1LWUA

Crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
NELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha-1 chain
publication title Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood clotting
total genus 30
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2002-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lwuA00
1LT9C 2HPCA 1RF0C 1FZFA 1FZAA 2H43A 2A45H 3H32B 1N73A 2HODA 2OYIA 1FZCB 1LTJA 1W2EA 1FZCC 1RE4A 3GHGA 3H32A 3HUSB 3HUSC 2Q9IA 1M1JA 2OYHA 2XNXA 1RE3C 2FFDB 3E1IA 2FFDC 1RF1B 1RF1C 1LWUA 1FZBA 1T3UA 2HLOA 2OYIC 2OYIB 1N86A 2HPCB 1LT9A 1RF0A 2Z4EA 1N73C 1N73B 1JY2O 3BVHA 1LTJC 1JY2N 2HODB 1LTJB 1RE4C 1FZEA 1JY3O 3GHGC 3GHGB 1JY2P 1JY3N 1JY3P 1M1JC 2A45I 3HUSA 1M1JB 1FZCA 2OYHC 2OYHB 1RE3A 2A45G 1LWUB 1RF1A 2FFDA 1LWUC 1FZGA 1LT9B
chains in the Genus database with same CATH superfamily
3RL0C 5TISE 3VYIA 3AE5C 3S4RA 1PGJA 2E75B 3HD7C 1JMMA 1NTMG 2JJLA 3KQGA 2YIUC 1JO5A 4RKUJ 1MFTA 2HODA 4W7ZA 3GHGA 2KOGA 5AVYB 3M91A 3KDPB 2OYIB 3CI9A 3CD6P 4NPFX 3CCSP 2WSCH 2KIKA 1GMJA 1NTKK 3WUVA 1S9KD 3L72J 2GM4A 2KP8A 2E76D 2J59M 4WVZA 4UB6E 1WT6A 2J5UA 1FJPA 4N6JA 1S9KE 3H1HD 1LJ2A 5TISH 2KLVA 3UIAA 1G2CB 3VMXA 5CMZA 1EZVI 1M1JC 1FU1A 4N3YB 3RK3D 3H1HE 3RL0D 2HPCA 5C39A 2E43A 1PIXA 2QJPC 4HH2A 3RK3E 1OWAA 4H13C 3Q5RA 2Q5UA 1CSBA 2NZ2A 3JCUE 3HD7D 1AVOA 2Q3EA 1KTMA 3S1KA 5BU5A 3RK3B 3M0DC 1LP1B 4IOIH 1URQB 1AQ5A 2FXMA 1TU3F 3C9IA 3FX0A 2P7JA 2XKMA 2YO2A 1L0ND 4UB6H 4YXDC 3HD7B 4D6TJ 1FS0E 3LIDA 2JP3A 2B88A 1L0NE 5CHXA 2KS1A 2ZAEB 1UIXA 1KFMA 3BATA 1HBWA 3OA7A 3AEFC 1SQXG 1E5WA 2HYNA 1FZCA 3NTNA 1JY3O 4WY4C 3A5TA 1ZP0C 3JCUH 3TNUA 2WT7A 4KT0J 5KKZB 1RQVA 1J1DC 3HTKB 3B5NA 2GA1A 1SLQA 4PD4I 2PFXA 2B87B 1W5CE 4K3AA 3SSUA 3CXHD 3AEEC 1MFZA 1L2PA 3H1JG 3H1LG 4JBZA 2KZJA 4U3FJ 1PP9D 2QJPB 2PP6A 3CXHE 3V2RA 1PP9E 4TLFA 2QJKC 1U7JA 3MIWA 2QA4P 1SQBG 2H8PD 2I1JA 3FWNA 5DJTB 3CCMP 1NTKD 3BRTB 3P8MC 1J1EB 4WY4D 4C46A 1BGYD 2V7QJ 1VF5C 3VMYA 4ZMDA 2IFMA 3L35A 1NTKE 3NMDA 1MV8A 2D2CC 1NH4A 2KB7P 3CCLP 2WSEJ 1BGYE 2CPSA 4JYBA 1Y8AA 2G8YA 3M9HA 1ZRTD 1SQQJ 3CXHH 2KYVA 1RE4C 3E7KA 4WY4B 1PPJD 1FOSF 1ZRTE 3CCQP 1J1DB 2KSJA 2P67A 1BE3D 2FYNC 4WWIA 1PPJE 5CCHC 5AW3B 4O9BA 1L0LD 2KLUA 3BCCD 3CMAP 3TYYA 2W90A 2HG5D 2WVRA 1OW8A 1BE3E 2H89C 2WPSA 3GF7A 3RGUA 2SPZA 1L0LE 3L37A 3BCCE 2W6BA 2ZVOB 1Y9BA 1HTLC 1QEXA 4B86A 2XV5A 2JDIH 1BCCD 1VF5D 3HE4A 2FYUK 1HF9A 1DH3A 2D2CD 2RMZA 1GL2A 5KLVG 1U57A 1BCCE 2XDJA 1KORA 2C0WA 3L70G 5B5EE 1AJYA 5B66E 2NPSC 1NU1G 2UWJE 2Q3IA 2E5TA 1VF5B 1FAVA 2IBZD 4UB8E 4CPGA 3D6ZA 3PHLA 1N7SA 2WZ7A 5CCHD 3L74D 1QX8A 3MHVA 2YNYA 3AE9C 3D71A 2IBZE 3O6QA 5AVUB 1RE3C 2PGDA 2ZVNB 2L5GB 4W7YA 2HR3A 3L74E 2AXCA 2QIWA 4GODA 1LTAC 5APTA 3L75D 1M1KQ 1W2EA 4EI2A 2OYHA 2XNXA 1SQVJ 3L75E 1Q81Q 5B5EH 3QH9A 5B66H 5KLIC 3HUSA 1BDCA 2M5AB 5E79E 1KQFB 3HRNA 2NPSD 4UB8H 2FY8A 1KILC 3S9OA 2BCCD 2KI7B 4TT3H 1YTZT 4BRYB 1LTJC 4JYCA 1JTHA 2BCCE 2OYIA 5AVWB 4OWFA 3H1KJ 2NPSB 3L71J 3TGUD 1LTGC 5CBNA 1JY2P 1NJIQ 3CWBD 4EDFA 2WPQA 2ZXEB 3II6A 1QL1A 2O01J 1HGVA 3RK2B 3K5BA 3CPWO 3CWBE 1VQ5P 2GUSA 4BXLA 2A06G 2WQYC 1N73C 1FBMA 1IFNA 1JY3N 1K73Q 1LWUC 4Y99B 3H1HG 2VRSA 1KILD 1S4XA 5BVZA 2FYUD 1M90Q 3RL0g 2IX7C 1JUNA 1USDA 1IO4A 1URQA 1KILE 2M0BA 2JO1A 5KLIB 3H32B 1KYOI 2O01H 2FYUE 3AEBC 2WTYA 1FZGA 1HGZA 1QGKB 1YJNP 4XE5B 1GDTA 3E1IA 3TDKA 1G1JA 4QMAA 1H8AA 5K5GB 3MD0A 4NPEA 1M7LA 1FZEA 4IL6E 1CZQA 2ZYDA 1GU4A 1LT9C 1L0NG 2P2UA 3B4SA 3GW6A 4PV1C 3GF3A 3HTKA 2IYPA 4OGQC 3KYQA 2B87A 2N1TC 3D70A 1HUCA 2XU6A 1VQMP 3H1IG 1R8EA 3AE8C 1T6AA 1SFCC 5AW4B 1DX7A 4I7ZC 1L4AC 2KNCB 1DEEG 1GW3A 4GIFA 4LLHA 2JWDA 3L72D 1LWUB 2E74B 4ZKPA 3AE1C 3FXEA 1LNQA 4IL6H 4H44C 3G3ZA 3L72E 2P10A 3KXDA 4ZKUA 3VMZA 2H88C 1GK4A 1YQ4C 4R4MA 5AW5B 4DZOA 1IFDA 1R5SA 2KSEA 1X22A 1PP9G 1SQQK 1KFNA 3VTPC 2O3JA 1YYCA 2YMKA 3OAKA 5CJ0A 3BASA 4PV1D 1Q7YQ 1IK9A 4OGQD 4AYCA 1NTZJ 2FYZA 1LT1A 2ZJSE 2N1TD 1Q90D 1LT9B 1NTKG 2A45H 1SFCD 1X79B 1L4AD 1BGYG 2E76B 1YQ3C 1GD2E 4PV1B 4D6TD 3N7NA 4OGQB 2ZFCA 5CBOA 2R5DA 1L0LK 2N1TB 4D6TE 4H44D 2HFED 1OIPA 3V6IA 2FXPA 1FOSE 3RL0B 2M8RA 3SFEC 4DJGA 4I7ZB 2Q7CA 1PPJG 1EDLA 5KJ7A 3I56P 1NWQA 3CCEP 2WITA 1P84I 1KC8Q 3GHGC 1DEBA 1H0TB 1BE3G 2YIUB 3PLNA 3O8ZA 2FFDA 3B71A 1FC2C 3BCCG 1ZR2A 1OVVA 3IAOA 1K9MQ 3KHUA 5CCGA 1OVRA 3L4FA 3WUUA 1JY3P 2YXQB 4U3FD 1NOHA 4XA4A 2E5YA 1BCCG 2IYOA 4H13D 2B9BA 1IC2A 4JF7A 4EOTA 1Q82Q 4U3FE 1IZNB 1PV3A 5APQA 1SQVK 1ZR4A 4HB1A 1QVFO 1M1JB 3CMEP 4KHXA 1RQUA 2I8DA 2K3RA 1NTMD 3E1RA 5AW1B 4H13B 2IBZG 1MUUA 3V2PA 1NTME 1FJKA 3KZIE 3L74G 1MZ9A 4EYYQ 3ITKA 1S1CX 4I1LA 3HE5B 1EZVD 2M5AA 1NTMJ 2P58A 1SQQD 3L75G 3I5CA 4JPZB 1EZVE 2JWAA 1SQQE 3L73G 3IFMA 1RY3A 2K37A 2MKVA 3M06A 5L8RJ 4BRYA 3B8EB 1FZCC 2N9YB 5APUA 2ZYGA 3AE7C 3B5NC 4DCKA 4YPCA 2P1JA 3U1CA 2IPPA 1E79H 3KZIH 2BCCG 1M57D 2V7QH 3EFFK 2HPCB 1VQOP 2WSFJ 1KB9I 2WSEH 3V2NA 1N2DC 3TGUG 3USSA 5AW8B 1JCCA 1T3UA 3CWBG 1NKZB 2K9JB 1NYHA 3MUDA 3JSVC 2QJKB 4PD4D 2K1AA 2BASA 1SQPG 2Q6QA 1NGMB 1HH0A 4PD4E 3B5ND 5AW6B 1RF0A 1PGQA 1QLED 3QWOC 2ZT9C 2FYUG 2WMMA 1ZLLA 2YKPA 3CX5I 2D2CB 2Y9ZA 1FZAA 1SQXJ 1FZCB 1SQVD 3AEDC 2WT7B 5H2FE 3OJAB 1XTCC 1SQVE 2WPRA 4KJMA 1EXIA 2OQQA 2FYNB 4DOJA 3LIEA 1KMIZ 1RF1C 1KV4A 3L36A 3TF5A 1CI6A 2LR2A 3H1JJ 3H1LJ 4PD4H 1AA0A 3AE3C 4DT0A 1YHQP 3H1KD 2KNCA 3CC4P 2O01N 3MP7B 2E42A 3L71D 1JNMA 1LTTC 3H1KE 1KZUB 1GL2C 2KUBA 1OX3A 1LTBC 1SQBJ 3L71E 3G71P 1JM0A 2ZT9D 5H2FH 1ZN5A 1S2EA 4GOFA 4PJ0E 1NTZK 2A45G 2ZXXA 2RH0A 2W83C 4ZNCA 3ZDMA 2BEZF 1NHLA 2H7HA 1VQ9P 3L72G 3FWLA 3L73J 1N7SC 2XZRA 3H25A 1JOCA 2POHA 2JKVA 4JQ0D 1XTGB 5BU8B 3VP8A 3CLQA 1U7MA 1YITP 1G2CA 1DIPA 5E79H 4Y28J 2YXRB 2WPVB 2QJYC 1ZOYC 3LW5J 3Q5PA 1JY2O 1OXZA 1YIJP 1W2BO 2OYHC 3AEGC 3GLMA 3EWKA 1KQLA 4PJ0H 1GU5A 3HUSC 2Q9IA 5AVVB 1GL2D 4OVNF 3T97B 2KXPB 1RF1B 2FKWB 3CX5D 2OARA 1LP1A 4HJGH 1VDFA 3R2PA 3CC7P 3CX5E 3WU2E 1VQ4P 3LW5H 4D6TG 1FZFA 1S5LE 1X0TA 3HD7A 1OVUA 2I1KA 1KILB 1N7SD 2OYIC 1GZLA 1RHZB 3A0HE 1SQPJ 5KLVJ 2QM7A 3TK1A 1LTJB 1Y47A 3V4WA 3MTUE 4C7RA 3IR9A 3L70J 3KPEA 1GW4A 1SP4A 1NU1J 1M8OB 4W80A 3P32A 1N7SB 1ZXGA 2LXCB 5AW7B 2Y0DA 4L73A 3EFGA 2O1KA 1VPCA 3VMAA 5AW9B 2R3CA 1OW6A 3O6QB 1T3JA 4N78D 1IFJA 1FDOA 2IFNA 2RN0A 5AVRB 2DW3A 4IFMA 3G4SP 2QE7H 1M1JA 3CX5H 2QJYB 4N78E 3WU2H 4U3FG 1S5LH 3IN6A 1NTMK 1EDIA 5AVTB 3GG2A 1N73B 2OYOA 1X8YA 3D6YA 2B89A 2WSCJ 3A0HH 2IZ1A 4I6MC 3A3YB 2IZ0A 3JC22 1WMKA 1URQC 2LXBA 3HUSB 2WWWA 2KZIA 1GK6A 1T2KC 1PGOA 4Z1MH 3WMM0 4M3LA 4LGDE 1NTZD 2YKQA 3M0DA 3MGNA 1NVOA 2FBWC 1J2JB 4ASWA 1BSNA 2W6JH 3HE5A 4OH8B 1NTZE 2YKOA 1BDDA 3F89A 4MN4C 3CXHI 1JTHB 1OMIA 2GUVA 5KAFE 2YMYA 1AV1A 1S3JA 3H6PA 3ABVC 2A06D 2NRGA 1AQTA 1AVYA 1EZVG 5KKZC 1RH5B 1SQQG 2M3BA 1KYOD 4WY4A 2A06E 1YJWP 4GDOA 2BEQD 3M9QA 5KAIE 1KN7A 5APXA 1KYOE 1QL2A 3TSIA 1URQD 4YXWH 3RBZA 1T2KD 1N7LA 3A2AA 3M0AA 3AEAC 1SFCB 1UIIA 1L4AB 1N86A 1NO4A 1OZHA 3AE4C 1SS1A 2OTKE 3H1HJ 1EXJA 5KAFH 5DJUB 2K9JA 1ZMEC 2N9BA 1L0LG 2RKLA 4H0LC 3Q3DA 4H44B 4AQRD 2MJZA 1SQXK 1OFCX 3A0BE 3FGAD 1J1EC 1VQ7P 2Z4EA 1NKNA 2OGUA 1USEA 2Z5HA 5KAIH 1KYOH 2JEEA 3Q5SA 1KD1Q 2CPBA 3G9RA 3H1ID 2FXOA 1L0NJ 1EQ7A 3H1IE 1IK7A 3AE2C 1X9VA 1RE4A 1HJBA 4C7NB 3V4QA 3FXDA 1YBKA 3PRJA 3VN0A 1KQSO 3N4XA 2XNDH 3BVHA 1PL5A 2L91A 1S5LX 3H1IJ 2ITAA 5CCHA 3A0BH 1SQVG 5AVSB 3W68A 1SQBK 1CI6B 1MKMA 4H0LD 5KJ7C 1IFMA 3GMAA 2IBZI 1K04A 5AVXB 2FFDC 2OTJP 4IL6X 3PJSK 3PTZA 2Y9YA 2V4HA 2HODB 1JY2N 2QSIA 3Q1MA 3GHGB 1OW7A 5CCGC 2K88A 3V2QA 4H0LB 2PAJA 3U1AA 1PGPA 1M56D 1EDKA 3P8CD 2YO3A 1PP9J 2QG4A 3EQ2A 4IFDK 1HVVA 3H1KG 1ZV8A 4YTPC 3W67A 3P8CE 2R3SA 3L71G 1IJDB 2NPSA 1K8AQ 1VQPP 3CCVP 2H43A 1DD4A 1P84D 3F5HA 1FE6A 1NAYA 4I2LC 1NTKJ 1P84E 5KJ7D 4HKZH 1RE3A 4L75A 1BGYJ 3A7OA 1A02J 2Z5IA 4L76A 3R4YA 3SWYA 3NFQA 1VQNP 5CJ4A 3CCUP 5CCGD 3T97A 1FDIA 1SQPK 2W6AA 4NPDA 5KLVK 1RF1A 1SQXD 2C9NY 4AUWA 4GKGA 2AEMA 1H89A 3CCJP 2KK7A 2WSFH 3H32A 2QM8A 1NU1K 1H88A 1PFIA 2FFDB 1BE3J 1SQXE 2O1JA 2HLOA 1QVGO 1T8ZA 2KS1B 3OW2O 1VQ8P 1L0LJ 1G1IA 2C0XA 2J58A 1EC5A 3BCCJ 5AVQB 1KILA 4RJTA 2LKMA 4HYTB 1P84H 1Q2NA 2W27A 1LTJA 5M1BA 2Q1KA 3TNUB 1LTSC 3H1JD 3H1LD 1YTZI 1LGHB 3B5NB 1Q86Q 2QRXA 3SWFA 1BCCJ 2C9LY 3C8VA 5GTIE 3H1JE 3H1LE 3CCRP 2QVAA 1Z56A 3RK2C 3V5BA 1SQBD 1PZQA 1S72P 1JB0J 1GTWA 5APSA 3MZWB 3PP5A 1SQBE 3Q2YA 4Y99C 2K9YA 1N73A 3MUDC 3SWKA 3NXSA 4GT1A 3L73D 3WUTA 2ZYAA 3AECC 3L74J 4XFJA 1LWUA 4RESB 4EIJA 1JMBA 3L73E 5EFWB 3I55P 5AW2B 3C1LA 1A02F 1RF0C 1EDJA 3L75J 1KB9D 5GTIH 5GTHE 3BRVB 4RO0A 2M3EA 1IFIA 1KB9E 2A45I 1VQ6P 2ZT9B 1NAFA 1NTZG 1VQKP 2G3AA 3RK2D 1R5LA 2AXTE 3IF4A 4R4LA 4U7JA 1DD3A 2R32A 4WB4A 1YJ9P 1LT9A 1HJ0A 5KTBA 2BCCJ 3RBXA 3TGUE 2AEJA 2AEFA 1SVFA 2WSSH 3AE6C 1JEKA 2IDBA 1WRGA 2Y0CA 2CK3H 1SQPD 5KLVD 1LTIC 2N1TA 3PH0A 5AW0B 1YI2P 3M9BA 5APVA 5GTHH 1JCDA 3TGUJ 3L70D 2E75C 4L74A 4IFFA 1NU1D 1SFCA 1SQPE 5KLVE 1L4AA 1KQGB 2E74C 1KB9H 3CWBJ 3L70E 2PRRA 4ASVA 3VP9A 3HE4B 1H0TA 1D7MA 1NU1E 2AXTH 5TJHA 1GL2B 1VL2A 2R44A 5APYA 1L0NK 3U59A 3SFDC 2OTLP 2JR8A 3P7KA 4GOEA 1HWTC 3G6EP 2FYUJ 5AVZB 1N8RQ 1IFPA 3CL3D 3VOPA 4A7PA 4K35A 1CW5A 4LC1A 1AFOA 1FDMA 1K05A 2E76C 1FZBA 2Y0EA 2E75D 5APWA 1ZW0A 2R5BA 2QEXP 4C7NA 4WBAA 2E74D 2OYHB 3CC2P 2W8ZA 1VQLP 4BWNA 1BSHA 3RK3C
chains in the Genus database with same CATH topology
5AVWB 3RL0C 2JEEA 3VYIA 2NPSB 5AW8B 1JCCA 2CPBA 1T3UA 1NKZB 3MUDA 3HD7C 1JMMA 1LTGC 1EQ7A 1JY2P 2JJLA 3KQGA 2WPQA 2ZXEB 1JO5A 2BASA 3II6A 1QL1A 1X9VA 2HODA 4W7ZA 1HH0A 1HGVA 1RE4A 3GHGA 3RK2B 1HJBA 4C7NB 3V4QA 2GUSA 2KOGA 5AVYB 3M91A 3B5ND 3KDPB 3VN0A 5AW6B 3CI9A 2OYIB 1RF0A 2WSCH 3N4XA 1N73C 1FBMA 3BVHA 1IFNA 1JY3N 5CCHA 5AVSB 1SQBK 1NTKK 1LWUC 5KJ7C 1ZLLA 1S9KD 2YKPA 4Y99B 1IFMA 2GM4A 2KP8A 1FZAA 2VRSA 2J59M 1KILD 1FZCB 1WT6A 5BVZA 2WT7B 1FJPA 4N6JA 5AVXB 2FFDC 1S9KE 2IX7C 1JUNA 2KLVA 3UIAA 1IO4A 1URQA 1XTCC 3OJAB 1G2CB 2HODB 1JY2N 3H32B 3VMXA 2O01H 3GHGB 5CMZA 1M1JC 1FU1A 4N3YB 3RK3D 2WPRA 2WTYA 1FZGA 5CCGC 3RL0D 1HGZA 2HPCA 3V2QA 2PAJA 2E43A 3U1AA 4XE5B 1GDTA 4HH2A 1OWAA 3P8CD 4DOJA 2YO3A 2Q5UA 3EQ2A 3LIEA 3E1IA 1RF1C 4IFDK 1CSBA 1G1JA 1HVVA 3L36A 1CI6A 3HD7D 1ZV8A 1H8AA 3MD0A 1M7LA 1FZEA 3P8CE 1IJDB 1CZQA 2NPSA 5BU5A 3RK3B 1GU4A 3M0DC 1LT9C 2H43A 1URQB 2E42A 1AQ5A 2P2UA 2FXMA 1JNMA 3C9IA 1LTTC 2P7JA 2XKMA 1KZUB 2YO2A 1GL2C 4I2LC 3HTKA 1LTBC 3HD7B 1ZN5A 3KYQA 3LIDA 5KJ7D 1NTZK 1RE3A 2A45G 2N1TC 5CHXA 1HUCA 3A7OA 2XU6A 1KFMA 3BATA 1A02J 1HBWA 1NHLA 2Z5IA 3OA7A 5AW4B 1SFCC 2H7HA 3SWYA 1DX7A 1L4AC 3NFQA 1E5WA 1N7SC 2XZRA 2HYNA 1GW3A 4GIFA 4LLHA 1JOCA 5CJ4A 1FZCA 3NTNA 1JY3O 4WY4C 2POHA 3A5TA 5CCGD 3TNUA 3T97A 2WT7A 2C9NY 1SQPK 2W6AA 1LWUB 5KLVK 1RF1A 4AUWA 1XTGB 4GKGA 5BU8B 1J1DC 3HTKB 3VP8A 4ZKPA 1H89A 3B5NA 3CLQA 1G2CA 2WSFH 3G3ZA 3H32A 2QM8A 1SLQA 1NU1K 1H88A 1PFIA 4ZKUA 2FFDB 3VMZA 2O1JA 1GK4A 2HLOA 1T8ZA 5AW5B 4DZOA 1IFDA 1JY2O 1G1IA 2C0XA 2J58A 1OXZA 5AVQB 1KILA 1MFZA 1SQQK 2OYHC 1KFNA 2LKMA 4HYTB 3VTPC 2W27A 1YYCA 3OAKA 1KQLA 1GU5A 1LTJA 2PP6A 5CJ0A 3BASA 3HUSC 2Q9IA 5AVVB 1GL2D 3TNUB 1LTSC 1RF1B 2FKWB 1IK9A 1YTZI 3V2RA 2OARA 4AYCA 1LGHB 3B5NB 2FYZA 3SWFA 2C9LY 1VDFA 3R2PA 2N1TD 3MIWA 3RK3C 1LT9B 2H8PD 3LW5H 2I1JA 1FZFA 1Z56A 2A45H 1SFCD 1X79B 3HD7A 3RK2C 1L4AD 2I1KA 3V5BA 1KILB 1N7SD 2OYIC 3BRTB 1GD2E 1GZLA 3P8MC 1J1EB 4WY4D 3N7NA 1GTWA 4C46A 2QM7A 5APSA 3TK1A 1LTJB 3V4WA 2ZFCA 3MTUE 3VMYA 4C7RA 2IFMA 3L35A 3PP5A 3IR9A 3NMDA 2R5DA 1L0LK 2N1TB 1MV8A 3KPEA 1GW4A 1SP4A 1NH4A 2KB7P 4Y99C 2HFED 1N73A 1FOSE 3RL0B 2M8RA 3NXSA 4GT1A 4W80A 2CPSA 4JYBA 2Q7CA 3M9HA 1LWUA 5KJ7A 3P32A 4RESB 4EIJA 1N7SB 1NWQA 5AW7B 2WITA 3EFGA 2O1KA 1VPCA 2KYVA 1RE4C 1DEBA 3GHGC 4WY4B 5AW9B 2R3CA 1FOSF 5AW2B 1T3JA 3O8ZA 4N78D 1IFJA 2FFDA 1J1DB 2IFNA 2KSJA 1RF0C 1A02F 5AVRB 1ZR2A 2P67A 4IFMA 3BRVB 5CCHC 1M1JA 5AW3B 4N78E 4O9BA 5CCGA 3TYYA 1IFIA 2HG5D 1NTMK 5AVTB 1N73B 3L4FA 2WPSA 1X8YA 2A45I 1JY3P 3L37A 1NOHA 4XA4A 1NAFA 4I6MC 3A3YB 2W6BA 3RK2D 1HTLC 1URQC 1IC2A 3HUSB 4JF7A 2WWWA 4EOTA 1GK6A 2R32A 1T2KC 3WMM0 4M3LA 4LGDE 4B86A 4WB4A 2XV5A 2YKQA 3M0DA 1LT9A 3MGNA 5KTBA 1J2JB 5APQA 1SQVK 1ZR4A 3HE4A 3HE5A 2FYUK 1M1JB 4OH8B 1DH3A 4KHXA 1SVFA 1GL2A 2YKOA 2XDJA 2C0WA 5AW1B 1JTHB 1WRGA 2NPSC 2GUVA 1LTIC 1MUUA 2N1TA 5AW0B 3V2PA 2YMYA 2Q3IA 3M9BA 5APVA 1FJKA 1JCDA 3H6PA 1FAVA 4IFFA 1MZ9A 1SFCA 1L4AA 2M3BA 1N7SA 2WZ7A 5CCHD 3VP9A 4I1LA 3HE5B 3HE4B 4WY4A 2YNYA 5AVUB 1RE3C 1GL2B 3I5CA 3M9QA 2L5GB 4W7YA 5APXA 1QL2A 3TSIA 1LTAC 5APYA 5APTA 1L0NK 3IFMA 1URQD 1RY3A 3M06A 3U59A 1T2KD 1N7LA 3A2AA 3M0AA 3B8EB 1W2EA 1FZCC 3P7KA 1SFCB 2OYHA 2XNXA 1L4AB 1HWTC 5APUA 1N86A 5AVZB 1NO4A 3B5NC 3CL3D 3VOPA 2P1JA 3HUSA 3U1CA 1CW5A 4LC1A 3HRNA 2IPPA 1AFOA 2N9BA 1FDMA 2NPSD 4AQRD 2MJZA 1KILC 1SQXK 1FZBA 2HPCB 1J1EC 5APWA 2Z4EA 2R5BA 1YTZT 1NKNA 1LTJC 4JYCA 2WSEH 2Z5HA 4C7NA 4WBAA 1N2DC 3V2NA 1JTHA 2OYHB 2OYIA 1CI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 C;  2HPC A;  1RF0 C;  1FZF A;  1FZA A;  2H43 A;  2A45 H;  3H32 B;  1N73 A;  2HOD A;  2OYI A;  1FZC B;  1LTJ A;  1W2E A;  1FZC C;  1RE4 A;  3GHG A;  3H32 A;  3HUS B;  3HUS C;  2Q9I A;  1M1J A;  2OYH A;  2XNX A;  1RE3 C;  2FFD B;  3E1I A;  2FFD C;  1RF1 B;  1RF1 C;  1LWU A;  1FZB A;  1T3U A;  2HLO A;  2OYI C;  2OYI B;  1N86 A;  2HPC B;  1LT9 A;  1RF0 A;  2Z4E A;  1N73 C;  1N73 B;  1JY2 O;  3BVH A;  1LTJ C;  1JY2 N;  2HOD B;  1LTJ B;  1RE4 C;  1FZE A;  1JY3 O;  3GHG C;  3GHG B;  1JY2 P;  1JY3 N;  1JY3 P;  1M1J C;  2A45 I;  3HUS A;  1M1J B;  1FZC A;  2OYH C;  2OYH B;  1RE3 A;  2A45 G;  1LWU B;  1RF1 A;  2FFD A;  1LWU C;  1FZG A;  1LT9 B; 
#chains in the Genus database with same CATH topology
 3RL0 C;  5TIS E;  3VYI A;  3AE5 C;  3S4R A;  1PGJ A;  2E75 B;  3HD7 C;  1JMM A;  1NTM G;  2JJL A;  3KQG A;  2YIU C;  1JO5 A;  4RKU J;  1MFT A;  2HOD A;  4W7Z A;  3GHG A;  2KOG A;  5AVY B;  3M91 A;  3KDP B;  2OYI B;  3CI9 A;  3CD6 P;  4NPF X;  3CCS P;  2WSC H;  2KIK A;  1GMJ A;  1NTK K;  3WUV A;  1S9K D;  3L72 J;  2GM4 A;  2KP8 A;  2E76 D;  2J59 M;  4WVZ A;  4UB6 E;  1WT6 A;  2J5U A;  1FJP A;  4N6J A;  1S9K E;  3H1H D;  1LJ2 A;  5TIS H;  2KLV A;  3UIA A;  1G2C B;  3VMX A;  5CMZ A;  1EZV I;  1M1J C;  1FU1 A;  4N3Y B;  3RK3 D;  3H1H E;  3RL0 D;  2HPC A;  5C39 A;  2E43 A;  1PIX A;  2QJP C;  4HH2 A;  3RK3 E;  1OWA A;  4H13 C;  3Q5R A;  2Q5U A;  1CSB A;  2NZ2 A;  3JCU E;  3HD7 D;  1AVO A;  2Q3E A;  1KTM A;  3S1K A;  5BU5 A;  3RK3 B;  3M0D C;  1LP1 B;  4IOI H;  1URQ B;  1AQ5 A;  2FXM A;  1TU3 F;  3C9I A;  3FX0 A;  2P7J A;  2XKM A;  2YO2 A;  1L0N D;  4UB6 H;  4YXD C;  3HD7 B;  4D6T J;  1FS0 E;  3LID A;  2JP3 A;  2B88 A;  1L0N E;  5CHX A;  2KS1 A;  2ZAE B;  1UIX A;  1KFM A;  3BAT A;  1HBW A;  3OA7 A;  3AEF C;  1SQX G;  1E5W A;  2HYN A;  1FZC A;  3NTN A;  1JY3 O;  4WY4 C;  3A5T A;  1ZP0 C;  3JCU H;  3TNU A;  2WT7 A;  4KT0 J;  5KKZ B;  1RQV A;  1J1D C;  3HTK B;  3B5N A;  2GA1 A;  1SLQ A;  4PD4 I;  2PFX A;  2B87 B;  1W5C E;  4K3A A;  3SSU A;  3CXH D;  3AEE C;  1MFZ A;  1L2P A;  3H1J G;  3H1L G;  4JBZ A;  2KZJ A;  4U3F J;  1PP9 D;  2QJP B;  2PP6 A;  3CXH E;  3V2R A;  1PP9 E;  4TLF A;  2QJK C;  1U7J A;  3MIW A;  2QA4 P;  1SQB G;  2H8P D;  2I1J A;  3FWN A;  5DJT B;  3CCM P;  1NTK D;  3BRT B;  3P8M C;  1J1E B;  4WY4 D;  4C46 A;  1BGY D;  2V7Q J;  1VF5 C;  3VMY A;  4ZMD A;  2IFM A;  3L35 A;  1NTK E;  3NMD A;  1MV8 A;  2D2C C;  1NH4 A;  2KB7 P;  3CCL P;  2WSE J;  1BGY E;  2CPS A;  4JYB A;  1Y8A A;  2G8Y A;  3M9H A;  1ZRT D;  1SQQ J;  3CXH H;  2KYV A;  1RE4 C;  3E7K A;  4WY4 B;  1PPJ D;  1FOS F;  1ZRT E;  3CCQ P;  1J1D B;  2KSJ A;  2P67 A;  1BE3 D;  2FYN C;  4WWI A;  1PPJ E;  5CCH C;  5AW3 B;  4O9B A;  1L0L D;  2KLU A;  3BCC D;  3CMA P;  3TYY A;  2W90 A;  2HG5 D;  2WVR A;  1OW8 A;  1BE3 E;  2H89 C;  2WPS A;  3GF7 A;  3RGU A;  2SPZ A;  1L0L E;  3L37 A;  3BCC E;  2W6B A;  2ZVO B;  1Y9B A;  1HTL C;  1QEX A;  4B86 A;  2XV5 A;  2JDI H;  1BCC D;  1VF5 D;  3HE4 A;  2FYU K;  1HF9 A;  1DH3 A;  2D2C D;  2RMZ A;  1GL2 A;  5KLV G;  1U57 A;  1BCC E;  2XDJ A;  1KOR A;  2C0W A;  3L70 G;  5B5E E;  1AJY A;  5B66 E;  2NPS C;  1NU1 G;  2UWJ E;  2Q3I A;  2E5T A;  1VF5 B;  1FAV A;  2IBZ D;  4UB8 E;  4CPG A;  3D6Z A;  3PHL A;  1N7S A;  2WZ7 A;  5CCH D;  3L74 D;  1QX8 A;  3MHV A;  2YNY A;  3AE9 C;  3D71 A;  2IBZ E;  3O6Q A;  5AVU B;  1RE3 C;  2PGD A;  2ZVN B;  2L5G B;  4W7Y A;  2HR3 A;  3L74 E;  2AXC A;  2QIW A;  4GOD A;  1LTA C;  5APT A;  3L75 D;  1M1K Q;  1W2E A;  4EI2 A;  2OYH A;  2XNX A;  1SQV J;  3L75 E;  1Q81 Q;  5B5E H;  3QH9 A;  5B66 H;  5KLI C;  3HUS A;  1BDC A;  2M5A B;  5E79 E;  1KQF B;  3HRN A;  2NPS D;  4UB8 H;  2FY8 A;  1KIL C;  3S9O A;  2BCC D;  2KI7 B;  4TT3 H;  1YTZ T;  4BRY B;  1LTJ C;  4JYC A;  1JTH A;  2BCC E;  2OYI A;  5AVW B;  4OWF A;  3H1K J;  2NPS B;  3L71 J;  3TGU D;  1LTG C;  5CBN A;  1JY2 P;  1NJI Q;  3CWB D;  4EDF A;  2WPQ A;  2ZXE B;  3II6 A;  1QL1 A;  2O01 J;  1HGV A;  3RK2 B;  3K5B A;  3CPW O;  3CWB E;  1VQ5 P;  2GUS A;  4BXL A;  2A06 G;  2WQY C;  1N73 C;  1FBM A;  1IFN A;  1JY3 N;  1K73 Q;  1LWU C;  4Y99 B;  3H1H G;  2VRS A;  1KIL D;  1S4X A;  5BVZ A;  2FYU D;  1M90 Q;  3RL0 g;  2IX7 C;  1JUN A;  1USD A;  1IO4 A;  1URQ A;  1KIL E;  2M0B A;  2JO1 A;  5KLI B;  3H32 B;  1KYO I;  2O01 H;  2FYU E;  3AEB C;  2WTY A;  1FZG A;  1HGZ A;  1QGK B;  1YJN P;  4XE5 B;  1GDT A;  3E1I A;  3TDK A;  1G1J A;  4QMA A;  1H8A A;  5K5G B;  3MD0 A;  4NPE A;  1M7L A;  1FZE A;  4IL6 E;  1CZQ A;  2ZYD A;  1GU4 A;  1LT9 C;  1L0N G;  2P2U A;  3B4S A;  3GW6 A;  4PV1 C;  3GF3 A;  3HTK A;  2IYP A;  4OGQ C;  3KYQ A;  2B87 A;  2N1T C;  3D70 A;  1HUC A;  2XU6 A;  1VQM P;  3H1I G;  1R8E A;  3AE8 C;  1T6A A;  1SFC C;  5AW4 B;  1DX7 A;  4I7Z C;  1L4A C;  2KNC B;  1DEE G;  1GW3 A;  4GIF A;  4LLH A;  2JWD A;  3L72 D;  1LWU B;  2E74 B;  4ZKP A;  3AE1 C;  3FXE A;  1LNQ A;  4IL6 H;  4H44 C;  3G3Z A;  3L72 E;  2P10 A;  3KXD A;  4ZKU A;  3VMZ A;  2H88 C;  1GK4 A;  1YQ4 C;  4R4M A;  5AW5 B;  4DZO A;  1IFD A;  1R5S A;  2KSE A;  1X22 A;  1PP9 G;  1SQQ K;  1KFN A;  3VTP C;  2O3J A;  1YYC A;  2YMK A;  3OAK A;  5CJ0 A;  3BAS A;  4PV1 D;  1Q7Y Q;  1IK9 A;  4OGQ D;  4AYC A;  1NTZ J;  2FYZ A;  1LT1 A;  2ZJS E;  2N1T D;  1Q90 D;  1LT9 B;  1NTK G;  2A45 H;  1SFC D;  1X79 B;  1L4A D;  1BGY G;  2E76 B;  1YQ3 C;  1GD2 E;  4PV1 B;  4D6T D;  3N7N A;  4OGQ B;  2ZFC A;  5CBO A;  2R5D A;  1L0L K;  2N1T B;  4D6T E;  4H44 D;  2HFE D;  1OIP A;  3V6I A;  2FXP A;  1FOS E;  3RL0 B;  2M8R A;  3SFE C;  4DJG A;  4I7Z B;  2Q7C A;  1PPJ G;  1EDL A;  5KJ7 A;  3I56 P;  1NWQ A;  3CCE P;  2WIT A;  1P84 I;  1KC8 Q;  3GHG C;  1DEB A;  1H0T B;  1BE3 G;  2YIU B;  3PLN A;  3O8Z A;  2FFD A;  3B71 A;  1FC2 C;  3BCC G;  1ZR2 A;  1OVV A;  3IAO A;  1K9M Q;  3KHU A;  5CCG A;  1OVR A;  3L4F A;  3WUU A;  1JY3 P;  2YXQ B;  4U3F D;  1NOH A;  4XA4 A;  2E5Y A;  1BCC G;  2IYO A;  4H13 D;  2B9B A;  1IC2 A;  4JF7 A;  4EOT A;  1Q82 Q;  4U3F E;  1IZN B;  1PV3 A;  5APQ A;  1SQV K;  1ZR4 A;  4HB1 A;  1QVF O;  1M1J B;  3CME P;  4KHX A;  1RQU A;  2I8D A;  2K3R A;  1NTM D;  3E1R A;  5AW1 B;  4H13 B;  2IBZ G;  1MUU A;  3V2P A;  1NTM E;  1FJK A;  3KZI E;  3L74 G;  1MZ9 A;  4EYY Q;  3ITK A;  1S1C X;  4I1L A;  3HE5 B;  1EZV D;  2M5A A;  1NTM J;  2P58 A;  1SQQ D;  3L75 G;  3I5C A;  4JPZ B;  1EZV E;  2JWA A;  1SQQ E;  3L73 G;  3IFM A;  1RY3 A;  2K37 A;  2MKV A;  3M06 A;  5L8R J;  4BRY A;  3B8E B;  1FZC C;  2N9Y B;  5APU A;  2ZYG A;  3AE7 C;  3B5N C;  4DCK A;  4YPC A;  2P1J A;  3U1C A;  2IPP A;  1E79 H;  3KZI H;  2BCC G;  1M57 D;  2V7Q H;  3EFF K;  2HPC B;  1VQO P;  2WSF J;  1KB9 I;  2WSE H;  3V2N A;  1N2D C;  3TGU G;  3USS A;  5AW8 B;  1JCC A;  1T3U A;  3CWB G;  1NKZ B;  2K9J B;  1NYH A;  3MUD A;  3JSV C;  2QJK B;  4PD4 D;  2K1A A;  2BAS A;  1SQP G;  2Q6Q A;  1NGM B;  1HH0 A;  4PD4 E;  3B5N D;  5AW6 B;  1RF0 A;  1PGQ A;  1QLE D;  3QWO C;  2ZT9 C;  2FYU G;  2WMM A;  1ZLL A;  2YKP A;  3CX5 I;  2D2C B;  2Y9Z A;  1FZA A;  1SQX J;  1FZC B;  1SQV D;  3AED C;  2WT7 B;  5H2F E;  3OJA B;  1XTC C;  1SQV E;  2WPR A;  4KJM A;  1EXI A;  2OQQ A;  2FYN B;  4DOJ A;  3LIE A;  1KMI Z;  1RF1 C;  1KV4 A;  3L36 A;  3TF5 A;  1CI6 A;  2LR2 A;  3H1J J;  3H1L J;  4PD4 H;  1AA0 A;  3AE3 C;  4DT0 A;  1YHQ P;  3H1K D;  2KNC A;  3CC4 P;  2O01 N;  3MP7 B;  2E42 A;  3L71 D;  1JNM A;  1LTT C;  3H1K E;  1KZU B;  1GL2 C;  2KUB A;  1OX3 A;  1LTB C;  1SQB J;  3L71 E;  3G71 P;  1JM0 A;  2ZT9 D;  5H2F H;  1ZN5 A;  1S2E A;  4GOF A;  4PJ0 E;  1NTZ K;  2A45 G;  2ZXX A;  2RH0 A;  2W83 C;  4ZNC A;  3ZDM A;  2BEZ F;  1NHL A;  2H7H A;  1VQ9 P;  3L72 G;  3FWL A;  3L73 J;  1N7S C;  2XZR A;  3H25 A;  1JOC A;  2POH A;  2JKV A;  4JQ0 D;  1XTG B;  5BU8 B;  3VP8 A;  3CLQ A;  1U7M A;  1YIT P;  1G2C A;  1DIP A;  5E79 H;  4Y28 J;  2YXR B;  2WPV B;  2QJY C;  1ZOY C;  3LW5 J;  3Q5P A;  1JY2 O;  1OXZ A;  1YIJ P;  1W2B O;  2OYH C;  3AEG C;  3GLM A;  3EWK A;  1KQL A;  4PJ0 H;  1GU5 A;  3HUS C;  2Q9I A;  5AVV B;  1GL2 D;  4OVN F;  3T97 B;  2KXP B;  1RF1 B;  2FKW B;  3CX5 D;  2OAR A;  1LP1 A;  4HJG H;  1VDF A;  3R2P A;  3CC7 P;  3CX5 E;  3WU2 E;  1VQ4 P;  3LW5 H;  4D6T G;  1FZF A;  1S5L E;  1X0T A;  3HD7 A;  1OVU A;  2I1K A;  1KIL B;  1N7S D;  2OYI C;  1GZL A;  1RHZ B;  3A0H E;  1SQP J;  5KLV J;  2QM7 A;  3TK1 A;  1LTJ B;  1Y47 A;  3V4W A;  3MTU E;  4C7R A;  3IR9 A;  3L70 J;  3KPE A;  1GW4 A;  1SP4 A;  1NU1 J;  1M8O B;  4W80 A;  3P32 A;  1N7S B;  1ZXG A;  2LXC B;  5AW7 B;  2Y0D A;  4L73 A;  3EFG A;  2O1K A;  1VPC A;  3VMA A;  5AW9 B;  2R3C A;  1OW6 A;  3O6Q B;  1T3J A;  4N78 D;  1IFJ A;  1FDO A;  2IFN A;  2RN0 A;  5AVR B;  2DW3 A;  4IFM A;  3G4S P;  2QE7 H;  1M1J A;  3CX5 H;  2QJY B;  4N78 E;  3WU2 H;  4U3F G;  1S5L H;  3IN6 A;  1NTM K;  1EDI A;  5AVT B;  3GG2 A;  1N73 B;  2OYO A;  1X8Y A;  3D6Y A;  2B89 A;  2WSC J;  3A0H H;  2IZ1 A;  4I6M C;  3A3Y B;  2IZ0 A;  3JC2 2;  1WMK A;  1URQ C;  2LXB A;  3HUS B;  2WWW A;  2KZI A;  1GK6 A;  1T2K C;  1PGO A;  4Z1M H;  3WMM 0;  4M3L A;  4LGD E;  1NTZ D;  2YKQ A;  3M0D A;  3MGN A;  1NVO A;  2FBW C;  1J2J B;  4ASW A;  1BSN A;  2W6J H;  3HE5 A;  4OH8 B;  1NTZ E;  2YKO A;  1BDD A;  3F89 A;  4MN4 C;  3CXH I;  1JTH B;  1OMI A;  2GUV A;  5KAF E;  2YMY A;  1AV1 A;  1S3J A;  3H6P A;  3ABV C;  2A06 D;  2NRG A;  1AQT A;  1AVY A;  1EZV G;  5KKZ C;  1RH5 B;  1SQQ G;  2M3B A;  1KYO D;  4WY4 A;  2A06 E;  1YJW P;  4GDO A;  2BEQ D;  3M9Q A;  5KAI E;  1KN7 A;  5APX A;  1KYO E;  1QL2 A;  3TSI A;  1URQ D;  4YXW H;  3RBZ A;  1T2K D;  1N7L A;  3A2A A;  3M0A A;  3AEA C;  1SFC B;  1UII A;  1L4A B;  1N86 A;  1NO4 A;  1OZH A;  3AE4 C;  1SS1 A;  2OTK E;  3H1H J;  1EXJ A;  5KAF H;  5DJU B;  2K9J A;  1ZME C;  2N9B A;  1L0L G;  2RKL A;  4H0L C;  3Q3D A;  4H44 B;  4AQR D;  2MJZ A;  1SQX K;  1OFC X;  3A0B E;  3FGA D;  1J1E C;  1VQ7 P;  2Z4E A;  1NKN A;  2OGU A;  1USE A;  2Z5H A;  5KAI H;  1KYO H;  2JEE A;  3Q5S A;  1KD1 Q;  2CPB A;  3G9R A;  3H1I D;  2FXO A;  1L0N J;  1EQ7 A;  3H1I E;  1IK7 A;  3AE2 C;  1X9V A;  1RE4 A;  1HJB A;  4C7N B;  3V4Q A;  3FXD A;  1YBK A;  3PRJ A;  3VN0 A;  1KQS O;  3N4X A;  2XND H;  3BVH A;  1PL5 A;  2L91 A;  1S5L X;  3H1I J;  2ITA A;  5CCH A;  3A0B H;  1SQV G;  5AVS B;  3W68 A;  1SQB K;  1CI6 B;  1MKM A;  4H0L D;  5KJ7 C;  1IFM A;  3GMA A;  2IBZ I;  1K04 A;  5AVX B;  2FFD C;  2OTJ P;  4IL6 X;  3PJS K;  3PTZ A;  2Y9Y A;  2V4H A;  2HOD B;  1JY2 N;  2QSI A;  3Q1M A;  3GHG B;  1OW7 A;  5CCG C;  2K88 A;  3V2Q A;  4H0L B;  2PAJ A;  3U1A A;  1PGP A;  1M56 D;  1EDK A;  3P8C D;  2YO3 A;  1PP9 J;  2QG4 A;  3EQ2 A;  4IFD K;  1HVV A;  3H1K G;  1ZV8 A;  4YTP C;  3W67 A;  3P8C E;  2R3S A;  3L71 G;  1IJD B;  2NPS A;  1K8A Q;  1VQP P;  3CCV P;  2H43 A;  1DD4 A;  1P84 D;  3F5H A;  1FE6 A;  1NAY A;  4I2L C;  1NTK J;  1P84 E;  5KJ7 D;  4HKZ H;  1RE3 A;  4L75 A;  1BGY J;  3A7O A;  1A02 J;  2Z5I A;  4L76 A;  3R4Y A;  3SWY A;  3NFQ A;  1VQN P;  5CJ4 A;  3CCU P;  5CCG D;  3T97 A;  1FDI A;  1SQP K;  2W6A A;  4NPD A;  5KLV K;  1RF1 A;  1SQX D;  2C9N Y;  4AUW A;  4GKG A;  2AEM A;  1H89 A;  3CCJ P;  2KK7 A;  2WSF H;  3H32 A;  2QM8 A;  1NU1 K;  1H88 A;  1PFI A;  2FFD B;  1BE3 J;  1SQX E;  2O1J A;  2HLO A;  1QVG O;  1T8Z A;  2KS1 B;  3OW2 O;  1VQ8 P;  1L0L J;  1G1I A;  2C0X A;  2J58 A;  1EC5 A;  3BCC J;  5AVQ B;  1KIL A;  4RJT A;  2LKM A;  4HYT B;  1P84 H;  1Q2N A;  2W27 A;  1LTJ A;  5M1B A;  2Q1K A;  3TNU B;  1LTS C;  3H1J D;  3H1L D;  1YTZ I;  1LGH B;  3B5N B;  1Q86 Q;  2QRX A;  3SWF A;  1BCC J;  2C9L Y;  3C8V A;  5GTI E;  3H1J E;  3H1L E;  3CCR P;  2QVA A;  1Z56 A;  3RK2 C;  3V5B A;  1SQB D;  1PZQ A;  1S72 P;  1JB0 J;  1GTW A;  5APS A;  3MZW B;  3PP5 A;  1SQB E;  3Q2Y A;  4Y99 C;  2K9Y A;  1N73 A;  3MUD C;  3SWK A;  3NXS A;  4GT1 A;  3L73 D;  3WUT A;  2ZYA A;  3AEC C;  3L74 J;  4XFJ A;  1LWU A;  4RES B;  4EIJ A;  1JMB A;  3L73 E;  5EFW B;  3I55 P;  5AW2 B;  3C1L A;  1A02 F;  1RF0 C;  1EDJ A;  3L75 J;  1KB9 D;  5GTI H;  5GTH E;  3BRV B;  4RO0 A;  2M3E A;  1IFI A;  1KB9 E;  2A45 I;  1VQ6 P;  2ZT9 B;  1NAF A;  1NTZ G;  1VQK P;  2G3A A;  3RK2 D;  1R5L A;  2AXT E;  3IF4 A;  4R4L A;  4U7J A;  1DD3 A;  2R32 A;  4WB4 A;  1YJ9 P;  1LT9 A;  1HJ0 A;  5KTB A;  2BCC J;  3RBX A;  3TGU E;  2AEJ A;  2AEF A;  1SVF A;  2WSS H;  3AE6 C;  1JEK A;  2IDB A;  1WRG A;  2Y0C A;  2CK3 H;  1SQP D;  5KLV D;  1LTI C;  2N1T A;  3PH0 A;  5AW0 B;  1YI2 P;  3M9B A;  5APV A;  5GTH H;  1JCD A;  3TGU J;  3L70 D;  2E75 C;  4L74 A;  4IFF A;  1NU1 D;  1SFC A;  1SQP E;  5KLV E;  1L4A A;  1KQG B;  2E74 C;  1KB9 H;  3CWB J;  3L70 E;  2PRR A;  4ASV A;  3VP9 A;  3HE4 B;  1H0T A;  1D7M A;  1NU1 E;  2AXT H;  5TJH A;  1GL2 B;  1VL2 A;  2R44 A;  5APY A;  1L0N K;  3U59 A;  3SFD C;  2OTL P;  2JR8 A;  3P7K A;  4GOE A;  1HWT C;  3G6E P;  2FYU J;  5AVZ B;  1N8R Q;  1IFP A;  3CL3 D;  3VOP A;  4A7P A;  4K35 A;  1CW5 A;  4LC1 A;  1AFO A;  1FDM A;  1K05 A;  2E76 C;  1FZB A;  2Y0E A;  2E75 D;  5APW A;  1ZW0 A;  2R5B A;  2QEX P;  4C7N A;  4WBA A;  2E74 D;  2OYH B;  3CC2 P;  2W8Z A;  1VQL P;  4BWN A;  1BSH A;  3RK3 C; 
#chains in the Genus database with same CATH homology
 5AVW B;  3RL0 C;  2JEE A;  3VYI A;  2NPS B;  5AW8 B;  1JCC A;  2CPB A;  1T3U A;  1NKZ B;  3MUD A;  3HD7 C;  1JMM A;  1LTG C;  1EQ7 A;  1JY2 P;  2JJL A;  3KQG A;  2WPQ A;  2ZXE B;  1JO5 A;  2BAS A;  3II6 A;  1QL1 A;  1X9V A;  2HOD A;  4W7Z A;  1HH0 A;  1HGV A;  1RE4 A;  3GHG A;  3RK2 B;  1HJB A;  4C7N B;  3V4Q A;  2GUS A;  2KOG A;  5AVY B;  3M91 A;  3B5N D;  3KDP B;  3VN0 A;  5AW6 B;  3CI9 A;  2OYI B;  1RF0 A;  2WSC H;  3N4X A;  1N73 C;  1FBM A;  3BVH A;  1IFN A;  1JY3 N;  5CCH A;  5AVS B;  1SQB K;  1NTK K;  1LWU C;  5KJ7 C;  1ZLL A;  1S9K D;  2YKP A;  4Y99 B;  1IFM A;  2GM4 A;  2KP8 A;  1FZA A;  2VRS A;  2J59 M;  1KIL D;  1FZC B;  1WT6 A;  5BVZ A;  2WT7 B;  1FJP A;  4N6J A;  5AVX B;  2FFD C;  1S9K E;  2IX7 C;  1JUN A;  2KLV A;  3UIA A;  1IO4 A;  1URQ A;  1XTC C;  3OJA B;  1G2C B;  2HOD B;  1JY2 N;  3H32 B;  3VMX A;  2O01 H;  3GHG B;  5CMZ A;  1M1J C;  1FU1 A;  4N3Y B;  3RK3 D;  2WPR A;  2WTY A;  1FZG A;  5CCG C;  3RL0 D;  1HGZ A;  2HPC A;  3V2Q A;  2PAJ A;  2E43 A;  3U1A A;  4XE5 B;  1GDT A;  4HH2 A;  1OWA A;  3P8C D;  4DOJ A;  2YO3 A;  2Q5U A;  3EQ2 A;  3LIE A;  3E1I A;  1RF1 C;  4IFD K;  1CSB A;  1G1J A;  1HVV A;  3L36 A;  1CI6 A;  3HD7 D;  1ZV8 A;  1H8A A;  3MD0 A;  1M7L A;  1FZE A;  3P8C E;  1IJD B;  1CZQ A;  2NPS A;  5BU5 A;  3RK3 B;  1GU4 A;  3M0D C;  1LT9 C;  2H43 A;  1URQ B;  2E42 A;  1AQ5 A;  2P2U A;  2FXM A;  1JNM A;  3C9I A;  1LTT C;  2P7J A;  2XKM A;  1KZU B;  2YO2 A;  1GL2 C;  4I2L C;  3HTK A;  1LTB C;  3HD7 B;  1ZN5 A;  3KYQ A;  3LID A;  5KJ7 D;  1NTZ K;  1RE3 A;  2A45 G;  2N1T C;  5CHX A;  1HUC A;  3A7O A;  2XU6 A;  1KFM A;  3BAT A;  1A02 J;  1HBW A;  1NHL A;  2Z5I A;  3OA7 A;  5AW4 B;  1SFC C;  2H7H A;  3SWY A;  1DX7 A;  1L4A C;  3NFQ A;  1E5W A;  1N7S C;  2XZR A;  2HYN A;  1GW3 A;  4GIF A;  4LLH A;  1JOC A;  5CJ4 A;  1FZC A;  3NTN A;  1JY3 O;  4WY4 C;  2POH A;  3A5T A;  5CCG D;  3TNU A;  3T97 A;  2WT7 A;  2C9N Y;  1SQP K;  2W6A A;  1LWU B;  5KLV K;  1RF1 A;  4AUW A;  1XTG B;  4GKG A;  5BU8 B;  1J1D C;  3HTK B;  3VP8 A;  4ZKP A;  1H89 A;  3B5N A;  3CLQ A;  1G2C A;  2WSF H;  3G3Z A;  3H32 A;  2QM8 A;  1SLQ A;  1NU1 K;  1H88 A;  1PFI A;  4ZKU A;  2FFD B;  3VMZ A;  2O1J A;  1GK4 A;  2HLO A;  1T8Z A;  5AW5 B;  4DZO A;  1IFD A;  1JY2 O;  1G1I A;  2C0X A;  2J58 A;  1OXZ A;  5AVQ B;  1KIL A;  1MFZ A;  1SQQ K;  2OYH C;  1KFN A;  2LKM A;  4HYT B;  3VTP C;  2W27 A;  1YYC A;  3OAK A;  1KQL A;  1GU5 A;  1LTJ A;  2PP6 A;  5CJ0 A;  3BAS A;  3HUS C;  2Q9I A;  5AVV B;  1GL2 D;  3TNU B;  1LTS C;  1RF1 B;  2FKW B;  1IK9 A;  1YTZ I;  3V2R A;  2OAR A;  4AYC A;  1LGH B;  3B5N B;  2FYZ A;  3SWF A;  2C9L Y;  1VDF A;  3R2P A;  2N1T D;  3MIW A;  3RK3 C;  1LT9 B;  2H8P D;  3LW5 H;  2I1J A;  1FZF A;  1Z56 A;  2A45 H;  1SFC D;  1X79 B;  3HD7 A;  3RK2 C;  1L4A D;  2I1K A;  3V5B A;  1KIL B;  1N7S D;  2OYI C;  3BRT B;  1GD2 E;  1GZL A;  3P8M C;  1J1E B;  4WY4 D;  3N7N A;  1GTW A;  4C46 A;  2QM7 A;  5APS A;  3TK1 A;  1LTJ B;  3V4W A;  2ZFC A;  3MTU E;  3VMY A;  4C7R A;  2IFM A;  3L35 A;  3PP5 A;  3IR9 A;  3NMD A;  2R5D A;  1L0L K;  2N1T B;  1MV8 A;  3KPE A;  1GW4 A;  1SP4 A;  1NH4 A;  2KB7 P;  4Y99 C;  2HFE D;  1N73 A;  1FOS E;  3RL0 B;  2M8R A;  3NXS A;  4GT1 A;  4W80 A;  2CPS A;  4JYB A;  2Q7C A;  3M9H A;  1LWU A;  5KJ7 A;  3P32 A;  4RES B;  4EIJ A;  1N7S B;  1NWQ A;  5AW7 B;  2WIT A;  3EFG A;  2O1K A;  1VPC A;  2KYV A;  1RE4 C;  1DEB A;  3GHG C;  4WY4 B;  5AW9 B;  2R3C A;  1FOS F;  5AW2 B;  1T3J A;  3O8Z A;  4N78 D;  1IFJ A;  2FFD A;  1J1D B;  2IFN A;  2KSJ A;  1RF0 C;  1A02 F;  5AVR B;  1ZR2 A;  2P67 A;  4IFM A;  3BRV B;  5CCH C;  1M1J A;  5AW3 B;  4N78 E;  4O9B A;  5CCG A;  3TYY A;  1IFI A;  2HG5 D;  1NTM K;  5AVT B;  1N73 B;  3L4F A;  2WPS A;  1X8Y A;  2A45 I;  1JY3 P;  3L37 A;  1NOH A;  4XA4 A;  1NAF A;  4I6M C;  3A3Y B;  2W6B A;  3RK2 D;  1HTL C;  1URQ C;  1IC2 A;  3HUS B;  4JF7 A;  2WWW A;  4EOT A;  1GK6 A;  2R32 A;  1T2K C;  3WMM 0;  4M3L A;  4LGD E;  4B86 A;  4WB4 A;  2XV5 A;  2YKQ A;  3M0D A;  1LT9 A;  3MGN A;  5KTB A;  1J2J B;  5APQ A;  1SQV K;  1ZR4 A;  3HE4 A;  3HE5 A;  2FYU K;  1M1J B;  4OH8 B;  1DH3 A;  4KHX A;  1SVF A;  1GL2 A;  2YKO A;  2XDJ A;  2C0W A;  5AW1 B;  1JTH B;  1WRG A;  2NPS C;  2GUV A;  1LTI C;  1MUU A;  2N1T A;  5AW0 B;  3V2P A;  2YMY A;  2Q3I A;  3M9B A;  5APV A;  1FJK A;  1JCD A;  3H6P A;  1FAV A;  4IFF A;  1MZ9 A;  1SFC A;  1L4A A;  2M3B A;  1N7S A;  2WZ7 A;  5CCH D;  3VP9 A;  4I1L A;  3HE5 B;  3HE4 B;  4WY4 A;  2YNY A;  5AVU B;  1RE3 C;  1GL2 B;  3I5C A;  3M9Q A;  2L5G B;  4W7Y A;  5APX A;  1QL2 A;  3TSI A;  1LTA C;  5APY A;  5APT A;  1L0N K;  3IFM A;  1URQ D;  1RY3 A;  3M06 A;  3U59 A;  1T2K D;  1N7L A;  3A2A A;  3M0A A;  3B8E B;  1W2E A;  1FZC C;  3P7K A;  1SFC B;  2OYH A;  2XNX A;  1L4A B;  1HWT C;  5APU A;  1N86 A;  5AVZ B;  1NO4 A;  3B5N C;  3CL3 D;  3VOP A;  2P1J A;  3HUS A;  3U1C A;  1CW5 A;  4LC1 A;  3HRN A;  2IPP A;  1AFO A;  2N9B A;  1FDM A;  2NPS D;  4AQR D;  2MJZ A;  1KIL C;  1SQX K;  1FZB A;  2HPC B;  1J1E C;  5APW A;  2Z4E A;  2R5B A;  1YTZ T;  1NKN A;  1LTJ C;  4JYC A;  2WSE H;  2Z5H A;  4C7N A;  4WBA A;  1N2D C;  3V2N A;  1JTH A;  2OYH B;  2OYI A;  1CI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...