1LWXA

Azt diphosphate binding to nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
b'VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRAIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray analysis of azido-thymidine diphosphate binding to nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1lwxA00
1F6TA 3Q8UA 3ZTPA 3GP9A 3EMTA 2DXFA 3NGTA 4UOFA 3B54A 3ZTOA 2DXDA 3GPAA 1HIYA 1WKKA 3VVTA 3VVUA 3ZTSA 2ZUAA 1K44A 1NHKL 3WX8A 3NGUA 1HLWA 2CWKA 4ANDA 2AZ3A 3ZTRA 1S5ZA 4HR2A 3FBBA 4EK2A 3Q86A 3FBEA 3BH7B 1NUEA 2AZ1A 1U8WA 3Q8YA 2DXEA 3ETMA 1NPKA 1MN7A 1S57A 1PAEX 3B6BA 1XIQA 3VGVA 1LEOA 4CP5A 1NDLA 1NDKA 2DYAA 3FKBA 4W98A 3BBFA 3FBCA 3PJ9A 4DI6A 3FCWA 1F3FA 3BBBA 2HVEA 1NSPA 1WKJA 3EVOA 2NCKL 1B99A 4UOGA 3ELHA 4S0MA 5IOLA 3Q8VA 3FCVA 1NB2A 3VGTA 4DUTA 1JXVA 5BXIA 1NDPA 3NGRA 4FKXA 4ENOA 4F36A 3VGUA 4KPCA 3EVMA 4FKYA 2B8PA 1WKLA 1NDCA 1S59A 4UOHA 1NSKL 3DKDA 3L7UA 4O0NA 1W7WA 3FC9A 4DZ6A 5CAAA 3EICA 5C7PA 3EJMA 1MN9A 2HURA 3R9LA 2B8QA 1BHNA 4C6AA 1EHWA 3NGSA 1B4SA 1BUXA 4ANCA 1LWXA 2DY9A 4ANEA 1NCLA 5CABA 3PRVA 3Q83A 1HHQA 3FBFA 3BBCA 3EE3A 1UCNA 1PKUA 2BEFA 3Q89A 3ZTQA 3G2XA 3EVWA 3ENAA 2HVDA 3EM1A 3VGSA 1BE4A 1NSQA 1NLKL 4F4AA 1XQIA 1VYAA 1ZS6A 2VU5A 1KDNA 3MPDA 3BH6B 4WBFA 2BX6A 3JS9A 3DDIA
chains in the Genus database with same CATH superfamily
4DL4A 2KHCA 1MU2A 2DY1A 3N5FA 1U1QA 4EGLA 2A6OA 3GFHA 2RT3A 4I4BA 5IT9Y 2LYVA 1UFWA 4DSIA 2N7CA 5F8MA 4Q2MA 2LEAA 1EETA 1JLGB 3TNVA 3P8BB 1L3SA 1RTJB 1FDNA 2W2NP 1S9EA 4TXSA 5CD4H 1V9OA 2KXFA 4LR9A 2ZHOA 5A8WB 1VQKS 1RTIA 4YDXA 1CJKA 4DV7J 5BR8F 2HHSA 3RAMA 2R3VA 1Q0NA 3QQCD 1BQNB 2YNHB 5JJBA 3OVSA 2RF2A 3J7AN 4F0KA 1SC4B 1KFDA 2ZC4A 3SDEB 2GVDB 4HDGA 4X4SA 4OHVA 1CJVB 4J90A 3RBEA 4RW6B 2WVFA 5HSPA 3J7Z5 4NCBA 3TO8A 2UZAA 2QV6A 4QIFA 1RYSA 1S49A 1UZDA 1M1KT 1WC6A 3OQ2A 2DVIA 3R8YA 4HL9A 2IAJA 1A7GE 2VG6B 3M30B 3K17A 4B9TA 1IBKJ 2FTRA 1NHUA 3BGUA 5JVHQ 2FHJA 2HBRB 4TYBA 2CDQA 4PPDA 2GIFA 2AEJA 3M2VB 3NS5A 3CJ0A 2FVSA 5B0CA 3QT5A 1WSRA 3GLJA 2D9OA 1NPKA 2LXIA 5GAEI 1BLUA 2QRRA 2Y9HA 1TUGB 1X31C 4WXOA 3W60A 3SMZA 1KNZA 2UVUA 1FJGF 2FLOA 1FVQA 1SC1B 4DLEA 3BREA 4ID8A 2FLNA 3PIPQ 4OZNA 3A12A 2B8QA 4WKRA 4JV0A 3E01B 2AQ4A 4OX8A 5EX0A 1UVMA 3C2PA 4L3KA 1MROB 3N0VA 2W4PA 4NWBA 2HHHJ 4LF5F 4RU9A 4XPEA 3OL8A 3NNHA 1P8GA 4YP3A 3KTQA 2BANB 2MLYA 1VGYA 3PW5A 4KR0B 4PXEA 1RT6B 1H73A 5K5MA 3G71S 2A2CA 4ANDA 3MWBA 4HR2A 4NMXA 2B7BB 2DPIA 1RWPB 1MSWD 3NS7B 3BN4A 2F1FA 4A8OA 4WP3A 5EWGA 2B6AB 2YXLA 1RA6A 1FKOA 4DQPA 2LU2A 2IMWP 2W7OA 2MYFA 5IXUA 2HHUA 2YPYA 3CDAA 2AMCB 1UVJA 1N34J 1GXTA 1N5SA 3I0SB 3C46A 2YKOA 2HK2A 2HQFA 4ALZA 4YEAA 1NK9A 2YKMA 4Y00A 4DS4A 4N76A 1CC7A 4JYAJ 1KQKA 2MQPA 1YGYA 2J76E 1VRTA 3EDQB 1WC3A 3QGHA 4LBPA 4ID5B 3NLCA 1VHIA 2DGXA 1VIXA 2GZOA 4K4XA 1TKZB 1R8AA 2D69A 4J9LA 3J80U 2ROEA 2R8GA 4ELTA 1S9GB 4E98A 4ECVA 2YKQA 3IXQA 2FIUA 2ZKUA 3L7OA 4NI2A 2QFIA 1Z1ZA 3TX0A 2P2CB 2M70A 4YQWA 4ICLA 2AWZA 2OPPA 4A8FA 3ETMA 2CQ0A 5D0EA 4DQIA 3L95X 2IRUA 2VDIA 3W8GA 5IOLA 1U1OA 4QW9A 3M6VA 1EP4A 1U0SA 4FKYA 1EIYB 3PJWA 1WDTA 3KHGA 4G65A 1Q7LB 2ZH3A 4PQUA 3EJMA 2WOMA 2ZWOA 2QX0A 3O5TB 4HEA9 2XBPA 1N32F 2H5EA 2WVEA 2L41A 3W2VB 1UAWA 3K89A 3RW7A 2DGUA 1LW0A 4R5PA 1FWPA 2DGWA 3CIMA 3CCWA 2Z0GA 3Q8UA 3EZOA 2GNKA 3TANA 1JJ2R 3ZZOA 1HQEB 2HHXA 3RJMB 4M5JA 4CO1A 3MM8B 1AW0A 5GAGU 2CWKA 3CCMS 2RVJA 1WC5A 2Q79A 3P45B 1TL1A 5D0HA 5KFLA 2YWGA 2DXEA 2E5JA 3UWTA 2G1HA 5HQ8A 1UEVA 2HHPA 3MUTP 5EN1A 2FUG9 3BKUA 1R0CB 3C6TA 2V9WA 4ZLPA 3V6DB 2AX0A 5B0DA 3D7SB 1G4CA 1YRTA 4R0JA 1S97A 2C3MA 1S76D 4ZPCA 3DKDA 5EWFA 4YR3A 3TJAA 4OV1A 2B4VA 5GMEA 3O8WA 4N5SA 1WHXA 2H5IB 2CPXA 4C48A 3KK2A 4YUDA 1HPZB 1HL6A 4P7TA 4B3OA 4KGKA 1NEEA 2Q6BA 3CGIA 3QZ7A 3NMAA 1E6YA 3P5TL 3FRZA 4F67A 2FYXA 2Q3PA 4NXMF 2CUYA 2VPWB 1SC6A 2N4DA 3NAHA 1KC8T 2POKA 2IHR1 3TUZC 3QFWA 5IC6B 4IG3A 3I5AA 1RHMB 2DO0A 2HVIA 1Y5NB 2G0JA 1I94J 4UY8T 1U8WA 3MM9A 3R3TA 3WC0A 2VDHA 2ZVSA 1RT7A 2IJNA 2CQ1A 3CT9A 3QNWB 3Q8VA 5ETTA 4AXJA 4JI6F 2GGPB 2E7XA 3T1YF 4LIRA 3RYLA 4OZLA 1FRIA 5HMXA 2ACYA 4X2BA 3BKFA 1MNEA 2WB1D 2DNPA 5B0EA 4DV5F 3MOZA 4DHVA 4DV0J 1K1SA 5LMUF 4P10A 5CZXA 4B9SA 4WZQA 2DR5A 3TEHB 5D8HB 2ZD1A 1Q7YT 3GG1A 1FNMA 4X4RA 4C8ZA 2RAQA 2IDLA 3CMQA 4EEYA 3I9V9 3IAS9 4DG1B 1S6PB 3GFZA 5GMKa 4DU7A 1IBMJ 4Y2CA 4EO8A 4OYOA 2VBWA 4IRKA 4JI7F 4USUA 2UXBF 3PACA 4J5OA 3DLJA 2WW4A 4DR3F 3M8PB 4DMZA 3W63A 3QBCA 2PMWA 3VZIA 2XNQA 2GC8A 2GAGC 1U1KA 4CI0B 3ILJA 5CYQB 2AKWB 2ROPA 3LA0A 3HHLD 2CPYA 4O44A 1T9YA 1VOMA 3UDEA 3I55S 4HI2A 2E1RA 2ILZA 3MURP 2KM8B 5EGYA 3G6ES 3KJNB 2LCWA 2XMKA 3IG1B 2HZVA 2AGOA 1WG1A 1LFWA 3M2UA 3PJXA 1RE1B 3T3FA 2DO4A 2JRSA 1TKDA 3DLGB 4OZ3A 1QDUB 3EM1A 4DCOB 1X0FA 4QR1A 2I1RA 4ZKAA 1S0MA 4B3MF 1FEHA 3G6XA 2HBZB 2WVCA 4HH0A 4L75A 1N5YB 4L74A 2JVOA 1P1TA 2QL7B 3EMTA 1UWBB 1RHQB 3C19A 5DZ6A 5KFGA 2Z2MA 1O51A 3NCRA 3DMJA 4YHHJ 1RXOB 1NHKL 1VJWA 2K7KA 3CO9A 2Z56B 5IQQA 1KHVA 2HEKA 3R5JB 2QA4G 1Q53A 1WOOA 3B6BA 2FVQA 4F2RA 1TVRA 2VZ9A 4NA3A 3HMJG 1IBCB 3OTCA 3SQGB 2JVRA 3IBCB 4U67Q 2Z58B 2BBEA 5KFQA 4M8LA 3LWMA 2CQIA 3S01A 4J9MA 3S8SA 3BEGB 1YVFA 3G82B 1CJTA 2HURA 2FLPA 2U1AA 4ZN3A 1LK7A 5DO2A 4DSJA 4GKJJ 1HWLA 4CLLA 2ZZTA 2F3JA 4F25A 3ICLA 2CQGA 1T05A 4X66F 3CCJS 4ILRA 1C1BA 5K20B 4FS1A 1VS3A 3M6XA 2W2MP 3AJ2A 1U24A 3ZZRA 1S6UA 4C8LA 1RWKB 4LF6J 1IQTA 2BDPA 2KHDA 3BF4A 1K44A 2VF3A 4BC7A 4OYXA 1N4LA 4MKBA 1V6HA 2HFZA 5D3GB 3HPOA 1VFJA 4YB6A 4OZ5A 4KV8A 4IDKB 2BQ3A 1YJTA 2XSJB 5HK4A 5CXTA 3BR8A 1K47A 2HQIA 2EFPA 5I42A 1T3OA 4WFYA 1YWXA 2Q1LA 3K2YA 3DM2B 4LFAJ 4JI4F 3N28A 5HL7Q 5U47A 4W92B 4I2PB 4B9MA 5HJXA 2ZNZA 1CBKA 2RMLA 3LWLA 1OSCA 1JLAA 4RW9A 4EBDA 3UCUP 3DYAA 3AJ1A 1NSQA 4ZK7M 1VYAA 3K5MA 2MLXA 4ZPWR 5D0GA 4DV4F 1NMEB 2KB2A 2BE2A 3PG9A 2B5JA 2R2UA 4X4NA 1BY9A 3A8JA 1F3VA 2O1PA 5DZ7A 4HYKA 4LF1A 1PC4A 4OYIA 2YTCA 3KUHA 2YKNB 2HYIB 1LFPA 3GR0A 4MKAA 2HHWA 4ZS6A 4Y2MA 1HBNA 4QR0A 4LSNB 4DPUA 1V3RA 5E3RA 1NU4A 2RQMA 5C24B 3H98A 4O4GB 3VV2B 3OFFA 3NCQA 4ZJLA 3TAPA 3C15A 2UVVA 2JNJA 2MKKA 2Y1LB 3DRPB 4TQSA 3K0JA 4LQ9A 4QWEA 1WDDA 1KKHA 3DI6B 1OY8A 2DJWA 1I3OB 3MEKA 2YX7A 4B9LA 4QR2A 4XDCA 3KK1A 4GVBB 5KOXA 2ZEJA 3Q83A 3S7RA 2W9CA 3CCVS 3H2LA 1T94A 1U6FA 3EPGA 4K5SA 2RQCA 3UI3A 4FDFA 4HDHA 3G8QA 2QC3A 3P49B 3C6UA 2PMZD 3ZTOA 1SQEA 2O01C 2CJXB 1R8PA 4OLOA 1C0TA 1HMVA 8ATCB 4LF9F 4DR7J 3P5BP 3DOMA 4DFPA 1DLOA 4H4MA 1OQ6A 2SXLA 2UU9J 3CW2C 3ETOA 3BDPA 1S7HA 4U8YA 1KFSA 4LSLB 2X7IA 2XEXA 1VK3A 3K57A 2C22A 2LA4A 3UN5A 2W8LA 1FJCA 2BKPA 1U45A 1X8DA 5CD4A 3Q8SB 1QTMA 3AT1B 2PMHA 1DHMA 2RJZA 1DTTB 1FFWB 2GHPA 3FZBA 4J9QA 3Q24A 1CPZA 2R7RA 2PO4A 4UZCA 1IR2A 1XQIA 1UZHA 4ZVOB 4WBFA 3J81j 4OX6A 3LH2S 1ACMB 2F4VF 4A8YA 3UCGA 3UD5A 3FGVA 1WF2A 3GCXP 1X4GA 4DV2F 3B78A 2AJQA 2RNEA 3HP6A 2M8DB 1NZAA 5HJYA 1FDDA 4C4WA 2KO1A 1F60B 1OO0B 1JNZB 4JI2F 4M5DA 3MCMA 2IVYA 2QA1A 4JBCA 2R7TA 1I6JA 2FY8A 2FZKB 1WNEA 3C16A 3DU5A 1BQMB 5BXIA 4FKXA 5J2QB 4DQQA 4DFKA 3OL7A 2P6TA 2UXDJ 3CDWA 2UXCF 4ETXA 2JWNA 1XMOJ 2JLGA 4TYAA 4DPWA 1L3KA 1N48A 5KFEA 3LP2A 5C25B 5HLFA 1C1CA 3NOGA 1SIWB 3BR9A 3VALA 1R0BG 2NSBA 4CO4A 3MEDB 2BR0A 2MQ8A 2JSXA 1U6BA 3GONA 4FF3A 1JLBA 3GYXB 3DRSA 2QT7A 2ZNYA 2I5JB 4MKYA 3IWNC 3RRKA 4L3NA 1JLEB 1S48A 5KFSA 2XWXA 3DDNA 5G0RB 1TL3A 3RAXA 1YRXA 1T3NA 2O3DA 1ZBTA 5HVHA 3DOKB 2F8EX 4NLXA 5BR8J 2HRUA 3BBBA 2VJVA 3PX0A 4RW8B 4OX9J 4X65F 2HFUA 2LQ5A 1JLGA 1XBWA 1UVKA 4KBIA 5AXKA 1UWAA 3CJSA 3MPYA 1RTJA 2EI5A 1X60A 3GIJA 5CQGA 5A8WA 1B7FA 3BGLA 4OYWA 3LOUA 3RAQA 3CCUS 2DIUA 4ZVRB 2E9RX 2H54B 4I6WA 2VPYB 2YNHA 4C8YA 1B0VA 3RB6A 2F7VA 4ZCLA 2CVIA 3IC1A 2OFGX 2AJ4A 3TJ9A 4ZVUB 4C9DA 3SDEA 2GVDA 5SUHA 4KT0C 5E2QA 4NCAA 3SBMA 3L3CA 4RW6A 1A0OB 2G0CA 2FHMA 3RRHA 1RT5A 3MHYA 2DGTA 2QYGA 1R0AB 3DN9A 2YNGA 2XMWA 4WP8A 3T9ZA 3ZTRA 2KU7A 2VG6A 3M30A 2GHVC 4Q8EA 1R3NA 1HWUA 2C2OB 2M8HA 1SUQB 3M2VA 1JXVA 3R7NB 2UVRA 4F36A 4CZCA 3QPIA 4DR1F 2MZSA 3Q22A 1VQ5S 1HBUA 2VPZB 5HROB 3CF5Q 4JI5F 3MPVA 2DD8S 4PZVA 2J0QD 2YNIB 1PAUB 2CDRB 2IPOB 4I1TA 2I2YA 2O66A 4ECXA 4URGA 2GIRA 4Q8FA 2HQCA 2M0GB 3H25A 4K5RA 1IKXB 3ZZYA 2IYIA 1JXLA 2VC1A 1TV6B 3SV3A 3TP2A 4DBQA 2HAIA 3T6BA 4GRSA 4BHQA 3D0IE 3J7A1 1RT2B 2F9JA 3ZTPA 4CT9A 1Q1KA 3E01A 6FDRA 2PIIA 2V8DA 1MROA 1ZA1B 2OEJA 2QL9B 1T03B 1VQ9S 4RW7B 4NLVA 4DR4J 2BW2A 2VICA 2AYGA 1ICEB 5AE1A 2DBBA 3KJVA 4PWUA 2JX2A 1HNXJ 3VGVA 4KHPF 1FVSA 4DFJA 1HBOB 3FQLA 1RT6A 2WBMA 2K06A 3J81U 1LXNA 1XNRF 2CKWA 2HBYB 5A8RB 3SQOP 1J5OB 4IG0B 1IKWB 1Y7PA 3GJRB 3X3UA 3ET6A 2A6MA 3KLHB 5THWA 2HS0A 3D54A 1KLMA 1X7VA 4RUAA 2LEPA 4ED6A 3MTJA 3PFEA 1U1NA 4K0KF 1VQLS 3MM6B 3EE3A 1AUSL 2IDEA 1UL3A 1MW7A 2HK3A 4PRFA 3KFWX 2ALYB 4J9SA 3JSRA 1AFJA 2XZTB 4NYPA 4IQXA 2D7SA 1NK4A 2X51A 3JQJA 2M3DA 3H90A 2OH2A 5M2PA 4ID5A 4CNYA 1S5ZA 5L1JA 1H74A 5B7WA 2RD5C 2CVEA 3NBPB 4NLTA 2FVRA 1Q8BA 2K1RA 1X4EA 3PJ9A 1FRMA 3C66A 2OFHX 1S10A 2ZM6F 2FLLA 2EEYA 3M2RB 1N32J 4ED8A 1TK8A 2HGLA 4H4OA 2VONA 1EQ0A 3ONQA 3ZZ0A 2FZGB 5LL6d 2Y0BB 1WTFA 5B0GA 4ZVGA 5HO4A 4GC6A 4A46A 3MM5A 1IBKF 4Q44A 1BC6A 4K8RA 1IXKA 2R9LA 4J9RA 3PYEA 3QIDA 3PXGa 2YKPA 2ZH7A 1DFDA 2GA7A 4B02A 2D3UA 2PE8A 3CCRS 3W2VA 5GADI 5J1PA 4DN9A 1HNIB 4TLRA 4PYAA 4KAIA 4K4SA 5KFMA 1RTHA 4HTJA 3DFEA 2CJBA 3I5CA 1HQEA 5M2UA 3MM8A 2PGCA 3OFHA 3S6EA 2J9DA 2GX8A 4KKOB 2Z2LA 1VRUB 1RT4B 2EBGA 2ZC3A 4RBUA 1XTZA 2HSEB 2J6TA 4IH6A 4AT1B 2NXEA 3KOAA 1Y0HA 3HM9A 4NRUA 3EXYA 4RW4B 5C42A 2V4JA 3V6DA 1YJUA 2EBEA 2R7UA 3FJ2A 3GG0A 1VQ8S 4OZJA 1FTCA 1ELOA 2KVIA 3TR5A 4NXMJ 3GILA 2NXUA 4WPAA 3CC7S 3DDKA 3FUYA 1DQAA 2MZJA 1RBAA 4IQMA 5IWAJ 5ETLA 1HPZA 2CQBA 2XZWA 3DOLA 1BXNA 4OJ3A 1FHTA 4OYPA 2Y1RI 4C0OC 1BMQB 1QVGR 2ZITA 3HVWA 4QWAA 1QSYA 3KLIB 2HS3A 1PAEX 5IS2A 3OXFA 4JI6J 5KT3A 2MQQA 3HVTB 5L38A 3RR7A 1IJFB 3HD1A 4A8MP 4LT6A 1P9QC 3K5OA 1T9VA 4ECRA 5KFCA 4BWJA 1KEKA 1NDCA 4PEOA 3GYNA 5LMUJ 2OPQB 3SSSA 4NE9C 5E5NA 2AHOB 3JQKA 1HWJA 4TU8A 2GGPA 3I0RA 5KG3A 5CZVA 1S1WB 2HGMA 2ZKTA 2HVDA 4NL5A 1S0VA 5ETQA 5KT6A 2RRNA 2V34A 1RWOB 5BYSA 1OSDA 3I9ZA 2VIHA 3TI0A 4Z37A 3OHAA 1PBAA 4ZPAA 1OS5A 3FZ2A 1CC8A 3QLHB 2OUGA 1I5OB 3Q23A 3AOAA 2ROGA 4CTAA 5KFKA 2LQ8A 2UXBJ 3MPWA 2HS4A 5HP1A 4WU3A 3POTB 1WWHA 2XGQA 3JB9k 5FD1A 2DR7A 3MOJB 4XIUA 4IH7A 4U8VA 4FF1A 4IYQA 1HR0J 2KL8A 3A4TA 4DG1A 1OIAA 1GMUA 3ZXWA 1G2EA 4YOEA 3W64A 4WTOB 4C8KA 1SB6A 2APOA 1FO1A 2UV8A 4MK9A 4J9UE 5HMZA 3CE8A 3B4DA 4KO0B 2IA0A 1P6TA 1R8BA 4IUFA 2XNRA 5DQIA 1BWVA 2BOAA 4QW8A 4EMDA 1YZ6A 1M0SA 5L1IA 4I2QB 2DH9A 1WOSA 4WE1B 4P71A 3KLGB 4IRCA 3CPWR 2HVZA 1NJXA 3T19A 4D3HA 1VQ6S 3V6KA 3H20A 3MR2A 1RTDB 1QAYA 2R7SA 3BPDA 2KKHA 3OTEA 3DLGA 5DGBA 1YRUA 4EBEA 3FRYA 2AZ3A 2C42A 4ELVA 1FESA 4PWDB 2DEJA 1NUEA 3IR6B 1N5YA 1S77D 4F4ZA 2JEFA 1UWBA 3SSQA 9ATCB 2WRMA 1X0PA 4AQYJ 1NSAA 4U7UD 1NK6A 4Q2LA 2XSFA 4B9NA 3DLEB 4USHA 4A8KA 2HWHA 4NLYA 1WUUA 4CO2A 2OIHA 1B0PA 3FEZA 2QO3A 3HD2A 4DLGA 1ZM3A 1SV5B 5C7PA 2LLZA 5IT0A 4NCGA 3SQGA 1RT1B 1FE4A 1JKHA 5IQ6A 4LFBJ 4X66J 4EO6A 3DGPB 3E51A 4ZVHA 1WF0A 3W5ZA 1NAQA 2R8IA 1CQNA 3G82A 1ZYQA 2LQJA 2EFGA 3QIPA 4ECTA 2V8GA 1U1MA 5KG4A 3RTVA 4B3RJ 2V2KA 4M1KA 2WTFA 3NRBA 1MMLA 1FDAA 1F9FA 4OI3A 4Y2AA 5D4NA 1OJ4A 5KFHA 3PTWA 5A2QY 3P4UB 3IR7B 4DSFA 2HMIA 3FBEA 3MR5A 3AH6A 5I3UB 4F7VA 4R0EA 4IKAA 2FPHX 4IOBA 2K7JA 3GTYX 3FKBA 1DARA 4P74A 4JI4J 1RLDA 1VQPS 1D09B 5SZTA 4ZPDA 5K14A 2VA2A 4CH1A 3LTOA 4HLBA 3KJFB 3MFHA 2A10A 4EYHB 5D3GA 1TAUA 3AD8C 1VR6A 4YB7A 5RUBA 4QIEA 4C3KA 3MR7A 1ZAWA 2XSJA 2MKIA 1TFWA 1LWXA 1FEEA 2J0SD 3AQPA 2PDAA 1VQYA 3VAIA 2D74B 3G2XA 1R27B 3HFKA 2NPFA 3TUJC 5J1EA 2DNMA 4I2PA 2IJFA 3M8YA 2J0WA 4F3OA 3SCLE 1IBMF 1GXUA 5CH7B 4WYLA 4DL7A 4PAAA 2BW7A 2RIJA 1GFWB 2DHXA 2XMAA 3PX6A 2HZCA 3PW2A 4PWWA 4LF4J 3WX8A 3M8SA 1AROP 1REGX 3CULA 4PG7A 1QAXA 2NUUG 5M2RA 2RHSB 1U2CA 3FK4A 2KJWA 4OI0A 1NDKA 4DSLA 2DCLA 2XYPB 1AA1B 4X4PA 3FDSA 2QLXA 2OMLA 2JL9A 2FGOA 1JLQB 4KYZA 1Q86T 2R2TA 3RUBL 2WK4A 2YKNA 1TK5A 2HW3A 1Y9OA 2ZBCA 3ITHA 1I51B 2MQMA 3KXDA 5C24A 3JSMA 2FVCA 4O4GA 3HK2A 2XMTA 2W9AA 3JQMA 2MHEA 1SXLA 3D66A 4OX7A 1Q4RA 4G6VB 5AT1B 4WYWA 4USKA 1FT8A 1GX5A 2ZH1A 5L9NA 3HT0A 3ADAC 1N56A 4NXNJ 3DI6A 1RYRA 1YJRA 5DM7Q 1L3UA 3NNCA 2R2RA 2V0NA 2R2SA 4F4KA 4GVBA 3AHPA 4F8RA 3M8QA 3Q0AA 1RU2A 4DDFA 3ULHA 1D3WA 4ZCIA 1KQGB 5EX3A 1RSCA 1RP5A 2PT0A 4EYIB 5A0YA 3ZNJ1 4E2FB 1DURA 2J8AA 4RZRA 1QVFR 1XMQJ 1XNQJ 3OJSA 2NXNA 3W9HA 3CCES 3UD3P 2XCPA 4C7QA 5B08A 4ZCKA 3CCLS 2NS1B 1B70B 1XERA 2D3ZA 2Y1IA 1SQGA 1F9EB 3HVAA 4XAKA 2AV5A 4GKJF 3EZUA 4K7QA 4LSLA 1TL5A 3F44A 1NPPA 1TKXB 2DB1A 2GS8A 2CJAA 4WK3A 2HAFA 4MK7A 3QGGA 2XZDB 4WFXA 2VFUA 1CVJA 2F4VJ 4FYVB 1H38A 3IBWA 4LF6F 4DV2J 3HKZD 4C8NA 5E33A 3R97A 1DTTA 1RWVB 5CCLA 2OHDA 4KSEB 5KFNA 3THVA 3TW0A 2FDNA 3OTBA 1UVLA 4M5IA 3NNAA 1LOUA 2IRYA 3DCAA 3IMQJ 1AUDA 2VV5A 2PFDA 3RB3A 5IM0B 2H3EB 3IRXA 1XWLA 1VBKA 5A6PA 2EWHA 4LREA 4B08A 4HHHA 4WCEQ 2UXCJ 3IR5B 4NLOA 1AFIA 2RRBA 4CLTA 4JI0F 4CLZA 3O2IA 2VBYA 3Q8QB 3W2WB 1FRXA 5J2MB 1EQMA 2VBXA 1CQMA 4DOZA 2DGVA 3I87A 1BQMA 1XJWB 2VKRA 4NLQA 5L1KA 5J2QA 2WHOA 2M4MA 3D67A 1YJNS 1BE4A 4JP8A 3HULA 4KRWA 2C2NA 3IN5A 2F40A 4FF2A 4Y6IA 3LAKA 1KONA 1WHYA 5D15A 4C11A 4JV1A 2W4CA 4JI3F 1NBEB 1UJ5A 3QT7A 4X4UA 2MTLA 2J9EA 3DLKB 4DV1F 2Y3YA 4KH0B 2ASJA 2UUCF 1OPZA 2OSQA 3PRBA 5HAOA 1IWGA 2B4UA 3VHQA 4QPTA 2QLJB 2GMJA 3G86A 1XIQA 4OYZA 1AZSB 2I5JA 1YK9A 1NKEA 3SYZA 3ZNUA 5IC4B 3R6GB 2KYXA 3RRGA 4XDDA 2XLJA 4HT5A 5L8RC 5G0RA 1IR0A 1VHFA 4ZP9A 2FHJD 3DOKA 2J5AA 4U9RA 3BKTA 1T0TV 4KHMA 3D0GE 2DY9A 3V81B 4RW8A 3FBFA 1ZM4A 5AJ3J 3P6YC 3QRRA 5HI7A 2FC8A 2H48B 2QG9B 1DQ9A 2QZ8A 3NWGA 3DDIA 2BKOA 2C3OA 2FB0A 1Q5YA 3CIZA 3N5BA 4DR7F 2BKNA 1SI9A 3R2CJ 3PYFA 5L9XA 2HHVA 1PYSB 4AXIA 3UNYA 4C0BA 2Q43A 1MG7A 3CB4A 4DX5A 3W7BA 1ITPA 4TLQA 3OV7A 4F4YA 1NXIA 4OHWA 3MM7A 3CD0A 2AJFE 1SVDA 1HD1A 4P2SA 1NDLA 3GZ7A 2XM3A 3O1LA 3MD3A 4ZDNA 1HFEL 2B0GA 4LMZA 2X1GA 2N7YA 3HHEA 3JSBA 2DR8A 4JI5J 4Y65A 2BZ2A 1H98A 2DTJA 3UN3A 2E1CA 2YKAA 1DJ0A 3LAMA 3TARA 4DEZA 4UW2A 2MXYA 1SUQA 4FBTA 4YR2A 1U0HB 1UCNA 3MECB 2D41A 4WIIA 5LSRA 4M5HA 1JWWA 4IRDA 4QYZK 5KFWA 3BS9A 4RUCA 2QSWA 4WK1A 2VU5A 5HROA 1IKVB 9RUBA 3T5JA 2QE5A 2FVPA 3UNGC 5F3TA 1FRKA 3SCJE 1UA0A 4DQRA 2VC0A 1KS2A 1LW2A 1TV6A 3QAEA 1Y11A 2DCUB 1QM9A 3TVKA 1N36F 4CQ1A 4F4WA 2J7UA 3IGVA 4R8UB 1XNRJ 3IS9B 1WD6A 5F8NA 4NZ7A 2ZDOA 4QIGA 3KNGA 3UR3C 4BC9A 1XMOF 5LMNJ 3HT3A 1U7LA 1EJ7L 2HFVA 4X4QA 4X84A 5G4DA 5CYMB 3IO1A 4OI1A 4HACA 4K0KJ 1EKRA 1HD0A 1UW4A 3GCWP 4EZ9A 4NRTA 2DR9A 1U48A 4NLDA 1B0TA 1MLAA 4EWTA 4KH1B 2W2PP 1SQFA 3RG6A 2MSSA 4PR6A 3I4PA 3V4MA 4EBCA 1J5OA 1IKWA 4LF7F 3KLHA 3EX7B 1S1TB 3TZXA 4J9KA 1MWYA 3A13A 3I5BA 2C2RA 1RZMA 3MM6A 2HVHA 2JOQA 1FKPB 1YZ7A 4FN5A 1FRHA 5F3ZA 4Q45A 5F0WA 2P9CA 1HW9A 3IGNA 5D78A 4FXWA 1S4EA 1SKWA 1JB0C 3ZO7A 4OX9F 2HHQA 1OY9A 4CNZA 2DNZA 1G7CB 1RAIB 3TAQA 3FBCA 2ZM6J 2OI2A 3H5YA 2ASDA 4K2XA 1KR4A 2VUGA 3MEGB 3IRWP 2BJ9A 3PW7A 4V19X 3UPFA 3MAAA 1UVIA 5H1SV 5KT7A 3AFGA 3I32A 3L7UA 1J2VA 2WZ1A 4WJBA 2H4WB 3EICA 4FYWB 2YKMB 3WBZA 1RDRA 4QPXA 2J8SA 4ZIWA 1TKTB 5B09A 5KOWA 3NGKA 1NJYA 3EWGA 4B17A 1H0HB 3TWZA 4FXDA 3UQSA 2CZ4A 5CA5A 1OYEA 4F0MA 3M2RA 7AT1B 2DHGA 4FPIA 1N0UA 3H7HB 2B7CB 2HKEA 5HANA 3J80Y 1S9FA 5DG7A 2ATLA 2KT5A 4NI2B 4OZ0A 3CWJA 1REVA 2AGQA 2XY6A 4YFUA 2QL5B 2OPPB 1RT3B 1QE1B 3W5XA 1Y00A 5LJ5Y 1WG4A 2F9DA 1YTYA 4IR1A 2IJRA 2DGQA 1QUPA 3A8EA 2EC2A 4DXLA 5E3CA 1HNIA 2B4OA 3ISZA 1FXLA 1SIZA 1H7XA 1EP4B 2E1AA 4DWIA 2XYHB 4F0HA 1IQZA 8AT1B 4I56A 4OI4A 2V69A 4OIXA 4DN0A 1WTBA 2YPZA 4RNOA 1D8ZA 2WOMB 3TZZA 3JYTB 5KFAA 2HGNA 2DT9A 2FJAB 3LANA 4RJVA 2E9ZA 4KKOA 3FSIA 1HQUB 1RT4A 4Q43A 4KFBB 3F0NA 4I67A 2BVZA 5B0AA 2Q6CA 5B0FA 3M1VB 5GAGI 3CSKA 3HCXA 4RW4A 1R6YA 2BM0A 1FK9B 3O44A 5HBMB 4FYDA 3CXCR 4DR4F 3E8OA 4KPYA 5DG8A 1FX4A 4NLUA 4N56A 3LO3A 5GAHU 4JI1J 1HNXF 3W65A 1EARA 2QLFB 1UMJA 4HKQA 1LWFB 2NXCA 3QJLA 3JAMU 3DLLQ 3IP0A 2ZHAA 4NMLA 3BBFA 2ILYA 3GIKA 2KXNB 1CSJA 5D4PA 4MK8A 3KLIA 4IFYB 4F4XA 1VQMS 3KNAA 3TQEA 1ZAXA 2XCAA 3VAJA 2E5HA 4QYRA 1RADB 2EC0A 1JJCB 2DISA 3HVTA 1BUXA 1WSVA 2JH3A 3T1AA 3TAMA 4USJC 1VC5A 3EPIA 4HI1A 4FZVA 3KK2B 2FJVA 3PO5A 4OZ2A 5DDRC 2CPEA 4N8NA 3CCQS 4LF8F 2MGZB 4O0IA 1M1HA 4R25A 5FLXU 2XMJA 4C98A 4LIWA 1X5PA 2MY7A 4GO7X 4O3OA 3HSJA 4RL1A 5CHCB 4AL7A 2CQDA 3KLEB 2ERRA 3N6LA 2JEJA 3AA9A 3PW4A 3KG0A 2CG4A 3MM9B 4WIQA 1PBUA 1S6QA 3QLHA 2W4DA 5E0OA 3PRDA 2X1FA 3OSNA 2A18A 1R43A 3POTA 4CLFA 2DKOB 1QTNB 2B3TB 3CJRA 1DRZA 1B7YB 3MXHP 2KJVA 4RX6A 3PCOB 2IVMA 1YITS 1JJHA 3G96A 3MCSA 2CJYB 3CDUA 1SJQA 3HHNB 2HWIA 4QWBA 2K2PA 4KO0A 3N79A 1X4BA 1W2BR 3PEJA 4TNOA 3D3BJ 3AOCA 3CJ3A 1M1GA 2DNQA 5EHHA 2I38A 4L72B 3TVYA 3GFXA 1UETA 2XHCA 4DPYA 2DNGA 4W90B 2LQBA 3CEDA 4MAKA 3DHXA 2ZOFA 2C2KB 4F50A 1EAYC 4RR5A 1H2VZ 2ZVIA 2VQEJ 4DZDA 3BPSP 1QAIA 3MFIA 3RGIA 4CH0S 2A2DA 5C2GA 4I2QA 3OVBA 1VISA 2VODA 4WE1A 1IWAA 3KLGA 1KVJA 1WOPA 3HZEA 3I96A 3H4BA 2QYCA 1S57A 3D4JA 1XN9A 3PW0A 1JK9B 5LJ3Y 1NRKA 4U7UK 4G1QB 3EGNA 2DRDA 5MAOA 4O44B 4JUZA 4PWDA 2GMLA 4DL6A 2HFSA 2GV1A 2HFNA 2H5JB 1S1VB 2JC1A 2W25A 2OLWA 4OYBA 1N8RT 3HF5A 2R4FA 1BHNA 2XULA 4ZLNA 3DLEA 3I56S 2NUHA 2RILA 1UP1A 2PC6A 1AT1B 5L39A 1VJQA 4DL3A 1LK5A 2UUTA 2E5GA 5KG2A 2KFNA 4Z7CA 2YNFB 2R7WA 2DH8A 1SV5A 5IWAF 4K2JA 1RT1A 4YR0A 1X4HA 2YH1A 2IYGA 2UUBJ 3R6LB 3OTDA 4PUOB 1KTVA 4ED3A 4LF2A 4C3LA 1J27A 2BE9B 2JEGA 3CD7A 2LQ9A 4LRBA 3BQ1A 5HQLA 2RUSA 2CPFA 1UPMB 4X64F 1CULA 5D6GA 4C0HA 3KHHA 5LSOA 4AE5A 4ZPTR 2MEWA 2FD2A 3Q8RB 1GQEA 2RU9A 1NB2A 7FDRA 2E5LJ 1H2TZ 3H40A 4RUBA 5I3UA 2RS2A 2XMMA 1RCXB 3L09A 1AYEA 1N88A 3CMAS 3R5AA 3SXLA 1RCOB 4AL6A 3M8ZA 1JLCA 2MKJA 4QIWD 4KTQA 4MIAA 2WCXA 1T05B 3CTRA 3ILIA 4WKYA 1C1BB 1RISA 4I69A 1SJ4P 2X1AA 3RBXA 1R8HA 3H5XA 4DUZF 1HR0F 2BJ1A 2CQCA 2OP5A 3QSYB 1L3TA 3VCDA 3SSRA 4URQU 1VQNS 1A9NB 2YH0A 1UPPA 2IY5B 1S0OA 3D0HE 1F9HA 4PG8A 3BV8A 4Y34A 4F26A 3BGOP 2YX4A 4E8UA 3D6FB 2IM2A 3FFIA 1CS4A 4X62J 3N01A 4MYTA 3MMAA 3KHLA 1FWKA 1U02A 1U09A 2XB2D 2JEIA 5D77A 2F4FA 1JLQA 3QAUA 1JLAB 2ZZMA 3HKWA 4EU0A 3SI8A 4JB8B 3DYAB 2YQ1A 3BSCA 5E7OB 3DXBA 3MTKA 5B0BA 2EW9A 2DHHA 3LGHA 3Q8PB 4Y2KA 3OR1B 1V5IB 3CNQP 1GMWA 2BE2B 3TA2A 1YBAA 3F73A 2RE1A 4JV5F 2V67A 4ATNA 3ENVA 1M5OC 3LW5C 2J7WA 4AQYF 3IBFB 4O4RA 4OYMA 3MR3A 3J7ZT 3ILLA 3AD7C 1T8EA 1DBDA 1M5VC 1AB8A 1ZZNA 5FJ4A 2KT2A 3D1QA 2XLKA 3VAKA 2XO7A 3V6HA 3BQ2A 1X9SA 4C8OA 3OUYB 3KWMA 3C15B 4RBTA 5HMWA 3NCPA 1VMBA 4ENOA 1E6VB 2IC3B 4YS2A 3OPKA 4LFBF 2IFXA 1U1RA 2OD6A 3W62A 1KN6A 2CQPA 3KK1B 2CA9A 1B3TA 4DCPB 3HHLB 4FPRA 2W9CB 5K9FA 4E0DA 1NKCA 2EK6A 5L46A 1WACA 3LGNA 3B82A 3UVJA 3TZYA 2ADBA 1KVIA 4LBHA 4ZCMA 4QYZJ 4F4AA 4JOUA 3D6MB 5KG5A 5KFBA 4P2FA 4B3RF 1CJUB 1O0PA 2IMOA 2H51B 1TFYA 2W1BA 1RAEB 4ITSA 2VB6A 4OI2A 3FEXB 3NG8A 1TTHB 2DNKA 2CPDA 4OJ1A 4DL0C 2IM1A 1C0TB 2OPSA 1NPRA 5KFPA 3DOMB 1N5TA 1VK8A 4HHJA 3MMCB 3BH7B 4M95A 1P27B 4V1Ak 3Q8YA 1QD1A 3THTA 3LQVA 1X4AA 3K58A 5LSLA 1HNWF 2QFJA 1CEZA 2G2ZA 4URSA 3PR5B 4ZA1A 3X1LB 4JI0J 2ZFHA 2F63A 4QOTA 1RAOA 1TR0A 2MKCA 3J7YU 2B8PA 3U7JA 5IM0A 1Z4UA 3OBIA 4P6QA 1IR1A 3NWRA 5CAAA 2VFVA 1ZA2B 2MJUA 4ECSA 4MT1A 3LF0A 4A8QA 1JLFB 3BSAA 4UY85 1UJ6A 3NOCA 3HI9A 1WEXA 4JI3J 2K3IA 2ZOGA 2KDOA 3K5NA 5J2MA 3HJFA 1M5PC 4DV1J 1HNVB 4LF4F 1YI2S 1QAJA 2UUCJ 1SPBP 2BJEA 1TU0B 4AL5A 2BUNA 4YN3B 1OPIA 2KXHA 2DRBA 2VKZG 3NGUA 2XI3A 4NZ0A 2VG7B 3M8WA 5H9EK 4U6PA 2AZ1A 2IM3A 2LEBA 1QLNA 4CP5A 5IT4A 4W98A 3TZWA 3C16B 3UD4P 3GFYA 1B99A 4P9SA 4ZLLA 4A47A 2WSFC 3NGDA 2BV3A 3VGUA 4C97A 3GR1A 2YVSA 2NSCA 4UTGA 3U02A 3DRRB 4NLWA 1AZSA 4LFCJ 4NXNF 1EHWA 4B9UA 2B9EA 4FXVA 5I3QA 3M32B 4F2SA 3LP2B 2V9KA 4ECUA 5GMDA 4PQAA 3MMBA 1ZPWX 2NXJA 3PDNA 4L73A 4ECZA 4DR5J 4DU8A 1IBLJ 2V68A 2JJ4D 1X9WA 1JLBB 5DDPC 3IA0A 3B54A 4KC5A 3GPAA 1RGVA 3MD1A 2G0IA 3ZTSA 2CFXA 1XMQF 1XNQF 2ZDPA 2KG1A 4F04B 4WFAQ 1D9DA 1U49A 1MWZA 1HNZJ 3GJQB 1QSLA 1TL3B 3KMQA 2KZZA 5K8PA 1VQ4S 2FZCB 3KK3B 3CDBA 2HVEA 3OFGA 5ETSA 1D0EA 2FJWA 4PCQA 2B9XA 3MPUB 2W2OP 4ZP6A 3C8YA 2DPJA 1HARA 2HBQB 3BGRA 3QJPA 3SEOA 4IOCQ 1ZTTA 2H1YA 5CABA 1ZOTA 3HFZB 4ETZA 1U4BA 2FJEB 4J9VA 1K73T 1FA0A 2IM0A 4LRDA 2OEKA 2N3LA 2PI5A 3BO2A 3B4MA 3U1LA 2VG5B 4GKKF 1R8CA 4QCLA 1BGXT 1WC0A 3IFEA 1U0HA 3MECA 5DS7A 3UFCX 1YHQS 1RT5B 3EXCX 5J1NA 2YNGB 1N36J 4O3QA 2V5HG 1ZM9A 1K9MT 2KT3A 4OQJA 3K5LA 1IKVA 1UFLA 2UVWA 4DUYF 1APSA 2LECA 1NJZA 5BYRA 4B3SF 2OKQA 1ZH5A 1N6QB 2O67A 5ADZA 2LDYA 6FD1A 2N3OA 3NGRA 2V94A 4Q0BB 1KWMA 2V8VA 1HBUB 3FC9A 4R8UA 2LXFA 2J6SA 3IS9A 2P8IA 3QT8A 3BM7A 4J9OA 3HSZA 2BRLA 1M90T 4LF7J 4IR9A 4USVA 2NPIA 4CM0A 5LXRA 1RWMB 2W01A 4RKUC 2AIRB 1YJ9S 3O3LA 5CYMA 1YBUA 1WEYA 4FF4A 2DGOA 3LP0B 3V2UC 4TVAB 2MZQA 3H4DA 1F5CA 1K8AT 2YWHA 1NK0A 3HHDA 1Z2LA 5K8OA 5F8HA 3THPA 5IT9U 1TL4A 3N4WA 5LT5A 2Z2YB 4JI8F 1FRJA 2AP6A 4CO3A 2KRRA 1GAOA 4L76A 2ASYA 4J37A 1PG5B 2EFVA 1S1TA 1VI7A 3KJVB 4ECYA 4GO5X 2NZ4A 2XWYA 1RHKB 1FKPA 1WI6A 2DITA 4UOCA 4USIA 4KE5A 1VC0A 2MB0B 3VGTA 4LVOP 4ILMA 3EVMA 1FJ7A 1BQNA 2M2BA 3J81Y 3JSYA 2ALZA 2CIMA 1H3DA 2LVWA 1RABB 3ET6B 3R5BA 4AYBD 1Q8LA 3VQSA 1KLMB 1U1LA 5EWEA 5AJ3F 2D1CA 5T41A 2R42A 1Q95G 2Z57B 2BJ7A 1CJVA 4GVLA 3MEGA 4CRJA 2ZWPA 4N41A 2GMHA 2OJ3A 1OY6A 2YWEA 1N33J 1IKYB 1U47A 2BA9A 2RKIB 1Q78A 3CJTA 5F9LA 1FERA 4WWSA 2EFNA 1TKTA 1FX2A 1R31A 4NLPA 4UQTA 3WIUA 1WKKA 5HATA 1TUWA 1WEZA 4LQ3A 3HSGA 2RQ4A 4NYOA 1TZ0A 4NLSA 3T5LA 3N9UC 4YB1P 3JTOA 4I7FB 3CDEA 2VPXB 2K1RB 4QJVA 3VZHA 4BBYA 3AQOA 1S7IA 1RTZA 3CJ2A 4ZVFA 4CDIA 2ZH9A 4LJMA 3FSXA 6AT1B 4QWCA 2LFVA 3A8IA 2Z4PA 1NNDA 1KOHA 1RT3A 1QE1A 1RWUA 2HRTA 2J6UA 5GAEU 2DR6A 4DQSA 5F8IA 1PCAA 2L3MA 2BRKA 3CD6S 1ZAVA 4H4OB 2W9BB 1SL1A 4YB5A 4OJGA 5HQMA 1X4CA 3RR8A 1PJ5A 4HHUA 3GJSB 2G9OA 3WHIA 1VQ7S 3PKMA 3MM5B 2WONB 1DTQB 1VLOA 2W24A 2V50A 3FSYA 5KFRA 3JYTA 1IM4A 1BD6A 3BH6B 2ZH2A 3FQKA 4ES1A 3MCOA 5T7LB 5KG7A 3W3SA 3CCTA 2BANA 1HQUA 1Y4ZB 4KFBA 1T9TA 1F1BB 3W5YA 2AEMA 4A8SA 1XEZA 3DLHA 3B8HA 3MMJA 3M1VA 1RTHB 4P73A 1FK9A 1YKWA 5HBMA 3D3CJ 1J5EJ 2RH3A 1C2PA 5L1LA 4M94A 1C4CA 5LMNF 2WVBA 4ERDA 2B6AA 1WKJA 4FVMA 2HNDB 4P52A 2VFRA 3CJ5A 1SH0A 2LU1A 1KLNA 1NDPA 2ZBRA 2NZCA 4DV6J 1LWFA 1O6XA 2DIVA 3TEGA 3I0SA 1X4FA 4PABA 4DPTA 4ED2A 5C42B 2NYIA 2V4JB 4NEYA 3OLBA 3PNIA 2AJ1A 3MZIA 1HHQA 1IN0A 4LF8J 1FFSB 1PKUA 2HFOA 4PKDB 2WW8A 3ENAA 4IFYA 3MCNA 5IZHA 2K3KA 4XPCA 1YBTA 2MZRA 2DGSA 4ZIVA 4K4VA 1TKZA 4OFZA 2DNLA 3PO4A 1RWNB 1O5JA 2KZMA 1S9GA 3A3NB 1KOOA 4Y0FA 3AJDA 3DOLB 3GIMA 2GO9A 4X4VA 1HI0P 2ZUAA 4MFBB 1WC4A 2ZHBA 2MGZA 3R1LA 3H5SA 3RW6A 3OW2R 3PY8A 4PPZA 3RBZA 4WFBQ 2AD9A 3AD9C 1JX4A 4Y28C 5HVFA 4V19J 5GVQA 2KH9A 5IV3A 3BB5A 1D1UA 3KLEA 2CADA 3UW1A 3MUMP 3ZFVA 4KGVB 4N8OA 4U96A 2X3DA 2WSCC 3PR4A 3I31A 4ECWA 2HLUA 4RLEA 2PFFB 3G8TA 1X5TA 2V4RA 1N5QA 2QA4S 2MMYA 3US5A 1VCTA 3I0RB 4Z2XA 4G3IA 3V4IB 2DEIA 4TKTA 4DCJB 1RHRB 1WG5A 2UUWA 3A8KA 4P72A 2AJ0A 2XO6A 4P75A 3MPDA 5HMYA 3PIOQ 4DV3J 2GCFA 3TA0A 3DRYA 2H9ZA 4ZVPB 1F0XA 2DXFA 2QLWA 2RB7A 2LDIA 5KFDA 4CTAB 3OXGA 1PJ7A 1KD1T 3GMGA 5HP1B 2CAJA 2OEMA 3FNNA 4RU2A 2DHSA 1HA1A 1GX6A 4AUKA 3HVRA 2NLWA 5A6WA 4WF9Q 5DDQC 3EGWB 4J9PA 3QT6A 4H4KA 2ZJPQ 2HQDA 3HZGA 4TY8B 1TUVA 1S0NA 2R7OA 1Q81T 4OL8A 1VBXA 1GK8A 1W7WA 1CG2A 2XLIA 1ZPVA 4UUXA 1SL2A 3K59A 2E1PA 2QIFA 2ZE2B 1FJEB 4G1QA 3QGPA 2MSTA 2ZBQA 1RI7A 1VLYA 5ETMA 4EFAC 3ZTQA 3EVWA 5KFJA 4IO9Q 4UT4A 3CJKB 3H2UB 1S1VA 1ZS6A 3MDFA 3GIIA 4FP9A 3A1YG 4NA1A 2C2ZB 4JI1F 3GP9A 3GSIA 1C0UB 1VIOA 3AXKA 1SJFA 2P5VA 5IV4A 3VVUA 4PG6A 2RSQA 2R7VA 1TELA 3K7RA 2XGPA 1NJIT 2YNFA 2HNYB 2RUGA 3RBDA 1X9MA 4X64J 3FBBA 4DR6J 1KP6A 2HPUA 5E3PA 2NQPA 2Y1JA 3NMRA 4PUOA 3U1MA 4RUHA 3KDNA 1H2UX 4QQBA 3CJ4A 2ABYA 4MTPA 3D6TB 3LP1B 3GB0A 5KG1A 2QLBB 5FDLB 2W2QP 3W61A 2BE7D 1YG0A 1U2FA 1U1PA 3MEEB 4M5GA 2FY1A 4O3RA 3IAM9 1T9WA 3WC2A 3PM9A 4EI2A 1PO6A 4BWMA 4NCGB 3WDOA 3E3XA 1JKHB 3NGSA 3HHKA 2M9KA 3UN2A 1GNKA 1S79A 2IRXA 2C2EA 2HQGA 3NEKA 1HKAA 1LQ9A 3NY0A 1D9AA 1Q79A 4B9VA 2ZH8A 3HX9A 3KJQB 1OWXA 3QIPB 2EFQA 2LKZA 4USWA 3M9MB 3IWXA 4DUZJ 3GSDA 5F8LA 3RB4A 1YSJA 1RHUB 1S6PA 2ZH4A 2W7PA 4KGZB 3OTOF 2HMIB 4NOHA 5H9EJ 4EZ6A 2J7KA 1VC6A 3PV8A 1UA1A 2XY7A 3M8PA 1LEOA 1NH7A 5KFUA 4ED4A 1KTQA 2VASA 1Q8KA 4ZHRB 1RAJA 1U6ZA 2NREA 1HYSB 3LGMA 2YWWA 2EG1A 5K14B 3T1HJ 1CLFA 5CYQA 3M8RA 2KFZA 1GTEA 1Q82T 1UW9A 2PA8D 4CM2A 1Y3KA 3KHRA 1NHVA 2KYZA 3CCSS 2GFFA 4DZ6A 1KVKA 3N6MA 4QBUA 4YMEA 2A1BA 1WELA 2R8JA 3IG1A 3KMSA 4LBIA 4ZLJA 3PVXA 5A8KB 4DJBA 3DXSX 1FI4A 4KGMA 1RACB 3QWPA 3VQTA 4CLUA 1PIEA 2B9WA 4O23A 4ZVTB 4UZBA 4UQGA 7FD1A 4XTTA 1NK5A 5J1EB 2CYYA 5E3QA 2VQEF 2HNZB 2BX6A 5BYQA 4JV5J 2ZUGA 4G1IA 4D3GA 2VJUA 4DS5A 3QZ8A 5DLFA 2EG2A 5K8NA 2XYGB 4MMOA 1FXRA 2AGPA 2YQ0A 3DU6A 1LWCB 2DH7A 3OR1A 1KSPA 2MZ1A 5KG0A 1R89A 2JZ5A 3FCWA 1L5UA 3W8PA 2BQRA 1TMJA 3ELHA 1HI1A 3TUIC 1YJWS 4FYYB 3ITHB 3P3DA 2OMOA 1S1UB 2MLZA 4UOHA 2W7AA 2PEBA 4LR7A 3QO9B 3QMQA 3HLUA 1U25A 3JSMB 3OUYA 1JIHA 3BSOA 5KAKA 4WFZA 3FMBA 5DLGA 4DX7A 1E6VA 2IC3A 2R8KA 1S6OA 2UUBF 4KGXB 5KFZA 3KLVA 1ZM2A 2Q66A 3VAHA 3OLAA 4UUWA 3HHLA 2CZ9A 1T7PA 3M8QB 4WFNQ 1EKSA 3I4HX 1D8YA 3K8VA 2EK1A 2UUAF 5AE3A 5A0YB 3WQPA 1P1LA 1CJUA 2CJQA 3UE2A 1HNWJ 1TL7B 1FTRA 1NH8A 3VAGA 5C5JA 4O3SA 2E5LF 4IDKA 2AU0A 2AX1A 3OSPA 2MKYA 3D5MA 2ZBIA 3DM2A 5JXSA 3MGJA 3MMCA 2QTWA 4KPCA 4F3MA 1N5VA 4A48A 3M6WA 1N54B 2BJ3A 2OPRB 1NB7A 1RLCL 2QMXA 2J9DE 1RK8A 3CC2S 3IWLA 2JLFA 2HHTA 2AEFA 3R9LA 3MR6A 2ZJQQ 4LRAA 2L08A 4ZVEA 3OR2B 2FJXA 2CJ9A 2CQ2A 5ETVA 5J2NB 3BO3A 2E44A 5A76A 3OHBA 3BO4A 4OZ1A 2OAUA 3R27A 4MKVA 2KVQE 2UP1A 2NR0A 2B9YA 1JLFA 1S1XB 2RQKA 2ADCA 1H72C 3Q2SC 2CXEA 5BJRA 2V6AA 1S4FA 4B3TF 1HNVA 2B51A 4ZN1A 1W25A 3UDVA 2AYBA 3KLFB 1DQ8A 5F9NA 3SFGA 3IRXB 4LSNA 2CPHA 2D9PA 3QSIA 2OSRA 4X62F 3QGIA 3HFVA 2ZH5A 4WXWA 2MKSA 1YIJS 4P2XA 5LM7E 4X4OA 4IFVB 1EB0A 2VG7A 3DRPA 3CJQA 3V5RA 2MY8A 3ILOA 1JNRB 3KYLA 4NZ6A 1BQXA 3LUYA 1FWLA 1XR6A 2E7WA 4C6AA 1UJ4A 2JFDA 2YWFA 1BWEA 1FD2A 2C2DA 2CJKA 4YY3J 3MAQA 1SJ3P 3DHWC 4QWDA 8RUCA 4BS2A 2HRYA 2QJ3A 3DRRA 4HH1A 1PC5A 2GHWA 4N47A 4C11B 2DNNA 2VA3A 1DY3A 2CQ4A 4J9NA 3M32A 2N82B 2E9TA 4TN2A 3GV7B 2CWXA 2GVZB 2RS8A 2Z8QA 4ZJQA 4O3NA 3UO0A 3MUVP 1W26A 1MWQA 3WX4A 1HWIA 4EK2A 4OHZA 4KY3A 2P9GA 2JHEA 2XI2A 3TRGA 2DK2A 1IJEB 5EUHA 5MLCV 1TAQA 2NCKL 1WF1A 4S0MA 4CLWA 5J2PB 4PG5A 1LNQA 1ULRA 3L9ZA 3AY0A 1O8BA 1WKLA 3BYPA 4KHRA 1OQ3A 3PX4A 2RDDA 2D3OR 5KG6A 3E2EA 1HHTP 4M5MA 3KK3A 1WHVA 2AW0A 2KN4A 4ANCA 1NCLA 2BM1A 4DF4A 2HLTA 2LMIA 1F2HA 4GKKJ 4NPOA 2GAHC 3WZ0A 3UR0A 1RA7A 3GIRA 3KG1A 2BYCA 1YX2A 2BABA 2L9NA 1Q16B 2C3YA 5IFMA 5I4MA 3EDRB 1Z2ZA 2HWTA 3QYYA 4NLRA 4RNHA 4DUYJ 2I9SA 4NA2A 5EDWA 1AXQA 1HLWA 1RBLA 4B3SJ 5AE2A 5HN0A 1T02A 2VG5A 3MM7B 3G87A 3MI7X 4LVNP 3ZZTA 3GWCA 2PN6A 3UDLA 1XC9A 5AXMA 5E3AA 4K4WA 4OHXA 1HBMB 4UF4A 2FC9A 1ZTWA 1NO8A 4I6AA 3KDOA 4RBVA 3ZZPA 2J9CA 1OMSA 2GQCA 2C3PA 1FJGJ 2CNNB 2IVFB 1WI8A 1N6QA 4NYZA 1Q5VA 1GTHA 1IUJA 4FYXB 4DSEA 2B43A 4Q0BA 5C25A 3D68A 1FF2A 3GV5B 2QMWA 2Y8WA 3CUNA 4RNNA 1URNA 2COLA 1NJWA 2JFKA 3MEDA 4JI8J 3PKYA 2C1EB 3C14B 4LF5J 3DGVA 2GIQA 5DJBA 4ZMMA 3QATA 3ZZUA 1LW2B 2F8MA 4FVCA 5F8JA 2MDAA 3LP0A 2M5YA 2N4CA 1JLEA 3R1HA 2CZVC 4ILLA 3PHTA 1HQ2A 3PEHA 3ZZZA 2RRAA 3QRPA 5DQHA 3CMES 1PILA 2XMUA 1G3OA 2V8PA 2DNYA 1VDHA 3KUEA 4CYUB 2BMBA 4DR2F 1LWEB 2PD1A 1FKAF 4LFCF 5KTQA 4HACB 2VH7A 4I0WA 1VQOS 3RB0A 3CO0P 4ZPVR 1MU2B 3ENQA 3BBCA 4DR5F 1IBLF 3H42A 3QJJA 1Q8IA 4DL5A 2ZBPA 3VGSA 4WTYA 1OYDA 3K5PA 3BQ0A 4RWWA 4K59A 1TMMA 1EETB 1Y10A 1SKSA 1EZZB 3GQCA 2VQFF 1S9EB 3UDCA 2GJ2A 1HNZF 3VAFA 3ZC4A 1R0AA 2VD3A 2YQ3A 2R7XA 1IKYA 1RTIB 1CJKB 2RKIA 1K0TA 3D9BA 5HVGA 1HWKA 1RAAB 2WB4A 3ENWA 2RF2B 3A3PB 4FBUA 3AAWB 4TQRA 4N77A 4MYUA 2Y8YA 1NZ8A 2QSFA 4OI6A 4P2MA 2JDJA 2RU3A 5KFTA 3SCKE 4GC7A 2AYEA 4USMA 2M52A 4I7FA 3MAAB 2V8HA 3QFHA 4EUVA 4DV7F 3L4BC 5ITHA 4O0NA 2EKNA 4F02A 1RQ0A 4CH7A 2IAJB 1B4SA 4I64A 2YNIA 3ISNC 3N6NA 2BOPA 1RBOB 1JQGA 5DETA 2ZJRQ 2IA6A 2VOOA 4CT8A 1IKXA 4ECQA 1EX8A 2W9BA 1RT2A 4M5LA 3GU0A 2GQ2A 5FIIA 3TQ1A 4GMKA 4LRFA 4PG4A 4A4JA 2E7VA 1T03A 4RW7A 3H5UA 2WONA 1DTQA 1REVB 1HW8A 4TY9A 5T7LA 1TP7A 1P9YA 5F41A 2KI2A 4ZP7A 3PFOA 4ZJOA 1HBOA 1UTAA 2L9WA 2VFSA 5DG9A 1SKUB 2V2ZA 5A8RA 1MMDA 2V63A 1NSKL 4USTA 4IG0A 1A6LA 2XHWA 3OT9A 3AOBA 1HI8A 3GYGA 2AYMA 1MN9A 3T5KA 3NXZA 3AODA 1QUVA 2HNDA 5H9FK 3SZ2A 5DGAA 1MMNA 2MQNA 1WJ9A 4TU7A 1X4DA 3W1YC 5GAHI 5E41A 1UVNA 3OFEA 3W9IA 4C8MA 2C3UA 1N52B 5DRKA 4Q7AA 3NGTA 2HHHF 3GE9A 3I6PA 1HIYA 2ACMA 1IVZA 1RKJA 1R6VA 3HSDA 1FKOB 3DRXA 1H6KX 2QMUB 2DHAA 4RWXA 2V2VA 1JJ4A 2E66A 3AB2B 3BGFA 3NBPA 4ED5A 1U2RA 1D9FA 3JTNA 4C2MA 2XMVA 2HQ3A 2XC9A 4ZVQB 2GJIA 2ZOMA 4Z7YA 3JAMY 4F3QA 4MFBA 2WVDA 2F8HA 3NS6A 1VRTB 3FVYA 4BLGA 3M9OB 3M9NB 5KFYA 1S72S 3KKFA 5C2CA 3T1YJ 1N34F 1RU1A 1K1QA 4CLPA 3R5DA 3TAMB 3BYRA 2B4PA 1N33F 1SL0A 3H59A 2EPIA 4JYAF 4DV5J 3JXOA 4H54A 4A8WA 4ICLB 1F6TA 1HHSA 5FLXY 2I0XA 1ZZFA 5ETRA 3V4IA 3OXLA 3GJTB 3FCHA 3W9JA 1LKZA 2UV8G 1SCJB 2H65B 4J91A 3F41A 3L7PA 5CCMA 1FFGB 1S6QB 4OLPA 1B64A 1FCAA 1R7IA 1KRPA 2L48A 4JI7J 4PQUB 4X4TA 5GADU 2CPIA 2VL1A 4DR3J 2XTJP 2EFOA 1V3SA 2LP4A 1QJHA 4I6YA 4PYDA 1GXLA 3HO1A 1VRUA 3CD5A 3OL9A 5LOQA 4K4TA 4DFMA 2AT1B 2JLEA 1FNOA 4CLKA 4KIAA 5KFIA 4XK8C 3HXMA 4G1PA 2JC0A 1LW0B 1N0VC 4R5PB 3SIPB 4I68A 2IBOA 1VBZA 2CNOB 3BSNA 3SCIE 4TY8A 4NEZA 4ZOSA 2BJ8A 3QRQA 4ER8A 2MJNA 4ED1A 1FE0A 5CYJA 2DNRA 2DRAA 2XS7A 2OELA 1Y3JA 1TL1B 2ZE2A 3RU0A 3SFUA 3CCZA 4B3MJ 4BCAA 3CJKA 4LSZB 5ETNA 3C6TB 3RZAA 1J5EF 3GV8B 2GQQA 1RUSA 5KT5A 1C0UA 2IIHA 3R7SB 3BN7A 1V5VA 4QU7A 2OTJS 4DV6F 1F3FA 1TK0A 4QIVA 1NSPA 2XS5A 2PSZA 3NAIA 2HNYA 2G1DA 4B3OB 4DSKA 3QWUA 2HZAA 2E1MC 4CLYA 2WAQD 4YDDB 2OPQA 2CQ3A 3LP1A 1E6YB 1UFKA 1RKIA 5FDLA 1YJ7A 1XR7A 3D1OA 2KFYA 3MEEA 1S1WA 2XQCA 3AB4B 5JVGQ 3LPEA 4FNHA 1WORA 2DNOA 1NK7A 3FMWA 4IG3B 1SJ1A 5ETPA 4TU9A 2R7QA 1S12A 1RT7B 3MAHA 3OTOJ 1LV5A 4PXBA 1W2IA 4ZPBA 3V6JA 2C28A 2H4YB 4CIOA 2FGCA 2CQHA 2PEHA 2FHKA 3R5GA 3OVAA 1Y5LB 3AXMA 3MF5A 1CULB 4NLGA 1I94F 1RAGB 1T9XA 4DI6A 4OHYA 4K4UA 2RHQB 1GMWD 4MH8A 3Q2TC 2DNHA 5D4OA 5DDOC 2ZD1B 4CO0A 3D2WA 1UKUA 4U7CA 1RAFB 1DAXA 4AFFA 4ZHRA 1HYSA 4KB7A 1JLCB 5D4LA 1SKRA 4WU2A 2PA3A 2E5IA 3LALA 4C3MA 2V2QA 4DV3F 2BACA 4DV0F 1U8SA 4OV6A 2EXUA 2YWKA 3P96A 2X3GA 1GEHA 4MIWA 2AF6A 1RAHB 5A8KA 1RTDA 4N7TA 1XMBA 2U2FA 1NKBA 2VFTA 3OL6A 4DV4J 3TA1A 2BXJA 1JXEA 2HNZA 3NKYA 4H4KC 1URRA 3D28A 4OJHA 1FRLA 4ED7A 1YJVA 4Y2IA 5AXLA 3TOQA 2QEXS 1VRQC 2O5DA 1MN7A 2QN6B 5ETKA 3SV4A 3AA8A 4DL2A 1PGZA 2F5GA 2WBRA 4RNMA 5KT4A 4ELUA 5K8MA 3TUPA 3M2UB 3FFIB 2ZH6A 2J0XA 2ZZNA 1LWCA 3R2DJ 1CS4B 3MMAB 2R8HA 2I6WA 1V3ZA 3VTIA 4J7CA 4K4ZA 1X5SA 2XS2A 1M5SA 4HVZA 3DGPA 2KRBA 3DMJB 1GMVA 1S1UA 1IM6A 2QGFB 3QO9A 1RB0A 2IBKA 4FS2A 4K4YA 2BQUA 2MHNA 3UCZP 1PYOB 3CVKA 4U95A 2CNKB 2UUAJ 1TVRB 3EUNA 4DR6F 1ZETA 3VVTA 4JV2A 1RHJB 2GW8A 3OD2A 4HTIA 1NM2A 4RPFA 5A2QU 4L6V3 2XY5A 1G1XA 1KQSR 3C3LA 3Q86A 2Z30B 4YHHF 1RWWB 4LRCA 4LF9J 4IOAQ 2DYAA 2VHGA 1CJTB 2B56A 1KBRA 2MPUA 3EVOA 4CCHA 2F65A 1SJRA 1GT8A 1FNXH 4DPOA 3WIVA 1TL7A 1M5KC 2M88A 5ETOA 2A0FB 2ATCB 3R7BB 3H0PA 4DX6A 3K8WA 5DQGA 3EYZA 3KG4A 3U1NA 3UVJB 1L3VA 3BJYA 1NLKL 4HT7A 1U26A 2OPRA 2HG4A 2FHOB 1FD8A 4MJKA 3EZ5A 4RNFA 2RDJA 1X5OA 2OGUA 2XG8A 3TX8A 2YBVA 4KV8B 3G8SA 4M5KA 4WP9A 4CWBA 2OO4A 3OR2A 1WHWA 2OPSB 4AD6A 5J2NA 5I42B 4B3TJ 3BZQA 4DPXA 4MIBA 2WSEC 1T95A 1TQLA 3S1TA 1XR5A 3J7YI 3T1HF 3D1HA 2C2MB 2OTLS 1S1XA 3M05A 3TYTA 2KM8C 4BDPA 3IM8A 4UOGA 2HIQA 4JI2J 2D3O1 5D0RA 4RW9B 2MKHA 3G4SS 1GH8A 3H2VE 1PJ6A 4K50A 4PXDA 2QA2A 3KLFA 3KUGA 2G2YA 3R5CA 3G6YA 4LFAF 3HJVA 5F0UA 2Z2ZA 2MZTA 2MQOA 2NYHA 3O6QA 4ANEA 3PRVA 1ROFA 4IFVA 2B5JB 1YDLA 2M7SA 1K0VA 1M5HA 4WZMA 5AXNA 1VBYA 1HBNB 3EGZA 4UOFA 2DXDA 3U27A 2AJ2A 3G6VA 1KHWA 4NX9A 2G2OA 4O3PA 2L9DA 2FJBB 2G4BA 1SH3A 3BDEA 1LXJA 3M7VA 1VQSA 2A3JA 1S99A 2GVZA 1F5BA 4NASA 4P7VA 5DM6Q 3NL0A 3FCVA 2CNLB 4DUTA 2RDIA 4ES2A 3FEYB 3ISND 3A3OB 2PI4A 2EVZA 5F8GA 4ZP8A 3W66A 1QSSA 3VWSA 5LXYA 4CLSA 4QZVB 4X65J 4DF8A 3OJUA 4IH5A 3G9CA 1T11A 1H7WA 2HIYA 4ED0A 2X1BA 4CO5A 1XK8A 3C6UB 5J2PA 3HHLC 1TKXA 4Q5VA 3F56A 1YLXA 2ASLA 4ES3A 1QY7A 3MMBB 4OYAA 4W4MA 1HMVB 2GO8A 2CG8A 1DLOB 4H4MB 1SBRA 1I1GA 2BJDA 5KFFA 2FQQB 3PHEA 4PXCA 3M6UA 1SC3B 2CPZA 3CC4S 1YQHA 2YX1A 2GJFA 5JUMA 1FDBA 2UU9F 4KQZA 1RWXB 2V4QA 1SH2A 3EGVA 2P9EA 1UEUA 4DX8H 5KFXA 2VBZA 3H8YA 1JMTA 1S59A 1WC1A 3DC2A 1NK8A 4FNIA 3HDSA 2CRLA 3VAMA 3BGRB 3W2WA 4DR1J 4LUBA 2OD4A 5H9FJ 1HBMA 1FXDA 3D6HB 2KG0A 5JMNA 4KJIA 2KTQA 2CPJA 1KQFB 4QU6A 2I8EA 3JS9A 4ZVSB 2P6SA 3T6JA 5KT2A 4M5DB 2EKYA 3DLKA 1PYTA 1F5AA 3IM9A 1DZ5A 2VOPA 4ZITA 1G6BA 3JTPA 3T41A 4IO1A 3M4XA 2Y0SD 3TJ8A 5KFVA 3C14A 1UEKA 2MQLA 3T9NA 4DR2J 1F2GA 3NP5A 2K8GA 5T14A 1PSDA 5I3PA 2FJDB 2LXUA 2LA6A 3VF0B 4KHPJ 4M5NA 5HLFB 3DNCA 1C1CB 4Y3CA 2G13A 2E29A 4YY3F 2YY3A 3DLBA 3VR1A 3CJ8A 2UXDF 1T9UA 3PYDA 3LPYA 4RO0A 4XO0A 3V81A 4CYUA 3PZPA 2BEFA 3PYGA 1LWEA 3Q89A 5KFOA 3DRSB 1C4AA 1Y5IB 4A8XA 3I82A 2VQFJ 4M63A 1KDNA 4OMFG 4LR8A 3TVZA 1RJJA 3T5HA 2W8KA
chains in the Genus database with same CATH topology
1F6TA 3Q8UA 3ZTPA 3GP9A 3EMTA 2DXFA 3NGTA 4UOFA 3B54A 3ZTOA 2DXDA 3GPAA 1HIYA 1WKKA 3VVTA 3VVUA 3ZTSA 2ZUAA 1K44A 1NHKL 3WX8A 3NGUA 1HLWA 2CWKA 4ANDA 2AZ3A 3ZTRA 1S5ZA 4HR2A 3FBBA 4EK2A 3Q86A 3FBEA 3BH7B 1NUEA 2AZ1A 1U8WA 3Q8YA 2DXEA 3ETMA 1NPKA 1MN7A 1S57A 1PAEX 3B6BA 1XIQA 3VGVA 1LEOA 4CP5A 1NDLA 1NDKA 2DYAA 3FKBA 4W98A 3BBFA 3FBCA 3PJ9A 4DI6A 3FCWA 1F3FA 3BBBA 2HVEA 1NSPA 1WKJA 3EVOA 2NCKL 1B99A 4UOGA 3ELHA 4S0MA 5IOLA 3Q8VA 3FCVA 1NB2A 3VGTA 4DUTA 1JXVA 5BXIA 1NDPA 3NGRA 4FKXA 4ENOA 4F36A 3VGUA 4KPCA 3EVMA 4FKYA 2B8PA 1WKLA 1NDCA 1S59A 4UOHA 1NSKL 3DKDA 3L7UA 4O0NA 1W7WA 3FC9A 4DZ6A 5CAAA 3EICA 5C7PA 3EJMA 1MN9A 2HURA 3R9LA 2B8QA 1BHNA 4C6AA 1EHWA 3NGSA 1B4SA 1BUXA 4ANCA 1LWXA 2DY9A 4ANEA 1NCLA 5CABA 3PRVA 3Q83A 1HHQA 3FBFA 3BBCA 3EE3A 1UCNA 1PKUA 2BEFA 3Q89A 3ZTQA 3G2XA 3EVWA 3ENAA 2HVDA 3EM1A 3VGSA 1BE4A 1NSQA 1NLKL 4F4AA 1XQIA 1VYAA 1ZS6A 2VU5A 1KDNA 3MPDA 3BH6B 4WBFA 2BX6A 3JS9A 3DDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F6T A;  3Q8U A;  3ZTP A;  3GP9 A;  3EMT A;  2DXF A;  3NGT A;  4UOF A;  3B54 A;  3ZTO A;  2DXD A;  3GPA A;  1HIY A;  1WKK A;  3VVT A;  3VVU A;  3ZTS A;  2ZUA A;  1K44 A;  1NHK L;  3WX8 A;  3NGU A;  1HLW A;  2CWK A;  4AND A;  2AZ3 A;  3ZTR A;  1S5Z A;  4HR2 A;  3FBB A;  4EK2 A;  3Q86 A;  3FBE A;  3BH7 B;  1NUE A;  2AZ1 A;  1U8W A;  3Q8Y A;  2DXE A;  3ETM A;  1NPK A;  1MN7 A;  1S57 A;  1PAE X;  3B6B A;  1XIQ A;  3VGV A;  1LEO A;  4CP5 A;  1NDL A;  1NDK A;  2DYA A;  3FKB A;  4W98 A;  3BBF A;  3FBC A;  3PJ9 A;  4DI6 A;  3FCW A;  1F3F A;  3BBB A;  2HVE A;  1NSP A;  1WKJ A;  3EVO A;  2NCK L;  1B99 A;  4UOG A;  3ELH A;  4S0M A;  5IOL A;  3Q8V A;  3FCV A;  1NB2 A;  3VGT A;  4DUT A;  1JXV A;  5BXI A;  1NDP A;  3NGR A;  4FKX A;  4ENO A;  4F36 A;  3VGU A;  4KPC A;  3EVM A;  4FKY A;  2B8P A;  1WKL A;  1NDC A;  1S59 A;  4UOH A;  1NSK L;  3DKD A;  3L7U A;  4O0N A;  1W7W A;  3FC9 A;  4DZ6 A;  5CAA A;  3EIC A;  5C7P A;  3EJM A;  1MN9 A;  2HUR A;  3R9L A;  2B8Q A;  1BHN A;  4C6A A;  1EHW A;  3NGS A;  1B4S A;  1BUX A;  4ANC A;  1LWX A;  2DY9 A;  4ANE A;  1NCL A;  5CAB A;  3PRV A;  3Q83 A;  1HHQ A;  3FBF A;  3BBC A;  3EE3 A;  1UCN A;  1PKU A;  2BEF A;  3Q89 A;  3ZTQ A;  3G2X A;  3EVW A;  3ENA A;  2HVD A;  3EM1 A;  3VGS A;  1BE4 A;  1NSQ A;  1NLK L;  4F4A A;  1XQI A;  1VYA A;  1ZS6 A;  2VU5 A;  1KDN A;  3MPD A;  3BH6 B;  4WBF A;  2BX6 A;  3JS9 A;  3DDI A; 
#chains in the Genus database with same CATH topology
 4DL4 A;  2KHC A;  1MU2 A;  2DY1 A;  3N5F A;  1U1Q A;  4EGL A;  2A6O A;  3GFH A;  2RT3 A;  4I4B A;  5IT9 Y;  2LYV A;  1UFW A;  4DSI A;  2N7C A;  5F8M A;  4Q2M A;  2LEA A;  1EET A;  1JLG B;  3TNV A;  3P8B B;  1L3S A;  1RTJ B;  1FDN A;  2W2N P;  1S9E A;  4TXS A;  5CD4 H;  1V9O A;  2KXF A;  4LR9 A;  2ZHO A;  5A8W B;  1VQK S;  1RTI A;  4YDX A;  1CJK A;  4DV7 J;  5BR8 F;  2HHS A;  3RAM A;  2R3V A;  1Q0N A;  3QQC D;  1BQN B;  2YNH B;  5JJB A;  3OVS A;  2RF2 A;  3J7A N;  4F0K A;  1SC4 B;  1KFD A;  2ZC4 A;  3SDE B;  2GVD B;  4HDG A;  4X4S A;  4OHV A;  1CJV B;  4J90 A;  3RBE A;  4RW6 B;  2WVF A;  5HSP A;  3J7Z 5;  4NCB A;  3TO8 A;  2UZA A;  2QV6 A;  4QIF A;  1RYS A;  1S49 A;  1UZD A;  1M1K T;  1WC6 A;  3OQ2 A;  2DVI A;  3R8Y A;  4HL9 A;  2IAJ A;  1A7G E;  2VG6 B;  3M30 B;  3K17 A;  4B9T A;  1IBK J;  2FTR A;  1NHU A;  3BGU A;  5JVH Q;  2FHJ A;  2HBR B;  4TYB A;  2CDQ A;  4PPD A;  2GIF A;  2AEJ A;  3M2V B;  3NS5 A;  3CJ0 A;  2FVS A;  5B0C A;  3QT5 A;  1WSR A;  3GLJ A;  2D9O A;  1NPK A;  2LXI A;  5GAE I;  1BLU A;  2QRR A;  2Y9H A;  1TUG B;  1X31 C;  4WXO A;  3W60 A;  3SMZ A;  1KNZ A;  2UVU A;  1FJG F;  2FLO A;  1FVQ A;  1SC1 B;  4DLE A;  3BRE A;  4ID8 A;  2FLN A;  3PIP Q;  4OZN A;  3A12 A;  2B8Q A;  4WKR A;  4JV0 A;  3E01 B;  2AQ4 A;  4OX8 A;  5EX0 A;  1UVM A;  3C2P A;  4L3K A;  1MRO B;  3N0V A;  2W4P A;  4NWB A;  2HHH J;  4LF5 F;  4RU9 A;  4XPE A;  3OL8 A;  3NNH A;  1P8G A;  4YP3 A;  3KTQ A;  2BAN B;  2MLY A;  1VGY A;  3PW5 A;  4KR0 B;  4PXE A;  1RT6 B;  1H73 A;  5K5M A;  3G71 S;  2A2C A;  4AND A;  3MWB A;  4HR2 A;  4NMX A;  2B7B B;  2DPI A;  1RWP B;  1MSW D;  3NS7 B;  3BN4 A;  2F1F A;  4A8O A;  4WP3 A;  5EWG A;  2B6A B;  2YXL A;  1RA6 A;  1FKO A;  4DQP A;  2LU2 A;  2IMW P;  2W7O A;  2MYF A;  5IXU A;  2HHU A;  2YPY A;  3CDA A;  2AMC B;  1UVJ A;  1N34 J;  1GXT A;  1N5S A;  3I0S B;  3C46 A;  2YKO A;  2HK2 A;  2HQF A;  4ALZ A;  4YEA A;  1NK9 A;  2YKM A;  4Y00 A;  4DS4 A;  4N76 A;  1CC7 A;  4JYA J;  1KQK A;  2MQP A;  1YGY A;  2J76 E;  1VRT A;  3EDQ B;  1WC3 A;  3QGH A;  4LBP A;  4ID5 B;  3NLC A;  1VHI A;  2DGX A;  1VIX A;  2GZO A;  4K4X A;  1TKZ B;  1R8A A;  2D69 A;  4J9L A;  3J80 U;  2ROE A;  2R8G A;  4ELT A;  1S9G B;  4E98 A;  4ECV A;  2YKQ A;  3IXQ A;  2FIU A;  2ZKU A;  3L7O A;  4NI2 A;  2QFI A;  1Z1Z A;  3TX0 A;  2P2C B;  2M70 A;  4YQW A;  4ICL A;  2AWZ A;  2OPP A;  4A8F A;  3ETM A;  2CQ0 A;  5D0E A;  4DQI A;  3L95 X;  2IRU A;  2VDI A;  3W8G A;  5IOL A;  1U1O A;  4QW9 A;  3M6V A;  1EP4 A;  1U0S A;  4FKY A;  1EIY B;  3PJW A;  1WDT A;  3KHG A;  4G65 A;  1Q7L B;  2ZH3 A;  4PQU A;  3EJM A;  2WOM A;  2ZWO A;  2QX0 A;  3O5T B;  4HEA 9;  2XBP A;  1N32 F;  2H5E A;  2WVE A;  2L41 A;  3W2V B;  1UAW A;  3K89 A;  3RW7 A;  2DGU A;  1LW0 A;  4R5P A;  1FWP A;  2DGW A;  3CIM A;  3CCW A;  2Z0G A;  3Q8U A;  3EZO A;  2GNK A;  3TAN A;  1JJ2 R;  3ZZO A;  1HQE B;  2HHX A;  3RJM B;  4M5J A;  4CO1 A;  3MM8 B;  1AW0 A;  5GAG U;  2CWK A;  3CCM S;  2RVJ A;  1WC5 A;  2Q79 A;  3P45 B;  1TL1 A;  5D0H A;  5KFL A;  2YWG A;  2DXE A;  2E5J A;  3UWT A;  2G1H A;  5HQ8 A;  1UEV A;  2HHP A;  3MUT P;  5EN1 A;  2FUG 9;  3BKU A;  1R0C B;  3C6T A;  2V9W A;  4ZLP A;  3V6D B;  2AX0 A;  5B0D A;  3D7S B;  1G4C A;  1YRT A;  4R0J A;  1S97 A;  2C3M A;  1S76 D;  4ZPC A;  3DKD A;  5EWF A;  4YR3 A;  3TJA A;  4OV1 A;  2B4V A;  5GME A;  3O8W A;  4N5S A;  1WHX A;  2H5I B;  2CPX A;  4C48 A;  3KK2 A;  4YUD A;  1HPZ B;  1HL6 A;  4P7T A;  4B3O A;  4KGK A;  1NEE A;  2Q6B A;  3CGI A;  3QZ7 A;  3NMA A;  1E6Y A;  3P5T L;  3FRZ A;  4F67 A;  2FYX A;  2Q3P A;  4NXM F;  2CUY A;  2VPW B;  1SC6 A;  2N4D A;  3NAH A;  1KC8 T;  2POK A;  2IHR 1;  3TUZ C;  3QFW A;  5IC6 B;  4IG3 A;  3I5A A;  1RHM B;  2DO0 A;  2HVI A;  1Y5N B;  2G0J A;  1I94 J;  4UY8 T;  1U8W A;  3MM9 A;  3R3T A;  3WC0 A;  2VDH A;  2ZVS A;  1RT7 A;  2IJN A;  2CQ1 A;  3CT9 A;  3QNW B;  3Q8V A;  5ETT A;  4AXJ A;  4JI6 F;  2GGP B;  2E7X A;  3T1Y F;  4LIR A;  3RYL A;  4OZL A;  1FRI A;  5HMX A;  2ACY A;  4X2B A;  3BKF A;  1MNE A;  2WB1 D;  2DNP A;  5B0E A;  4DV5 F;  3MOZ A;  4DHV A;  4DV0 J;  1K1S A;  5LMU F;  4P10 A;  5CZX A;  4B9S A;  4WZQ A;  2DR5 A;  3TEH B;  5D8H B;  2ZD1 A;  1Q7Y T;  3GG1 A;  1FNM A;  4X4R A;  4C8Z A;  2RAQ A;  2IDL A;  3CMQ A;  4EEY A;  3I9V 9;  3IAS 9;  4DG1 B;  1S6P B;  3GFZ A;  5GMK a;  4DU7 A;  1IBM J;  4Y2C A;  4EO8 A;  4OYO A;  2VBW A;  4IRK A;  4JI7 F;  4USU A;  2UXB F;  3PAC A;  4J5O A;  3DLJ A;  2WW4 A;  4DR3 F;  3M8P B;  4DMZ A;  3W63 A;  3QBC A;  2PMW A;  3VZI A;  2XNQ A;  2GC8 A;  2GAG C;  1U1K A;  4CI0 B;  3ILJ A;  5CYQ B;  2AKW B;  2ROP A;  3LA0 A;  3HHL D;  2CPY A;  4O44 A;  1T9Y A;  1VOM A;  3UDE A;  3I55 S;  4HI2 A;  2E1R A;  2ILZ A;  3MUR P;  2KM8 B;  5EGY A;  3G6E S;  3KJN B;  2LCW A;  2XMK A;  3IG1 B;  2HZV A;  2AGO A;  1WG1 A;  1LFW A;  3M2U A;  3PJX A;  1RE1 B;  3T3F A;  2DO4 A;  2JRS A;  1TKD A;  3DLG B;  4OZ3 A;  1QDU B;  3EM1 A;  4DCO B;  1X0F A;  4QR1 A;  2I1R A;  4ZKA A;  1S0M A;  4B3M F;  1FEH A;  3G6X A;  2HBZ B;  2WVC A;  4HH0 A;  4L75 A;  1N5Y B;  4L74 A;  2JVO A;  1P1T A;  2QL7 B;  3EMT A;  1UWB B;  1RHQ B;  3C19 A;  5DZ6 A;  5KFG A;  2Z2M A;  1O51 A;  3NCR A;  3DMJ A;  4YHH J;  1RXO B;  1NHK L;  1VJW A;  2K7K A;  3CO9 A;  2Z56 B;  5IQQ A;  1KHV A;  2HEK A;  3R5J B;  2QA4 G;  1Q53 A;  1WOO A;  3B6B A;  2FVQ A;  4F2R A;  1TVR A;  2VZ9 A;  4NA3 A;  3HMJ G;  1IBC B;  3OTC A;  3SQG B;  2JVR A;  3IBC B;  4U67 Q;  2Z58 B;  2BBE A;  5KFQ A;  4M8L A;  3LWM A;  2CQI A;  3S01 A;  4J9M A;  3S8S A;  3BEG B;  1YVF A;  3G82 B;  1CJT A;  2HUR A;  2FLP A;  2U1A A;  4ZN3 A;  1LK7 A;  5DO2 A;  4DSJ A;  4GKJ J;  1HWL A;  4CLL A;  2ZZT A;  2F3J A;  4F25 A;  3ICL A;  2CQG A;  1T05 A;  4X66 F;  3CCJ S;  4ILR A;  1C1B A;  5K20 B;  4FS1 A;  1VS3 A;  3M6X A;  2W2M P;  3AJ2 A;  1U24 A;  3ZZR A;  1S6U A;  4C8L A;  1RWK B;  4LF6 J;  1IQT A;  2BDP A;  2KHD A;  3BF4 A;  1K44 A;  2VF3 A;  4BC7 A;  4OYX A;  1N4L A;  4MKB A;  1V6H A;  2HFZ A;  5D3G B;  3HPO A;  1VFJ A;  4YB6 A;  4OZ5 A;  4KV8 A;  4IDK B;  2BQ3 A;  1YJT A;  2XSJ B;  5HK4 A;  5CXT A;  3BR8 A;  1K47 A;  2HQI A;  2EFP A;  5I42 A;  1T3O A;  4WFY A;  1YWX A;  2Q1L A;  3K2Y A;  3DM2 B;  4LFA J;  4JI4 F;  3N28 A;  5HL7 Q;  5U47 A;  4W92 B;  4I2P B;  4B9M A;  5HJX A;  2ZNZ A;  1CBK A;  2RML A;  3LWL A;  1OSC A;  1JLA A;  4RW9 A;  4EBD A;  3UCU P;  3DYA A;  3AJ1 A;  1NSQ A;  4ZK7 M;  1VYA A;  3K5M A;  2MLX A;  4ZPW R;  5D0G A;  4DV4 F;  1NME B;  2KB2 A;  2BE2 A;  3PG9 A;  2B5J A;  2R2U A;  4X4N A;  1BY9 A;  3A8J A;  1F3V A;  2O1P A;  5DZ7 A;  4HYK A;  4LF1 A;  1PC4 A;  4OYI A;  2YTC A;  3KUH A;  2YKN B;  2HYI B;  1LFP A;  3GR0 A;  4MKA A;  2HHW A;  4ZS6 A;  4Y2M A;  1HBN A;  4QR0 A;  4LSN B;  4DPU A;  1V3R A;  5E3R A;  1NU4 A;  2RQM A;  5C24 B;  3H98 A;  4O4G B;  3VV2 B;  3OFF A;  3NCQ A;  4ZJL A;  3TAP A;  3C15 A;  2UVV A;  2JNJ A;  2MKK A;  2Y1L B;  3DRP B;  4TQS A;  3K0J A;  4LQ9 A;  4QWE A;  1WDD A;  1KKH A;  3DI6 B;  1OY8 A;  2DJW A;  1I3O B;  3MEK A;  2YX7 A;  4B9L A;  4QR2 A;  4XDC A;  3KK1 A;  4GVB B;  5KOX A;  2ZEJ A;  3Q83 A;  3S7R A;  2W9C A;  3CCV S;  3H2L A;  1T94 A;  1U6F A;  3EPG A;  4K5S A;  2RQC A;  3UI3 A;  4FDF A;  4HDH A;  3G8Q A;  2QC3 A;  3P49 B;  3C6U A;  2PMZ D;  3ZTO A;  1SQE A;  2O01 C;  2CJX B;  1R8P A;  4OLO A;  1C0T A;  1HMV A;  8ATC B;  4LF9 F;  4DR7 J;  3P5B P;  3DOM A;  4DFP A;  1DLO A;  4H4M A;  1OQ6 A;  2SXL A;  2UU9 J;  3CW2 C;  3ETO A;  3BDP A;  1S7H A;  4U8Y A;  1KFS A;  4LSL B;  2X7I A;  2XEX A;  1VK3 A;  3K57 A;  2C22 A;  2LA4 A;  3UN5 A;  2W8L A;  1FJC A;  2BKP A;  1U45 A;  1X8D A;  5CD4 A;  3Q8S B;  1QTM A;  3AT1 B;  2PMH A;  1DHM A;  2RJZ A;  1DTT B;  1FFW B;  2GHP A;  3FZB A;  4J9Q A;  3Q24 A;  1CPZ A;  2R7R A;  2PO4 A;  4UZC A;  1IR2 A;  1XQI A;  1UZH A;  4ZVO B;  4WBF A;  3J81 j;  4OX6 A;  3LH2 S;  1ACM B;  2F4V F;  4A8Y A;  3UCG A;  3UD5 A;  3FGV A;  1WF2 A;  3GCX P;  1X4G A;  4DV2 F;  3B78 A;  2AJQ A;  2RNE A;  3HP6 A;  2M8D B;  1NZA A;  5HJY A;  1FDD A;  4C4W A;  2KO1 A;  1F60 B;  1OO0 B;  1JNZ B;  4JI2 F;  4M5D A;  3MCM A;  2IVY A;  2QA1 A;  4JBC A;  2R7T A;  1I6J A;  2FY8 A;  2FZK B;  1WNE A;  3C16 A;  3DU5 A;  1BQM B;  5BXI A;  4FKX A;  5J2Q B;  4DQQ A;  4DFK A;  3OL7 A;  2P6T A;  2UXD J;  3CDW A;  2UXC F;  4ETX A;  2JWN A;  1XMO J;  2JLG A;  4TYA A;  4DPW A;  1L3K A;  1N48 A;  5KFE A;  3LP2 A;  5C25 B;  5HLF A;  1C1C A;  3NOG A;  1SIW B;  3BR9 A;  3VAL A;  1R0B G;  2NSB A;  4CO4 A;  3MED B;  2BR0 A;  2MQ8 A;  2JSX A;  1U6B A;  3GON A;  4FF3 A;  1JLB A;  3GYX B;  3DRS A;  2QT7 A;  2ZNY A;  2I5J B;  4MKY A;  3IWN C;  3RRK A;  4L3N A;  1JLE B;  1S48 A;  5KFS A;  2XWX A;  3DDN A;  5G0R B;  1TL3 A;  3RAX A;  1YRX A;  1T3N A;  2O3D A;  1ZBT A;  5HVH A;  3DOK B;  2F8E X;  4NLX A;  5BR8 J;  2HRU A;  3BBB A;  2VJV A;  3PX0 A;  4RW8 B;  4OX9 J;  4X65 F;  2HFU A;  2LQ5 A;  1JLG A;  1XBW A;  1UVK A;  4KBI A;  5AXK A;  1UWA A;  3CJS A;  3MPY A;  1RTJ A;  2EI5 A;  1X60 A;  3GIJ A;  5CQG A;  5A8W A;  1B7F A;  3BGL A;  4OYW A;  3LOU A;  3RAQ A;  3CCU S;  2DIU A;  4ZVR B;  2E9R X;  2H54 B;  4I6W A;  2VPY B;  2YNH A;  4C8Y A;  1B0V A;  3RB6 A;  2F7V A;  4ZCL A;  2CVI A;  3IC1 A;  2OFG X;  2AJ4 A;  3TJ9 A;  4ZVU B;  4C9D A;  3SDE A;  2GVD A;  5SUH A;  4KT0 C;  5E2Q A;  4NCA A;  3SBM A;  3L3C A;  4RW6 A;  1A0O B;  2G0C A;  2FHM A;  3RRH A;  1RT5 A;  3MHY A;  2DGT A;  2QYG A;  1R0A B;  3DN9 A;  2YNG A;  2XMW A;  4WP8 A;  3T9Z A;  3ZTR A;  2KU7 A;  2VG6 A;  3M30 A;  2GHV C;  4Q8E A;  1R3N A;  1HWU A;  2C2O B;  2M8H A;  1SUQ B;  3M2V A;  1JXV A;  3R7N B;  2UVR A;  4F36 A;  4CZC A;  3QPI A;  4DR1 F;  2MZS A;  3Q22 A;  1VQ5 S;  1HBU A;  2VPZ B;  5HRO B;  3CF5 Q;  4JI5 F;  3MPV A;  2DD8 S;  4PZV A;  2J0Q D;  2YNI B;  1PAU B;  2CDR B;  2IPO B;  4I1T A;  2I2Y A;  2O66 A;  4ECX A;  4URG A;  2GIR A;  4Q8F A;  2HQC A;  2M0G B;  3H25 A;  4K5R A;  1IKX B;  3ZZY A;  2IYI A;  1JXL A;  2VC1 A;  1TV6 B;  3SV3 A;  3TP2 A;  4DBQ A;  2HAI A;  3T6B A;  4GRS A;  4BHQ A;  3D0I E;  3J7A 1;  1RT2 B;  2F9J A;  3ZTP A;  4CT9 A;  1Q1K A;  3E01 A;  6FDR A;  2PII A;  2V8D A;  1MRO A;  1ZA1 B;  2OEJ A;  2QL9 B;  1T03 B;  1VQ9 S;  4RW7 B;  4NLV A;  4DR4 J;  2BW2 A;  2VIC A;  2AYG A;  1ICE B;  5AE1 A;  2DBB A;  3KJV A;  4PWU A;  2JX2 A;  1HNX J;  3VGV A;  4KHP F;  1FVS A;  4DFJ A;  1HBO B;  3FQL A;  1RT6 A;  2WBM A;  2K06 A;  3J81 U;  1LXN A;  1XNR F;  2CKW A;  2HBY B;  5A8R B;  3SQO P;  1J5O B;  4IG0 B;  1IKW B;  1Y7P A;  3GJR B;  3X3U A;  3ET6 A;  2A6M A;  3KLH B;  5THW A;  2HS0 A;  3D54 A;  1KLM A;  1X7V A;  4RUA A;  2LEP A;  4ED6 A;  3MTJ A;  3PFE A;  1U1N A;  4K0K F;  1VQL S;  3MM6 B;  3EE3 A;  1AUS L;  2IDE A;  1UL3 A;  1MW7 A;  2HK3 A;  4PRF A;  3KFW X;  2ALY B;  4J9S A;  3JSR A;  1AFJ A;  2XZT B;  4NYP A;  4IQX A;  2D7S A;  1NK4 A;  2X51 A;  3JQJ A;  2M3D A;  3H90 A;  2OH2 A;  5M2P A;  4ID5 A;  4CNY A;  1S5Z A;  5L1J A;  1H74 A;  5B7W A;  2RD5 C;  2CVE A;  3NBP B;  4NLT A;  2FVR A;  1Q8B A;  2K1R A;  1X4E A;  3PJ9 A;  1FRM A;  3C66 A;  2OFH X;  1S10 A;  2ZM6 F;  2FLL A;  2EEY A;  3M2R B;  1N32 J;  4ED8 A;  1TK8 A;  2HGL A;  4H4O A;  2VON A;  1EQ0 A;  3ONQ A;  3ZZ0 A;  2FZG B;  5LL6 d;  2Y0B B;  1WTF A;  5B0G A;  4ZVG A;  5HO4 A;  4GC6 A;  4A46 A;  3MM5 A;  1IBK F;  4Q44 A;  1BC6 A;  4K8R A;  1IXK A;  2R9L A;  4J9R A;  3PYE A;  3QID A;  3PXG a;  2YKP A;  2ZH7 A;  1DFD A;  2GA7 A;  4B02 A;  2D3U A;  2PE8 A;  3CCR S;  3W2V A;  5GAD I;  5J1P A;  4DN9 A;  1HNI B;  4TLR A;  4PYA A;  4KAI A;  4K4S A;  5KFM A;  1RTH A;  4HTJ A;  3DFE A;  2CJB A;  3I5C A;  1HQE A;  5M2U A;  3MM8 A;  2PGC A;  3OFH A;  3S6E A;  2J9D A;  2GX8 A;  4KKO B;  2Z2L A;  1VRU B;  1RT4 B;  2EBG A;  2ZC3 A;  4RBU A;  1XTZ A;  2HSE B;  2J6T A;  4IH6 A;  4AT1 B;  2NXE A;  3KOA A;  1Y0H A;  3HM9 A;  4NRU A;  3EXY A;  4RW4 B;  5C42 A;  2V4J A;  3V6D A;  1YJU A;  2EBE A;  2R7U A;  3FJ2 A;  3GG0 A;  1VQ8 S;  4OZJ A;  1FTC A;  1ELO A;  2KVI A;  3TR5 A;  4NXM J;  3GIL A;  2NXU A;  4WPA A;  3CC7 S;  3DDK A;  3FUY A;  1DQA A;  2MZJ A;  1RBA A;  4IQM A;  5IWA J;  5ETL A;  1HPZ A;  2CQB A;  2XZW A;  3DOL A;  1BXN A;  4OJ3 A;  1FHT A;  4OYP A;  2Y1R I;  4C0O C;  1BMQ B;  1QVG R;  2ZIT A;  3HVW A;  4QWA A;  1QSY A;  3KLI B;  2HS3 A;  1PAE X;  5IS2 A;  3OXF A;  4JI6 J;  5KT3 A;  2MQQ A;  3HVT B;  5L38 A;  3RR7 A;  1IJF B;  3HD1 A;  4A8M P;  4LT6 A;  1P9Q C;  3K5O A;  1T9V A;  4ECR A;  5KFC A;  4BWJ A;  1KEK A;  1NDC A;  4PEO A;  3GYN A;  5LMU J;  2OPQ B;  3SSS A;  4NE9 C;  5E5N A;  2AHO B;  3JQK A;  1HWJ A;  4TU8 A;  2GGP A;  3I0R A;  5KG3 A;  5CZV A;  1S1W B;  2HGM A;  2ZKT A;  2HVD A;  4NL5 A;  1S0V A;  5ETQ A;  5KT6 A;  2RRN A;  2V34 A;  1RWO B;  5BYS A;  1OSD A;  3I9Z A;  2VIH A;  3TI0 A;  4Z37 A;  3OHA A;  1PBA A;  4ZPA A;  1OS5 A;  3FZ2 A;  1CC8 A;  3QLH B;  2OUG A;  1I5O B;  3Q23 A;  3AOA A;  2ROG A;  4CTA A;  5KFK A;  2LQ8 A;  2UXB J;  3MPW A;  2HS4 A;  5HP1 A;  4WU3 A;  3POT B;  1WWH A;  2XGQ A;  3JB9 k;  5FD1 A;  2DR7 A;  3MOJ B;  4XIU A;  4IH7 A;  4U8V A;  4FF1 A;  4IYQ A;  1HR0 J;  2KL8 A;  3A4T A;  4DG1 A;  1OIA A;  1GMU A;  3ZXW A;  1G2E A;  4YOE A;  3W64 A;  4WTO B;  4C8K A;  1SB6 A;  2APO A;  1FO1 A;  2UV8 A;  4MK9 A;  4J9U E;  5HMZ A;  3CE8 A;  3B4D A;  4KO0 B;  2IA0 A;  1P6T A;  1R8B A;  4IUF A;  2XNR A;  5DQI A;  1BWV A;  2BOA A;  4QW8 A;  4EMD A;  1YZ6 A;  1M0S A;  5L1I A;  4I2Q B;  2DH9 A;  1WOS A;  4WE1 B;  4P71 A;  3KLG B;  4IRC A;  3CPW R;  2HVZ A;  1NJX A;  3T19 A;  4D3H A;  1VQ6 S;  3V6K A;  3H20 A;  3MR2 A;  1RTD B;  1QAY A;  2R7S A;  3BPD A;  2KKH A;  3OTE A;  3DLG A;  5DGB A;  1YRU A;  4EBE A;  3FRY A;  2AZ3 A;  2C42 A;  4ELV A;  1FES A;  4PWD B;  2DEJ A;  1NUE A;  3IR6 B;  1N5Y A;  1S77 D;  4F4Z A;  2JEF A;  1UWB A;  3SSQ A;  9ATC B;  2WRM A;  1X0P A;  4AQY J;  1NSA A;  4U7U D;  1NK6 A;  4Q2L A;  2XSF A;  4B9N A;  3DLE B;  4USH A;  4A8K A;  2HWH A;  4NLY A;  1WUU A;  4CO2 A;  2OIH A;  1B0P A;  3FEZ A;  2QO3 A;  3HD2 A;  4DLG A;  1ZM3 A;  1SV5 B;  5C7P A;  2LLZ A;  5IT0 A;  4NCG A;  3SQG A;  1RT1 B;  1FE4 A;  1JKH A;  5IQ6 A;  4LFB J;  4X66 J;  4EO6 A;  3DGP B;  3E51 A;  4ZVH A;  1WF0 A;  3W5Z A;  1NAQ A;  2R8I A;  1CQN A;  3G82 A;  1ZYQ A;  2LQJ A;  2EFG A;  3QIP A;  4ECT A;  2V8G A;  1U1M A;  5KG4 A;  3RTV A;  4B3R J;  2V2K A;  4M1K A;  2WTF A;  3NRB A;  1MML A;  1FDA A;  1F9F A;  4OI3 A;  4Y2A A;  5D4N A;  1OJ4 A;  5KFH A;  3PTW A;  5A2Q Y;  3P4U B;  3IR7 B;  4DSF A;  2HMI A;  3FBE A;  3MR5 A;  3AH6 A;  5I3U B;  4F7V A;  4R0E A;  4IKA A;  2FPH X;  4IOB A;  2K7J A;  3GTY X;  3FKB A;  1DAR A;  4P74 A;  4JI4 J;  1RLD A;  1VQP S;  1D09 B;  5SZT A;  4ZPD A;  5K14 A;  2VA2 A;  4CH1 A;  3LTO A;  4HLB A;  3KJF B;  3MFH A;  2A10 A;  4EYH B;  5D3G A;  1TAU A;  3AD8 C;  1VR6 A;  4YB7 A;  5RUB A;  4QIE A;  4C3K A;  3MR7 A;  1ZAW A;  2XSJ A;  2MKI A;  1TFW A;  1LWX A;  1FEE A;  2J0S D;  3AQP A;  2PDA A;  1VQY A;  3VAI A;  2D74 B;  3G2X A;  1R27 B;  3HFK A;  2NPF A;  3TUJ C;  5J1E A;  2DNM A;  4I2P A;  2IJF A;  3M8Y A;  2J0W A;  4F3O A;  3SCL E;  1IBM F;  1GXU A;  5CH7 B;  4WYL A;  4DL7 A;  4PAA A;  2BW7 A;  2RIJ A;  1GFW B;  2DHX A;  2XMA A;  3PX6 A;  2HZC A;  3PW2 A;  4PWW A;  4LF4 J;  3WX8 A;  3M8S A;  1ARO P;  1REG X;  3CUL A;  4PG7 A;  1QAX A;  2NUU G;  5M2R A;  2RHS B;  1U2C A;  3FK4 A;  2KJW A;  4OI0 A;  1NDK A;  4DSL A;  2DCL A;  2XYP B;  1AA1 B;  4X4P A;  3FDS A;  2QLX A;  2OML A;  2JL9 A;  2FGO A;  1JLQ B;  4KYZ A;  1Q86 T;  2R2T A;  3RUB L;  2WK4 A;  2YKN A;  1TK5 A;  2HW3 A;  1Y9O A;  2ZBC A;  3ITH A;  1I51 B;  2MQM A;  3KXD A;  5C24 A;  3JSM A;  2FVC A;  4O4G A;  3HK2 A;  2XMT A;  2W9A A;  3JQM A;  2MHE A;  1SXL A;  3D66 A;  4OX7 A;  1Q4R A;  4G6V B;  5AT1 B;  4WYW A;  4USK A;  1FT8 A;  1GX5 A;  2ZH1 A;  5L9N A;  3HT0 A;  3ADA C;  1N56 A;  4NXN J;  3DI6 A;  1RYR A;  1YJR A;  5DM7 Q;  1L3U A;  3NNC A;  2R2R A;  2V0N A;  2R2S A;  4F4K A;  4GVB A;  3AHP A;  4F8R A;  3M8Q A;  3Q0A A;  1RU2 A;  4DDF A;  3ULH A;  1D3W A;  4ZCI A;  1KQG B;  5EX3 A;  1RSC A;  1RP5 A;  2PT0 A;  4EYI B;  5A0Y A;  3ZNJ 1;  4E2F B;  1DUR A;  2J8A A;  4RZR A;  1QVF R;  1XMQ J;  1XNQ J;  3OJS A;  2NXN A;  3W9H A;  3CCE S;  3UD3 P;  2XCP A;  4C7Q A;  5B08 A;  4ZCK A;  3CCL S;  2NS1 B;  1B70 B;  1XER A;  2D3Z A;  2Y1I A;  1SQG A;  1F9E B;  3HVA A;  4XAK A;  2AV5 A;  4GKJ F;  3EZU A;  4K7Q A;  4LSL A;  1TL5 A;  3F44 A;  1NPP A;  1TKX B;  2DB1 A;  2GS8 A;  2CJA A;  4WK3 A;  2HAF A;  4MK7 A;  3QGG A;  2XZD B;  4WFX A;  2VFU A;  1CVJ A;  2F4V J;  4FYV B;  1H38 A;  3IBW A;  4LF6 F;  4DV2 J;  3HKZ D;  4C8N A;  5E33 A;  3R97 A;  1DTT A;  1RWV B;  5CCL A;  2OHD A;  4KSE B;  5KFN A;  3THV A;  3TW0 A;  2FDN A;  3OTB A;  1UVL A;  4M5I A;  3NNA A;  1LOU A;  2IRY A;  3DCA A;  3IMQ J;  1AUD A;  2VV5 A;  2PFD A;  3RB3 A;  5IM0 B;  2H3E B;  3IRX A;  1XWL A;  1VBK A;  5A6P A;  2EWH A;  4LRE A;  4B08 A;  4HHH A;  4WCE Q;  2UXC J;  3IR5 B;  4NLO A;  1AFI A;  2RRB A;  4CLT A;  4JI0 F;  4CLZ A;  3O2I A;  2VBY A;  3Q8Q B;  3W2W B;  1FRX A;  5J2M B;  1EQM A;  2VBX A;  1CQM A;  4DOZ A;  2DGV A;  3I87 A;  1BQM A;  1XJW B;  2VKR A;  4NLQ A;  5L1K A;  5J2Q A;  2WHO A;  2M4M A;  3D67 A;  1YJN S;  1BE4 A;  4JP8 A;  3HUL A;  4KRW A;  2C2N A;  3IN5 A;  2F40 A;  4FF2 A;  4Y6I A;  3LAK A;  1KON A;  1WHY A;  5D15 A;  4C11 A;  4JV1 A;  2W4C A;  4JI3 F;  1NBE B;  1UJ5 A;  3QT7 A;  4X4U A;  2MTL A;  2J9E A;  3DLK B;  4DV1 F;  2Y3Y A;  4KH0 B;  2ASJ A;  2UUC F;  1OPZ A;  2OSQ A;  3PRB A;  5HAO A;  1IWG A;  2B4U A;  3VHQ A;  4QPT A;  2QLJ B;  2GMJ A;  3G86 A;  1XIQ A;  4OYZ A;  1AZS B;  2I5J A;  1YK9 A;  1NKE A;  3SYZ A;  3ZNU A;  5IC4 B;  3R6G B;  2KYX A;  3RRG A;  4XDD A;  2XLJ A;  4HT5 A;  5L8R C;  5G0R A;  1IR0 A;  1VHF A;  4ZP9 A;  2FHJ D;  3DOK A;  2J5A A;  4U9R A;  3BKT A;  1T0T V;  4KHM A;  3D0G E;  2DY9 A;  3V81 B;  4RW8 A;  3FBF A;  1ZM4 A;  5AJ3 J;  3P6Y C;  3QRR A;  5HI7 A;  2FC8 A;  2H48 B;  2QG9 B;  1DQ9 A;  2QZ8 A;  3NWG A;  3DDI A;  2BKO A;  2C3O A;  2FB0 A;  1Q5Y A;  3CIZ A;  3N5B A;  4DR7 F;  2BKN A;  1SI9 A;  3R2C J;  3PYF A;  5L9X A;  2HHV A;  1PYS B;  4AXI A;  3UNY A;  4C0B A;  2Q43 A;  1MG7 A;  3CB4 A;  4DX5 A;  3W7B A;  1ITP A;  4TLQ A;  3OV7 A;  4F4Y A;  1NXI A;  4OHW A;  3MM7 A;  3CD0 A;  2AJF E;  1SVD A;  1HD1 A;  4P2S A;  1NDL A;  3GZ7 A;  2XM3 A;  3O1L A;  3MD3 A;  4ZDN A;  1HFE L;  2B0G A;  4LMZ A;  2X1G A;  2N7Y A;  3HHE A;  3JSB A;  2DR8 A;  4JI5 J;  4Y65 A;  2BZ2 A;  1H98 A;  2DTJ A;  3UN3 A;  2E1C A;  2YKA A;  1DJ0 A;  3LAM A;  3TAR A;  4DEZ A;  4UW2 A;  2MXY A;  1SUQ A;  4FBT A;  4YR2 A;  1U0H B;  1UCN A;  3MEC B;  2D41 A;  4WII A;  5LSR A;  4M5H A;  1JWW A;  4IRD A;  4QYZ K;  5KFW A;  3BS9 A;  4RUC A;  2QSW A;  4WK1 A;  2VU5 A;  5HRO A;  1IKV B;  9RUB A;  3T5J A;  2QE5 A;  2FVP A;  3UNG C;  5F3T A;  1FRK A;  3SCJ E;  1UA0 A;  4DQR A;  2VC0 A;  1KS2 A;  1LW2 A;  1TV6 A;  3QAE A;  1Y11 A;  2DCU B;  1QM9 A;  3TVK A;  1N36 F;  4CQ1 A;  4F4W A;  2J7U A;  3IGV A;  4R8U B;  1XNR J;  3IS9 B;  1WD6 A;  5F8N A;  4NZ7 A;  2ZDO A;  4QIG A;  3KNG A;  3UR3 C;  4BC9 A;  1XMO F;  5LMN J;  3HT3 A;  1U7L A;  1EJ7 L;  2HFV A;  4X4Q A;  4X84 A;  5G4D A;  5CYM B;  3IO1 A;  4OI1 A;  4HAC A;  4K0K J;  1EKR A;  1HD0 A;  1UW4 A;  3GCW P;  4EZ9 A;  4NRT A;  2DR9 A;  1U48 A;  4NLD A;  1B0T A;  1MLA A;  4EWT A;  4KH1 B;  2W2P P;  1SQF A;  3RG6 A;  2MSS A;  4PR6 A;  3I4P A;  3V4M A;  4EBC A;  1J5O A;  1IKW A;  4LF7 F;  3KLH A;  3EX7 B;  1S1T B;  3TZX A;  4J9K A;  1MWY A;  3A13 A;  3I5B A;  2C2R A;  1RZM A;  3MM6 A;  2HVH A;  2JOQ A;  1FKP B;  1YZ7 A;  4FN5 A;  1FRH A;  5F3Z A;  4Q45 A;  5F0W A;  2P9C A;  1HW9 A;  3IGN A;  5D78 A;  4FXW A;  1S4E A;  1SKW A;  1JB0 C;  3ZO7 A;  4OX9 F;  2HHQ A;  1OY9 A;  4CNZ A;  2DNZ A;  1G7C B;  1RAI B;  3TAQ A;  3FBC A;  2ZM6 J;  2OI2 A;  3H5Y A;  2ASD A;  4K2X A;  1KR4 A;  2VUG A;  3MEG B;  3IRW P;  2BJ9 A;  3PW7 A;  4V19 X;  3UPF A;  3MAA A;  1UVI A;  5H1S V;  5KT7 A;  3AFG A;  3I32 A;  3L7U A;  1J2V A;  2WZ1 A;  4WJB A;  2H4W B;  3EIC A;  4FYW B;  2YKM B;  3WBZ A;  1RDR A;  4QPX A;  2J8S A;  4ZIW A;  1TKT B;  5B09 A;  5KOW A;  3NGK A;  1NJY A;  3EWG A;  4B17 A;  1H0H B;  3TWZ A;  4FXD A;  3UQS A;  2CZ4 A;  5CA5 A;  1OYE A;  4F0M A;  3M2R A;  7AT1 B;  2DHG A;  4FPI A;  1N0U A;  3H7H B;  2B7C B;  2HKE A;  5HAN A;  3J80 Y;  1S9F A;  5DG7 A;  2ATL A;  2KT5 A;  4NI2 B;  4OZ0 A;  3CWJ A;  1REV A;  2AGQ A;  2XY6 A;  4YFU A;  2QL5 B;  2OPP B;  1RT3 B;  1QE1 B;  3W5X A;  1Y00 A;  5LJ5 Y;  1WG4 A;  2F9D A;  1YTY A;  4IR1 A;  2IJR A;  2DGQ A;  1QUP A;  3A8E A;  2EC2 A;  4DXL A;  5E3C A;  1HNI A;  2B4O A;  3ISZ A;  1FXL A;  1SIZ A;  1H7X A;  1EP4 B;  2E1A A;  4DWI A;  2XYH B;  4F0H A;  1IQZ A;  8AT1 B;  4I56 A;  4OI4 A;  2V69 A;  4OIX A;  4DN0 A;  1WTB A;  2YPZ A;  4RNO A;  1D8Z A;  2WOM B;  3TZZ A;  3JYT B;  5KFA A;  2HGN A;  2DT9 A;  2FJA B;  3LAN A;  4RJV A;  2E9Z A;  4KKO A;  3FSI A;  1HQU B;  1RT4 A;  4Q43 A;  4KFB B;  3F0N A;  4I67 A;  2BVZ A;  5B0A A;  2Q6C A;  5B0F A;  3M1V B;  5GAG I;  3CSK A;  3HCX A;  4RW4 A;  1R6Y A;  2BM0 A;  1FK9 B;  3O44 A;  5HBM B;  4FYD A;  3CXC R;  4DR4 F;  3E8O A;  4KPY A;  5DG8 A;  1FX4 A;  4NLU A;  4N56 A;  3LO3 A;  5GAH U;  4JI1 J;  1HNX F;  3W65 A;  1EAR A;  2QLF B;  1UMJ A;  4HKQ A;  1LWF B;  2NXC A;  3QJL A;  3JAM U;  3DLL Q;  3IP0 A;  2ZHA A;  4NML A;  3BBF A;  2ILY A;  3GIK A;  2KXN B;  1CSJ A;  5D4P A;  4MK8 A;  3KLI A;  4IFY B;  4F4X A;  1VQM S;  3KNA A;  3TQE A;  1ZAX A;  2XCA A;  3VAJ A;  2E5H A;  4QYR A;  1RAD B;  2EC0 A;  1JJC B;  2DIS A;  3HVT A;  1BUX A;  1WSV A;  2JH3 A;  3T1A A;  3TAM A;  4USJ C;  1VC5 A;  3EPI A;  4HI1 A;  4FZV A;  3KK2 B;  2FJV A;  3PO5 A;  4OZ2 A;  5DDR C;  2CPE A;  4N8N A;  3CCQ S;  4LF8 F;  2MGZ B;  4O0I A;  1M1H A;  4R25 A;  5FLX U;  2XMJ A;  4C98 A;  4LIW A;  1X5P A;  2MY7 A;  4GO7 X;  4O3O A;  3HSJ A;  4RL1 A;  5CHC B;  4AL7 A;  2CQD A;  3KLE B;  2ERR A;  3N6L A;  2JEJ A;  3AA9 A;  3PW4 A;  3KG0 A;  2CG4 A;  3MM9 B;  4WIQ A;  1PBU A;  1S6Q A;  3QLH A;  2W4D A;  5E0O A;  3PRD A;  2X1F A;  3OSN A;  2A18 A;  1R43 A;  3POT A;  4CLF A;  2DKO B;  1QTN B;  2B3T B;  3CJR A;  1DRZ A;  1B7Y B;  3MXH P;  2KJV A;  4RX6 A;  3PCO B;  2IVM A;  1YIT S;  1JJH A;  3G96 A;  3MCS A;  2CJY B;  3CDU A;  1SJQ A;  3HHN B;  2HWI A;  4QWB A;  2K2P A;  4KO0 A;  3N79 A;  1X4B A;  1W2B R;  3PEJ A;  4TNO A;  3D3B J;  3AOC A;  3CJ3 A;  1M1G A;  2DNQ A;  5EHH A;  2I38 A;  4L72 B;  3TVY A;  3GFX A;  1UET A;  2XHC A;  4DPY A;  2DNG A;  4W90 B;  2LQB A;  3CED A;  4MAK A;  3DHX A;  2ZOF A;  2C2K B;  4F50 A;  1EAY C;  4RR5 A;  1H2V Z;  2ZVI A;  2VQE J;  4DZD A;  3BPS P;  1QAI A;  3MFI A;  3RGI A;  4CH0 S;  2A2D A;  5C2G A;  4I2Q A;  3OVB A;  1VIS A;  2VOD A;  4WE1 A;  1IWA A;  3KLG A;  1KVJ A;  1WOP A;  3HZE A;  3I96 A;  3H4B A;  2QYC A;  1S57 A;  3D4J A;  1XN9 A;  3PW0 A;  1JK9 B;  5LJ3 Y;  1NRK A;  4U7U K;  4G1Q B;  3EGN A;  2DRD A;  5MAO A;  4O44 B;  4JUZ A;  4PWD A;  2GML A;  4DL6 A;  2HFS A;  2GV1 A;  2HFN A;  2H5J B;  1S1V B;  2JC1 A;  2W25 A;  2OLW A;  4OYB A;  1N8R T;  3HF5 A;  2R4F A;  1BHN A;  2XUL A;  4ZLN A;  3DLE A;  3I56 S;  2NUH A;  2RIL A;  1UP1 A;  2PC6 A;  1AT1 B;  5L39 A;  1VJQ A;  4DL3 A;  1LK5 A;  2UUT A;  2E5G A;  5KG2 A;  2KFN A;  4Z7C A;  2YNF B;  2R7W A;  2DH8 A;  1SV5 A;  5IWA F;  4K2J A;  1RT1 A;  4YR0 A;  1X4H A;  2YH1 A;  2IYG A;  2UUB J;  3R6L B;  3OTD A;  4PUO B;  1KTV A;  4ED3 A;  4LF2 A;  4C3L A;  1J27 A;  2BE9 B;  2JEG A;  3CD7 A;  2LQ9 A;  4LRB A;  3BQ1 A;  5HQL A;  2RUS A;  2CPF A;  1UPM B;  4X64 F;  1CUL A;  5D6G A;  4C0H A;  3KHH A;  5LSO A;  4AE5 A;  4ZPT R;  2MEW A;  2FD2 A;  3Q8R B;  1GQE A;  2RU9 A;  1NB2 A;  7FDR A;  2E5L J;  1H2T Z;  3H40 A;  4RUB A;  5I3U A;  2RS2 A;  2XMM A;  1RCX B;  3L09 A;  1AYE A;  1N88 A;  3CMA S;  3R5A A;  3SXL A;  1RCO B;  4AL6 A;  3M8Z A;  1JLC A;  2MKJ A;  4QIW D;  4KTQ A;  4MIA A;  2WCX A;  1T05 B;  3CTR A;  3ILI A;  4WKY A;  1C1B B;  1RIS A;  4I69 A;  1SJ4 P;  2X1A A;  3RBX A;  1R8H A;  3H5X A;  4DUZ F;  1HR0 F;  2BJ1 A;  2CQC A;  2OP5 A;  3QSY B;  1L3T A;  3VCD A;  3SSR A;  4URQ U;  1VQN S;  1A9N B;  2YH0 A;  1UPP A;  2IY5 B;  1S0O A;  3D0H E;  1F9H A;  4PG8 A;  3BV8 A;  4Y34 A;  4F26 A;  3BGO P;  2YX4 A;  4E8U A;  3D6F B;  2IM2 A;  3FFI A;  1CS4 A;  4X62 J;  3N01 A;  4MYT A;  3MMA A;  3KHL A;  1FWK A;  1U02 A;  1U09 A;  2XB2 D;  2JEI A;  5D77 A;  2F4F A;  1JLQ A;  3QAU A;  1JLA B;  2ZZM A;  3HKW A;  4EU0 A;  3SI8 A;  4JB8 B;  3DYA B;  2YQ1 A;  3BSC A;  5E7O B;  3DXB A;  3MTK A;  5B0B A;  2EW9 A;  2DHH A;  3LGH A;  3Q8P B;  4Y2K A;  3OR1 B;  1V5I B;  3CNQ P;  1GMW A;  2BE2 B;  3TA2 A;  1YBA A;  3F73 A;  2RE1 A;  4JV5 F;  2V67 A;  4ATN A;  3ENV A;  1M5O C;  3LW5 C;  2J7W A;  4AQY F;  3IBF B;  4O4R A;  4OYM A;  3MR3 A;  3J7Z T;  3ILL A;  3AD7 C;  1T8E A;  1DBD A;  1M5V C;  1AB8 A;  1ZZN A;  5FJ4 A;  2KT2 A;  3D1Q A;  2XLK A;  3VAK A;  2XO7 A;  3V6H A;  3BQ2 A;  1X9S A;  4C8O A;  3OUY B;  3KWM A;  3C15 B;  4RBT A;  5HMW A;  3NCP A;  1VMB A;  4ENO A;  1E6V B;  2IC3 B;  4YS2 A;  3OPK A;  4LFB F;  2IFX A;  1U1R A;  2OD6 A;  3W62 A;  1KN6 A;  2CQP A;  3KK1 B;  2CA9 A;  1B3T A;  4DCP B;  3HHL B;  4FPR A;  2W9C B;  5K9F A;  4E0D A;  1NKC A;  2EK6 A;  5L46 A;  1WAC A;  3LGN A;  3B82 A;  3UVJ A;  3TZY A;  2ADB A;  1KVI A;  4LBH A;  4ZCM A;  4QYZ J;  4F4A A;  4JOU A;  3D6M B;  5KG5 A;  5KFB A;  4P2F A;  4B3R F;  1CJU B;  1O0P A;  2IMO A;  2H51 B;  1TFY A;  2W1B A;  1RAE B;  4ITS A;  2VB6 A;  4OI2 A;  3FEX B;  3NG8 A;  1TTH B;  2DNK A;  2CPD A;  4OJ1 A;  4DL0 C;  2IM1 A;  1C0T B;  2OPS A;  1NPR A;  5KFP A;  3DOM B;  1N5T A;  1VK8 A;  4HHJ A;  3MMC B;  3BH7 B;  4M95 A;  1P27 B;  4V1A k;  3Q8Y A;  1QD1 A;  3THT A;  3LQV A;  1X4A A;  3K58 A;  5LSL A;  1HNW F;  2QFJ A;  1CEZ A;  2G2Z A;  4URS A;  3PR5 B;  4ZA1 A;  3X1L B;  4JI0 J;  2ZFH A;  2F63 A;  4QOT A;  1RAO A;  1TR0 A;  2MKC A;  3J7Y U;  2B8P A;  3U7J A;  5IM0 A;  1Z4U A;  3OBI A;  4P6Q A;  1IR1 A;  3NWR A;  5CAA A;  2VFV A;  1ZA2 B;  2MJU A;  4ECS A;  4MT1 A;  3LF0 A;  4A8Q A;  1JLF B;  3BSA A;  4UY8 5;  1UJ6 A;  3NOC A;  3HI9 A;  1WEX A;  4JI3 J;  2K3I A;  2ZOG A;  2KDO A;  3K5N A;  5J2M A;  3HJF A;  1M5P C;  4DV1 J;  1HNV B;  4LF4 F;  1YI2 S;  1QAJ A;  2UUC J;  1SPB P;  2BJE A;  1TU0 B;  4AL5 A;  2BUN A;  4YN3 B;  1OPI A;  2KXH A;  2DRB A;  2VKZ G;  3NGU A;  2XI3 A;  4NZ0 A;  2VG7 B;  3M8W A;  5H9E K;  4U6P A;  2AZ1 A;  2IM3 A;  2LEB A;  1QLN A;  4CP5 A;  5IT4 A;  4W98 A;  3TZW A;  3C16 B;  3UD4 P;  3GFY A;  1B99 A;  4P9S A;  4ZLL A;  4A47 A;  2WSF C;  3NGD A;  2BV3 A;  3VGU A;  4C97 A;  3GR1 A;  2YVS A;  2NSC A;  4UTG A;  3U02 A;  3DRR B;  4NLW A;  1AZS A;  4LFC J;  4NXN F;  1EHW A;  4B9U A;  2B9E A;  4FXV A;  5I3Q A;  3M32 B;  4F2S A;  3LP2 B;  2V9K A;  4ECU A;  5GMD A;  4PQA A;  3MMB A;  1ZPW X;  2NXJ A;  3PDN A;  4L73 A;  4ECZ A;  4DR5 J;  4DU8 A;  1IBL J;  2V68 A;  2JJ4 D;  1X9W A;  1JLB B;  5DDP C;  3IA0 A;  3B54 A;  4KC5 A;  3GPA A;  1RGV A;  3MD1 A;  2G0I A;  3ZTS A;  2CFX A;  1XMQ F;  1XNQ F;  2ZDP A;  2KG1 A;  4F04 B;  4WFA Q;  1D9D A;  1U49 A;  1MWZ A;  1HNZ J;  3GJQ B;  1QSL A;  1TL3 B;  3KMQ A;  2KZZ A;  5K8P A;  1VQ4 S;  2FZC B;  3KK3 B;  3CDB A;  2HVE A;  3OFG A;  5ETS A;  1D0E A;  2FJW A;  4PCQ A;  2B9X A;  3MPU B;  2W2O P;  4ZP6 A;  3C8Y A;  2DPJ A;  1HAR A;  2HBQ B;  3BGR A;  3QJP A;  3SEO A;  4IOC Q;  1ZTT A;  2H1Y A;  5CAB A;  1ZOT A;  3HFZ B;  4ETZ A;  1U4B A;  2FJE B;  4J9V A;  1K73 T;  1FA0 A;  2IM0 A;  4LRD A;  2OEK A;  2N3L A;  2PI5 A;  3BO2 A;  3B4M A;  3U1L A;  2VG5 B;  4GKK F;  1R8C A;  4QCL A;  1BGX T;  1WC0 A;  3IFE A;  1U0H A;  3MEC A;  5DS7 A;  3UFC X;  1YHQ S;  1RT5 B;  3EXC X;  5J1N A;  2YNG B;  1N36 J;  4O3Q A;  2V5H G;  1ZM9 A;  1K9M T;  2KT3 A;  4OQJ A;  3K5L A;  1IKV A;  1UFL A;  2UVW A;  4DUY F;  1APS A;  2LEC A;  1NJZ A;  5BYR A;  4B3S F;  2OKQ A;  1ZH5 A;  1N6Q B;  2O67 A;  5ADZ A;  2LDY A;  6FD1 A;  2N3O A;  3NGR A;  2V94 A;  4Q0B B;  1KWM A;  2V8V A;  1HBU B;  3FC9 A;  4R8U A;  2LXF A;  2J6S A;  3IS9 A;  2P8I A;  3QT8 A;  3BM7 A;  4J9O A;  3HSZ A;  2BRL A;  1M90 T;  4LF7 J;  4IR9 A;  4USV A;  2NPI A;  4CM0 A;  5LXR A;  1RWM B;  2W01 A;  4RKU C;  2AIR B;  1YJ9 S;  3O3L A;  5CYM A;  1YBU A;  1WEY A;  4FF4 A;  2DGO A;  3LP0 B;  3V2U C;  4TVA B;  2MZQ A;  3H4D A;  1F5C A;  1K8A T;  2YWH A;  1NK0 A;  3HHD A;  1Z2L A;  5K8O A;  5F8H A;  3THP A;  5IT9 U;  1TL4 A;  3N4W A;  5LT5 A;  2Z2Y B;  4JI8 F;  1FRJ A;  2AP6 A;  4CO3 A;  2KRR A;  1GAO A;  4L76 A;  2ASY A;  4J37 A;  1PG5 B;  2EFV A;  1S1T A;  1VI7 A;  3KJV B;  4ECY A;  4GO5 X;  2NZ4 A;  2XWY A;  1RHK B;  1FKP A;  1WI6 A;  2DIT A;  4UOC A;  4USI A;  4KE5 A;  1VC0 A;  2MB0 B;  3VGT A;  4LVO P;  4ILM A;  3EVM A;  1FJ7 A;  1BQN A;  2M2B A;  3J81 Y;  3JSY A;  2ALZ A;  2CIM A;  1H3D A;  2LVW A;  1RAB B;  3ET6 B;  3R5B A;  4AYB D;  1Q8L A;  3VQS A;  1KLM B;  1U1L A;  5EWE A;  5AJ3 F;  2D1C A;  5T41 A;  2R42 A;  1Q95 G;  2Z57 B;  2BJ7 A;  1CJV A;  4GVL A;  3MEG A;  4CRJ A;  2ZWP A;  4N41 A;  2GMH A;  2OJ3 A;  1OY6 A;  2YWE A;  1N33 J;  1IKY B;  1U47 A;  2BA9 A;  2RKI B;  1Q78 A;  3CJT A;  5F9L A;  1FER A;  4WWS A;  2EFN A;  1TKT A;  1FX2 A;  1R31 A;  4NLP A;  4UQT A;  3WIU A;  1WKK A;  5HAT A;  1TUW A;  1WEZ A;  4LQ3 A;  3HSG A;  2RQ4 A;  4NYO A;  1TZ0 A;  4NLS A;  3T5L A;  3N9U C;  4YB1 P;  3JTO A;  4I7F B;  3CDE A;  2VPX B;  2K1R B;  4QJV A;  3VZH A;  4BBY A;  3AQO A;  1S7I A;  1RTZ A;  3CJ2 A;  4ZVF A;  4CDI A;  2ZH9 A;  4LJM A;  3FSX A;  6AT1 B;  4QWC A;  2LFV A;  3A8I A;  2Z4P A;  1NND A;  1KOH A;  1RT3 A;  1QE1 A;  1RWU A;  2HRT A;  2J6U A;  5GAE U;  2DR6 A;  4DQS A;  5F8I A;  1PCA A;  2L3M A;  2BRK A;  3CD6 S;  1ZAV A;  4H4O B;  2W9B B;  1SL1 A;  4YB5 A;  4OJG A;  5HQM A;  1X4C A;  3RR8 A;  1PJ5 A;  4HHU A;  3GJS B;  2G9O A;  3WHI A;  1VQ7 S;  3PKM A;  3MM5 B;  2WON B;  1DTQ B;  1VLO A;  2W24 A;  2V50 A;  3FSY A;  5KFR A;  3JYT A;  1IM4 A;  1BD6 A;  3BH6 B;  2ZH2 A;  3FQK A;  4ES1 A;  3MCO A;  5T7L B;  5KG7 A;  3W3S A;  3CCT A;  2BAN A;  1HQU A;  1Y4Z B;  4KFB A;  1T9T A;  1F1B B;  3W5Y A;  2AEM A;  4A8S A;  1XEZ A;  3DLH A;  3B8H A;  3MMJ A;  3M1V A;  1RTH B;  4P73 A;  1FK9 A;  1YKW A;  5HBM A;  3D3C J;  1J5E J;  2RH3 A;  1C2P A;  5L1L A;  4M94 A;  1C4C A;  5LMN F;  2WVB A;  4ERD A;  2B6A A;  1WKJ A;  4FVM A;  2HND B;  4P52 A;  2VFR A;  3CJ5 A;  1SH0 A;  2LU1 A;  1KLN A;  1NDP A;  2ZBR A;  2NZC A;  4DV6 J;  1LWF A;  1O6X A;  2DIV A;  3TEG A;  3I0S A;  1X4F A;  4PAB A;  4DPT A;  4ED2 A;  5C42 B;  2NYI A;  2V4J B;  4NEY A;  3OLB A;  3PNI A;  2AJ1 A;  3MZI A;  1HHQ A;  1IN0 A;  4LF8 J;  1FFS B;  1PKU A;  2HFO A;  4PKD B;  2WW8 A;  3ENA A;  4IFY A;  3MCN A;  5IZH A;  2K3K A;  4XPC A;  1YBT A;  2MZR A;  2DGS A;  4ZIV A;  4K4V A;  1TKZ A;  4OFZ A;  2DNL A;  3PO4 A;  1RWN B;  1O5J A;  2KZM A;  1S9G A;  3A3N B;  1KOO A;  4Y0F A;  3AJD A;  3DOL B;  3GIM A;  2GO9 A;  4X4V A;  1HI0 P;  2ZUA A;  4MFB B;  1WC4 A;  2ZHB A;  2MGZ A;  3R1L A;  3H5S A;  3RW6 A;  3OW2 R;  3PY8 A;  4PPZ A;  3RBZ A;  4WFB Q;  2AD9 A;  3AD9 C;  1JX4 A;  4Y28 C;  5HVF A;  4V19 J;  5GVQ A;  2KH9 A;  5IV3 A;  3BB5 A;  1D1U A;  3KLE A;  2CAD A;  3UW1 A;  3MUM P;  3ZFV A;  4KGV B;  4N8O A;  4U96 A;  2X3D A;  2WSC C;  3PR4 A;  3I31 A;  4ECW A;  2HLU A;  4RLE A;  2PFF B;  3G8T A;  1X5T A;  2V4R A;  1N5Q A;  2QA4 S;  2MMY A;  3US5 A;  1VCT A;  3I0R B;  4Z2X A;  4G3I A;  3V4I B;  2DEI A;  4TKT A;  4DCJ B;  1RHR B;  1WG5 A;  2UUW A;  3A8K A;  4P72 A;  2AJ0 A;  2XO6 A;  4P75 A;  3MPD A;  5HMY A;  3PIO Q;  4DV3 J;  2GCF A;  3TA0 A;  3DRY A;  2H9Z A;  4ZVP B;  1F0X A;  2DXF A;  2QLW A;  2RB7 A;  2LDI A;  5KFD A;  4CTA B;  3OXG A;  1PJ7 A;  1KD1 T;  3GMG A;  5HP1 B;  2CAJ A;  2OEM A;  3FNN A;  4RU2 A;  2DHS A;  1HA1 A;  1GX6 A;  4AUK A;  3HVR A;  2NLW A;  5A6W A;  4WF9 Q;  5DDQ C;  3EGW B;  4J9P A;  3QT6 A;  4H4K A;  2ZJP Q;  2HQD A;  3HZG A;  4TY8 B;  1TUV A;  1S0N A;  2R7O A;  1Q81 T;  4OL8 A;  1VBX A;  1GK8 A;  1W7W A;  1CG2 A;  2XLI A;  1ZPV A;  4UUX A;  1SL2 A;  3K59 A;  2E1P A;  2QIF A;  2ZE2 B;  1FJE B;  4G1Q A;  3QGP A;  2MST A;  2ZBQ A;  1RI7 A;  1VLY A;  5ETM A;  4EFA C;  3ZTQ A;  3EVW A;  5KFJ A;  4IO9 Q;  4UT4 A;  3CJK B;  3H2U B;  1S1V A;  1ZS6 A;  3MDF A;  3GII A;  4FP9 A;  3A1Y G;  4NA1 A;  2C2Z B;  4JI1 F;  3GP9 A;  3GSI A;  1C0U B;  1VIO A;  3AXK A;  1SJF A;  2P5V A;  5IV4 A;  3VVU A;  4PG6 A;  2RSQ A;  2R7V A;  1TEL A;  3K7R A;  2XGP A;  1NJI T;  2YNF A;  2HNY B;  2RUG A;  3RBD A;  1X9M A;  4X64 J;  3FBB A;  4DR6 J;  1KP6 A;  2HPU A;  5E3P A;  2NQP A;  2Y1J A;  3NMR A;  4PUO A;  3U1M A;  4RUH A;  3KDN A;  1H2U X;  4QQB A;  3CJ4 A;  2ABY A;  4MTP A;  3D6T B;  3LP1 B;  3GB0 A;  5KG1 A;  2QLB B;  5FDL B;  2W2Q P;  3W61 A;  2BE7 D;  1YG0 A;  1U2F A;  1U1P A;  3MEE B;  4M5G A;  2FY1 A;  4O3R A;  3IAM 9;  1T9W A;  3WC2 A;  3PM9 A;  4EI2 A;  1PO6 A;  4BWM A;  4NCG B;  3WDO A;  3E3X A;  1JKH B;  3NGS A;  3HHK A;  2M9K A;  3UN2 A;  1GNK A;  1S79 A;  2IRX A;  2C2E A;  2HQG A;  3NEK A;  1HKA A;  1LQ9 A;  3NY0 A;  1D9A A;  1Q79 A;  4B9V A;  2ZH8 A;  3HX9 A;  3KJQ B;  1OWX A;  3QIP B;  2EFQ A;  2LKZ A;  4USW A;  3M9M B;  3IWX A;  4DUZ J;  3GSD A;  5F8L A;  3RB4 A;  1YSJ A;  1RHU B;  1S6P A;  2ZH4 A;  2W7P A;  4KGZ B;  3OTO F;  2HMI B;  4NOH A;  5H9E J;  4EZ6 A;  2J7K A;  1VC6 A;  3PV8 A;  1UA1 A;  2XY7 A;  3M8P A;  1LEO A;  1NH7 A;  5KFU A;  4ED4 A;  1KTQ A;  2VAS A;  1Q8K A;  4ZHR B;  1RAJ A;  1U6Z A;  2NRE A;  1HYS B;  3LGM A;  2YWW A;  2EG1 A;  5K14 B;  3T1H J;  1CLF A;  5CYQ A;  3M8R A;  2KFZ A;  1GTE A;  1Q82 T;  1UW9 A;  2PA8 D;  4CM2 A;  1Y3K A;  3KHR A;  1NHV A;  2KYZ A;  3CCS S;  2GFF A;  4DZ6 A;  1KVK A;  3N6M A;  4QBU A;  4YME A;  2A1B A;  1WEL A;  2R8J A;  3IG1 A;  3KMS A;  4LBI A;  4ZLJ A;  3PVX A;  5A8K B;  4DJB A;  3DXS X;  1FI4 A;  4KGM A;  1RAC B;  3QWP A;  3VQT A;  4CLU A;  1PIE A;  2B9W A;  4O23 A;  4ZVT B;  4UZB A;  4UQG A;  7FD1 A;  4XTT A;  1NK5 A;  5J1E B;  2CYY A;  5E3Q A;  2VQE F;  2HNZ B;  2BX6 A;  5BYQ A;  4JV5 J;  2ZUG A;  4G1I A;  4D3G A;  2VJU A;  4DS5 A;  3QZ8 A;  5DLF A;  2EG2 A;  5K8N A;  2XYG B;  4MMO A;  1FXR A;  2AGP A;  2YQ0 A;  3DU6 A;  1LWC B;  2DH7 A;  3OR1 A;  1KSP A;  2MZ1 A;  5KG0 A;  1R89 A;  2JZ5 A;  3FCW A;  1L5U A;  3W8P A;  2BQR A;  1TMJ A;  3ELH A;  1HI1 A;  3TUI C;  1YJW S;  4FYY B;  3ITH B;  3P3D A;  2OMO A;  1S1U B;  2MLZ A;  4UOH A;  2W7A A;  2PEB A;  4LR7 A;  3QO9 B;  3QMQ A;  3HLU A;  1U25 A;  3JSM B;  3OUY A;  1JIH A;  3BSO A;  5KAK A;  4WFZ A;  3FMB A;  5DLG A;  4DX7 A;  1E6V A;  2IC3 A;  2R8K A;  1S6O A;  2UUB F;  4KGX B;  5KFZ A;  3KLV A;  1ZM2 A;  2Q66 A;  3VAH A;  3OLA A;  4UUW A;  3HHL A;  2CZ9 A;  1T7P A;  3M8Q B;  4WFN Q;  1EKS A;  3I4H X;  1D8Y A;  3K8V A;  2EK1 A;  2UUA F;  5AE3 A;  5A0Y B;  3WQP A;  1P1L A;  1CJU A;  2CJQ A;  3UE2 A;  1HNW J;  1TL7 B;  1FTR A;  1NH8 A;  3VAG A;  5C5J A;  4O3S A;  2E5L F;  4IDK A;  2AU0 A;  2AX1 A;  3OSP A;  2MKY A;  3D5M A;  2ZBI A;  3DM2 A;  5JXS A;  3MGJ A;  3MMC A;  2QTW A;  4KPC A;  4F3M A;  1N5V A;  4A48 A;  3M6W A;  1N54 B;  2BJ3 A;  2OPR B;  1NB7 A;  1RLC L;  2QMX A;  2J9D E;  1RK8 A;  3CC2 S;  3IWL A;  2JLF A;  2HHT A;  2AEF A;  3R9L A;  3MR6 A;  2ZJQ Q;  4LRA A;  2L08 A;  4ZVE A;  3OR2 B;  2FJX A;  2CJ9 A;  2CQ2 A;  5ETV A;  5J2N B;  3BO3 A;  2E44 A;  5A76 A;  3OHB A;  3BO4 A;  4OZ1 A;  2OAU A;  3R27 A;  4MKV A;  2KVQ E;  2UP1 A;  2NR0 A;  2B9Y A;  1JLF A;  1S1X B;  2RQK A;  2ADC A;  1H72 C;  3Q2S C;  2CXE A;  5BJR A;  2V6A A;  1S4F A;  4B3T F;  1HNV A;  2B51 A;  4ZN1 A;  1W25 A;  3UDV A;  2AYB A;  3KLF B;  1DQ8 A;  5F9N A;  3SFG A;  3IRX B;  4LSN A;  2CPH A;  2D9P A;  3QSI A;  2OSR A;  4X62 F;  3QGI A;  3HFV A;  2ZH5 A;  4WXW A;  2MKS A;  1YIJ S;  4P2X A;  5LM7 E;  4X4O A;  4IFV B;  1EB0 A;  2VG7 A;  3DRP A;  3CJQ A;  3V5R A;  2MY8 A;  3ILO A;  1JNR B;  3KYL A;  4NZ6 A;  1BQX A;  3LUY A;  1FWL A;  1XR6 A;  2E7W A;  4C6A A;  1UJ4 A;  2JFD A;  2YWF A;  1BWE A;  1FD2 A;  2C2D A;  2CJK A;  4YY3 J;  3MAQ A;  1SJ3 P;  3DHW C;  4QWD A;  8RUC A;  4BS2 A;  2HRY A;  2QJ3 A;  3DRR A;  4HH1 A;  1PC5 A;  2GHW A;  4N47 A;  4C11 B;  2DNN A;  2VA3 A;  1DY3 A;  2CQ4 A;  4J9N A;  3M32 A;  2N82 B;  2E9T A;  4TN2 A;  3GV7 B;  2CWX A;  2GVZ B;  2RS8 A;  2Z8Q A;  4ZJQ A;  4O3N A;  3UO0 A;  3MUV P;  1W26 A;  1MWQ A;  3WX4 A;  1HWI A;  4EK2 A;  4OHZ A;  4KY3 A;  2P9G A;  2JHE A;  2XI2 A;  3TRG A;  2DK2 A;  1IJE B;  5EUH A;  5MLC V;  1TAQ A;  2NCK L;  1WF1 A;  4S0M A;  4CLW A;  5J2P B;  4PG5 A;  1LNQ A;  1ULR A;  3L9Z A;  3AY0 A;  1O8B A;  1WKL A;  3BYP A;  4KHR A;  1OQ3 A;  3PX4 A;  2RDD A;  2D3O R;  5KG6 A;  3E2E A;  1HHT P;  4M5M A;  3KK3 A;  1WHV A;  2AW0 A;  2KN4 A;  4ANC A;  1NCL A;  2BM1 A;  4DF4 A;  2HLT A;  2LMI A;  1F2H A;  4GKK J;  4NPO A;  2GAH C;  3WZ0 A;  3UR0 A;  1RA7 A;  3GIR A;  3KG1 A;  2BYC A;  1YX2 A;  2BAB A;  2L9N A;  1Q16 B;  2C3Y A;  5IFM A;  5I4M A;  3EDR B;  1Z2Z A;  2HWT A;  3QYY A;  4NLR A;  4RNH A;  4DUY J;  2I9S A;  4NA2 A;  5EDW A;  1AXQ A;  1HLW A;  1RBL A;  4B3S J;  5AE2 A;  5HN0 A;  1T02 A;  2VG5 A;  3MM7 B;  3G87 A;  3MI7 X;  4LVN P;  3ZZT A;  3GWC A;  2PN6 A;  3UDL A;  1XC9 A;  5AXM A;  5E3A A;  4K4W A;  4OHX A;  1HBM B;  4UF4 A;  2FC9 A;  1ZTW A;  1NO8 A;  4I6A A;  3KDO A;  4RBV A;  3ZZP A;  2J9C A;  1OMS A;  2GQC A;  2C3P A;  1FJG J;  2CNN B;  2IVF B;  1WI8 A;  1N6Q A;  4NYZ A;  1Q5V A;  1GTH A;  1IUJ A;  4FYX B;  4DSE A;  2B43 A;  4Q0B A;  5C25 A;  3D68 A;  1FF2 A;  3GV5 B;  2QMW A;  2Y8W A;  3CUN A;  4RNN A;  1URN A;  2COL A;  1NJW A;  2JFK A;  3MED A;  4JI8 J;  3PKY A;  2C1E B;  3C14 B;  4LF5 J;  3DGV A;  2GIQ A;  5DJB A;  4ZMM A;  3QAT A;  3ZZU A;  1LW2 B;  2F8M A;  4FVC A;  5F8J A;  2MDA A;  3LP0 A;  2M5Y A;  2N4C A;  1JLE A;  3R1H A;  2CZV C;  4ILL A;  3PHT A;  1HQ2 A;  3PEH A;  3ZZZ A;  2RRA A;  3QRP A;  5DQH A;  3CME S;  1PIL A;  2XMU A;  1G3O A;  2V8P A;  2DNY A;  1VDH A;  3KUE A;  4CYU B;  2BMB A;  4DR2 F;  1LWE B;  2PD1 A;  1FKA F;  4LFC F;  5KTQ A;  4HAC B;  2VH7 A;  4I0W A;  1VQO S;  3RB0 A;  3CO0 P;  4ZPV R;  1MU2 B;  3ENQ A;  3BBC A;  4DR5 F;  1IBL F;  3H42 A;  3QJJ A;  1Q8I A;  4DL5 A;  2ZBP A;  3VGS A;  4WTY A;  1OYD A;  3K5P A;  3BQ0 A;  4RWW A;  4K59 A;  1TMM A;  1EET B;  1Y10 A;  1SKS A;  1EZZ B;  3GQC A;  2VQF F;  1S9E B;  3UDC A;  2GJ2 A;  1HNZ F;  3VAF A;  3ZC4 A;  1R0A A;  2VD3 A;  2YQ3 A;  2R7X A;  1IKY A;  1RTI B;  1CJK B;  2RKI A;  1K0T A;  3D9B A;  5HVG A;  1HWK A;  1RAA B;  2WB4 A;  3ENW A;  2RF2 B;  3A3P B;  4FBU A;  3AAW B;  4TQR A;  4N77 A;  4MYU A;  2Y8Y A;  1NZ8 A;  2QSF A;  4OI6 A;  4P2M A;  2JDJ A;  2RU3 A;  5KFT A;  3SCK E;  4GC7 A;  2AYE A;  4USM A;  2M52 A;  4I7F A;  3MAA B;  2V8H A;  3QFH A;  4EUV A;  4DV7 F;  3L4B C;  5ITH A;  4O0N A;  2EKN A;  4F02 A;  1RQ0 A;  4CH7 A;  2IAJ B;  1B4S A;  4I64 A;  2YNI A;  3ISN C;  3N6N A;  2BOP A;  1RBO B;  1JQG A;  5DET A;  2ZJR Q;  2IA6 A;  2VOO A;  4CT8 A;  1IKX A;  4ECQ A;  1EX8 A;  2W9B A;  1RT2 A;  4M5L A;  3GU0 A;  2GQ2 A;  5FII A;  3TQ1 A;  4GMK A;  4LRF A;  4PG4 A;  4A4J A;  2E7V A;  1T03 A;  4RW7 A;  3H5U A;  2WON A;  1DTQ A;  1REV B;  1HW8 A;  4TY9 A;  5T7L A;  1TP7 A;  1P9Y A;  5F41 A;  2KI2 A;  4ZP7 A;  3PFO A;  4ZJO A;  1HBO A;  1UTA A;  2L9W A;  2VFS A;  5DG9 A;  1SKU B;  2V2Z A;  5A8R A;  1MMD A;  2V63 A;  1NSK L;  4UST A;  4IG0 A;  1A6L A;  2XHW A;  3OT9 A;  3AOB A;  1HI8 A;  3GYG A;  2AYM A;  1MN9 A;  3T5K A;  3NXZ A;  3AOD A;  1QUV A;  2HND A;  5H9F K;  3SZ2 A;  5DGA A;  1MMN A;  2MQN A;  1WJ9 A;  4TU7 A;  1X4D A;  3W1Y C;  5GAH I;  5E41 A;  1UVN A;  3OFE A;  3W9I A;  4C8M A;  2C3U A;  1N52 B;  5DRK A;  4Q7A A;  3NGT A;  2HHH F;  3GE9 A;  3I6P A;  1HIY A;  2ACM A;  1IVZ A;  1RKJ A;  1R6V A;  3HSD A;  1FKO B;  3DRX A;  1H6K X;  2QMU B;  2DHA A;  4RWX A;  2V2V A;  1JJ4 A;  2E66 A;  3AB2 B;  3BGF A;  3NBP A;  4ED5 A;  1U2R A;  1D9F A;  3JTN A;  4C2M A;  2XMV A;  2HQ3 A;  2XC9 A;  4ZVQ B;  2GJI A;  2ZOM A;  4Z7Y A;  3JAM Y;  4F3Q A;  4MFB A;  2WVD A;  2F8H A;  3NS6 A;  1VRT B;  3FVY A;  4BLG A;  3M9O B;  3M9N B;  5KFY A;  1S72 S;  3KKF A;  5C2C A;  3T1Y J;  1N34 F;  1RU1 A;  1K1Q A;  4CLP A;  3R5D A;  3TAM B;  3BYR A;  2B4P A;  1N33 F;  1SL0 A;  3H59 A;  2EPI A;  4JYA F;  4DV5 J;  3JXO A;  4H54 A;  4A8W A;  4ICL B;  1F6T A;  1HHS A;  5FLX Y;  2I0X A;  1ZZF A;  5ETR A;  3V4I A;  3OXL A;  3GJT B;  3FCH A;  3W9J A;  1LKZ A;  2UV8 G;  1SCJ B;  2H65 B;  4J91 A;  3F41 A;  3L7P A;  5CCM A;  1FFG B;  1S6Q B;  4OLP A;  1B64 A;  1FCA A;  1R7I A;  1KRP A;  2L48 A;  4JI7 J;  4PQU B;  4X4T A;  5GAD U;  2CPI A;  2VL1 A;  4DR3 J;  2XTJ P;  2EFO A;  1V3S A;  2LP4 A;  1QJH A;  4I6Y A;  4PYD A;  1GXL A;  3HO1 A;  1VRU A;  3CD5 A;  3OL9 A;  5LOQ A;  4K4T A;  4DFM A;  2AT1 B;  2JLE A;  1FNO A;  4CLK A;  4KIA A;  5KFI A;  4XK8 C;  3HXM A;  4G1P A;  2JC0 A;  1LW0 B;  1N0V C;  4R5P B;  3SIP B;  4I68 A;  2IBO A;  1VBZ A;  2CNO B;  3BSN A;  3SCI E;  4TY8 A;  4NEZ A;  4ZOS A;  2BJ8 A;  3QRQ A;  4ER8 A;  2MJN A;  4ED1 A;  1FE0 A;  5CYJ A;  2DNR A;  2DRA A;  2XS7 A;  2OEL A;  1Y3J A;  1TL1 B;  2ZE2 A;  3RU0 A;  3SFU A;  3CCZ A;  4B3M J;  4BCA A;  3CJK A;  4LSZ B;  5ETN A;  3C6T B;  3RZA A;  1J5E F;  3GV8 B;  2GQQ A;  1RUS A;  5KT5 A;  1C0U A;  2IIH A;  3R7S B;  3BN7 A;  1V5V A;  4QU7 A;  2OTJ S;  4DV6 F;  1F3F A;  1TK0 A;  4QIV A;  1NSP A;  2XS5 A;  2PSZ A;  3NAI A;  2HNY A;  2G1D A;  4B3O B;  4DSK A;  3QWU A;  2HZA A;  2E1M C;  4CLY A;  2WAQ D;  4YDD B;  2OPQ A;  2CQ3 A;  3LP1 A;  1E6Y B;  1UFK A;  1RKI A;  5FDL A;  1YJ7 A;  1XR7 A;  3D1O A;  2KFY A;  3MEE A;  1S1W A;  2XQC A;  3AB4 B;  5JVG Q;  3LPE A;  4FNH A;  1WOR A;  2DNO A;  1NK7 A;  3FMW A;  4IG3 B;  1SJ1 A;  5ETP A;  4TU9 A;  2R7Q A;  1S12 A;  1RT7 B;  3MAH A;  3OTO J;  1LV5 A;  4PXB A;  1W2I A;  4ZPB A;  3V6J A;  2C28 A;  2H4Y B;  4CIO A;  2FGC A;  2CQH A;  2PEH A;  2FHK A;  3R5G A;  3OVA A;  1Y5L B;  3AXM A;  3MF5 A;  1CUL B;  4NLG A;  1I94 F;  1RAG B;  1T9X A;  4DI6 A;  4OHY A;  4K4U A;  2RHQ B;  1GMW D;  4MH8 A;  3Q2T C;  2DNH A;  5D4O A;  5DDO C;  2ZD1 B;  4CO0 A;  3D2W A;  1UKU A;  4U7C A;  1RAF B;  1DAX A;  4AFF A;  4ZHR A;  1HYS A;  4KB7 A;  1JLC B;  5D4L A;  1SKR A;  4WU2 A;  2PA3 A;  2E5I A;  3LAL A;  4C3M A;  2V2Q A;  4DV3 F;  2BAC A;  4DV0 F;  1U8S A;  4OV6 A;  2EXU A;  2YWK A;  3P96 A;  2X3G A;  1GEH A;  4MIW A;  2AF6 A;  1RAH B;  5A8K A;  1RTD A;  4N7T A;  1XMB A;  2U2F A;  1NKB A;  2VFT A;  3OL6 A;  4DV4 J;  3TA1 A;  2BXJ A;  1JXE A;  2HNZ A;  3NKY A;  4H4K C;  1URR A;  3D28 A;  4OJH A;  1FRL A;  4ED7 A;  1YJV A;  4Y2I A;  5AXL A;  3TOQ A;  2QEX S;  1VRQ C;  2O5D A;  1MN7 A;  2QN6 B;  5ETK A;  3SV4 A;  3AA8 A;  4DL2 A;  1PGZ A;  2F5G A;  2WBR A;  4RNM A;  5KT4 A;  4ELU A;  5K8M A;  3TUP A;  3M2U B;  3FFI B;  2ZH6 A;  2J0X A;  2ZZN A;  1LWC A;  3R2D J;  1CS4 B;  3MMA B;  2R8H A;  2I6W A;  1V3Z A;  3VTI A;  4J7C A;  4K4Z A;  1X5S A;  2XS2 A;  1M5S A;  4HVZ A;  3DGP A;  2KRB A;  3DMJ B;  1GMV A;  1S1U A;  1IM6 A;  2QGF B;  3QO9 A;  1RB0 A;  2IBK A;  4FS2 A;  4K4Y A;  2BQU A;  2MHN A;  3UCZ P;  1PYO B;  3CVK A;  4U95 A;  2CNK B;  2UUA J;  1TVR B;  3EUN A;  4DR6 F;  1ZET A;  3VVT A;  4JV2 A;  1RHJ B;  2GW8 A;  3OD2 A;  4HTI A;  1NM2 A;  4RPF A;  5A2Q U;  4L6V 3;  2XY5 A;  1G1X A;  1KQS R;  3C3L A;  3Q86 A;  2Z30 B;  4YHH F;  1RWW B;  4LRC A;  4LF9 J;  4IOA Q;  2DYA A;  2VHG A;  1CJT B;  2B56 A;  1KBR A;  2MPU A;  3EVO A;  4CCH A;  2F65 A;  1SJR A;  1GT8 A;  1FNX H;  4DPO A;  3WIV A;  1TL7 A;  1M5K C;  2M88 A;  5ETO A;  2A0F B;  2ATC B;  3R7B B;  3H0P A;  4DX6 A;  3K8W A;  5DQG A;  3EYZ A;  3KG4 A;  3U1N A;  3UVJ B;  1L3V A;  3BJY A;  1NLK L;  4HT7 A;  1U26 A;  2OPR A;  2HG4 A;  2FHO B;  1FD8 A;  4MJK A;  3EZ5 A;  4RNF A;  2RDJ A;  1X5O A;  2OGU A;  2XG8 A;  3TX8 A;  2YBV A;  4KV8 B;  3G8S A;  4M5K A;  4WP9 A;  4CWB A;  2OO4 A;  3OR2 A;  1WHW A;  2OPS B;  4AD6 A;  5J2N A;  5I42 B;  4B3T J;  3BZQ A;  4DPX A;  4MIB A;  2WSE C;  1T95 A;  1TQL A;  3S1T A;  1XR5 A;  3J7Y I;  3T1H F;  3D1H A;  2C2M B;  2OTL S;  1S1X A;  3M05 A;  3TYT A;  2KM8 C;  4BDP A;  3IM8 A;  4UOG A;  2HIQ A;  4JI2 J;  2D3O 1;  5D0R A;  4RW9 B;  2MKH A;  3G4S S;  1GH8 A;  3H2V E;  1PJ6 A;  4K50 A;  4PXD A;  2QA2 A;  3KLF A;  3KUG A;  2G2Y A;  3R5C A;  3G6Y A;  4LFA F;  3HJV A;  5F0U A;  2Z2Z A;  2MZT A;  2MQO A;  2NYH A;  3O6Q A;  4ANE A;  3PRV A;  1ROF A;  4IFV A;  2B5J B;  1YDL A;  2M7S A;  1K0V A;  1M5H A;  4WZM A;  5AXN A;  1VBY A;  1HBN B;  3EGZ A;  4UOF A;  2DXD A;  3U27 A;  2AJ2 A;  3G6V A;  1KHW A;  4NX9 A;  2G2O A;  4O3P A;  2L9D A;  2FJB B;  2G4B A;  1SH3 A;  3BDE A;  1LXJ A;  3M7V A;  1VQS A;  2A3J A;  1S99 A;  2GVZ A;  1F5B A;  4NAS A;  4P7V A;  5DM6 Q;  3NL0 A;  3FCV A;  2CNL B;  4DUT A;  2RDI A;  4ES2 A;  3FEY B;  3ISN D;  3A3O B;  2PI4 A;  2EVZ A;  5F8G A;  4ZP8 A;  3W66 A;  1QSS A;  3VWS A;  5LXY A;  4CLS A;  4QZV B;  4X65 J;  4DF8 A;  3OJU A;  4IH5 A;  3G9C A;  1T11 A;  1H7W A;  2HIY A;  4ED0 A;  2X1B A;  4CO5 A;  1XK8 A;  3C6U B;  5J2P A;  3HHL C;  1TKX A;  4Q5V A;  3F56 A;  1YLX A;  2ASL A;  4ES3 A;  1QY7 A;  3MMB B;  4OYA A;  4W4M A;  1HMV B;  2GO8 A;  2CG8 A;  1DLO B;  4H4M B;  1SBR A;  1I1G A;  2BJD A;  5KFF A;  2FQQ B;  3PHE A;  4PXC A;  3M6U A;  1SC3 B;  2CPZ A;  3CC4 S;  1YQH A;  2YX1 A;  2GJF A;  5JUM A;  1FDB A;  2UU9 F;  4KQZ A;  1RWX B;  2V4Q A;  1SH2 A;  3EGV A;  2P9E A;  1UEU A;  4DX8 H;  5KFX A;  2VBZ A;  3H8Y A;  1JMT A;  1S59 A;  1WC1 A;  3DC2 A;  1NK8 A;  4FNI A;  3HDS A;  2CRL A;  3VAM A;  3BGR B;  3W2W A;  4DR1 J;  4LUB A;  2OD4 A;  5H9F J;  1HBM A;  1FXD A;  3D6H B;  2KG0 A;  5JMN A;  4KJI A;  2KTQ A;  2CPJ A;  1KQF B;  4QU6 A;  2I8E A;  3JS9 A;  4ZVS B;  2P6S A;  3T6J A;  5KT2 A;  4M5D B;  2EKY A;  3DLK A;  1PYT A;  1F5A A;  3IM9 A;  1DZ5 A;  2VOP A;  4ZIT A;  1G6B A;  3JTP A;  3T41 A;  4IO1 A;  3M4X A;  2Y0S D;  3TJ8 A;  5KFV A;  3C14 A;  1UEK A;  2MQL A;  3T9N A;  4DR2 J;  1F2G A;  3NP5 A;  2K8G A;  5T14 A;  1PSD A;  5I3P A;  2FJD B;  2LXU A;  2LA6 A;  3VF0 B;  4KHP J;  4M5N A;  5HLF B;  3DNC A;  1C1C B;  4Y3C A;  2G13 A;  2E29 A;  4YY3 F;  2YY3 A;  3DLB A;  3VR1 A;  3CJ8 A;  2UXD F;  1T9U A;  3PYD A;  3LPY A;  4RO0 A;  4XO0 A;  3V81 A;  4CYU A;  3PZP A;  2BEF A;  3PYG A;  1LWE A;  3Q89 A;  5KFO A;  3DRS B;  1C4A A;  1Y5I B;  4A8X A;  3I82 A;  2VQF J;  4M63 A;  1KDN A;  4OMF G;  4LR8 A;  3TVZ A;  1RJJ A;  3T5H A;  2W8K A; 
#chains in the Genus database with same CATH homology
 1F6T A;  3Q8U A;  3ZTP A;  3GP9 A;  3EMT A;  2DXF A;  3NGT A;  4UOF A;  3B54 A;  3ZTO A;  2DXD A;  3GPA A;  1HIY A;  1WKK A;  3VVT A;  3VVU A;  3ZTS A;  2ZUA A;  1K44 A;  1NHK L;  3WX8 A;  3NGU A;  1HLW A;  2CWK A;  4AND A;  2AZ3 A;  3ZTR A;  1S5Z A;  4HR2 A;  3FBB A;  4EK2 A;  3Q86 A;  3FBE A;  3BH7 B;  1NUE A;  2AZ1 A;  1U8W A;  3Q8Y A;  2DXE A;  3ETM A;  1NPK A;  1MN7 A;  1S57 A;  1PAE X;  3B6B A;  1XIQ A;  3VGV A;  1LEO A;  4CP5 A;  1NDL A;  1NDK A;  2DYA A;  3FKB A;  4W98 A;  3BBF A;  3FBC A;  3PJ9 A;  4DI6 A;  3FCW A;  1F3F A;  3BBB A;  2HVE A;  1NSP A;  1WKJ A;  3EVO A;  2NCK L;  1B99 A;  4UOG A;  3ELH A;  4S0M A;  5IOL A;  3Q8V A;  3FCV A;  1NB2 A;  3VGT A;  4DUT A;  1JXV A;  5BXI A;  1NDP A;  3NGR A;  4FKX A;  4ENO A;  4F36 A;  3VGU A;  4KPC A;  3EVM A;  4FKY A;  2B8P A;  1WKL A;  1NDC A;  1S59 A;  4UOH A;  1NSK L;  3DKD A;  3L7U A;  4O0N A;  1W7W A;  3FC9 A;  4DZ6 A;  5CAA A;  3EIC A;  5C7P A;  3EJM A;  1MN9 A;  2HUR A;  3R9L A;  2B8Q A;  1BHN A;  4C6A A;  1EHW A;  3NGS A;  1B4S A;  1BUX A;  4ANC A;  1LWX A;  2DY9 A;  4ANE A;  1NCL A;  5CAB A;  3PRV A;  3Q83 A;  1HHQ A;  3FBF A;  3BBC A;  3EE3 A;  1UCN A;  1PKU A;  2BEF A;  3Q89 A;  3ZTQ A;  3G2X A;  3EVW A;  3ENA A;  2HVD A;  3EM1 A;  3VGS A;  1BE4 A;  1NSQ A;  1NLK L;  4F4A A;  1XQI A;  1VYA A;  1ZS6 A;  2VU5 A;  1KDN A;  3MPD A;  3BH6 B;  4WBF A;  2BX6 A;  3JS9 A;  3DDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...