZP8A 1Q9XA 3DI6A 4TYAA 1IKYA 4DF4A 2JC0A 1S1UB 3QGHA 2HHWA 2OPSB 1JLGA 4CJQA 4M3YA 1ZTWA 2E6LA 5L1JA 2YV0X 1WSGA 1RT5B 3SQ0A 3B6OA 3RRHA 3WNGA 4TY8A 2OH2A 5KFNA 4BDPA 1VSKA 4CGIA 3KLGB 3H08A 3OS0A 4CEBA 2OA8A 1Q9YA 4ECSA 4ICLB 5HRNA 4ZVGA 4JV0A 4DEZA 4LD0A 2AGPA 3CFRA 5KFMA 3M8QB 2ALZA 1SKWA 3PVXA 5KFBA 2A1SA 4M3RA 1FK9B 4TLRA 4GC7A 1VSIA 4DTRA 2X6NA 4DFKA 2QKKA 2R2SA 4RW9A 4O55A 4K8ZA 4XPCA 3SPZA 5KRSA 3QLHA 1NJYA 2IM2A 1YTAA 4LH4A 2PYLA 1O1WA 3KLIB 3DOLA 1NK9A 3L2QA 3PY8A 3OLAA 4KHMA 5L1IA 4M3WA 4CIEA 1W25A 4ID5B 1KFSA 3FQKA 5DG9A 3VQPA 3AO4A 4DTJA 1KHWA 4NRUA 1A5VA 2OPPA 4URQU 3VQ9A 2ZE2B 3NAHA 5I42B 4KKOB 2XI2A 3PR5B 4DWIA 4DU3A 4IKFA 3L3UA 1C1CA 4CJSA 5JUMA 4R8UB 3O3GA 2D5RA 1S1XB 1A5XA 2OPQA 1IKXB 3WNFA 4HVJA 3HJFA 4W5QA 4OKJA 4J9QA 4ELVA 1JLFA 2FVCA 3L2VA 2GIQA 3H40A 5KFOA 4PUOB 3H5YA 3OHAA 1QSYA 2Z1GA 2EX3A 1LV5A 2FLLA 5J2PA 4FJ9A 4H8KA 3OVNA 3KLIA 3NL0A 2XY8A 4MK9A 2W9BA 3GV8B 3U6FA 1BL3A 4CF0A 4CEEA 4K50A 5CYQA 4EO8A 1TK8A 3SZ2A 1IM4A 2RN2A 3DLGB 3UDLA 4EEYA 1W0HA 3FSIA 1SKRA 1UA0A 4QPXA 2XY6A 4NLQA 4FJGA 3CJ4A 3P1GA 4OJRA 3DYAB 1X9SA 1YVFA 4KTZA 4DTUA 1SKSA 4J2DA 4KI4A 4DL2A 1UWBA 4E89A 1HARA 1WNSA 3BQ1A 2FJVA 2IAJA 2V0NA 3VQEA 2Z1JA 3ZSOA 1LWCA 4JRPA 3M8PA 4WFYA 4C8KA 4W5NA 2RF2B 3H98A 2ZD1B 4TXSA 2IDOA 2I5JA 1BIZA 1EP4A 4RNOA 4DTXA 4TQSA 2PZSA 1JIHA 4U6PA 4C8OA 4FS1A 4Q8FA 3CJ0A 1ZBIA 1QSLA 1RDAA 1XR5A 4HTUA 1IG9A 3GV7B 3QERA 4ECTA 2KFNA 2EHGA 5F8JA 3ITHB 3IN5A 4IG0A 4AHUA 4DSIA 4KHNA 4YMEA 1BQNB 4NLRA 3BSAA 3VQ6A 2BANB 3DLKA 3TAFA 2HWHA 3OYBA 1S97A 5F8GA 4NLSA 1BCMA 4CF2A 3AVBA 2B5JA 1C1BB 1J5OB 3QEVA 3LP2B 3RR7A 3VQ5A 1RTIB 1DTQA 1RILA 3HVTA 2IJNA 3PJXA 3ZT4A 3K5LA 2HHQA 1S9GA 4F4ZA 4BE2A 1K1SA 5KG2A 3I5CA 4B3OA 1HYZA 4E3SA 3MXIA 3C6TA 5KFWA 5F8LA 4FJ7A 4K4WA 1XWLA 4K4SA 1HYSA 3V6JA 4EYHB 4O4GB 1N4LA 1SV5A 1RT3A 1I6JA 4I2QB 2G8HA 1ZTTA 3QO9B 4NZ0A 4FZYA 4DS4A 4FJ5A 1YT3A 5C25B 3CFOA 3SUOA 4CJUA 3OHBA 2YKMA 4Q0BA 4ED6A 4DTPA 1TV6A 2Z1IA 2ITGA 5KT5A 4IOBA 4KV8A 5KFZA 4CEDA 3QIPB 4OGCA 2YKNA 4CGDA 4KAZA 3WNEA 1ASVA 3T5LA 4YR0A 3C6UA 2WOMB 1TV6B 4XIUA 4B9LA 1HNIB 5DK5A 4OVLA 2KFZA 2XCAA 4O44B 3NH2A 1S0MA 1HQEA 3DRSB 4NYNA 2XO7A 2IJFA 3BQ2A 1QUVA 3K57A 1G15A 3KKRA 2BANA 5F8NA 1S1TB 3PO4A 3KOAA 1TVRB 2DTUA 4Q8EA 2ASDA 1C0MA 2ATLA 3IRXB 3THVA 3CO9A 2C22A 1C0UA 3PX6A 1RT2B 1RBRA 3V4IA 3GQCA 1GX5A 3IRXA
chains in the Genus database with same CATH superfamily
1OVQA 3G0ZA 3BJYA 2HHTA 2X1BA 5GAHU 3MFHA 3ZZ0A 3AH6A 3NNHA 4ZITA 1P8GA 2Z56B 3MX5A 2WSCC 3VVTA 4KJIA 2CQ3A 4ZCKA 1N0VC 1NNEA 4ZLNA 5HN0A 2F1FA 3JB9k 3DOKA 2L48A 5HANA 3LP2A 5KGXA 4FM1A 3SPYA 4ZCLA 3LZIA 4CJFA 4M5KA 2D0AA 2IVFB 2KXHA 3ZFVA 3U1MA 1ULRA 2ZNYA 2C2EA 1NXIA 1NGDA 3AOBA 1CZBA 1UTAA 2DB1A 2IMWP 3N79A 5HL7Q 2UVVA 3AGRA 2V51B 4KHYA 2YJEA 2Q0RA 2V4RA 2G8WA 2DNOA 2BE7D 2DNHA 1CJUA 2FB0A 1FVQA 3MZIA 3U3YA 4ANEA 4F3OA 2RU3A 2RUGA 3M9MB 1S6PA 3HHLC 1W2BR 4CLYA 1Q4RA 2X74A 4RX6A 2IAJB 2HFVA 4C0BA 4DR5K 2AX0A 5ETVA 2PYJA 4JB8B 3M9OB 1KRPA 4C3MA 1SJQA 1Y4ZB 2YBVA 2XHBA 1XC9A 2XHWA 4O3QA 2Y1RI 2YNIA 3NHGA 4U67L 2VOPA 2FDNA 1NGEA 1SPBP 3TWHA 3V6DA 2R7QA 4BR5A 3QWUA 3MMBA 4M63A 4BVOA 3CD5A 3PYFA 3R6MA 5F9LA 3UNGC 3M8RA 4K5SA 3NMAA 3DM2A 4AF1A 3AVFA 4J91A 2WSFC 1JCFA 4WF9Q 3MM6B 3BGOP 1JLFB 3N4WA 4USHA 2RDJA 4WFXA 4CJKA 2Y8YA 3EZWA 3J7A1 3S3OA 3MCSA 4BC2A 4A62A 4NL5A 2XWYA 2NRXA 5LMNJ 4O23A 2KJVA 1RSCA 2R2UA 5F9NA 3AGKA 4GVEA 3TA1A 2MJNA 2VWJA 1EARA 2V2QA 4BRAA 2IM1A 1RAHB 3BO2A 5CHCB 4Y1DA 5BRFA 2WTUA 1IBLF 2WK4A 4TSXA 4ED2A 3ADAC 4MO5A 3PZPA 3N6NA 4MAKA 2E1ZA 3L2WA 3SMPA 3BF1A 4FF1A 1XN9A 1KLNA 4RW6B 1FNOA 1TUWA 1M1KO 2OEKA 4CTAB 2IIRA 4E1MA 4O5BA 1XI1A 4Z4EA 3MMAB 3J81U 4QOZB 2OTJN 4RPFA 3H5SA 4X64J 2ZFHA 3GG4A 3I4PA 1R0BG 1SIWB 4C4WA 2AYEA 5GAGP 1NSKL 3MEGA 4J9VA 5G4DA 1FXLA 4JKAA 4FVUA 3I87A 2CQGA 2F8SA 1KC8T 1S48A 2RRNA 4CHPA 4CEAA 1U1RA 5A6WA 3ZX3A 2W24A 1GOBA 3UD4P 4O8UA 2C2OB 1XEZA 1T8EA 7FDRA 3FCVA 4QBUA 4WE1A 1QVFR 3VWSA 2F9DA 2B4VA 4J9RA 3K5NA 4DR3K 4N8OA 3KLGA 2WVCA 3PR4A 3DRXA 2ACMA 4D3GA 2NR0A 1WBBA 1K8AO 2MTLA 2D69A 3TZZA 2KH9A 4WZQA 2E66A 4FP9A 4FXWA 2HBJA 4FLTA 5HLFB 2JSXA 4OZLA 4DDFA 1MWMA 3FZFA 3OYGA 3DLEB 4K7QA 4OZNA 4N77A 2CJQA 2QYCA 1WI6A 1FRMA 1DARA 3NP5A 1HBNA 3EZUA 2IS3A 1AUDA 3KIOA 1WKKA 4BDYA 5FROA 2HWTA 4BLGA 4JI5F 4QW9A 3GONA 5D4OA 1HD1A 3TRGA 5DM6L 5I3QA 4CE9A 2B4JA 1NG9A 4U8VA 3WXMB 4CLFA 4O4RA 4DV3J 5D15A 1QQOA 4CECA 3B82A 2GCFA 1ASUA 3LWLA 2M4MA 1RT7B 4CZHA 4BG8A 2HHHK 2O8CA 3N28A 3W1YC 2DK2A 1F9EB 4KREA 4K2XA 3I31A 5IFMA 4ECQA 2VQFJ 1FDAA 1SV5B 2OMOA 2AF6A 5GAGU 2OZMA 3TAPA 4IG3B 3HP6A 1YHQN 4YOYA 3KLHA 1SH3A 5F0XA 4WFNQ 2R7XA 2BVZA 6FDRA 4DV1K 2DCLA 1Z4UA 3EGZA 1TGOA 2XRIA 5H9EK 3D28A 4DV0K 4KHSA 2LECA 4FJKA 3M4XA 2A10A 4HTIA 2MZQA 3GJSB 3NNCA 2XNRA 2J9DA 3FVYA 4QWAA 4E7HA 3GIIA 2W6LA 2QM1A 1GLEG 4EBDA 1DQ9A 4RNNA 4E0DA 3C2PA 4AXJA 4OX8A 2H5IB 2NRVA 4IJNA 2HS0A 2W9AA 1YVNA 4LRAA 1VQLS 5ADXH 3KLHB 2YX7A 4HLBA 4OFZA 4DU7A 1Q5VA 4NO7A 2H54B 5B0GA 2HNZA 4RNFA 1VQ9S 3CGIA 2RQKA 1FJGF 1NH7A 1NB2A 4FL9A 1N56A 1Q16B 9ATCB 3BGUA 1FRIA 1VQON 2HMIB 2HBRB 3GZ7A 2VA2A 5DDRC 4CTAA 5SZTA 3M8SA 2GVZB 2X3DA 3W7BA 4CH7A 4PCQA 4Z0UA 5JXSA 3C65A 2O3DA 2VBXA 3V6HA 4WQ4A 3RBXA 3LANA 1URRA 4K43A 4V19S 2CKWA 4K4XA 2H4YB 2ZBQA 3KVGA 2CQ1A 1NHKL 3G2XA 1HI0P 1WSEA 2XSFA 3IO1A 4WIIA 1DLOB 2A2CA 3E8OA 2FY8A 4Q0BB 2HZCA 3CCZA 4X66K 4GC6A 1CQMA 1KS2A 4G65A 3MMAA 4Y6IA 4P6QA 1LWEB 5DZ6A 2AEFA 3WBZA 4LF9K 2QWNA 2R8KA 1OO0B 3NCIA 1NK0A 2WRMA 4M5IA 4ZVRB 5GAHP 1PJ5A 4B3SJ 1D8YA 3PFOA 2G2ZA 3UPFA 3CCMN 1Q5YA 4UY85 1ILYA 4W5RA 3FZMA 3BEGB 1HNXF 4CM2A 3OFGA 3KK2A 5AZIA 3HCXA 1SL2A 3P8BB 3OW2R 2G8FA 2A2DA 4PKHA 1WSRA 1NK8A 1BQMA 2WBRA 2A1RA 3CCES 2UUCF 5H1SV 4R5PB 2ZWHA 1VS3A 3PDNA 1KQGB 4JI6F 3A8JA 4CH1A 2DO4A 4I7FA 2NXCA 1U48A 4B3SK 3OPKA 2IRUA 2LQJA 2XC9A 2R4FA 2KQ2A 1O5JA 2KFYA 4FOEA 2XY5A 1S3XA 4RW4B 2DY9A 2ILYA 2J4RA 4JKGB 1RHMB 4XTTA 4DV7F 2I8EA 3OY9A 2MLYA 4WCEQ 2Q31A 1XR7A 3CETA 4B3MF 1VQLN 4X4PA 2ZJPQ 4B3TF 4QWBA 4A57A 1QHAA 4JI1J 2E2QA 1S7HA 1QZ6A 4M95A 4P72A 5HATA 1HNZK 3NOGA 2N7CA 5JMNA 1VR6A 4DPOA 2B51A 1DURA 5HVHA 4JI2F 3SI6A 1I94F 1JJHA 2YH0A 1TFWA 4F4AA 3MPDA 2V52B 3N4QA 4IG3A 1MROB 1S1UA 2DNKA 1CC7A 3KTQA 1XHXA 1FEHA 4JI0F 3AO3A 5LSRA 1JL1A 4KV8B 3JAMU 1TL1A 4DHVA 1SC3B 1X9MA 3CMAN 4FWPA 2KHDA 2ZE2A 4RWTA 2AEJA 3JYTA 2VQFF 1NNDA 3LPYA 1JLGB 1J5EJ 3MCAB 1VHFA 3ZNUA 3AVLA 3CHWA 1J5EF 4AILC 3T1YJ 3S3NA 3SDEA 3HOSA 2V63A 3MD1A 2N7YA 4DUYJ 2UVRA 2UUTA 4JHDA 2KI2A 1LW0A 4BWJA 1RBSA 3IS9A 4FKXA 2YPZA 3VF2A 2F8HA 1VQ9N 4B9VA 2E9RX 5GVQA 1HYSB 1HFEL 3SV3A 2O1PA 2EBEA 1O6XA 2MZJA 1D3WA 3PX4A 2JVOA 1VQ4N 2FGCA 4DR2K 1VI7A 2OD6A 4BG9A 1L3UA 3D2EB 2V2ZA 2DXDA 2FSKA 1VRUB 1E6YB 1U26A 2IOCA 1FK9A 4J2BA 3PIPQ 1R8CA 2MLXA 1SJ4P 4LF9F 3QAEA 4DR6K 2OUGA 3JS9A 3BQ0A 2OYQA 3RB6A 2P9UB 2CJXB 1G6BA 3H3OB 1ZA2B 1JXLA 2HFUA 1B7FA 3CPWR 3D0IE 2FJEB 2C3UA 3TP2A 1TKTB 5C25A 1OPIA 3QFUA 2JC1A 2RE1A 4NB4A 1IH7A 1HUXA 2KLAA 3C95A 1WKLA 3O6QA 1QE1B 4PAAA 3DHXA 4DFJA 4FWKA 5B0CA 4CLUA 3CC2S 2V9KA 4I2QA 2ZJRL 5C15A 1QZ5A 4KHPJ 3BO4A 1IXKA 3RJMB 3KD1E 2HOEA 4EBCA 3FE1A 5CE3A 4CRJA 2HNYB 1TMMA 2WVEA 1S4FA 4DF8A 1NU4A 3M2VA 3T6JA 2FTRA 4UQTA 4G3IA 1HWJA 4OX9J 4BCAA 4W90B 3M2UA 2VC1A 4CO0A 2V4QA 4BRLA 4ISEA 3OYCA 4WQ4C 5CYMB 4H4MA 3CYMA 1RGVA 2IRXA 4FYWB 3AVIA 5L46A 1RK8A 4CLLA 3AQPA 3E01A 4CF9A 4FYDA 4RUAA 4JOUA 3V4MA 3VQTA 1JKHB 1SI9A 1U8WA 3W5ZA 1FEEA 1TUVA 2ZKTA 1LNQA 2DXEA 4E8UA 4XAKA 2RIJA 5BR8F 3S01A 4YB1P 5B08A 3I33A 2QGFB 4KQZA 1H73A 4LSNB 4QZVB 4Y0WA 3UR0A 5E84A 5M1NA 2V8GA 4USKA 1RJJA 1V5IB 4DUYF 1Q8IA 3OYJA 3CCEN 4DX8H 2WVBA 1N5YB 4URGA 5E41A 3N5BA 1VQ5N 1X4GA 2YNFB 4BE1A 1H72C 1DBDA 4ANCA 2F3JA 1U1NA 3UQSA 1VSHA 4KHPK 2CVIA 4ZHRB 4PQUA 4IG0B 3DGPB 3GCWP 3PX0A 2ZBCA 4KB1A 2BM1A 2HHSA 2JX2A 4ZVUB 3VENA 2DH9A 3C66A 4JI6K 2I5JB 1HA1A 4L3NA 3MCOA 4JI3F 4R5PA 3F2KA 4NLCA 2LA6A 3W65A 1NPRA 2DNPA 1Q78A 2J9EA 1UJ4A 4LFCF 2YHBA 3OXGA 3FK4A 1RBOB 2WB1D 2UZAA 3VQ8A 1TL7A 4OX7A 1FKPB 4A8OA 2HNYA 2ATQA 3FFIB 1RDWX 3K7RA 1S9EA 1GLBG 4IZ9A 4KBIA 1RT4B 3TQ1A 1HBUB 4YDUA 3TZWA 2VQEJ 1GH8A 3ISNC 1YJVA 1G4CA 3CO0P 1UJ5A 1VCTA 4AQYF 3CC2N 1B0PA 1E3MA 4Y34A 3M6UA 2YNGB 1WDTA 3V81A 4J7CA 3TA0A 1RCOB 4CIGA 5ETKA 4LFBJ 2FBTA 3GG0A 3AVJA 4UUWA 3ZTPA 1MU2B 2FBXA 3MEDA 5M2PA 2NNWA 4JI5K 3DU5A 2W9CA 5AQYA 1K73T 3H20A 1KCFA 3I0RA 1FXDA 2PMHA 1YWXA 3D2EA 3TAEA 2QA4N 5GAEI 3RRGA 4F26A 3BBFA 2YX6A 4RZRA 2NXJA 4PG6A 3WHIA 3CJ2A 4O3RA 2R7OA 1Y5LB 2KHCA 2D9PA 3BBBA 3OXFA 2YHXA 3UKRA 2XCPA 1F2HA 2YQ0A 1XNQK 2QMWA 3K0SA 4K8RA 1I3AA 2GV9A 2O8EB 4WQ5C 1YGYA 3HM9A 2DR9A 1EETB 1YBAA 1ITGA 3D68A 3IWXA 2XYPB 3VTIA 3E9OA 4DV1F 2EFPA 3ENWA 4O44A 5HROB 4LH5A 1VQ5S 5L8RC 1KWMA 3AVMA 1MLAA 3UB5A 3BKTA 3DMJB 5JLFA 1ESVA 4RTFD 1KVKA 3F73A 1QHTA 2H9ZA 2O01C 2AP6A 4PG5A 1NLVA 4B9UA 4ILJA 4BQLA 1J27A 2XB2D 3E51A 4QR2A 4HT5A 3HM8A 1YJWN 1CVJA 4FXDA 2MB0B 3MXJA 3MEDB 2FVRA 2C42A 2CPYA 4DFMA 3HZ6A 2F8MA 3C46A 1FNXH 1RBTA 2BX6A 2MPUA 4FBUA 1R0AB 2IYIA 3CIPA 3Q7CA 2KU7A 4CFBA 2QTWA 4BRCA 3VESA 2MQ8A 2KJWA 2HRUA 2A3ZA 3FRZA 4FVMA 4IR9A 3MECB 4NXMJ 4CEQA 2WONA 3ZT1A 3GIJA 2QWMA 4K41A 1FVSA 2RT3A 3TJAA 2BQUA 3KYLA 3Q2TC 5T7BA 3MK6A 1S6QB 3N9UC 1RISA 3H4DA 1HNVB 1TK5A 4PYDA 4MIBA 3FCWA 2DRAA 4CJEA 2XHCA 2ADBA 2A18A 4H4KC 4CHYA 3P3DA 4F0KA 3FR0A 2O8BA 3CDWA 1RWWB 5LMUJ 4Z4GA 1TAQA 4ZOSA 1P1TA 3J8AA 1S0NA 1QVFM 1L3VA 2OPRA 4DG1A 2KZMA 1RT4A 1KSPA 4LQ9A 2B9XA 5KAKA 1UFWA 2HMPA 3IA0A 4OL8A 2MLZA 3T1HF 2PY5A 3VZHA 3MGJA 2Y0SD 1MWKA 1TL7B 1J5EK 3VAJA 3BZKA 4F4KA 5E33A 1Q82O 4NLYA 3MR7A 3I8DA 2NLWA 1GLCG 3VGMA 4YY3K 3LZJA 4AHRA 1JNZB 1RWNB 1LAWA 3Q24A 1LK5A 5DM7L 2DNGA 3TAMA 1JLCA 4B3RJ 1H7XA 4DG1B 4ZVOB 2YNHB 3E2EA 1NGIA 4FJJA 4CESA 1FDDA 1S5ZA 4QIGA 2YHYA 4OPAA 3CCSN 3GFXA 2YJFA 1R6VA 4USMA 1YRTA 2RSQA 1F21A 1M1HA 4LC9B 4PUOA 4JUZA 3ZSWA 1ZOTA 1YZ7A 2B4PA 1RT1B 3SI8A 4K4UA 4RJVA 1L3TA 3N6LA 3KK3A 3MI7X 2ASMA 1JJCB 3QRRA 5AXLA 3KG1A 3G10A 1LOUA 4RW7A 1S0OA 2HIYA 1ZBUA 3BEXA 2P8IA 1FESA 3Q8UA 4AHCA 4ECUA 3LW5C 1V3RA 2FHKA 2XS2A 3CIZA 2UUBJ 2QA4S 2D0CA 1FFWB 4Z2XA 3MM7B 3DRRA 2HQIA 4A8FA 3ILOA 4M45A 1VJWA 3PYGA 2NCKL 3CMEN 4IEEA 4F2SA 3OYDA 4YDUC 2VL1A 2W2OP 4F4WA 4USJC 4G9ZA 1AFIA 3L2UA 1T44A 3CI5A 2XYHB 4ALZA 3NG8A 4Z37A 1WC6A 2FJAB 3R5AA 4NXMF 2FHMA 5DMRA 3TAMB 2AYBA 3L7UA 4PZVA 4ES3A 2AQ4A 3NGZA 1X4HA 3ILIA 5FLXY 3G82B 2YQ3A 4JI6J 2D1CA 3RRKA 2VKRA 2IMOA 1SAZA 4P9SA 3HPGA 4DSFA 3G96A 1HD0A 3CDEA 4Q2MA 3P5BP 2ALYB 1C0TB 4G1QA 4DV5K 2P9IA 2FVPA 4UY8T 3AVAA 3QEPA 1VQKS 3DLLL 1NGHA 1TL3A 3W60A 3CT9A 3CW2C 3SV4A 3ZC4A 3MECA 3RYLA 5SUHA 3GBTA 2RQMA 4NLPA 3S8SA 2W2MP 3EX7B 4K4YA 1AFJA 1PBAA 5C2CA 4I6YA 5HQ8A 2CGKA 2GJ2A 4M5LA 1FXXA 3HI9A 4OHZA 3G87A 1FJ7A 3QNNA 5LMNF 4QWDA 1IUJA 5CHIA 3ET6A 1F3VA 3EXCX 4QYZK 3HFZB 2QJ3A 5RUBA 2I7PA 4DQQA 3DOKB 5A2QU 4A46A 3RW6A 3CCUS 4CCHA 1QTMA 1WAJA 4K25A 4BR0A 4H0TB 2GELA 1YLXA 4LSLB 3VALA 3PW4A 4C23A 3DI6A 1WTBA 1RAOA 2IDEA 1WEYA 3CERA 2JC0A 2H4WB 2HHWA 2OPSB 5AQZA 4CJQA 1WI8A 2E6LA 4PG7A 2DHAA 2YV0X 3N5FA 1XMQK 2R42A 3SQ0A 1NZ8A 4RBVA 3B6OA 4AM6A 1E6VA 3H45C 4CEBA 4PXBA 4CQ1A 1Z2LA 4IO1A 4ZVPB 2DHHA 2OA8A 4ZVGA 1GXTA 3CFRA 2AGPA 4C48A 5KFMA 1ROFA 1U2CA 1SKWA 4BRPA 3QMQA 2QSWA 5KFBA 4M3RA 3QFHA 4TLRA 4DTRA 3ULEA 3MHYA 4DR4K 2X6NA 4CD3A 3SSSA 2N82B 4DFKA 2R2SA 1Q79A 4O55A 2HG4A 4AQYJ 2M2BA 1RWPB 2J7KA 3MD3A 2IM2A 4HDHA 1O1WA 3KLIB 1GEHA 3THYA 2FHOB 3C19A 4R79A 3UN3A 2EPIA 1OJ4A 2VFUA 2H3EB 2MKIA 3I32A 1W25A 4WP3A 2NPFA 1KFSA 1Y5IB 4GO7X 1JCGA 1HHSA 3FEZA 1RU1A 3WIVA 1K9MT 5D6GA 4IEIA 4OYBA 1UVLA 1X0FA 3VQ9A 2ZE2B 1MN9A 5AE2A 1QAXA 4PWUA 4KGVB 4CJSA 3MWBA 1KD1T 2E20A 1S1XB 4LF4K 1NB7A 1IKXB 3WNFA 4HVJA 4OKJA 2QEXS 3NXZA 3T41A 1CS4B 2HURA 3HZEA 2GIQA 1ZS6A 2A1BA 4YHHK 1S6OA 1VQMS 4OO1J 3OQ2A 4OI2A 2EX3A 3K9KA 1TL4A 2ABYA 1G3OA 4GMKA 3OVNA 3NL0A 3WT0A 1NH8A 2XY8A 4MK9A 3LDQA 3BKUA 1VQ4S 3G6EN 5BR8J 1FT8A 5CYQA 4EO8A 3HD1A 2LEBA 3I55S 3PHTA 4U96A 4QPXA 2XY6A 3CJ4A 3NCQA 1IWAA 3P1GA 3DYAB 2MJUA 5JVHL 4DV6J 5B0FA 4J2DA 1BUXA 3HT0A 4KI4A 4DL2A 3T9NA 3UFCX 2RE2A 4WFBQ 2V0NA 2LXUA 2ROGA 3GE1A 2MQLA 4UZCA 1LWCA 1R59O 3M8PA 5FIIA 4EFAC 4NA1A 3Q83A 3GPAA 4C8ZA 4DTXA 2PZSA 4C8OA 2F7TA 3CJ0A 1Y0HA 1SZ2A 1GXUA 3EMTA 3ITHB 3IN5A 3DGPA 3UN2A 4DSIA 2UUAK 3J7YI 2FIUA 2BANB 3DLKA 4H03B 2HWHA 3ET6B 5B0AA 3MN5A 1FTRA 5F8GA 2L08A 2Z2LA 2ZGZA 3CCLS 1KOOA 1D4XA 3KZBA 3R2DJ 1C1BB 2OMLA 1VQNS 3LP2B 3VQ5A 1RTIB 1DTQA 1RILA 3HVTA 2IJNA 3ZT4A 1LXNA 4BE2A 5KG2A 3I5CA 1NMNA 5JMVA 4B3OA 4E3SA 4OI6A 5DJBA 3CJKB 2JVRA 4K4WA 1XWLA 4AD6A 4LRDA 3J7AP 1HNZF 1ZAXA 2QLJB 4EHTA 1SV5A 3KUHA 1MWYA 1XMOF 2G8HA 3CC7S 3QO9B 2EG2A 2HGLA 2DNQA 1IBLJ 3WEEB 4YY3F 5EHHA 5LOQA 4YDXA 1S72S 3PKMA 3CJAA 2O66A 2O8DA 3GJQB 3ZZOA 4ED6A 4DTPA 2B8PA 2HQGA 2J0XA 5G0RA 4HHUA 1VMBA 2ITGA 1IBMK 2KT5A 5A8RB 5BPMA 4CGDA 4LBPA 2LVWA 3BN4A 3DN9A 3WNEA 4YR0A 2XMKA 1TV6B 2UXBJ 4IOCQ 5DK5A 1HBMB 1OH6A 2Q1NA 4DB3A 1FI4A 4CZLA 3VR1A 2XCAA 1HQEA 3BH6B 4FYYB 3X3UA 1G15A 3G71S 1TVRB 4Q8EA 2IVMA 3THVA 1RT2B 5IC4B 2PN6A 1FNMA 3R9LA 3SDEB 4IWVA 4J8FA 4B1XB 5HK4A 2P9PA 1RT7A 2C2KB 4E7LA 4QWEA 5KFKA 2HNZB 1VSMA 2KHOA 2GBZA 3AOCA 4PRFA 5I3UA 2Y0BB 4ED3A 3BZCA 4PL8A 5LMNK 2DFHA 4YHHF 3VAKA 2JEFA 2VCPA 1DQAA 5KG1A 3DXKB 1LXJA 3IP0A 1CJVA 2DNMA 4EUVA 3F44A 4KGZB 4TNOA 2YKOA 1YIJN 1RAFB 4CVNE 1XUPO 3TAQA 4DQSA 4MFBB 2KG1A 3QESA 2CQDA 3W9HA 1X9WA 4DL0C 1O0PA 4JV2A 3C6HA 2Q3PA 2XGQA 3DRRB 1HL6A 2FSNA 1U0HA 2FF6A 5LXYA 4N8NA 4CGHA 1CJTA 2VD3A 2RDIA 3JQMA 4X4SA 3ID8A 3CM5A 5HAOA 4P2MA 4K0KJ 1NKEA 4TY9A 4OYIA 4LQ3A 3VGTA 1R6YA 1RWXB 3D6HB 3U4LA 4OHXA 5GMDA 3CDUA 5D78A 1NO8A 4FPBA 2MKKA 1UAXA 4M42A 2NYHA 1CXUA 4JV5J 5EWFA 1RP5A 3CXCR 2W40A 2ZH2A 1JLQB 3HVRA 4Q2LA 1YDLA 4C1NK 2AEMA 2V4JB 1VQMN 2WB4A 2ZOGA 4CYUA 4DL3A 1X4DA 1TKDA 4FWMA 2GC8A 2DXFA 4PEOA 3C14B 2FHJA 2JJ4D 2YHWA 3SAFA 4LF5F 4ZTJA 1RBLA 5AQUA 3O9QA 1SH2A 2HFNA 3I0SA 2ZM6K 3VEWA 4ZHRA 3D54A 3BYRA 2MDAA 3SUNA 1Z1ZA 3D1QA 2LQ8A 1YXQA 4WK3A 1HQUA 4Y2CA 4DCJB 4QS7A 2Q1LA 2VG6A 5KG5A 3EJMA 3B4MA 2DHXA 2OPPB 1JLAA 5KFRA 3LQVA 2EVZA 1SC6A 3ENBA 2CJKA 2BRKA 2BE2A 3THTA 2VBWA 2HBKA 3LO3A 1D9DA 3VCDA 4CI0B 2XY7A 4UUXA 5KFDA 2CGLA 3LM2A 2EK6A 1RHJB 1VQ8N 4DV2J 1KBRA 1MMNA 4DSKA 3AO2A 4MK8A 4F25A 3P39A 3ENHA 4OYWA 1X4AA 4NRTA 4ZIVA 4LR9A 2P9LB 3CM6A 3KNAA 4CZCA 4KHUA 1IVZA 4JI7J 3OFFA 4WWSA 4JK8A 3RB4A 3BPDA 1YITS 4LBIA 3OLBA 2IA6A 3FZLA 3MR6A 3I56S 3N0VA 1BOTO 2ZJRQ 5DDPC 3DXSX 1YTUA 4UY8O 3M5RA 2VV5A 3R5DA 4IDHA 3J7ZT 4RW8B 4ZP7A 1FJGJ 3EEQA 2P9EA 3JQJA 4DI6A 3LP3A 4AH9A 1S4EA 4URSA 4DV4F 5KFCA 1ZETA 2I1RA 2FBYA 1H7WA 3V1OA 1I94K 4WQ5A 3SQOP 4OYOA 1TKTA 2VODA 3PIOQ 3H1QA 4AM7A 1EIYB 3AXKA 3PKYA 2ZBRA 4GKKK 2FUG9 1QE1A 3O9RA 2QI2A 4MO4A 3M8ZA 2F8TA 3OBWA 4LF4F 2E44A 1JK9B 3EVWA 1GLDG 4DL5A 1FA0A 2KG0A 2QWQA 5DO2A 3IXQA 2CH5A 1E6YA 2C3MA 1ZYQA 3QBXA 5CZ2A 4M41A 3LDLA 3OYAA 4CF1A 3QEXA 4DUZJ 3T5JA 3ZETA 3AHPA 4Y28C 4IDKA 1U24A 4P73A 4IOXA 4K2JA 5KFAA 2MKSA 4FJXA 5LT5A 4CNZA 4ED8A 2JWLA 3EGNA 2CPXA 4DHYA 5DQIA 2Q2RA 2P9KB 4DV7K 4ILRA 4L73A 4JI8F 3HK2A 2V8PA 1U6BA 3WZ0A 5DM7Q 1C6VA 3D7EO 3UO0A 2IVYA 5H9FK 1T94A 4DUYK 2YKMB 2GHWA 1C0TA 4G1QB 3CCRN 3M8WA 4JI0J 4CJ3A 4BC4A 2NRWA 1KLMB 4L76A 2AGOA 1WC4A 1WB9A 3ZSZA 3W62A 4QIFA 2P9KA 2QO3A 3J80O 3CCVS 3SBGA 1CBKA 3OYEA 2F96A 3V6KA 2GMHA 4IXCA 4BRGA 4DL6A 2FJWA 3HHNB 5ETRA 2LEAA 2Z2MA 2QKBA 1RTHB 2MHNA 1XNQJ 4PHTX 4DR1F 1WD6A 3PSFA 2RRAA 2YWKA 4EIAA 1ZM4A 4B08A 4USIA 4KPYA 1KLMA 3VERA 3NOCA 1BCOA 1CEZA 3SCJE 3PO5A 3PIOL 3T5HA 2ZC4A 5JVHQ 1P9YA 1MDUB 1IBLK 1LKZA 1E4FT 4B02A 4PKDB 4HR2A 4JI4J 1S77D 4YB6A 1T02A 1UWAA 4EAHD 3JSBA 1AW0A 3FNNA 4ZP9A 4CJTA 1J5OA 5BR9A 3J7YP 4ILGB 2WW8A 3H3NO 2UV8G 3FQLA 5AQTA 3TABA 3L4QA 3I82A 4CJLA 5HJYA 3OL7A 1RTIA 5GAEP 2LQ5A 4UT4A 3EWGA 4ECRA 1F5BA 1H0HB 2OIHA 1UVJA 2M8HA 2CQPA 4I6MB 2E5LJ 4EWTA 2Z8QA 1VHIA 4CJ7A 3DCAA 3V81B 3DLGA 5ELZA 5HL7L 3AO5A 5B09A 1NKBA 1HNXJ 3HKWA 4CJWA 1TL5A 5KFHA 4CEOA 5FPDA 1C0GA 1ZXOA 2E6MA 1ZBFA 3L3CA 2LFVA 4Q43A 2GQQA 2K1RB 4ZLJA 1DTTB 2P5GA 4IJAA 2M0GB 3FZKA 5ETSA 5KPRA 3HX9A 1V3ZA 5IQQA 4FLXA 5CD4A 3O3HA 5KFYA 4AT1B 1V4SA 1B7YB 4JKCA 1G1XA 4LUBA 3EPGA 1WHXA 3DDKA 3MAAB 4C3LA 3IBFB 2VH7A 2IIHA 1REVA 2WAQD 3H90A 3RB0A 2V2VA 4CK2A 1RWVB 2ZH7A 4OIXA 3ID6A 1RTDB 3AJDA 1AZSB 3M7VA 1XC3A 2F4VF 1VSFA 3TVYA 4CT9A 4TYBA 3TYTA 2DIUA 1TK0A 1U0SA 3MM9A 2YNFA 1WUAA 1HR0F 2Z2YB 4U95A 4RUBA 2OSRA 5D4PA 2JLEA 7AT1B 4KHWA 3A8IA 3R1LA 2ZVSA 3W3DA 3ETOA 2UXDJ 2EKNA 3VAIA 2CGJA 4CGJA 1L3KA 4PA1A 1YJRA 5AFUA 5AQFA 2YI1A 4NLWA 4ZMMA 1NM1A 2OFGX 5LMUF 4UTGA 3FBEA 5HQMA 2FJXA 2G9OA 5DGAA 1UZDA 1FWKA 1L3SA 1HNZJ 4PYAA 1Q7YO 2DNLA 2E2OA 1XNRJ 2CPZA 2BJ8A 2VPWB 4EZ9A 3SUQA 1X5PA 1VLYA 2GEMA 2VOOA 3NWGA 1NJZA 1XMOK 4ANDA 4BR7A 3TOQA 3SUPA 4QAGA 1BLUA 2R8HA 2YKQA 1FCAA 3MUTP 4CERA 5KFIA 4PPDA 4DX5A 2HB5A 2OKQA 4ZJQA 3LAMA 3K5OA 3BR9A 1VHXA 2KO1A 4QQBA 5J2MA 2EG1A 1JLEA 2BJ3A 1W2BM 2DNNA 4LFBK 1NHVA 2GWJA 2ZH4A 5L1KA 1RTHA 3DMJA 3E9LA 2Q43A 3FBCA 1ZBSA 4BVPA 4ZP6A 2ZUGA 3OFHA 4DR7J 1VFJA 4USWA 3KG4A 4DQPA 4B3TK 1S1WB 1OS5A 1HKGA 3PRDA 4KFBB 2VG5A 4H4OB 2WW4A 3CCRS 3QETA 3K58A 2DHSA 3DKDA 4CDIA 4ID1A 5HP1B 4USUA 3NF7A 3AJ1A 3HF5A 4OQJA 3BDPA 3TZYA 3C16A 3JQKA 2MSTA 2IC3A 3WQTA 4NE9C 3MN6A 4PKGA 1H6KX 1ZAWA 1UA1A 4B9QA 3NVMA 1S22A 1VSEA 1HI8A 3NF9A 3QATA 4B1VA 4B9MA 4LRCA 3WXLA 3FJ2A 1W2IA 2AKWB 3GOIA 5KRTA 1RU2A 1C4CA 3MPYA 2R7YA 2QW9A 4JI0K 4PPZA 4RNMA 1LW2A 3MN9A 5BYRA 2MKCA 2NS1B 3DRPA 1R8BA 1NJXA 3OTCA 3R9PA 2JOQA 3NRBA 3CC7N 3AA4A 4DR1K 2RNEA 3TR8A 1FD8A 3JS6A 2HYIB 2UXCJ 2PC6A 1U1KA 2H65B 4B1ZA 1RKJA 4GKKJ 2HZVA 2IBKA 3PXGa 3ICLA 1YI2S 3E9PA 1QAYA 4D3HA 4GY2B 1VISA 3OL8A 3R6LB 4JAXA 4RO0A 3D5MA 4JI1K 3O8MA 5JLHA 1WWHA 4ZPBA 1N33F 4QU7A 1EB0A 4H5VA 3RTVA 2ROEA 1RWKB 5KFVA 2BW7A 4J9KA 5CD4H 1T05A 2A40A 1Y97A 1ZZFA 2LQ9A 2MZRA 5J2MB 2PMWA 4QU6A 3R1HA 2CPHA 2FLOA 3CXCM 4NOHA 5L1LA 4DX6A 4A8SA 3QRQA 1GTEA 5HMYA 4LJMA 4KGMA 2HBZB 2POKA 1T6DA 4E1NA 4DV4J 4X62K 4F2RA 4DL7A 5E5NA 4FF3A 3M6GA 2UVWA 1NJWA 5ETNA 2MQMA 4MKBA 1MMDA 4IQMA 4WTYA 4HL9A 3IDHA 1AUSL 3FZHA 1RTDA 3H2UB 3MX2A 4M3ZA 1D9AA 1VLOA 2R7SA 1HW8A 2ATCB 4OPKA 4BRDA 2IM0A 4LF6K 5LL6d 4M94A 1GAOA 3IGVA 3CCWA 5HBMA 2CWXA 2HF4A 4U67Q 2HFZA 4DJBA 2LXFA 4BC7A 2JLGA 5IS2A 2KTQA 4FZVA 4EI2A 3AA5X 2WC9A 3LOUA 1C1CB 5E3QA 3OXLA 2W2NP 3ENVA 1BO5O 4RW8A 2JFDA 3QFPA 2W1BA 2YY3A 2HAFA 1FHTA 2F63A 2D7SA 3FKBA 1NSAA 5KG7A 1EX8A 5KT7A 1TP7A 1RT6A 1T03A 1NJIO 3RU0A 3ZXWA 3LPEA 3H59A 1FE4A 2E7WA 4XDCA 3KJVB 3ZT0A 2KDOA 3IM8A 1ZZNA 4WYLA 3HLUA 2BXJA 2XO6A 3IC1A 4OMFG 1UCNA 4M3XA 3M8PB 1HWUA 1LOTB 5CABA 1S1XA 4JKEA 3B6PA 1BU6O 4RW9B 2Q3SA 2D3OR 4PG4A 4NCBA 3MM5B 4XH5A 4ZJOA 5JICA 2BMBA 1T05B 4F3QA 4DUZK 4JN4A 1TKXA 2F7VA 3M8QA 2ZHAA 5D8HB 4HKQA 2WUSA 2VG7A 3H42A 4K4ZA 5DZ7A 4LREA 4F8RA 4RUHA 3I0SB 4FCYA 2UYTA 4I68A 1FDNA 1Y9OA 3DLLQ 2CPDA 5AQMA 4QS9A 1XNQF 3GR1A 3R7NB 2IC3B 4A2BA 2BGGA 2O4IA 5E3PA 4BROA 2O8BB 3HHLA 2EC0A 4CZFA 3SAGA 4G1IA 3HOTA 3UKRB 1R27B 1UEVA 4IR1A 6FD1A 4JD2B 4DR4F 3BSCA 4NLGA 1N32K 1F5AA 2DITA 4A59A 4K0KF 5F8MA 1OYDA 3NGDA 2X3GA 3PG9A 4ES2A 3UR3C 4IFVA 3D67A 2M70A 4OV1A 1QJHA 4FS2A 2PE8A 1S9FA 2JGUA 4JI8J 2BA9A 2LQBA 3CWJA 3A8KA 2XG8A 5G0RB 3OYMA 4OX6A 1TAUA 2F4VJ 4CF8A 2BEFA 4Y2IA 4C0OC 1YJNN 1Y11A 4FWRA 4TQRA 1VQOS 4ZVFA 4DUZF 5KT3A 1S6PB 4CIOA 3DI6B 1C0UB 1XMBA 5M1KA 4WP9A 4NPOA 2VG5B 3NE6A 3GYXB 3FMBA 4CZMA 1TVRA 1TL3B 3DRSA 2K2PA 3VA0A 3VPZA 3U9DA 4UOHA 2YHAA 3QICA 3AA2A 2V68A 1ZBLA 4IFYA 1VAZA 2BM0A 1HNVA 4DUTA 1HPMA 2GW8A 5C24B 2NREA 4CEFA 1SIZA 4KO0B 3BO3A 5CAAA 4YDDB 3AJ2A 1MU2A 3SEOA 4M3UA 1Q7YT 5KPZA 1GNKA 3VF0B 2C2RA 4CM0A 1YJ9N 2QL5B 4PY5A 1S1VA 3QT6A 5F1XA 1NDPA 1NPKA 4B9NA 3RMDA 4J2EA 2Y1JA 3MM9B 3C94A 3R7BB 1N34K 1R89A 1EKSA 3NS5A 2B9YA 3NCRA 1QUPA 1NDLA 3K5MA 1WJ9A 3CFPA 3HHEA 1IN0A 2GVDA 1NMDA 2M88A 4CK3A 1FD2A 4FLWA 3BSOA 1RA7A 3KDOA 2V8VA 4UQGA 4B1UB 2LU1A 3IMXA 5K20B 1FKPA 5CXTA 3D1HA 4MMOA 1N33J 4M5GA 4RW7B 4FLZA 3KWIA 4FN5A 1K1QA 1FW6A 4YOXA 3PV8A 4WU2A 1UL3A 4H0YB 2VUGA 1J9AA 3I96A 3ULDA 4Y00A 4Y3CA 1VRTB 5M2RA 2C3YA 1HWIA 3TARA 1HBNB 3CC4S 1R8HA 3IM9A 4WTOB 5E3RA 4B3MJ 4FLYA 3GMGA 4O4GA 1RDRA 2Z0GA 1VSDA 5LSLA 3P83D 4DR2J 2G8IA 4F50A 1BUPA 3RBDA 2DEJA 3BS9A 3HXMA 3QIDA 1V5VA 1G2EA 4DV5J 4GVBA 5IXUA 4YR2A 1R3NA 2V34A 1C1AA 2MY8A 3VQSA 1U47A 1GFWB 5HMXA 2QWOA 4QWCA 1BQNA 2R7TA 2O4GA 1T3NA 2QTDA 5JS1A 3A3NB 1NPPA 3BSNA 1K8KB 3ZTSA 1PILA 4KHQA 2COLA 2QSFA 4WXOA 4EYIB 2XBPA 3O9SA 3H5XA 2MGZB 1LK7A 4I1TA 3RMCA 1MWZA 4ED4A 2L3MA 1RNHA 3C14A 2R8IA 1MWQA 2V9WA 1YJ7A 4XO0A 2JHEA 4ECXA 3D0HE 5ETTA 1WBDA 2D0PA 4LF6F 3AAQA 3SNNA 3BB5A 2R9LA 3VQCA 4AYBD 3TEGA 1I51B 3GILA 3TANA 2V4JA 1LAVA 4H5NA 1VRTA 2PD1A 5BYQA 1I1GA 1ZH5A 5GADI 5CYMA 4CGFA 3I8BA 2QLFB 3N6MA 3CDAA 4YB7A 1L5UA 2J8SA 2OHDA 5FPEA 1EJ7L 2ZZTA 4IH6A 5HRRA 4C98A 3LP0B 3RMAA 4DMNA 3L7PA 5C0YA 4ECWA 3MF5A 3NWRA 2E1PA 5T14A 5H1SQ 4V1Ak 4HUEA 1F6TA 1UMJA 4W5OA 4Z4FA 5T7LB 1N8RT 2UU9J 4KSEB 4YP3A 2J76E 5C2DA 4KO0A 2K8GA 4S0MA 3NGUA 4QOTA 2ZH6A 1CJVB 5EWGA 4MDBA 1SQEA 4H0OA 3KHYA 5J1EB 5BN8A 4BHQA 3VQ4A 4H5WA 4UOGA 3P49B 3CC4N 1S12A 3DHWC 1H2UX 1B9FA 2OEJA 2R7RA 3O4WA 1ZA1B 2HHVA 2XMWA 2BABA 3Q23A 3TZXA 3B4DA 1B0TA 4RWXA 4C11B 5F3TA 1DRZA 1YG0A 2ZOMA 1RFQA 1W97L 1EHWA 3H25A 2OPRB 2GVZA 2XULA 3TU5A 2P1JA 4KH4A 1RTJA 2U1AA 2XTJP 2HBLA 4NLVA 1U1PA 4J5OA 2IFXA 1RT2A 3MTKA 2YKPA 3RSEA 4ECZA 3TI0A 1IBMF 3V9SA 1IBMJ 1RAIB 1XTZA 4X4VA 3MCMA 3KHRA 3F56A 1X5SA 1BGXT 4ZPCA 1U1OA 4LSZB 1KVAA 3ZSQA 3K17A 4OGEA 3C7NB 4CO4A 3MMJA 1HW9A 3SXLA 2A0FB 4NASA 1A7GE 1Y00A 1SKUB 2O5DA 1PKUA 3M9NB 1RYSA 4F4YA 5GAHI 1YJ9S 3OS1A 4FWQA 2EFQA 1ACMB 3O80A 3AB2B 3RSEB 3CNQP 2E5LF 4IKAA 4LFCK 3QT7A 3EDRB 4QR0A 4DF4A 1J6ZA 1NWKA 3QGHA 3VEOA 3M1VA 1ZTWA 1KQSM 1RT5B 3J7YU 3RRHA 4Y2MA 3WNGA 4GV6A 2A6OA 1HBOA 4U7BA 1B99A 4IOAQ 2G2OA 1Q53A 4CGIA 3KLGB 4CZKA 1KN6A 3MM5A 3OTDA 2OTJS 2QWLA 4DEZA 4LD0A 2FSJA 1IBKK 3M8QB 3MTJA 4JI4F 2DHGA 5ETQA 1LFWA 4FPIA 4DPYA 1RB0A 2NRHA 2XMMA 4OYPA 1HR0K 5AQKA 4HTLA 4K8ZA 2VBYA 4FF4A 3AD7C 2H48B 3H2VE 3UDEA 2PYLA 3DOLA 3ONQA 3OLAA 1FRJA 4AUKA 1GLJO 4KHMA 4NX9A 5L1IA 4KR0B 4LMZA 4ID5B 3FQKA 2VFSA 3PTWA 4MYUA 2RRBA 5AQGA 1FWPA 4P2FA 2VIHA 4ENOA 3AO4A 3GU0A 3WC0A 4X4NA 1A5VA 4RR5A 2OPPA 5HI7A 2C3OA 4URQU 3NAHA 2E29A 2GAGC 4IKFA 2DD8S 4CWBA 5C7PA 5JUMA 2D5RA 2MZ1A 1XK8A 1HWLA 2F5GA 1MG7A 2CQ0A 1RUSA 3H40A 3OHAA 1HNWJ 5ETPA 5GIOA 1QSYA 4LIRA 4CLPA 1LV5A 2FLLA 5BN9A 4CYUB 3G8TA 2W9BA 3GV8B 1BL3A 1EZZB 3DLJA 2KB2A 3QRPA 4X4OA 1RHKB 2GMJA 3MAAA 1IM4A 3DLGB 1SKRA 3FSIA 4FF2A 4BRKA 2YWHA 3WXKA 1HNWF 4FJGA 1YKWA 3CJSA 1X9SA 3MWPA 1SKSA 2C1EB 2ZBIA 2B4OA 3JAMY 1UWBA 2QMXA 1HARA 3TUPA 4EHUA 5AT1B 2JH3A 5D77A 3VQEA 3ZSOA 1O51A 1RXOB 2J8AA 4WFYA 3QAUA 4W5NA 3IMQJ 1NBWA 2EFNA 2K1RA 2ZD1B 2IDOA 2I5JA 4RNOA 4TU8A 4TQSA 1JIHA 2AV5A 4Q8FA 5HO4A 2EWSA 2CIMA 4HH1A 1XR5A 4HTUA 5A8WA 2UP1A 1YAGA 2KFNA 2NYIA 3OHRA 4C8YA 1Y3JA 2M5YA 5F8JA 4WFBL 4ZN1A 3D9BA 4Y65A 3EKSA 5IWAK 2C3PA 4NLRA 3VQ6A 2G2YA 1S97A 5AQRA 2CFXA 3QWPA 3CCMS 3GWCA 2Q79A 4NLSA 2GX9A 2XMTA 4CF2A 3K89A 3RBZA 5F2RA 1PC4A 2CG8A 4B3MK 5LSOA 3AVBA 4DCHA 3HDSA 2ZH8A 4HTJA 2E8AA 3QBWA 1CG2A 1S9GA 3GSDA 4F4ZA 4JI7F 2P6TA 1HYZA 5TKYA 4JI1F 3C6TA 1FDBA 1W7AA 3R6GB 5F8LA 3UE2A 1HYSA 4O4GB 1N4LA 2KVQE 1I6JA 3M1VB 4I2QB 3IKMA 4NMXA 4JHDB 1EWQA 1YT3A 5C25B 1Y5NB 1R43A 3U02A 3DOMB 2ASYA 2YKMA 4Q0BA 4JI3J 3W8PA 3GCXP 3ULHA 5KT5A 4KV8A 3QIPB 3IFEA 2G0JA 3T5LA 3J81Y 3D2FA 4B9LA 3C6UA 1IWGA 4QIVA 4OLPA 2DR5A 2E5GA 2ZWOA 2KFZA 1FKAF 5EVZA 3FSYA 4M5HA 2F9WA 3NH2A 4WIQA 3T1YK 2PSZA 3ZETB 2BANA 3KOAA 1VBXA 4ZJLA 1N36J 3CO9A 4P2XA 1GMWD 1RE1B 2C22A 1OSDA 2P5VA 1RBRA 5FLXU 2HGNA 3V4IA 4X4UA 2FQQB 1TU0B 3IRXA 4J9UE 3T19A 3KNGA 5I4MA 2H5EA 4B3OB 4DTOA 4ZVEA 5B0BA 3D45A 5C10A 2NSBA 3HVTB 2HRTA 5C5JA 5K9FA 4DR4J 3L2RA 3VHQA 3NH1A 4CT8A 4OHWA 1DKGD 2HIQA 4NYZA 3D0PA 2R8GA 3OSPA 5KI6A 3TUIC 3ENOA 4USTA 4NLDA 2HLUA 2KL8A 4C8LA 1JB0C 4L3KA 3NGKA 3X1LB 4I7FB 2P9CA 4JI3K 3OR1B 4N76A 1RCHA 1T6CA 3DFEA 3IS9B 2EFOA 5F8HA 3WIUA 2X7IA 1NGGA 3TJ8A 3D66A 2D3ZA 2MGZA 2W4PA 3A5LC 3D1OA 4PABA 1X4CA 1NHUA 5EDWA 3SQGB 4CIFA 3M1FA 3QJLA 4AFFA 2JEIA 3G9CA 1DHMA 5KG6A 4ZN3A 3UDVA 4NCGA 3HJVA 2HEKA 3MUVP 1NGBA 4I2PB 4OV6A 2EFVA 1S9EB 3M2RA 4C97A 4KE5A 3AA8A 2Y3YA 2J6TA 1RT3B 4ITSA 3WNHA 3TX8A 1IJFB 3IR5B 3EUNA 3CJKA 2PAVA 4R25A 3NGYA 3BP8A 3S9HA 1X9JA 1U09A 1CZ9A 3MEEB 2HRYA 4BY9C 4ETZA 3OL6A 4DN9A 1B9DA 4CLSA 2BW2A 1YQHA 1X4EA 1V3SA 3PJ9A 2MY7A 3MM8A 4LF9J 2IPOB 5FPNA 2J0QD 3F0NA 1KAZA 2QWRA 2FF3B 3AA9A 1SL1A 3ZX0A 2FD2A 5DRKA 1SQGA 4GVMA 3FDSA 5FD1A 3MM6A 5IT4A 4B9SA 2ZQBA 4NXNJ 5AR0A 4NYOA 4DTNA 1SJ1A 3B78A 2HS4A 3MFIA 1KTVA 3CF5Q 3A3PB 5E26A 4FYVB 2VU5A 4ED5A 2QIFA 3VEVA 1F60B 2DNYA 1IQTA 2Q0UA 2ZF5O 1VQYA 4FVCA 1X0PA 4DV3K 1WLJA 2FZCB 1N34F 3AO1A 2VWKA 4EMDA 3U8XA 2NQPA 2UUWA 9RUBA 4ED1A 4QPTA 4CZEA 4B3RF 4DPWA 1JNRB 3THYB 2ACYA 4DMZA 3NGTA 4DR5F 2GUIA 2VZ9A 4TU7A 3CCUN 1QS4A 4JP8A 2KYZA 3OYFA 3NS6A 2PT0A 5KFEA 1CLQA 4FNHA 3ENAA 3HSCA 5AQXA 3FBBA 1GXLA 4Y2KA 3R97A 1CS4A 3M6XA 5J2PB 3QLHB 1DLOA 4ATNA 1RDUA 4OJGA 1NSPA 3ZCMA 1T9TA 5AZIB 4LF5K 3DGVA 2XI3A 5KT6A 3PW5A 3PUFA 1HNWK 3GE9A 4MK7A 5F41A 3LH2S 2IJRA 2YKAA 1TKZB 1VIOA 3T5KA 1BA0A 5EUHA 5LJVA 1RI7A 3VAGA 2W7OA 1R0AA 3T7ZA 2P9NB 3WX4A 4IOCL 4OX9F 2WBNA 4A8MP 2CPIA 3WQUA 3F9KA 2AYGA 1CQNA 3MR5A 1KVJA 1VGYA 2NRTA 3CJ7A 3AFGA 4OI4A 3C6TB 1X31C 2QYGA 1A5WA 2P5OA 3AAPA 3JTNA 5HVFA 1GLAG 4B9TA 2BKPA 2PFFB 1HKBA 3ZLJA 4O0IA 2G8UA 5AJ3J 1HX1A 3LWMA 4HI2A 3M8YA 3SQ2A 3ZZUA 3KHLA 2RPIA 2D3O1 1JLQA 4DSJA 1BHLA 1AA1B 4PL7A 1WSVA 5FDLB 5KFJA 1C2PA 4TVAB 5ETLA 1ZC6A 3D2FB 2GO9A 3M30B 1M90O 2V6AA 3QSIA 1HLWA 3DLRA 2RKIB 4FJMA 1QDUB 2DKOB 2D0OA 1PJ7A 2LU2A 2FC0A 2PBDA 3CJRA 2VJVA 2OPSA 4H4OA 3HO1A 3PW2A 3A5MC 3L6QA 3NCPA 1YHQS 4FBTA 1FERA 3HPHA 3IAYA 2LCWA 4I67A 4BC5A 1U2VA 3DRYA 2B0GA 2DGXA 4O3SA 2IM3A 2XGPA 4E7KA 1T0TV 4AHTA 3EE9A 5AQSA 2BQ3A 1XBWA 3CULA 1JCEA 1BIUA 1EAYC 3SLCA 1IO2A 1A0OB 3HSDA 3L4BC 4BDZA 1BA1A 4C8MA 4IFVB 2WTFA 4FZZA 3KK1B 3PFEA 2FPHX 2X51A 3KJVA 1QM9A 2ZDPA 4WP8A 4F0MA 2ADCA 3HFVA 1T03B 4MTPA 1BI4A 3NAEA 3GLJA 1AXQA 4MKAA 3SJJA 4IFEA 2DY4A 1TQLA 2PI5A 2UU9F 1HMVB 2LA4A 3EL2A 3R3LA 3O9TA 5KFSA 1CJKB 5K14A 2K7KA 2R2TA 4MT1A 4E19A 2JFKA 1J54A 4ZPWR 4ZLPA 2VONA 4EGLA 2E5IA 2MKJA 1RWMB 2C2ZB 5IV4A 1VDHA 3CQXA 3Q7BA 2VB6A 4ILLA 2WFBA 3CCJN 1WF0A 4KRWA 3HVWA 2VGMA 2W9CB 2BJ7A 1RT1A 2UUCJ 3QEWA 1NUEA 1RDCA 3V9ZA 1X60A 4KB7A 3BF4A 3J81j 2HSTA 1LEOA 1XQSC 1AZSA 1U6ZA 3TEHB 3VQ7A 4N47A 2B56A 2DTJA 1RT6B 1QQNA 3VA3A 2JRSA 5BR8K 1JLBA 3W5YA 1LWFB 1KC8O 2ZJQQ 2Y9HA 1ASWA 2QT7A 2CA9A 3BGRA 1Q0NA 1HPZA 4YEAA 2NSCA 4U7UD 2XZWA 2OTLS 3SJHA 2Q66A 2CH6A 4NLUA 1VSLA 1RWUA 3N01A 4ER8A 3VQAA 3GV5B 2BE2B 1RAGB 3PW0A 3CJ1A 3GYNA 1GMUA 1WHYA 3AVKA 4GW6A 4X65K 4DCOB 1DT9A 1SS6A 1JKHA 1JLBB 2BKOA 1C4AA 4JI2K 4DOZA 4BREA 4TN2A 5AXMA 1IKVB 1A9NB 2E1CA 3R8EA 4IQXA 1K8AT 1F3FA 2OPQB 2P9UA 1UJ6A 2KW4A 3H8YA 2XMVA 1U1MA 1QVGR 1WN7A 1NCLA 3VEYA 4K42A 2AJ2A 5JVGL 2HHUA 4OYMA 1YJWS 2YCHA 5IQ6A 1VBYA 3OYNA 5AQHA 1S6QA 4EP4A 2HKEA 2QE5A 4FK2A 4DQ8A 2AGQA 3CJ9A 2CJBA 4GVBB 5GMKa 3VN5A 3FUYA 1M5KC 2WONB 1RQ0A 3ZSYA 3O1BA 3QJJA 3HL8A 2I7NA 1B0VA 1FKOB 2EI5A 4G6VB 2G1DA 3AOAA 1QQCA 2DGSA 1EXQA 3CUNA 4DR1J 3V9XA 3Q8YA 4JKBA 1HKAA 3VQBA 2FZGB 5GADU 3HSTB 5EN1A 1B70B 2RAQA 3CQYA 4KRFA 5DQHA 4GV9A 5B0DA 1NGJA 1KNZA 5DLGA 2ZEJA 3AVNA 2UV8A 4FYXB 3A1YG 4DCPB 3QIOA 4PWDB 3OYHA 4HACB 4YN3B 1WF1A 5CQGA 4ZVTB 1YBUA 2Q36A 2QZ8A 2H3GX 1XMQJ 2X6SA 5A8RA 1CSJA 1WACA 3I5AA 3A8YA 1N5QA 3QT8A 4PKIA 2O8DB 3ILJA 4P7TA 4CFCA 4DR5J 2OCEA 3T1YF 5HVGA 4IUFA 2DH7A 3QNOA 4YOEA 4CHZA 1KONA 3QEIA 1U25A 2YWGA 2ZITA 2P2CB 4TY8B 3CMES 4PWDA 5J2NA 5D4LA 2MHEA 1WELA 4A5AA 1X8DA 5CH7B 4ZA1A 1N34J 1IG8A 4Z94A 2J6SA 3BY5A 3SFUA 1CZAN 4F02A 2VFVA 3W9IA 2UXBF 4JS4A 4HHHA 3CVKA 6AT1B 1HJRA 1JJ2R 2X1GA 1VRUA 4PXCA 2D41A 3FZBA 3G86A 4Z4CA 3O3FA 4ZTFA 2J6UA 2O8FB 2I2YA 2VFTA 2QL7B 4OI3A 2BKNA 2DGQA 1OH5A 1GQEA 2X1FA 4IFYB 2ZJPL 1REGX 2FC9A 3ZNJ1 4CJVA 3T9ZA 3J80Y 4FO0A 2WOMA 2LSNA 3UDCA 4J2AA 1U4BA 2NUHA 2J7UA 4HACA 2ZDOA 1I5OB 5DS7A 1GOAA 2QMUB 4EK2A 1S1WA 4YORA 3KUGA 4J9PA 2XMJA 4ZPVR 4CFDA 3CEDA 5K5MA 3P6YC 3ZTOA 4OLBA 4C11A 3HHDA 2OJ3A 3GL1A 5AQNA 2F8EX 2V50A 2XLIA 4RNHA 3G82A 3SMSA 5KG4A 3KLVA 3CCJS 4DR7K 2BJEA 4FWOA 2WVFA 2N4DA 1IV0A 4KBOA 1VRQC 3OBYA 1TKZA 4ED7A 2ERRA 2P9GA 4J9MA 4I9QA 1D09B 4NLXA 3LTOA 3MPVA 3CD0A 3HD2A 2ZC3A 2E5HA 3US5A 2PA8D 5EU7A 3EO3A 1MROA 1KAYA 2D4WA 1EQMA 4A8YA 3JAMO 4R0JA 3L4IA 3DLKB 1R0CB 3BN7A 1U49A 2P9NA 1Z6RA 5HRPA 2HVEA 1TZ0A 3HZGA 1FRKA 3DLHA 4ELTA 4JKFA 3KLFA 3ZSXA 3AARA 2FVSA 2AIRB 4ILMA 4DZDA 5KFGA 4FKYA 4H5RA 2HBQB 2BYCA 2AJ1A 1YVUA 4DSLA 3W0LA 1N5YA 2WCXA 4OJ3A 2E2PA 3PIPL 3OYKA 3VAMA 1YBTA 1VK0A 1HPZB 4ZPDA 4CD1A 4DR6J 5IM0A 4O0JA 1H98A 1T3OA 1XQIA 2HVHA 2DYAA 4CJ4A 3K9JA 1OQ6A 5C42A 5C12A 4TKTA 2D9OA 2VFRA 2J5AA 3Q86A 2P9LA 1S1VB 4HHTA 1K8KA 3NVKA 1NDKA 1N0UA 2VQFK 5AE1A 4I6AA 3RAQA 1U1QA 3PHEA 3ZZZA 1VQPS 4YR3A 1NOZA 2YX1A 5D0GA 2ETJA 3M6VA 3TX0A 5BPLA 4QYRA 3TPQA 5A0YA 3QZ7A 2UVUA 2RH3A 5IM0B 3SSRA 3SMZA 4ZPAA 2G8VA 4WKRA 2QL9B 5F8IA 1QD1A 4WXWA 4FJIA 3AY9A 1OH7A 4JKHA 1HRHA 2B9EA 3B8AX 4ID8A 2W2QP 2JEGA 5FJ4A 3F5TA 3HSJA 4BGAA 4YNQA 4QIWD 2MZSA 1QAIA 2HMIA 3CCTA 3SQGA 3THWA 4N56A 4BRFA 4F0HA 1UPPA 3O8WA 5DG8A 1ITPA 4NA2A 3L3VA 3OUYB 3TTDA 3U3GA 2FXUA 3TNVA 1RACB 2Z4PA 4NYFA 3G6ES 5KFLA 5D3GB 1S79A 2ZNZA 1N36K 2CQIA 4LFAJ 3GSIA 4CZIA 4A8KA 3I55N 5D0RA 4KI6A 1UW9A 2W4DA 3NDKA 4HT7A 4FK4A 4X66F 2O8FA 1UEKA 3G6YA 2V67A 1KOHA 4JEPA 5AQWA 3JSRA 5K14B 5L38A 2CJYB 4MKYA 1PYTA 5DGBA 2K06A 2Y1IA 2CQ2A 3CD6N 3ZZYA 4L8RB 4X65J 1D5AA 3ZEUA 3KDNA 4DPXA 4CZJA 3DOMA 2W6KA 4M1KA 1RA6A 5I3PA 4JKDA 5KFFA 4CO3A 1SC4B 4WBFA 1LQ9A 2PA3A 2V69A 2QXLA 3AQOA 3OSNA 3BUZB 4MFBA 3D3BJ 4QCLA 3ZT2A 3PM9A 5EX3A 1VQ7N 5CCMA 4HHJA 4Z4IA 4LR8A 2CAJA 3QNWB 2M8DB 4CFAA 3LL3A 1WOPA 2QX0A 4IOAL 3GJRB 4GV3A 4P74A 4DQIA 4CLTA 1RBVA 4MIWA 5FRMA 5DDOC 2DT9A 1Q81O 5HROA 2IY5B 4CBWA 3NLCA 4BRQA 5KTQA 2DVIA 2R7WA 1CXQA 1TMJA 2WHOA 3SCKE 5BPNA 3A3OB 1DFDA 1AB8A 3ZSRA 3U7JA 2AMCB 3R5JB 3C7NA 4ZPTR 3LA0A 1VQPN 1X5OA 5F0UA 2E9ZA 3NH0A 4PQAA 2YWWA 2RHKA 3O4NA 2RHQB 2HLTA 4M5DA 4MH8A 3PCOB