1LWUA

Crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'NELEVRYSEVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha-1 chain
publication title Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood clotting
total genus 30
structure length 99
sequence length 99
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2002-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lwuA00
1N73A 2FFDA 1M1JC 1LWUC 1FZCB 1LT9B 2HLOA 1LT9A 1JY3N 1FZCA 1FZGA 2OYIC 1RF0C 2OYHB 3HUSB 3GHGC 2OYHA 2HODB 2A45G 3E1IA 1W2EA 2A45H 3HUSA 2A45I 1LTJC 1FZEA 2HODA 1JY2O 2FFDC 2FFDB 1FZAA 1N73C 1RE3A 1FZCC 1LT9C 1FZBA 1RE4A 1LWUB 1RF1B 1M1JB 1RF1A 1JY2P 1M1JA 1N86A 1LWUA 1FZFA 3H32B 1JY3O 2OYHC 2Q9IA 2Z4EA 2H43A 3HUSC 2OYIB 3H32A 2HPCB 1RE3C 1RF0A 3GHGB 1JY3P 1T3UA 1JY2N 3GHGA 1LTJB 2OYIA 2HPCA 1N73B 1RE4C 2XNXA 1LTJA 3BVHA 1RF1C
chains in the Genus database with same CATH superfamily
2OTLP 3IN6A 3H1IG 1BGYD 1LTBC 1KTMA 1L0ND 4DZOA 2LKMA 3AECC 3H1JG 3TF5A 1JMBA 3HE4B 2BEZF 4EYYQ 3L37A 1PPJE 2I8DA 3AE8C 3RK2C 3E7KA 4IFMA 4XE5B 3MHVA 2W6JH 4C7NA 2FYUG 1N7SD 3B5NC 1DX7A 1Q7YQ 5APWA 3U1CA 2QIWA 1EZVD 4NPFX 3CC7P 1OW7A 1WRGA 1JEKA 2H43A 3JCUE 2PGDA 3RBXA 1FAVA 1USDA 4LC1A 3L73G 1SQQK 2ZXEB 1URQB 3HE5A 4JPZB 1HWTC 2XZRA 2ZT9C 2IX7C 1BSHA 1L0LJ 2QJPB 5AW6B 2KB7P 1FDOA 5KLIB 1L0LK 5AW0B 1HGVA 2N1TC 2HR3A 2FBWC 5KKZB 4JF7A 1RY3A 3H1HE 3M91A 1M90Q 3AE7C 2XV5A 1YJ9P 1PPJD 1NTMJ 3H1LE 3AEDC 1NJIQ 1NTMK 3CWBE 2WITA 4DJGA 1VQPP 1RE4C 1MUUA 1LT9B 5CJ4A 2NZ2A 4ASVA 3Q2YA 1NU1E 5C39A 3P8MC 4OGQC 2HODB 2ZVNB 3CXHI 5TISH 1SQVG 1FBMA 3CI9A 2IPPA 5AVWB 1NGMB 2L91A 3CPWO 3VYIA 1BCCG 2R44A 4XA4A 1NTKJ 2BCCE 2LXBA 1M56D 1LT1A 1LTTC 2IZ1A 3RL0B 1H89A 5K5GB 3H1HD 3FXDA 1DD4A 2KZJA 3BCCG 2E75C 3HUSC 2O1JA 1SS1A 2MKVA 3TNUA 3HTKA 1LJ2A 3H1LD 1FC2C 1AVOA 3CCLP 3MGNA 5KJ7A 3A0BE 4IL6H 4UB8H 4EDFA 5DJUB 2WTYA 1NU1D 3CX5H 2A06E 4DOJA 3BRTB 3RL0D 2ZT9B 1GL2B 1QLED 2BASA 2YKPA 2QSIA 1SQBE 1X0TA 2KZIA 1H0TA 4D6TG 3AE3C 5L8RJ 1SQQG 1J2JB 3PLNA 4C46A 1ZOYC 2W6AA 2YKOA 1S1CX 2BCCD 1PP9J 4U3FJ 5TJHA 3HD7C 3VMYA 1RF1C 4GIFA 1EXJA 2OYHA 2KLUA 1AVYA 5CCGC 2ZT9D 4HKZH 1EZVG 1GL2D 1N86A 1CI6A 2D2CB 5CCHA 3A3YB 3WU2H 2KS1A 3OW2O 2A06D 1W5CE 3BRVB 1ZMEC 1S72P 1NKZB 2R3CA 1HGZA 3L36A 3WUVA 1SQBD 3TGUD 1UIIA 1KD1Q 2UWJE 2XNXA 2ZVOB 2D2CD 3P32A 1KB9I 3TK1A 1FZGA 2AEJA 3AEGC 1Y47A 3HUSB 1PPJG 1LTAC 3AE9C 1JY2P 1OWAA 3L71E 4UB6H 1H88A 3ZDMA 3LIDA 2C9NY 1M1KQ 5TISE 2Y0EA 3SFDC 3PH0A 1JNMA 1ZLLA 3E1RA 3CC4P 4L76A 5KLVJ 1R5SA 2AEFA 3Q5RA 4N78E 2M3BA 1KQSO 3H32B 1IC2A 2P1JA 3G6EP 2FYNC 3I5CA 2G8YA 2RN0A 2POHA 3RGUA 3H1HG 2P58A 1OMIA 1YTZI 1X8YA 4KHXA 2CPBA 2O01J 4IL6E 4UB8E 5AVSB 3CX5E 3D6ZA 5CBNA 1NTZK 1S9KE 1YYCA 2AEMA 1S3JA 1M1JA 2FY8A 4ASWA 3L73E 3HD7D 1OVUA 4N78D 4WB4A 1OVVA 2QM7A 2OARA 2Q6QA 2ZYAA 5CCGD 3M9QA 3H1KJ 2JDIH 4W7ZA 2BCCG 3PJSK 4KT0J 2HPCB 1QVFO 4IOIH 3IFMA 1N8RQ 1L4AB 4I2LC 1PGPA 2B87A 1GU5A 3MUDA 1K8AQ 4L73A 1JTHB 2IZ0A 3E1IA 2IDBA 2K37A 1J1EC 3WMM0 2W90A 2JP3A 3L75G 1H8AA 3WU2E 3L72E 1RHZB 2WZ7A 2FKWB 1KYOH 1BSNA 1S5LH 4AUWA 2A06G 1SQVE 1IFPA 1KV4A 3L73D 3ABVC 1W2EA 4U7JA 1Q86Q 4IFDK 2WT7B 1AJYA 2FYNB 1SQBG 1LWUA 3O6QA 4OWFA 4PD4H 3TGUG 4RESB 3CCQP 2IYOA 3CCSP 4WY4A 3C9IA 1FOSF 3GW6A 2FYUJ 1P84D 2V7QH 3BCCE 4UB6E 4BXLA 1MFTA 2M8RA 4KJMA 2Q9IA 1Q82Q 2WSFJ 1IJDB 3BVHA 1N73A 1GDTA 1LNQA 3QWOC 3L72D 1U7MA 3A0HH 1VQOP 1UIXA 3EFGA 2KNCB 4GODA 1SQVD 1KILA 1JY3O 1K04A 1ZN5A 4LGDE 1FDMA 1NTZG 2FFDB 3TDKA 4H13C 1FZCB 2XNDH 4D6TE 1G2CA 1SQQE 1GU4A 2LXCB 3AE1C 2MJZA 3N4XA 2R3SA 1OVRA 1OZHA 3JSVC 1E5WA 5AW9B 1YI2P 3BCCD 3AE2C 1OFCX 2M3EA 1YTZT 4ZKUA 3MZWB 1IFMA 4HH2A 3RK3E 3EFFK 1FZAA 1Y8AA 3P7KA 1BE3G 3UIAA 4YXWH 1G1IA 3BASA 1BCCJ 1NTME 1ZW0A 2E42A 2ZXXA 5AVRB 2N9YB 4K35A 3RK3B 3FXEA 4W80A 3RBZA 1NKNA 5BU5A 1NAFA 4D6TD 1FZFA 2VRSA 1SQQD 5DJTB 2KUBA 4BWNA 2M5AA 2QJKC 4Y28J 2RH0A 2PRRA 3V2RA 1KYOE 5KJ7C 1S5LE 3RK3D 2P67A 4RJTA 1GW3A 3HE5B 4GKGA 1BGYJ 2FXMA 1L0NJ 3MD0A 1SQPJ 3B71A 4PD4E 1NTMD 2ZFCA 1PIXA 2PFXA 2HG5D 2FXOA 1SQPK 2O01H 2QJYB 2M0BA 3II6A 4OH8B 4BRYB 3VP9A 1E79H 3SWFA 1URQA 1ZXGA 3GLMA 1PGQA 4YXDC 2NPSC 2OYHC 1SQXG 2Q3IA 3GHGB 2QM8A 1S2EA 3L70G 3A0HE 2L5GB 2J59M 1KYOD 3L72G 5CCHC 2JWAA 1JY2O 1EQ7A 1LTIC 3VTPC 4I7ZC 4PD4D 2R5DA 4L75A 2Z5IA 1KC8Q 1PZQA 5AW1B 1LT9A 2OYIC 1YIJP 4YPCA 3VMZA 4NPDA 1VL2A 3D70A 3IAOA 1NTKK 3S1KA 3RK2B 4L74A 2FYZA 1NWQA 3B5NB 1XTGB 3TNUB 3L74E 1NH4A 4HB1A 1VQLP 3GMAA 4B86A 3B4SA 2YXQB 3TYYA 3L75E 1LP1B 1YJWP 1OW8A 4PV1C 2JR8A 5E79H 3CCRP 2O01N 3Q1MA 2YMYA 4U3FD 3RK2D 1IZNB 1VF5C 3H6PA 5APVA 3B5ND 3MP7B 5AVVB 1M7LA 1VQNP 1H0TB 3TGUE 2N1TB 1WT6A 3M0DA 5GTIH 3H1HJ 5KJ7D 2WSCH 4WVZA 3H1LJ 2WSEJ 3PTZA 2R32A 2R5BA 3D71A 2NPSA 3L4FA 5APUA 3CWBJ 1P84H 2N9BA 2A45G 3L74D 2KOGA 1JCDA 3AE4C 1L0LG 2K1AA 3LW5H 1NU1J 5CJ0A 1JUNA 3L75D 4OGQB 2E74C 2N1TD 2K9JA 1M1JC 2W8ZA 5APTA 3CCMP 3CD6P 3OA7A 1HVVA 4I7ZB 1NYHA 5AVQB 1NTMG 3IF4A 2SPZA 3CCEP 3CLQA 3KQGA 1NTZE 3WUUA 2BCCJ 3KPEA 2OYIA 2KI7B 5CCHD 4OGQD 3V2PA 2E75B 1DD3A 3MUDC 2QE7H 2ZAEB 1T2KC 3H1KE 1USEA 4EI2A 1NTKG 4PV1B 1AV1A 2OTKE 1HUCA 1SVFA 1BE3E 3WUTA 1GZLA 1M8OB 1QGKB 1JM0A 2E75D 1SQBJ 4DCKA 5KLVK 3G71P 1LWUC 2YMKA 1NTZD 5AVZB 2IYPA 5KAIH 3PHLA 4WY4C 4PV1D 3G4SP 3HD7B 2J58A 2BEQD 4XFJA 2YIUC 1RF1B 2KXPB 5APXA 4R4MA 1VF5D 1HTLC 3V5BA 1QL2A 1IK9A 4OVNF 5E79E 1FOSE 3NXSA 2YNYA 3H1KD 2A45H 1N73C 4O9BA 2GA1A 3KYQA 1PP9G 1EDJA 4U3FG 1KN7A 1BE3D 1ZP0C 1Q81Q 1KILC 3P8CE 1CW5A 5GTIE 1OXZA 2OGUA 2KP8A 1NVOA 3I56P 2P7JA 1M57D 1VQMP 2HFED 3CX5I 2WPQA 2E74D 1PV3A 1J1DC 1P84E 2B87B 3L71J 3L74G 3CC2P 1AQTA 4H44C 2GUSA 2YO2A 3KZIH 1S4XA 1SQXE 1U57A 2GM4A 5APYA 1OIPA 4AQRD 3L70E 3PP5A 1YBKA 1KFMA 1RF0A 3S9OA 5AW5B 1LTJA 3T97B 1K9MQ 1L4AA 3U1AA 2QA4P 1QVGO 3M9HA 3JC22 3H1IJ 2J5UA 1LWUB 3P8CD 3O6QB 1W2BO 3H1JJ 1LTSC 2KSJA 3M9BA 2RMZA 2YIUB 1ZV8A 2I1JA 1N7SC 3V4WA 2WT7A 2FYUK 3K5BA 3R4YA 3Q5SA 3MTUE 3V2NA 1N73B 1SQXD 3VP8A 5AVUB 1VQ7P 5AW3B 3L73J 1HJ0A 5APQA 3L70D 5B66H 3CXHH 1KFNA 4WY4D 2Y0DA 4QMAA 1GW4A 1MKMA 2C0XA 4GT1A 5KAIE 5AW7B 1G2CB 1VPCA 1YQ3C 3AEAC 3AEBC 1URQC 2KNCA 1VQ8P 2WQYC 4H44B 5KAFH 1SFCA 5AW8B 2H7HA 3Q5PA 1J1EB 1KILD 2QVAA 1D7MA 2FFDA 1X79B 2QJPC 1L0LE 4Y99C 3V2QA 1FZCA 2Q5UA 3H1KG 3L72J 5CMZA 1R5LA 1YJNP 5KKZC 2IBZE 2K9YA 1SQVJ 5B5EH 2Z4EA 3N7NA 1T3UA 2HLOA 4H44D 3HRNA 4N6JA 5M1BA 3SSUA 2JJLA 3RL0g 1EZVI 1LT9C 4YTPC 3BCCJ 4DT0A 2QEXP 1N7SA 1Z56A 2NRGA 2M5AB 3KZIE 1HBWA 4C7NB 5AW4B 1SQPD 1RQUA 1OW6A 2LR2A 1KQGB 3BATA 1L0LD 3NTNA 1NTKE 3SFEC 3HE4A 1DEEG 1DIPA 3RL0C 5KTBA 2IBZD 2C0WA 4NPEA 4R4LA 5AVTB 1YHQP 1IFDA 1L0NK 4H13B 4D6TJ 2XDJA 1SQQJ 3CCUP 4K3AA 1NO4A 3M0DC 1KYOI 1X22A 2WPRA 1FU1A 4ZKPA 1KB9H 1JB0J 4M3LA 3W68A 1FZEA 1VQ4P 3CMAP 1GL2C 4Y99B 1T3JA 1AFOA 1QX8A 1SP4A 4PD4I 1PGJA 3VMXA 4BRYA 5B66E 3CXHE 3FX0A 4H13D 4ZNCA 1NTKD 5H2FH 3EQ2A 1PP9E 4U3FE 1URQD 5GTHE 2WWWA 3NFQA 1JCCA 3PRJA 2P2UA 1JY3P 3CL3D 3GHGA 1VQ6P 1FE6A 1VQ5P 3NMDA 1VQKP 2D2CC 3SWYA 2PAJA 2B88A 2HODA 2ZYDA 5KAFE 4A7PA 1FJKA 2B89A 1EDKA 2YXRB 2QJKB 3HTKB 1PFIA 2E43A 2AXTH 1GMJA 4WWIA 2KK7A 5B5EE 3CXHD 1KORA 1NHLA 2G3AA 3B5NA 1PP9D 3LIEA 1JMMA 2AXCA 3KDPB 1Q90D 1DEBA 3CWBD 4IL6X 1AA0A 3AEEC 2WPSA 1JO5A 1LP1A 2IFMA 2O3JA 2V7QJ 2Y9ZA 1MZ9A 3VMAA 2WSFH 2E5YA 2YO3A 1RE3C 2PP6A 2KYVA 4LLHA 2ZYGA 5KLVE 5BVZA 2DW3A 1BGYG 1L0NG 1SQPG 2NPSB 1GL2A 2OYHB 2C9LY 1KQFB 3S4RA 3SWKA 1U7JA 1GK4A 3U59A 1BDDA 2N1TA 1VQ9P 1CI6B 3GF3A 2K9JB 2WMMA 2IBZG 1NU1K 1OX3A 2RKLA 2KS1B 1TU3F 3F89A 4Z1MH 1JOCA 4I6MC 3V4QA 2K88A 4HJGH 1RE4A 1CSBA 2NPSD 2OYIB 1KB9E 3VN0A 3O8ZA 5CBOA 3A2AA 3Q3DA 3M06A 4GDOA 1LTGC 3L74J 1A02J 5KLVD 2CK3H 4HYTB 1K73Q 4N3YB 1A02F 3L75J 3GF7A 3KXDA 5H2FE 3USSA 4RO0A 4GOFA 2I1KA 1Q2NA 3AE6C 5EFWB 4H0LC 1RF0C 1Y9BA 1GD2E 3ITKA 3HUSA 1LTJC 1EDIA 1VF5B 1L4AC 2JWDA 3AE5C 1EDLA 2W6BA 1L2PA 1GTWA 3TGUJ 2H88C 1MV8A 4EIJA 2XU6A 2QG4A 4PJ0H 2YKQA 1SQBK 1JY3N 1IFIA 1KB9D 1QL1A 1RE3A 3VOPA 4ZMDA 3G9RA 1N2DC 2AXTE 1BDCA 3H32A 1XTCC 3FGAD 3H1IE 3R2PA 3H1JE 3D6YA 1RQVA 2E74B 3W67A 1KMIZ 3HD7A 1RH5B 1FZBA 1IFNA 4I1LA 2XKMA 1M1JB 1RF1A 2P10A 1K05A 3H1LG 2FYUE 2W83C 5AVYB 5CCGA 2Q1KA 2H89C 3QH9A 1NTZJ 3CWBG 3L71D 4TT3H 1WMKA 1HJBA 2W27A 1N7LA 1R8EA 2K3RA 1NU1G 1G1JA 2CPSA 5BU8B 5CHXA 3G3ZA 2QRXA 2KSEA 3OJAB 4JYCA 2E5TA 2FXPA 1SFCC 1ZR2A 3H25A 3H1ID 2OTJP 2FFDC 1IFJA 5AVXB 3FWNA 1FZCC 2ITAA 1IO4A 2H8PD 4H0LB 3H1JD 4AYCA 1FJPA 1BE3J 2Q3EA 3GG2A 1LTJB 2E76C 2HPCA 3A5TA 1YQ4C 4WBAA 3CCVP 2KLVA 1DH3A 1NAYA 2GUVA 1MFZA 1KZUB 1P84I 2FYUD 1JTHA 3FWLA 3KHUA 1KQLA 2WSSH 3CMEP 3C8VA 1YITP 3CX5D 1CZQA 1T2KD 1S9KD 1VDFA 4WY4B 1S5LX 2KIKA 3T97A 1PL5A 4TLFA 4H0LD 3JCUH 1ZRTE 1T8ZA 2JKVA 4JQ0D 2V4HA 2Q7CA 5KLVG 4EOTA 2Y0CA 3L35A 1L4AD 1BCCE 1EXIA 4JYBA 1KILE 2JEEA 4MN4C 3RK3C 4GOEA 3CCJP 1T6AA 2OQQA 3IR9A 3I55P 4IFFA 3A7OA 2ZJSE 2OYOA 1X9VA 1KILB 3B8EB 4W7YA 4PJ0E 1EC5A 2O1KA 2WSCJ 1LGHB 1JY2N 3F5HA 2WSEH 5GTHH 3C1LA 2JO1A 2WVRA 1J1DB 1HF9A 1ZR4A 2Z5HA 1FS0E 1ZRTD 3LW5J 1SFCB 1BGYE 1L0NE 5APSA 1SQPE 1PGOA 1SQXJ 1BCCD 2HYNA 1NOHA 2QJYC 5AW2B 3L70J 1SQXK 5KLIC 3AEFC 2E76B 1GK6A 1FDIA 4C7RA 3EWKA 4CPGA 1IK7A 3M0AA 3TSIA 2Y9YA 2WPVB 1SQVK 3L71G 1EZVE 2B9BA 3V6IA 1SFCD 3MIWA 4RKUJ 3GHGC 4JBZA 1AQ5A 2A45I 1QEXA 1SLQA 3A0BH 1N7SB 2E76D 2IFNA 3OAKA 2IBZI 1HH0A
chains in the Genus database with same CATH topology
4AUWA 1LTBC 4DZOA 2LKMA 1HUCA 1W2EA 1SVFA 4IFDK 1GZLA 2WT7B 1LWUA 1NHLA 3HE4B 4RESB 5KLVK 3B5NA 3LIEA 1JMMA 3L37A 3RK2C 4IFMA 4XE5B 3KDPB 4WY4A 1LWUC 3C9IA 1FOSF 1DEBA 5AVZB 2E43A 4C7NA 3B5NC 1N7SD 1DX7A 5APWA 3U1CA 2WPSA 1JO5A 4WY4C 3HD7B 2IFMA 2J58A 1RF1B 1MZ9A 2M8RA 2WSFH 5APXA 1WRGA 2Q9IA 2H43A 2YO3A 1IJDB 1RE3C 2PP6A 2KYVA 4LLHA 1FAVA 1HTLC 3V5BA 5BVZA 3BVHA 4LC1A 1N73A 1QL2A 1GDTA 1SQQK 2ZXEB 1URQB 2NPSB 1IK9A 3HE5A 1GL2A 2OYHB 1FOSE 3NXSA 2YNYA 1HWTC 2C9LY 2A45H 2XZRA 1N73C 1GK4A 4O9BA 3U59A 3EFGA 3KYQA 2IX7C 2N1TA 1CI6B 1KILA 1JY3O 5AW6B 2KB7P 1ZN5A 1L0LK 5AW0B 4LGDE 1FDMA 1HGVA 2N1TC 2FFDB 1NU1K 1KILC 1FZCB 3P8CE 4JF7A 1RY3A 3M91A 1CW5A 1G2CA 1JOCA 1OXZA 2KP8A 4I6MC 2XV5A 1GU4A 3V4QA 2P7JA 2MJZA 3N4XA 1RE4A 1CSBA 2NPSD 2HFED 1E5WA 2WPQA 1NTMK 2OYIB 5AW9B 2WITA 3VN0A 3O8ZA 1J1DC 1RE4C 1MUUA 1LT9B 3A2AA 5CJ4A 3M06A 1YTZT 3P8MC 4ZKUA 2GUSA 1LTGC 1IFMA 2HODB 4HH2A 1A02J 2YO2A 1FZAA 1FBMA 3CI9A 2GM4A 2IPPA 3P7KA 4HYTB 5APYA 4N3YB 4AQRD 5AVWB 1A02F 3PP5A 3UIAA 3VYIA 1G1IA 1KFMA 1RF0A 3BASA 5AW5B 1LTJA 2I1KA 4XA4A 1L4AA 3U1AA 2E42A 5AVRB 1RF0C 1GD2E 3M9HA 3HUSA 1LTJC 3RK3B 1LTTC 3RL0B 4W80A 1L4AC 1H89A 1LWUB 3P8CD 1NKNA 5BU5A 1NAFA 1FZFA 2VRSA 1LTSC 2W6BA 3HUSC 1GTWA 2KSJA 3M9BA 2O1JA 3TNUA 3HTKA 1MV8A 4EIJA 2XU6A 2YKQA 1SQBK 1JY3N 1IFIA 1ZV8A 2I1JA 1N7SC 3V4WA 3MGNA 5KJ7A 2WTYA 1QL1A 1RE3A 3VOPA 2WT7A 3V2RA 1N2DC 2FYUK 5KJ7C 3H32A 3RK3D 1XTCC 3MTUE 4DOJA 2P67A 3BRTB 3RL0D 3V2NA 1N73B 3VP8A 1GW3A 5AVUB 3HE5B 4GKGA 1GL2B 3R2PA 5AW3B 2BASA 5APQA 2YKPA 2FXMA 3MD0A 1KFNA 4WY4D 2ZFCA 1GW4A 3HD7A 2HG5D 1FZBA 1IFNA 4I1LA 1J2JB 1SQPK 2XKMA 1M1JB 1RF1A 2O01H 4C46A 2W6AA 2YKOA 3II6A 4OH8B 2C0XA 4GT1A 3VP9A 3HD7C 5AVYB 5CCGA 5AW7B 3VMYA 1RF1C 3SWFA 1G2CB 1VPCA 1URQA 4GIFA 1HJBA 2OYHA 2W27A 5CCGC 1N7LA 1G1JA 1GL2D 2CPSA 1URQC 5BU8B 2NPSC 3G3ZA 5CHXA 1N86A 2OYHC 1CI6A 1SFCA 2Q3IA 3GHGB 5CCHA 5AW8B 2H7HA 3A3YB 2QM8A 1J1EB 3OJAB 1KILD 2FFDA 1X79B 4JYCA 2L5GB 2J59M 4Y99C 3V2QA 1FZCA 2Q5UA 1SFCC 1ZR2A 5CCHC 5CMZA 3BRVB 1JY2O 2FFDC 1IFJA 1EQ7A 5AVXB 1FZCC 1NKZB 1IO4A 2H8PD 2R3CA 1LTIC 1HGZA 3L36A 3VTPC 4AYCA 2Z4EA 3N7NA 1FJPA 1T3UA 2R5DA 1LTJB 2HPCA 3A5TA 2XNXA 2Z5IA 4WBAA 2KLVA 1DH3A 5AW1B 2HLOA 1LT9A 3HRNA 2GUVA 3P32A 4N6JA 3TK1A 1FZGA 1MFZA 2OYIC 3HUSB 1KZUB 1LTAC 3VMZA 1JTHA 2JJLA 1NTKK 1KQLA 3RK2B 1LT9C 1JY2P 2FYZA 1OWAA 1NWQA 1H88A 3B5NB 1XTGB 1CZQA 3LIDA 3TNUB 1T2KD 1N7SA 1S9KD 1VDFA 1NH4A 1Z56A 4WY4B 2C9NY 4B86A 3T97A 1HBWA 4C7NB 5AW4B 1JNMA 1ZLLA 1T8ZA 3TYYA 2Q7CA 4EOTA 3L35A 1L4AD 4JYBA 3BATA 2JEEA 4N78E 2M3BA 3NTNA 3H32B 1IC2A 3HE4A 3RK3C 2YMYA 2P1JA 3RK2D 3RL0C 3H6PA 5KTBA 3IR9A 5APVA 3B5ND 2C0WA 3I5CA 5AVVB 2POHA 5AVTB 1M7LA 4IFFA 3A7OA 2N1TB 1WT6A 3M0DA 1IFDA 1L0NK 1X9VA 1KILB 5KJ7D 3B8EB 4W7YA 2XDJA 1YTZI 2WSCH 1X8YA 4KHXA 2CPBA 2O1KA 1LGHB 1JY2N 1NO4A 3M0DC 2WSEH 2WPRA 1FU1A 4ZKPA 2R32A 2R5BA 4M3LA 2NPSA 3L4FA 5APUA 2N9BA 2A45G 5AVSB 2KOGA 1JCDA 1FZEA 1J1DB 1NTZK 1S9KE 1ZR4A 3LW5H 1YYCA 1GL2C 2Z5HA 4Y99B 1T3JA 1M1JA 1AFOA 1SFCB 1SP4A 5CJ0A 1JUNA 5APSA 3VMXA 3HD7D 2N1TD 2HYNA 1NOHA 1M1JC 4N78D 5APTA 4WB4A 5AW2B 3OA7A 1HVVA 1SQXK 2QM7A 2OARA 5AVQB 5CCGD 3EQ2A 3M9QA 1GK6A 1URQD 4C7RA 4W7ZA 2WWWA 3CLQA 3KQGA 3NFQA 1JCCA 3M0AA 3TSIA 2P2UA 2HPCB 3KPEA 1JY3P 3CL3D 3GHGA 2OYIA 3IFMA 1SQVK 1L4AB 1SFCD 3MIWA 3NMDA 5CCHD 4I2LC 3SWYA 1GU5A 3MUDA 3V2PA 3GHGC 2PAJA 1JTHB 3E1IA 1AQ5A 2A45I 1J1EC 3WMM0 2HODA 1FJKA 1SLQA 1H8AA 1N7SB 2IFNA 1T2KC 3HTKB 2WZ7A 3OAKA 2FKWB 1PFIA 1HH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 A;  2FFD A;  1M1J C;  1LWU C;  1FZC B;  1LT9 B;  2HLO A;  1LT9 A;  1JY3 N;  1FZC A;  1FZG A;  2OYI C;  1RF0 C;  2OYH B;  3HUS B;  3GHG C;  2OYH A;  2HOD B;  2A45 G;  3E1I A;  1W2E A;  2A45 H;  3HUS A;  2A45 I;  1LTJ C;  1FZE A;  2HOD A;  1JY2 O;  2FFD C;  2FFD B;  1FZA A;  1N73 C;  1RE3 A;  1FZC C;  1LT9 C;  1FZB A;  1RE4 A;  1LWU B;  1RF1 B;  1M1J B;  1RF1 A;  1JY2 P;  1M1J A;  1N86 A;  1LWU A;  1FZF A;  3H32 B;  1JY3 O;  2OYH C;  2Q9I A;  2Z4E A;  2H43 A;  3HUS C;  2OYI B;  3H32 A;  2HPC B;  1RE3 C;  1RF0 A;  3GHG B;  1JY3 P;  1T3U A;  1JY2 N;  3GHG A;  1LTJ B;  2OYI A;  2HPC A;  1N73 B;  1RE4 C;  2XNX A;  1LTJ A;  3BVH A;  1RF1 C; 
#chains in the Genus database with same CATH topology
 2OTL P;  3IN6 A;  3H1I G;  1BGY D;  1LTB C;  1KTM A;  1L0N D;  4DZO A;  2LKM A;  3AEC C;  3H1J G;  3TF5 A;  1JMB A;  3HE4 B;  2BEZ F;  4EYY Q;  3L37 A;  1PPJ E;  2I8D A;  3AE8 C;  3RK2 C;  3E7K A;  4IFM A;  4XE5 B;  3MHV A;  2W6J H;  4C7N A;  2FYU G;  1N7S D;  3B5N C;  1DX7 A;  1Q7Y Q;  5APW A;  3U1C A;  2QIW A;  1EZV D;  4NPF X;  3CC7 P;  1OW7 A;  1WRG A;  1JEK A;  2H43 A;  3JCU E;  2PGD A;  3RBX A;  1FAV A;  1USD A;  4LC1 A;  3L73 G;  1SQQ K;  2ZXE B;  1URQ B;  3HE5 A;  4JPZ B;  1HWT C;  2XZR A;  2ZT9 C;  2IX7 C;  1BSH A;  1L0L J;  2QJP B;  5AW6 B;  2KB7 P;  1FDO A;  5KLI B;  1L0L K;  5AW0 B;  1HGV A;  2N1T C;  2HR3 A;  2FBW C;  5KKZ B;  4JF7 A;  1RY3 A;  3H1H E;  3M91 A;  1M90 Q;  3AE7 C;  2XV5 A;  1YJ9 P;  1PPJ D;  1NTM J;  3H1L E;  3AED C;  1NJI Q;  1NTM K;  3CWB E;  2WIT A;  4DJG A;  1VQP P;  1RE4 C;  1MUU A;  1LT9 B;  5CJ4 A;  2NZ2 A;  4ASV A;  3Q2Y A;  1NU1 E;  5C39 A;  3P8M C;  4OGQ C;  2HOD B;  2ZVN B;  3CXH I;  5TIS H;  1SQV G;  1FBM A;  3CI9 A;  2IPP A;  5AVW B;  1NGM B;  2L91 A;  3CPW O;  3VYI A;  1BCC G;  2R44 A;  4XA4 A;  1NTK J;  2BCC E;  2LXB A;  1M56 D;  1LT1 A;  1LTT C;  2IZ1 A;  3RL0 B;  1H89 A;  5K5G B;  3H1H D;  3FXD A;  1DD4 A;  2KZJ A;  3BCC G;  2E75 C;  3HUS C;  2O1J A;  1SS1 A;  2MKV A;  3TNU A;  3HTK A;  1LJ2 A;  3H1L D;  1FC2 C;  1AVO A;  3CCL P;  3MGN A;  5KJ7 A;  3A0B E;  4IL6 H;  4UB8 H;  4EDF A;  5DJU B;  2WTY A;  1NU1 D;  3CX5 H;  2A06 E;  4DOJ A;  3BRT B;  3RL0 D;  2ZT9 B;  1GL2 B;  1QLE D;  2BAS A;  2YKP A;  2QSI A;  1SQB E;  1X0T A;  2KZI A;  1H0T A;  4D6T G;  3AE3 C;  5L8R J;  1SQQ G;  1J2J B;  3PLN A;  4C46 A;  1ZOY C;  2W6A A;  2YKO A;  1S1C X;  2BCC D;  1PP9 J;  4U3F J;  5TJH A;  3HD7 C;  3VMY A;  1RF1 C;  4GIF A;  1EXJ A;  2OYH A;  2KLU A;  1AVY A;  5CCG C;  2ZT9 D;  4HKZ H;  1EZV G;  1GL2 D;  1N86 A;  1CI6 A;  2D2C B;  5CCH A;  3A3Y B;  3WU2 H;  2KS1 A;  3OW2 O;  2A06 D;  1W5C E;  3BRV B;  1ZME C;  1S72 P;  1NKZ B;  2R3C A;  1HGZ A;  3L36 A;  3WUV A;  1SQB D;  3TGU D;  1UII A;  1KD1 Q;  2UWJ E;  2XNX A;  2ZVO B;  2D2C D;  3P32 A;  1KB9 I;  3TK1 A;  1FZG A;  2AEJ A;  3AEG C;  1Y47 A;  3HUS B;  1PPJ G;  1LTA C;  3AE9 C;  1JY2 P;  1OWA A;  3L71 E;  4UB6 H;  1H88 A;  3ZDM A;  3LID A;  2C9N Y;  1M1K Q;  5TIS E;  2Y0E A;  3SFD C;  3PH0 A;  1JNM A;  1ZLL A;  3E1R A;  3CC4 P;  4L76 A;  5KLV J;  1R5S A;  2AEF A;  3Q5R A;  4N78 E;  2M3B A;  1KQS O;  3H32 B;  1IC2 A;  2P1J A;  3G6E P;  2FYN C;  3I5C A;  2G8Y A;  2RN0 A;  2POH A;  3RGU A;  3H1H G;  2P58 A;  1OMI A;  1YTZ I;  1X8Y A;  4KHX A;  2CPB A;  2O01 J;  4IL6 E;  4UB8 E;  5AVS B;  3CX5 E;  3D6Z A;  5CBN A;  1NTZ K;  1S9K E;  1YYC A;  2AEM A;  1S3J A;  1M1J A;  2FY8 A;  4ASW A;  3L73 E;  3HD7 D;  1OVU A;  4N78 D;  4WB4 A;  1OVV A;  2QM7 A;  2OAR A;  2Q6Q A;  2ZYA A;  5CCG D;  3M9Q A;  3H1K J;  2JDI H;  4W7Z A;  2BCC G;  3PJS K;  4KT0 J;  2HPC B;  1QVF O;  4IOI H;  3IFM A;  1N8R Q;  1L4A B;  4I2L C;  1PGP A;  2B87 A;  1GU5 A;  3MUD A;  1K8A Q;  4L73 A;  1JTH B;  2IZ0 A;  3E1I A;  2IDB A;  2K37 A;  1J1E C;  3WMM 0;  2W90 A;  2JP3 A;  3L75 G;  1H8A A;  3WU2 E;  3L72 E;  1RHZ B;  2WZ7 A;  2FKW B;  1KYO H;  1BSN A;  1S5L H;  4AUW A;  2A06 G;  1SQV E;  1IFP A;  1KV4 A;  3L73 D;  3ABV C;  1W2E A;  4U7J A;  1Q86 Q;  4IFD K;  2WT7 B;  1AJY A;  2FYN B;  1SQB G;  1LWU A;  3O6Q A;  4OWF A;  4PD4 H;  3TGU G;  4RES B;  3CCQ P;  2IYO A;  3CCS P;  4WY4 A;  3C9I A;  1FOS F;  3GW6 A;  2FYU J;  1P84 D;  2V7Q H;  3BCC E;  4UB6 E;  4BXL A;  1MFT A;  2M8R A;  4KJM A;  2Q9I A;  1Q82 Q;  2WSF J;  1IJD B;  3BVH A;  1N73 A;  1GDT A;  1LNQ A;  3QWO C;  3L72 D;  1U7M A;  3A0H H;  1VQO P;  1UIX A;  3EFG A;  2KNC B;  4GOD A;  1SQV D;  1KIL A;  1JY3 O;  1K04 A;  1ZN5 A;  4LGD E;  1FDM A;  1NTZ G;  2FFD B;  3TDK A;  4H13 C;  1FZC B;  2XND H;  4D6T E;  1G2C A;  1SQQ E;  1GU4 A;  2LXC B;  3AE1 C;  2MJZ A;  3N4X A;  2R3S A;  1OVR A;  1OZH A;  3JSV C;  1E5W A;  5AW9 B;  1YI2 P;  3BCC D;  3AE2 C;  1OFC X;  2M3E A;  1YTZ T;  4ZKU A;  3MZW B;  1IFM A;  4HH2 A;  3RK3 E;  3EFF K;  1FZA A;  1Y8A A;  3P7K A;  1BE3 G;  3UIA A;  4YXW H;  1G1I A;  3BAS A;  1BCC J;  1NTM E;  1ZW0 A;  2E42 A;  2ZXX A;  5AVR B;  2N9Y B;  4K35 A;  3RK3 B;  3FXE A;  4W80 A;  3RBZ A;  1NKN A;  5BU5 A;  1NAF A;  4D6T D;  1FZF A;  2VRS A;  1SQQ D;  5DJT B;  2KUB A;  4BWN A;  2M5A A;  2QJK C;  4Y28 J;  2RH0 A;  2PRR A;  3V2R A;  1KYO E;  5KJ7 C;  1S5L E;  3RK3 D;  2P67 A;  4RJT A;  1GW3 A;  3HE5 B;  4GKG A;  1BGY J;  2FXM A;  1L0N J;  3MD0 A;  1SQP J;  3B71 A;  4PD4 E;  1NTM D;  2ZFC A;  1PIX A;  2PFX A;  2HG5 D;  2FXO A;  1SQP K;  2O01 H;  2QJY B;  2M0B A;  3II6 A;  4OH8 B;  4BRY B;  3VP9 A;  1E79 H;  3SWF A;  1URQ A;  1ZXG A;  3GLM A;  1PGQ A;  4YXD C;  2NPS C;  2OYH C;  1SQX G;  2Q3I A;  3GHG B;  2QM8 A;  1S2E A;  3L70 G;  3A0H E;  2L5G B;  2J59 M;  1KYO D;  3L72 G;  5CCH C;  2JWA A;  1JY2 O;  1EQ7 A;  1LTI C;  3VTP C;  4I7Z C;  4PD4 D;  2R5D A;  4L75 A;  2Z5I A;  1KC8 Q;  1PZQ A;  5AW1 B;  1LT9 A;  2OYI C;  1YIJ P;  4YPC A;  3VMZ A;  4NPD A;  1VL2 A;  3D70 A;  3IAO A;  1NTK K;  3S1K A;  3RK2 B;  4L74 A;  2FYZ A;  1NWQ A;  3B5N B;  1XTG B;  3TNU B;  3L74 E;  1NH4 A;  4HB1 A;  1VQL P;  3GMA A;  4B86 A;  3B4S A;  2YXQ B;  3TYY A;  3L75 E;  1LP1 B;  1YJW P;  1OW8 A;  4PV1 C;  2JR8 A;  5E79 H;  3CCR P;  2O01 N;  3Q1M A;  2YMY A;  4U3F D;  3RK2 D;  1IZN B;  1VF5 C;  3H6P A;  5APV A;  3B5N D;  3MP7 B;  5AVV B;  1M7L A;  1VQN P;  1H0T B;  3TGU E;  2N1T B;  1WT6 A;  3M0D A;  5GTI H;  3H1H J;  5KJ7 D;  2WSC H;  4WVZ A;  3H1L J;  2WSE J;  3PTZ A;  2R32 A;  2R5B A;  3D71 A;  2NPS A;  3L4F A;  5APU A;  3CWB J;  1P84 H;  2N9B A;  2A45 G;  3L74 D;  2KOG A;  1JCD A;  3AE4 C;  1L0L G;  2K1A A;  3LW5 H;  1NU1 J;  5CJ0 A;  1JUN A;  3L75 D;  4OGQ B;  2E74 C;  2N1T D;  2K9J A;  1M1J C;  2W8Z A;  5APT A;  3CCM P;  3CD6 P;  3OA7 A;  1HVV A;  4I7Z B;  1NYH A;  5AVQ B;  1NTM G;  3IF4 A;  2SPZ A;  3CCE P;  3CLQ A;  3KQG A;  1NTZ E;  3WUU A;  2BCC J;  3KPE A;  2OYI A;  2KI7 B;  5CCH D;  4OGQ D;  3V2P A;  2E75 B;  1DD3 A;  3MUD C;  2QE7 H;  2ZAE B;  1T2K C;  3H1K E;  1USE A;  4EI2 A;  1NTK G;  4PV1 B;  1AV1 A;  2OTK E;  1HUC A;  1SVF A;  1BE3 E;  3WUT A;  1GZL A;  1M8O B;  1QGK B;  1JM0 A;  2E75 D;  1SQB J;  4DCK A;  5KLV K;  3G71 P;  1LWU C;  2YMK A;  1NTZ D;  5AVZ B;  2IYP A;  5KAI H;  3PHL A;  4WY4 C;  4PV1 D;  3G4S P;  3HD7 B;  2J58 A;  2BEQ D;  4XFJ A;  2YIU C;  1RF1 B;  2KXP B;  5APX A;  4R4M A;  1VF5 D;  1HTL C;  3V5B A;  1QL2 A;  1IK9 A;  4OVN F;  5E79 E;  1FOS E;  3NXS A;  2YNY A;  3H1K D;  2A45 H;  1N73 C;  4O9B A;  2GA1 A;  3KYQ A;  1PP9 G;  1EDJ A;  4U3F G;  1KN7 A;  1BE3 D;  1ZP0 C;  1Q81 Q;  1KIL C;  3P8C E;  1CW5 A;  5GTI E;  1OXZ A;  2OGU A;  2KP8 A;  1NVO A;  3I56 P;  2P7J A;  1M57 D;  1VQM P;  2HFE D;  3CX5 I;  2WPQ A;  2E74 D;  1PV3 A;  1J1D C;  1P84 E;  2B87 B;  3L71 J;  3L74 G;  3CC2 P;  1AQT A;  4H44 C;  2GUS A;  2YO2 A;  3KZI H;  1S4X A;  1SQX E;  1U57 A;  2GM4 A;  5APY A;  1OIP A;  4AQR D;  3L70 E;  3PP5 A;  1YBK A;  1KFM A;  1RF0 A;  3S9O A;  5AW5 B;  1LTJ A;  3T97 B;  1K9M Q;  1L4A A;  3U1A A;  2QA4 P;  1QVG O;  3M9H A;  3JC2 2;  3H1I J;  2J5U A;  1LWU B;  3P8C D;  3O6Q B;  1W2B O;  3H1J J;  1LTS C;  2KSJ A;  3M9B A;  2RMZ A;  2YIU B;  1ZV8 A;  2I1J A;  1N7S C;  3V4W A;  2WT7 A;  2FYU K;  3K5B A;  3R4Y A;  3Q5S A;  3MTU E;  3V2N A;  1N73 B;  1SQX D;  3VP8 A;  5AVU B;  1VQ7 P;  5AW3 B;  3L73 J;  1HJ0 A;  5APQ A;  3L70 D;  5B66 H;  3CXH H;  1KFN A;  4WY4 D;  2Y0D A;  4QMA A;  1GW4 A;  1MKM A;  2C0X A;  4GT1 A;  5KAI E;  5AW7 B;  1G2C B;  1VPC A;  1YQ3 C;  3AEA C;  3AEB C;  1URQ C;  2KNC A;  1VQ8 P;  2WQY C;  4H44 B;  5KAF H;  1SFC A;  5AW8 B;  2H7H A;  3Q5P A;  1J1E B;  1KIL D;  2QVA A;  1D7M A;  2FFD A;  1X79 B;  2QJP C;  1L0L E;  4Y99 C;  3V2Q A;  1FZC A;  2Q5U A;  3H1K G;  3L72 J;  5CMZ A;  1R5L A;  1YJN P;  5KKZ C;  2IBZ E;  2K9Y A;  1SQV J;  5B5E H;  2Z4E A;  3N7N A;  1T3U A;  2HLO A;  4H44 D;  3HRN A;  4N6J A;  5M1B A;  3SSU A;  2JJL A;  3RL0 g;  1EZV I;  1LT9 C;  4YTP C;  3BCC J;  4DT0 A;  2QEX P;  1N7S A;  1Z56 A;  2NRG A;  2M5A B;  3KZI E;  1HBW A;  4C7N B;  5AW4 B;  1SQP D;  1RQU A;  1OW6 A;  2LR2 A;  1KQG B;  3BAT A;  1L0L D;  3NTN A;  1NTK E;  3SFE C;  3HE4 A;  1DEE G;  1DIP A;  3RL0 C;  5KTB A;  2IBZ D;  2C0W A;  4NPE A;  4R4L A;  5AVT B;  1YHQ P;  1IFD A;  1L0N K;  4H13 B;  4D6T J;  2XDJ A;  1SQQ J;  3CCU P;  4K3A A;  1NO4 A;  3M0D C;  1KYO I;  1X22 A;  2WPR A;  1FU1 A;  4ZKP A;  1KB9 H;  1JB0 J;  4M3L A;  3W68 A;  1FZE A;  1VQ4 P;  3CMA P;  1GL2 C;  4Y99 B;  1T3J A;  1AFO A;  1QX8 A;  1SP4 A;  4PD4 I;  1PGJ A;  3VMX A;  4BRY A;  5B66 E;  3CXH E;  3FX0 A;  4H13 D;  4ZNC A;  1NTK D;  5H2F H;  3EQ2 A;  1PP9 E;  4U3F E;  1URQ D;  5GTH E;  2WWW A;  3NFQ A;  1JCC A;  3PRJ A;  2P2U A;  1JY3 P;  3CL3 D;  3GHG A;  1VQ6 P;  1FE6 A;  1VQ5 P;  3NMD A;  1VQK P;  2D2C C;  3SWY A;  2PAJ A;  2B88 A;  2HOD A;  2ZYD A;  5KAF E;  4A7P A;  1FJK A;  2B89 A;  1EDK A;  2YXR B;  2QJK B;  3HTK B;  1PFI A;  2E43 A;  2AXT H;  1GMJ A;  4WWI A;  2KK7 A;  5B5E E;  3CXH D;  1KOR A;  1NHL A;  2G3A A;  3B5N A;  1PP9 D;  3LIE A;  1JMM A;  2AXC A;  3KDP B;  1Q90 D;  1DEB A;  3CWB D;  4IL6 X;  1AA0 A;  3AEE C;  2WPS A;  1JO5 A;  1LP1 A;  2IFM A;  2O3J A;  2V7Q J;  2Y9Z A;  1MZ9 A;  3VMA A;  2WSF H;  2E5Y A;  2YO3 A;  1RE3 C;  2PP6 A;  2KYV A;  4LLH A;  2ZYG A;  5KLV E;  5BVZ A;  2DW3 A;  1BGY G;  1L0N G;  1SQP G;  2NPS B;  1GL2 A;  2OYH B;  2C9L Y;  1KQF B;  3S4R A;  3SWK A;  1U7J A;  1GK4 A;  3U59 A;  1BDD A;  2N1T A;  1VQ9 P;  1CI6 B;  3GF3 A;  2K9J B;  2WMM A;  2IBZ G;  1NU1 K;  1OX3 A;  2RKL A;  2KS1 B;  1TU3 F;  3F89 A;  4Z1M H;  1JOC A;  4I6M C;  3V4Q A;  2K88 A;  4HJG H;  1RE4 A;  1CSB A;  2NPS D;  2OYI B;  1KB9 E;  3VN0 A;  3O8Z A;  5CBO A;  3A2A A;  3Q3D A;  3M06 A;  4GDO A;  1LTG C;  3L74 J;  1A02 J;  5KLV D;  2CK3 H;  4HYT B;  1K73 Q;  4N3Y B;  1A02 F;  3L75 J;  3GF7 A;  3KXD A;  5H2F E;  3USS A;  4RO0 A;  4GOF A;  2I1K A;  1Q2N A;  3AE6 C;  5EFW B;  4H0L C;  1RF0 C;  1Y9B A;  1GD2 E;  3ITK A;  3HUS A;  1LTJ C;  1EDI A;  1VF5 B;  1L4A C;  2JWD A;  3AE5 C;  1EDL A;  2W6B A;  1L2P A;  1GTW A;  3TGU J;  2H88 C;  1MV8 A;  4EIJ A;  2XU6 A;  2QG4 A;  4PJ0 H;  2YKQ A;  1SQB K;  1JY3 N;  1IFI A;  1KB9 D;  1QL1 A;  1RE3 A;  3VOP A;  4ZMD A;  3G9R A;  1N2D C;  2AXT E;  1BDC A;  3H32 A;  1XTC C;  3FGA D;  3H1I E;  3R2P A;  3H1J E;  3D6Y A;  1RQV A;  2E74 B;  3W67 A;  1KMI Z;  3HD7 A;  1RH5 B;  1FZB A;  1IFN A;  4I1L A;  2XKM A;  1M1J B;  1RF1 A;  2P10 A;  1K05 A;  3H1L G;  2FYU E;  2W83 C;  5AVY B;  5CCG A;  2Q1K A;  2H89 C;  3QH9 A;  1NTZ J;  3CWB G;  3L71 D;  4TT3 H;  1WMK A;  1HJB A;  2W27 A;  1N7L A;  1R8E A;  2K3R A;  1NU1 G;  1G1J A;  2CPS A;  5BU8 B;  5CHX A;  3G3Z A;  2QRX A;  2KSE A;  3OJA B;  4JYC A;  2E5T A;  2FXP A;  1SFC C;  1ZR2 A;  3H25 A;  3H1I D;  2OTJ P;  2FFD C;  1IFJ A;  5AVX B;  3FWN A;  1FZC C;  2ITA A;  1IO4 A;  2H8P D;  4H0L B;  3H1J D;  4AYC A;  1FJP A;  1BE3 J;  2Q3E A;  3GG2 A;  1LTJ B;  2E76 C;  2HPC A;  3A5T A;  1YQ4 C;  4WBA A;  3CCV P;  2KLV A;  1DH3 A;  1NAY A;  2GUV A;  1MFZ A;  1KZU B;  1P84 I;  2FYU D;  1JTH A;  3FWL A;  3KHU A;  1KQL A;  2WSS H;  3CME P;  3C8V A;  1YIT P;  3CX5 D;  1CZQ A;  1T2K D;  1S9K D;  1VDF A;  4WY4 B;  1S5L X;  2KIK A;  3T97 A;  1PL5 A;  4TLF A;  4H0L D;  3JCU H;  1ZRT E;  1T8Z A;  2JKV A;  4JQ0 D;  2V4H A;  2Q7C A;  5KLV G;  4EOT A;  2Y0C A;  3L35 A;  1L4A D;  1BCC E;  1EXI A;  4JYB A;  1KIL E;  2JEE A;  4MN4 C;  3RK3 C;  4GOE A;  3CCJ P;  1T6A A;  2OQQ A;  3IR9 A;  3I55 P;  4IFF A;  3A7O A;  2ZJS E;  2OYO A;  1X9V A;  1KIL B;  3B8E B;  4W7Y A;  4PJ0 E;  1EC5 A;  2O1K A;  2WSC J;  1LGH B;  1JY2 N;  3F5H A;  2WSE H;  5GTH H;  3C1L A;  2JO1 A;  2WVR A;  1J1D B;  1HF9 A;  1ZR4 A;  2Z5H A;  1FS0 E;  1ZRT D;  3LW5 J;  1SFC B;  1BGY E;  1L0N E;  5APS A;  1SQP E;  1PGO A;  1SQX J;  1BCC D;  2HYN A;  1NOH A;  2QJY C;  5AW2 B;  3L70 J;  1SQX K;  5KLI C;  3AEF C;  2E76 B;  1GK6 A;  1FDI A;  4C7R A;  3EWK A;  4CPG A;  1IK7 A;  3M0A A;  3TSI A;  2Y9Y A;  2WPV B;  1SQV K;  3L71 G;  1EZV E;  2B9B A;  3V6I A;  1SFC D;  3MIW A;  4RKU J;  3GHG C;  4JBZ A;  1AQ5 A;  2A45 I;  1QEX A;  1SLQ A;  3A0B H;  1N7S B;  2E76 D;  2IFN A;  3OAK A;  2IBZ I;  1HH0 A; 
#chains in the Genus database with same CATH homology
 4AUW A;  1LTB C;  4DZO A;  2LKM A;  1HUC A;  1W2E A;  1SVF A;  4IFD K;  1GZL A;  2WT7 B;  1LWU A;  1NHL A;  3HE4 B;  4RES B;  5KLV K;  3B5N A;  3LIE A;  1JMM A;  3L37 A;  3RK2 C;  4IFM A;  4XE5 B;  3KDP B;  4WY4 A;  1LWU C;  3C9I A;  1FOS F;  1DEB A;  5AVZ B;  2E43 A;  4C7N A;  3B5N C;  1N7S D;  1DX7 A;  5APW A;  3U1C A;  2WPS A;  1JO5 A;  4WY4 C;  3HD7 B;  2IFM A;  2J58 A;  1RF1 B;  1MZ9 A;  2M8R A;  2WSF H;  5APX A;  1WRG A;  2Q9I A;  2H43 A;  2YO3 A;  1IJD B;  1RE3 C;  2PP6 A;  2KYV A;  4LLH A;  1FAV A;  1HTL C;  3V5B A;  5BVZ A;  3BVH A;  4LC1 A;  1N73 A;  1QL2 A;  1GDT A;  1SQQ K;  2ZXE B;  1URQ B;  2NPS B;  1IK9 A;  3HE5 A;  1GL2 A;  2OYH B;  1FOS E;  3NXS A;  2YNY A;  1HWT C;  2C9L Y;  2A45 H;  2XZR A;  1N73 C;  1GK4 A;  4O9B A;  3U59 A;  3EFG A;  3KYQ A;  2IX7 C;  2N1T A;  1CI6 B;  1KIL A;  1JY3 O;  5AW6 B;  2KB7 P;  1ZN5 A;  1L0L K;  5AW0 B;  4LGD E;  1FDM A;  1HGV A;  2N1T C;  2FFD B;  1NU1 K;  1KIL C;  1FZC B;  3P8C E;  4JF7 A;  1RY3 A;  3M91 A;  1CW5 A;  1G2C A;  1JOC A;  1OXZ A;  2KP8 A;  4I6M C;  2XV5 A;  1GU4 A;  3V4Q A;  2P7J A;  2MJZ A;  3N4X A;  1RE4 A;  1CSB A;  2NPS D;  2HFE D;  1E5W A;  2WPQ A;  1NTM K;  2OYI B;  5AW9 B;  2WIT A;  3VN0 A;  3O8Z A;  1J1D C;  1RE4 C;  1MUU A;  1LT9 B;  3A2A A;  5CJ4 A;  3M06 A;  1YTZ T;  3P8M C;  4ZKU A;  2GUS A;  1LTG C;  1IFM A;  2HOD B;  4HH2 A;  1A02 J;  2YO2 A;  1FZA A;  1FBM A;  3CI9 A;  2GM4 A;  2IPP A;  3P7K A;  4HYT B;  5APY A;  4N3Y B;  4AQR D;  5AVW B;  1A02 F;  3PP5 A;  3UIA A;  3VYI A;  1G1I A;  1KFM A;  1RF0 A;  3BAS A;  5AW5 B;  1LTJ A;  2I1K A;  4XA4 A;  1L4A A;  3U1A A;  2E42 A;  5AVR B;  1RF0 C;  1GD2 E;  3M9H A;  3HUS A;  1LTJ C;  3RK3 B;  1LTT C;  3RL0 B;  4W80 A;  1L4A C;  1H89 A;  1LWU B;  3P8C D;  1NKN A;  5BU5 A;  1NAF A;  1FZF A;  2VRS A;  1LTS C;  2W6B A;  3HUS C;  1GTW A;  2KSJ A;  3M9B A;  2O1J A;  3TNU A;  3HTK A;  1MV8 A;  4EIJ A;  2XU6 A;  2YKQ A;  1SQB K;  1JY3 N;  1IFI A;  1ZV8 A;  2I1J A;  1N7S C;  3V4W A;  3MGN A;  5KJ7 A;  2WTY A;  1QL1 A;  1RE3 A;  3VOP A;  2WT7 A;  3V2R A;  1N2D C;  2FYU K;  5KJ7 C;  3H32 A;  3RK3 D;  1XTC C;  3MTU E;  4DOJ A;  2P67 A;  3BRT B;  3RL0 D;  3V2N A;  1N73 B;  3VP8 A;  1GW3 A;  5AVU B;  3HE5 B;  4GKG A;  1GL2 B;  3R2P A;  5AW3 B;  2BAS A;  5APQ A;  2YKP A;  2FXM A;  3MD0 A;  1KFN A;  4WY4 D;  2ZFC A;  1GW4 A;  3HD7 A;  2HG5 D;  1FZB A;  1IFN A;  4I1L A;  1J2J B;  1SQP K;  2XKM A;  1M1J B;  1RF1 A;  2O01 H;  4C46 A;  2W6A A;  2YKO A;  3II6 A;  4OH8 B;  2C0X A;  4GT1 A;  3VP9 A;  3HD7 C;  5AVY B;  5CCG A;  5AW7 B;  3VMY A;  1RF1 C;  3SWF A;  1G2C B;  1VPC A;  1URQ A;  4GIF A;  1HJB A;  2OYH A;  2W27 A;  5CCG C;  1N7L A;  1G1J A;  1GL2 D;  2CPS A;  1URQ C;  5BU8 B;  2NPS C;  3G3Z A;  5CHX A;  1N86 A;  2OYH C;  1CI6 A;  1SFC A;  2Q3I A;  3GHG B;  5CCH A;  5AW8 B;  2H7H A;  3A3Y B;  2QM8 A;  1J1E B;  3OJA B;  1KIL D;  2FFD A;  1X79 B;  4JYC A;  2L5G B;  2J59 M;  4Y99 C;  3V2Q A;  1FZC A;  2Q5U A;  1SFC C;  1ZR2 A;  5CCH C;  5CMZ A;  3BRV B;  1JY2 O;  2FFD C;  1IFJ A;  1EQ7 A;  5AVX B;  1FZC C;  1NKZ B;  1IO4 A;  2H8P D;  2R3C A;  1LTI C;  1HGZ A;  3L36 A;  3VTP C;  4AYC A;  2Z4E A;  3N7N A;  1FJP A;  1T3U A;  2R5D A;  1LTJ B;  2HPC A;  3A5T A;  2XNX A;  2Z5I A;  4WBA A;  2KLV A;  1DH3 A;  5AW1 B;  2HLO A;  1LT9 A;  3HRN A;  2GUV A;  3P32 A;  4N6J A;  3TK1 A;  1FZG A;  1MFZ A;  2OYI C;  3HUS B;  1KZU B;  1LTA C;  3VMZ A;  1JTH A;  2JJL A;  1NTK K;  1KQL A;  3RK2 B;  1LT9 C;  1JY2 P;  2FYZ A;  1OWA A;  1NWQ A;  1H88 A;  3B5N B;  1XTG B;  1CZQ A;  3LID A;  3TNU B;  1T2K D;  1N7S A;  1S9K D;  1VDF A;  1NH4 A;  1Z56 A;  4WY4 B;  2C9N Y;  4B86 A;  3T97 A;  1HBW A;  4C7N B;  5AW4 B;  1JNM A;  1ZLL A;  1T8Z A;  3TYY A;  2Q7C A;  4EOT A;  3L35 A;  1L4A D;  4JYB A;  3BAT A;  2JEE A;  4N78 E;  2M3B A;  3NTN A;  3H32 B;  1IC2 A;  3HE4 A;  3RK3 C;  2YMY A;  2P1J A;  3RK2 D;  3RL0 C;  3H6P A;  5KTB A;  3IR9 A;  5APV A;  3B5N D;  2C0W A;  3I5C A;  5AVV B;  2POH A;  5AVT B;  1M7L A;  4IFF A;  3A7O A;  2N1T B;  1WT6 A;  3M0D A;  1IFD A;  1L0N K;  1X9V A;  1KIL B;  5KJ7 D;  3B8E B;  4W7Y A;  2XDJ A;  1YTZ I;  2WSC H;  1X8Y A;  4KHX A;  2CPB A;  2O1K A;  1LGH B;  1JY2 N;  1NO4 A;  3M0D C;  2WSE H;  2WPR A;  1FU1 A;  4ZKP A;  2R32 A;  2R5B A;  4M3L A;  2NPS A;  3L4F A;  5APU A;  2N9B A;  2A45 G;  5AVS B;  2KOG A;  1JCD A;  1FZE A;  1J1D B;  1NTZ K;  1S9K E;  1ZR4 A;  3LW5 H;  1YYC A;  1GL2 C;  2Z5H A;  4Y99 B;  1T3J A;  1M1J A;  1AFO A;  1SFC B;  1SP4 A;  5CJ0 A;  1JUN A;  5APS A;  3VMX A;  3HD7 D;  2N1T D;  2HYN A;  1NOH A;  1M1J C;  4N78 D;  5APT A;  4WB4 A;  5AW2 B;  3OA7 A;  1HVV A;  1SQX K;  2QM7 A;  2OAR A;  5AVQ B;  5CCG D;  3EQ2 A;  3M9Q A;  1GK6 A;  1URQ D;  4C7R A;  4W7Z A;  2WWW A;  3CLQ A;  3KQG A;  3NFQ A;  1JCC A;  3M0A A;  3TSI A;  2P2U A;  2HPC B;  3KPE A;  1JY3 P;  3CL3 D;  3GHG A;  2OYI A;  3IFM A;  1SQV K;  1L4A B;  1SFC D;  3MIW A;  3NMD A;  5CCH D;  4I2L C;  3SWY A;  1GU5 A;  3MUD A;  3V2P A;  3GHG C;  2PAJ A;  1JTH B;  3E1I A;  1AQ5 A;  2A45 I;  1J1E C;  3WMM 0;  2HOD A;  1FJK A;  1SLQ A;  1H8A A;  1N7S B;  2IFN A;  1T2K C;  3HTK B;  2WZ7 A;  3OAK A;  2FKW B;  1PFI A;  1HH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...