1LWXA

Azt diphosphate binding to nucleoside diphosphate kinase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRAIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray analysis of azido-thymidine diphosphate binding to nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 44
structure length 150
sequence length 150
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1lwxA00
3EJMA 3FCVA 3BBFA 3L7UA 1PKUA 1NUEA 3VGUA 3FKBA 1NHKL 4ANDA 1S59A 4ANEA 4HR2A 3BBCA 1HIYA 5CABA 3VVTA 4S0MA 1XIQA 1UCNA 4DUTA 1BUXA 3VGVA 3GP9A 3VGTA 1WKKA 2ZUAA 3B6BA 3BBBA 3Q89A 5C7PA 1F6TA 3DDIA 3Q8UA 3G2XA 4O0NA 4UOGA 1KDNA 1F3FA 3ZTSA 1NDCA 3PRVA 5IOLA 1NLKL 4KPCA 1VYAA 3WX8A 1U8WA 1BHNA 1W7WA 4FKYA 5BXIA 4FKXA 3EVMA 3NGTA 3EVWA 3R9LA 1BE4A 4CP5A 3Q8VA 3NGRA 2B8QA 3FBFA 3NGSA 3EMTA 2DXFA 3ZTQA 1HLWA 3FCWA 2HURA 1B4SA 3PJ9A 2DXEA 3ZTRA 3BH7B 4EK2A 3FC9A 3FBCA 4DI6A 1LWXA 2HVEA 2VU5A 2CWKA 4ANCA 3FBBA 2NCKL 3JS9A 3ETMA 4UOFA 1S5ZA 3EM1A 2BX6A 1NSPA 3DKDA 3BH6B 4F4AA 1NPKA 2HVDA 2DY9A 2BEFA 4DZ6A 1MN9A 2B8PA 4F36A 3EICA 1B99A 1NSKL 2DYAA 1NSQA 3GPAA 1PAEX 1JXVA 3MPDA 2DXDA 3ZTPA 1K44A 3VGSA 4ENOA 1LEOA 1MN7A 1WKLA 3EE3A 3ENAA 1S57A 4WBFA 1ZS6A 1NDLA 3Q8YA 1HHQA 1NDKA 3ZTOA 3ELHA 5CAAA 1NB2A 1EHWA 2AZ1A 3Q86A 1NCLA 1NDPA 2AZ3A 4UOHA 4C6AA 4W98A 3B54A 1XQIA 3NGUA 3FBEA 3Q83A 3EVOA 3VVUA 1WKJA
chains in the Genus database with same CATH superfamily
4KGZB 4CLWA 2EFPA 1SV5B 2QLXA 2VQFF 1EARA 3W60A 5KG0A 3FEYB 2N4CA 4OYAA 2YWFA 4P7VA 2HBYB 1OIAA 4P2FA 2RJZA 3M30A 2ZJPQ 4OYMA 4KPCA 4JV1A 1GXTA 1HNIB 4PUOA 3FRZA 2YQ1A 2ZH7A 4IO1A 2MHEA 4GO5X 3AD9C 4M95A 2DEJA 4HDHA 2LA6A 2YKNB 4IRCA 5IM0B 2XM3A 1U0HB 5DS7A 4EU0A 2GVDA 1M1GA 3PW0A 4HTJA 4ZCLA 2RUSA 2QLJB 3GV7B 1S6PB 5F0UA 4H4OA 3W8PA 1RT2A 5T7LA 1EB0A 2GGPB 2VODA 4LMZA 3LP2A 4C0BA 1NSAA 1AXQA 2P6TA 3BGOP 2B43A 4YHHJ 1HNZF 3E8OA 4QYZJ 2D3UA 4AT1B 2G2ZA 3UCZP 2J5AA 2RVJA 4X62J 3IM8A 5KFCA 9ATCB 4WIQA 2M2BA 1WC1A 4MTPA 1HR0J 3IRWP 4DUYJ 2D74B 2E5LJ 1IKXA 2W9BB 2K7JA 2IRUA 3CT9A 5AJ3F 2EKYA 4ILMA 4KY3A 5L46A 5HP1B 5FDLA 3KDNA 2BRKA 3M2VA 3TZWA 2E5JA 3OTOJ 4E8UA 4WFXA 4F4YA 3RRHA 3PJXA 2XYHB 4QWDA 1MLAA 1KNZA 5F8NA 3EWGA 1WWHA 4MH8A 4WFYA 5KFZA 4DFKA 4MYTA 5BYRA 2C28A 3PIOQ 3DMJB 4A8SA 4NLPA 5GMEA 3PVXA 2JHEA 2IC3B 4URQU 3THVA 1VRQC 3D6HB 2UUWA 2Y9HA 4MK9A 1TL1B 2ASJA 3ILOA 3DOLB 3CMQA 4L72B 2HWHA 3FQKA 2YWGA 1YKWA 1WSRA 2GO8A 1AROP 4RR5A 1KHWA 3FKBA 2E44A 2CJBA 2BJ7A 1T95A 3VVTA 3WQPA 1FDAA 3MM8A 4HHUA 2HVIA 4ED1A 8ATCB 4DCPB 1UPPA 5EWGA 4TLRA 1SKUB 1Y9OA 3W2WA 5FJ4A 4HT5A 3G6XA 3M1VB 3OXGA 3BGFA 2IM3A 3B4MA 4DR6F 3M2UA 5H1SV 1X5OA 2CFXA 5D0RA 1B4SA 2HAFA 3UO0A 2J6TA 3JAMY 1I6JA 3CJQA 1HWJA 3QIPB 2XGQA 2QIFA 2I6WA 1QSLA 4WPAA 2MKCA 1Z1ZA 3G6ES 4NLUA 1YJ9S 5D4LA 5KTQA 4C98A 4ID5B 2XY7A 1KLMB 2ZZTA 4NEYA 4F0KA 4ZJOA 3DLEB 4O0IA 5C5JA 2YWHA 5M2PA 2RMLA 1PAUB 5I42A 1NUEA 1RTJB 4FS2A 2VB6A 2NLWA 3MM9B 3I0RB 3E01A 4I6AA 3TJ9A 2LEAA 3AA9A 4G1QB 4QBUA 2WAQD 1RWWB 5DM7Q 4LF8F 3J81U 2HLUA 3KHHA 4N77A 2VONA 3AOCA 2HBZB 2OAUA 1KR4A 4OJ1A 3TA0A 2PA3A 4ZK7M 3C19A 1F5AA 2J9EA 5BR8F 1IM6A 2ZOFA 1JLBA 3CD6S 3IM9A 3P96A 3VCDA 3V6HA 4MK7A 4JI8J 5CD4H 3EPIA 2XZTB 3HKZD 5G0RB 3ILLA 1NK7A 4NYPA 4F26A 3S1TA 2MZJA 3OTBA 3PKMA 2LVWA 4NOHA 3U1MA 4K2XA 3U02A 2QJ3A 5HATA 3RRGA 5FLXU 4ECRA 3M8YA 2OEJA 1PJ5A 5E2QA 2NZCA 3FEXB 2XMKA 1ITPA 2EFOA 4TYAA 5J2MB 4I2PB 4DJBA 5EWFA 4O3NA 1D9AA 5F8JA 3EZOA 1M1HA 2BOAA 4LR8A 1YGYA 3OVSA 4ILRA 1IBMF 1VQMS 2A18A 3NMRA 5CHCB 4X64F 1SC1B 3KLHB 4F2RA 2C2EA 5FIIA 4OYPA 4NCGA 1DTQB 3BYPA 3EDQB 3RZAA 4WP3A 2W7OA 3HVTA 2Y0SD 3NEKA 3IMQJ 2MKJA 3QBCA 2NUUG 5IC4B 4USJC 4WFNQ 2YPZA 3M32B 1URRA 2DNGA 1F9EB 1H74A 1RAOA 1YBAA 1B70B 2XGPA 1JLEA 4F36A 2KH9A 1K8AT 3BSNA 2YXLA 4OX9J 2FD2A 3I82A 4LQ9A 1S6OA 3TUZC 5IV4A 3NWGA 2DITA 1NDLA 3RBXA 5HVHA 4CYUA 2BJ3A 1RAIB 1MWZA 3SBMA 2ALZA 2L9WA 1S97A 2R7RA 5JUMA 3RAQA 3S6EA 3MMCB 2X1BA 4XK8C 1C1BB 3A8KA 3MCNA 2IY5B 1YRUA 3UVJA 3MPYA 4IG3B 3N4WA 3T5JA 1U8WA 3VAJA 2NXNA 4DV4F 2VG7B 1KEKA 5ETSA 1T7PA 1L3SA 2H5IB 2U1AA 3BDEA 1UVMA 3B8HA 1S76D 4YDXA 3SZ2A 4ANCA 5HAOA 1YJUA 3HSJA 1SL1A 3GR0A 3LP0B 1QD1A 3A3NB 3M2RA 4J9OA 1T94A 3DLGB 3AQOA 4TYBA 3R5GA 5DDPC 3AQPA 5CAAA 3U7JA 1RHJB 2RHSB 2R2TA 3M8PB 1NU4A 1ZPVA 4JI4F 4DUTA 2ZUGA 3CDEA 4LF4J 3L9ZA 3LWMA 1UWBA 4P2MA 3VGUA 1NHKL 3C6TA 4ZP7A 3MM7B 2AU0A 2XLKA 2N7CA 3OV7A 1RHRB 8RUCA 3MEEB 2DJWA 2WSCC 1RYSA 4ZLNA 3MZIA 1ZAWA 3GQCA 2QL9B 5A0YA 1I94F 1RISA 4OHYA 2XI3A 2XHCA 2VBWA 3CMAS 3HSDA 3THPA 2P9CA 4XIUA 4DX6A 2BW7A 3HK2A 4FZVA 3R1LA 4NA1A 1E6YB 2F9DA 4YB7A 1NH7A 3W63A 3NGSA 4Q45A 4WZMA 1Q1KA 4C8OA 1X7VA 2W7PA 2IPOB 4G65A 2C3OA 2VF3A 3TWZA 2QV6A 3DHXA 4NLTA 4OJHA 4OI6A 1H0HB 1R43A 1I1GA 2HHPA 2FVCA 4DR2J 2F4FA 4DX5A 1MN7A 4A46A 2E66A 3R5AA 1UAWA 1GXLA 2AP6A 5LJ5Y 1S1XB 4W98A 3M9MB 3FMBA 3BV8A 1P1LA 1V3SA 4Q2MA 5K8NA 2CQHA 4QYZK 4L76A 1HW9A 5DLFA 3LGMA 2GVZB 3CJ5A 3MUMP 1LW0A 2LQJA 1IKYB 1Y5LB 4W90B 3HD1A 1E6VA 1FJEB 4X65J 3CXCR 1BQNA 4PEOA 3VAIA 3AHPA 2K3KA 2XBPA 5IZHA 4RNMA 1NK5A 2R7TA 3FBFA 2HGLA 4HH0A 4X62F 4UOFA 2YNIB 3N5FA 2GHVC 4NRUA 4DUZF 1T3NA 5KFUA 3MM6A 4DZ6A 1L3KA 2AX1A 2UXBJ 2C3YA 4FF3A 1UP1A 3W3SA 2I5JA 3MOZA 3R6GB 2XZWA 3KLGB 1SQEA 5F0WA 3D6FB 2IHR1 2WVDA 4BS2A 4B3RJ 2F63A 2D41A 3ZZUA 2B5JA 3SQOP 2AQ4A 2HWIA 2XG8A 3D0IE 3M9OB 4PYAA 4I7FA 1DQAA 4ZP8A 4OZ2A 5L38A 2ZUAA 1L3TA 4OYWA 2OMOA 2MXYA 1RTHB 1LWCB 4CM0A 1FJGJ 4KO0B 4CM2A 1AUDA 4DV5J 3MF5A 3EMTA 3BGRB 1CJUB 4ZLLA 4ERDA 1YQHA 1MROA 2WRMA 4B9UA 3CCMS 4ELTA 3W62A 2EFQA 1CJVA 1PO6A 2RU3A 4KHPJ 1X60A 1N6QB 4P2SA 4J9PA 2RF2A 4ICLA 1MN9A 4ZPCA 2EBEA 2LFVA 1CULA 3PM9A 4PG4A 5EHHA 3KJVB 1HBOA 1KOOA 2KJVA 5B08A 2AGOA 2R8GA 2CQPA 1S0VA 2EXUA 2LEPA 1I3OB 2YKMB 4M5LA 3NGKA 2O67A 2ALYB 5I3UB 5IWAJ 3PDNA 4LSZB 1RT6B 4FVCA 4RW4A 1EKRA 4F3QA 1FVSA 4CLKA 1EAYC 4B3OA 4PZVA 3LO3A 2KFZA 1TVRB 2WONB 2YNGA 3R7NB 5GAGU 3KG0A 1P9YA 2DHXA 3BR9A 1V5IB 5MLCV 2L41A 2HHHF 1URNA 4ZJLA 1D9DA 3OVBA 4B3MJ 2G0JA 3FBCA 2HHTA 1H2TZ 1FF2A 3PYGA 2DR9A 2ZBQA 2HIQA 1EIYB 2YKNA 1X5SA 1D9FA 4NLYA 4GO7X 5IM0A 2BANB 1MSWD 3RW6A 2Q6BA 4E2FB 2MKIA 2LQ9A 2POKA 1S9EB 2Z4PA 2CKWA 1QAXA 5CYJA 4FXVA 1SL2A 1B0TA 2GGPA 4LBPA 1S79A 2HFOA 4YS2A 5CZXA 2VPWB 1LFWA 1QTMA 4MKAA 1RUSA 2ZDPA 2WB1D 1QSSA 3KK1B 4NXNJ 1KFSA 4KHRA 1DTTB 2DIVA 1U47A 1TKXB 1AYEA 2FC9A 1VQOS 4F2SA 2DHGA 3OFFA 4J9RA 3OJSA 5HP1A 2C3PA 4FXDA 1NZ8A 3GCXP 3I6PA 3CE8A 2FUG9 1PC5A 2RQ4A 3GCWP 3L95X 2DNLA 2HK3A 3QT5A 2Y8WA 2LQ8A 1UEUA 3DMJA 4M5GA 2RKIB 4P71A 3E2EA 4KV8A 5KFSA 4CLTA 1H7XA 1Y00A 4DEZA 3UR0A 1RKIA 4WTOB 2IAJB 1LNQA 2YWWA 5KFQA 2I38A 4C8YA 1UVLA 4Z2XA 1D0EA 2ZC4A 1FA0A 1FWPA 3ZZ0A 2FY8A 1HIYA 2B4PA 4DSJA 3WX4A 3R5BA 2FZCB 4X4NA 1TP7A 2R8IA 3DLKB 1NK6A 4ZMMA 4N56A 3LW5C 4B9TA 3KK2B 4EFAC 2KJWA 2GV1A 3EPGA 4CLUA 4EO6A 4I69A 2VC0A 3VF0B 3M1VA 2JWNA 4YN3B 4RBVA 3P3DA 3R3TA 1S7HA 3HI9A 3QATA 4JI2J 3MTKA 5B0AA 4NXMF 3EICA 4LFAF 1VQNS 3GJSB 5KFNA 3KG1A 2VFVA 4N76A 2LYVA 2FJAB 3QIPA 2LQ5A 3OQ2A 4DDFA 4NLVA 3FQLA 3LQVA 4B9NA 2BBEA 1W26A 2RQCA 2GJIA 1FRIA 1TV6B 3D7SB 3TQ1A 1NM2A 4MAKA 4C8MA 1XMQJ 4PPDA 3BKTA 3PNIA 3QLHB 3RB6A 3SMZA 4X4TA 4ANEA 1KLMA 1VISA 2DRBA 3DLEA 1HBUB 4FF4A 4WXOA 5EDWA 1LOUA 3OHAA 1KHVA 1F3FA 2HBQB 1RTJA 2RDDA 3LGHA 4NCBA 4NEZA 3I0RA 4P9SA 1XWLA 1AT1B 4NA3A 4QPTA 2FYXA 1IN0A 1X4CA 2DGSA 3F73A 1MU2B 1UJ4A 3TP2A 3B4DA 2V4QA 2XO7A 1VK3A 2RRBA 4OYBA 2E1CA 2E5GA 3MUTP 3O44A 1HA1A 5KFJA 2HVEA 3MR2A 3J7Z5 4JP8A 3DRSA 4C8NA 4CH1A 4DFJA 3HHKA 1FK9A 2VKZG 3GIIA 2F3JA 4DWIA 2DHHA 2QA4G 2OEMA 2OELA 2MLXA 1S7IA 1EHWA 2R7WA 2IVYA 3RBEA 1WJ9A 2PMHA 4RW9B 4EEYA 3AXKA 4CLFA 3KLIA 5KT5A 1UL3A 5DO2A 1PKUA 2G1HA 3I9V9 3H25A 1FRMA 1RT5A 4ECZA 4ZJQA 4RNHA 3HVWA 2VFSA 4HEA9 4FF1A 4FYWB 5J2MA 2RHQB 4WKYA 1N56A 1IR0A 1FEHA 4MFBB 4JI3F 1RAAB 2XNRA 2XI2A 3LWLA 1R8HA 4O4GB 1MG7A 5ETQA 2HMIB 3GSIA 5HMZA 1WACA 2CDQA 4KAIA 5CH7B 2YWEA 4YR0A 5A8WA 2RILA 1T3OA 3ZTRA 3IAM9 3FNNA 2RT3A 1GX6A 3ISND 3D4JA 1DTQA 2F4VJ 3PEHA 1LWEB 3DXSX 4JI0F 2ZJQQ 5HN0A 3CDAA 2QZ8A 4G1IA 3P4UB 1IKVA 4X65F 1GT8A 2HRUA 3JQMA 3LTOA 4ZLPA 5DG9A 3M8RA 3Q2TC 4K4XA 2RIJA 5HSPA 2Z2MA 3RTVA 2XSJB 2O01C 1S1WB 2AZ1A 4UOHA 4RX6A 1FNXH 3N01A 1TL3A 5AXMA 1NJYA 4QPXA 3V81B 4X4OA 4CCHA 5F8IA 2RUGA 5E3AA 2V67A 4M5KA 3DRPA 4DR3F 3AOBA 3GFYA 2MHNA 2GAHC 2KI2A 1QE1A 3MECB 3C15B 3QGPA 2A2DA 3OVAA 5M2UA 1HNWJ 2V2ZA 2C2KB 5LT5A 1XNQF 3MMCA 4UT4A 2AHOB 3HP6A 3RR7A 3R2DJ 2BXJA 3T1HJ 2JFDA 4JV2A 2MLZA 2BMBA 1HQEB 2CWKA 2ZBIA 2XZDB 3MEDB 1O51A 2C2DA 4QIFA 2UUBJ 1F5CA 1NJIT 4LF7J 4CLPA 1K0VA 5C42B 3POTA 3OSPA 1X8DA 4IG0B 2HAIA 2DH9A 4Y2MA 3CO0P 3D28A 4ZVRB 3RUBL 4DV5F 2E9ZA 4WZQA 3PKYA 4I67A 4LVNP 3VAMA 3MTJA 1GEHA 3US5A 3DLGA 1R0AB 2L3MA 3R2CJ 5LMNF 4N41A 2ZWPA 3AAWB 1IBLJ 2PA8D 3G82B 2M8DB 4PXBA 5CABA 1UA1A 1VRTA 1SC3B 3UE2A 2ZDOA 4C3KA 2V0NA 4UOGA 2AGPA 3AODA 2C22A 4K4UA 4G1PA 1F9FA 2QG9B 4IH5A 2AT1B 1LKZA 4ZP6A 5H9EJ 5HROB 4PWDB 1RI7A 3MEEA 4UUWA 4LFBF 4ZVEA 4X66J 2W9AA 1B64A 3T5LA 1TL4A 2ZFHA 1WC0A 4NLGA 3NS7B 2JSXA 4ZVOB 1QAJA 3VR1A 4K4VA 2ZOMA 2HK2A 4YP3A 2DK2A 2KB2A 2OTLS 1JXEA 1VIXA 1KQKA 4PG7A 4EYIB 1XMBA 3IWXA 3T3FA 3CEDA 2MYFA 3BGLA 5GMKa 1CLFA 4LFCJ 6AT1B 4U95A 2H51B 3G86A 3B54A 4B3MF 5E7OB 1XMOF 4IH7A 3PACA 2OHDA 4W4MA 1RB0A 2X1AA 3I9ZA 1RABB 1WHXA 5L9NA 1S1XA 1FERA 3QZ8A 4URGA 2QC3A 3BYRA 4DR5J 2OSQA 2B9YA 3MR5A 1Q16B 4ZPBA 1HQUA 1J2VA 4K5RA 3PXGa 3CJSA 1PJ6A 1YVFA 2AEFA 1VYAA 2DGVA 1F3VA 2XS2A 2XTJP 2MDAA 4NASA 2MZSA 2KVQE 2K1RB 2DH7A 5D4NA 2RDIA 1OJ4A 3GFXA 2PFDA 3ETMA 1R6YA 1RAEB 3WHIA 3MURP 3UN5A 4LSNB 1JJCB 1IWGA 2Y0BB 2CQDA 2YNIA 1IQZA 4B3SJ 4ENOA 2AGQA 2ACYA 3OLBA 5F3TA 3EE3A 4G3IA 5K14A 3UW1A 5EN1A 2ZZMA 4A8KA 1JJHA 1N33J 4O23A 1ZM4A 4P7TA 2OD6A 4DR4J 3J80U 1HFEL 2L9NA 3EX7B 4UZBA 2R7VA 1JLQB 2XY6A 2JZ5A 4X4UA 4USKA 3RRKA 4OHXA 2HWTA 3IWLA 3MWBA 4A8QA 4B3TF 3BSOA 4B9SA 1T05B 2JL9A 3CJTA 2YNHB 3WIUA 3KJNB 3ZO7A 1O6XA 2WSFC 1RWMB 5D78A 2NYHA 1WI6A 1UVJA 5KFDA 1P8GA 1RTHA 1LWCA 4EWTA 2HHUA 4P52A 4DHVA 1LWFB 5K8MA 3JS9A 5HANA 2J6UA 4ZS6A 2NSBA 3BGRA 3J7AN 1U48A 4ZPVR 3SYZA 1UJ6A 5U47A 2HPUA 1ZBTA 2YKPA 1OSCA 4PUOB 5B0DA 5GAHU 2ZE2A 1KQFB 5GAEU 1YSJA 3KJVA 4ZITA 1RAFB 5HJXA 3EXCX 2AJ2A 3PY8A 2HZCA 2ZZNA 2YKMA 3A12A 3MMAA 2XMTA 3GIJA 3G6VA 5I3UA 4DR1F 4WP8A 3HHLD 4O3SA 3CJKA 4AQYF 4V19X 1GTHA 4IQMA 1FRXA 2VASA 3TEGA 1RT2B 5J2QB 4TVAB 4RO0A 3GG1A 3LP2B 3D54A 2G4BA 1JQGA 4YEAA 1F0XA 5CA5A 4ED8A 3UD5A 1ZTWA 4O3PA 1DHMA 3KLEA 1NSPA 3HSGA 1JKHB 1S1VA 4J37A 4QWEA 1V3RA 2R42A 2BKOA 1NNDA 2AJ0A 3GILA 2CQCA 1SB6A 4Y34A 1MMDA 2W25A 3FJ2A 1U49A 3K5MA 3OT9A 2CPZA 4Q8FA 4WK1A 2C1EB 3KUEA 4C9DA 2K7KA 3NY0A 4ECUA 3M2VB 2MQ8A 1RYRA 1VJWA 4ZLJA 3BQ1A 1FX2A 3KK3B 1SI9A 1S9EA 1WHVA 2LXFA 1KTQA 2UXDF 1S1UB 2BKPA 2IA0A 1WKKA 3VAKA 3Q8RB 1WELA 3U1NA 1D8ZA 3KFWX 3THTA 2WW8A 3T19A 1ZETA 2C3MA 3R27A 1RTDB 3Q22A 2NPIA 5KG6A 3SXLA 3FSYA 4OZ0A 2RDJA 1DTTA 1V3ZA 4XDCA 3D5MA 4F0HA 1EQ0A 4KH1B 1OO0B 3EZUA 1HYSA 3MM8B 5G4DA 2HQFA 4MKBA 2I8EA 2ZBPA 2FVPA 4YB5A 1HW8A 1DLOA 1Y3JA 4ZPAA 4EYHB 5E0OA 3IGNA 3I32A 1HNXJ 3M2UB 2PMZD 5E5NA 2RKIA 2ABYA 3Q23A 5AT1B 4DPYA 1GMUA 9RUBA 3RYLA 1H2UX 3GJTB 3CC4S 1R89A 1YIJS 2WHOA 3DDIA 4FDFA 2LP4A 2OGUA 2GCFA 2E9RX 3GONA 5ETKA 2HSEB 1X4AA 2OKQA 1YRTA 1NHUA 3H5UA 2VBYA 4JI6F 3PHTA 3DLKA 2NCKL 2OO4A 3TRGA 1X4FA 5I42B 1WI8A 2P9GA 4LF5F 5LSLA 3FGVA 1Q7LB 4NLSA 2XCPA 3E01B 5AE3A 2V68A 1IVZA 3SCIE 1JLFA 1HWIA 5LM7E 3TR5A 3RB0A 3T1HF 1IWAA 1LXJA 1ZYQA 3QIDA 3PX0A 1FXLA 4KR0B 4MJKA 2I2YA 4RBUA 1XN9A 4YB6A 1JLBB 3GFZA 1TV6A 1VOMA 1G3OA 2HHXA 1D3WA 2GQCA 1YBTA 2EC2A 1FEEA 3DGPA 2CJQA 2XMVA 3TUJC 4OHWA 2GIRA 4AL5A 2QL5B 3MOJB 4OHVA 3LAKA 2M70A 1BMQB 3G8QA 3GYXB 4KRWA 3AFGA 4JYAJ 1WHWA 1FXRA 2V34A 3DOKB 5KFPA 1MU2A 2MQPA 2AYEA 2DNKA 3RR8A 2B4VA 5DZ7A 4MK8A 5D0GA 4Y28C 4OI4A 1QY7A 2B8PA 4TY8B 4DF4A 1HL6A 2E1MC 4AE5A 2RS2A 4YB1P 1HPZB 3R5JB 3NLCA 5GADU 4I64A 2DR8A 4ZVPB 1X9MA 3JQKA 2IDEA 1XR6A 4CTAA 2Q79A 1SH2A 4F0MA 3GP9A 4DSIA 1C0TB 2D69A 4NYZA 3RG6A 4FNIA 4DV0F 3DCAA 4F4XA 4CLLA 2Z2LA 2KDOA 2BQUA 1J5EJ 5BXIA 3J7YI 3TVKA 1K73T 2ZD1A 1A9NB 2ZWOA 3JXOA 2C42A 4MFBA 2NXJA 1S99A 3D67A 4X4QA 4IR9A 2H54B 4CYUB 1JLCA 5I3PA 4DL5A 2JOQA 2ZH3A 4KB7A 4TXSA 2X51A 1IBKJ 5IT9U 4B9MA 2CJXB 1QUVA 4RKUC 3CGIA 3S01A 1PAEX 5KT7A 1S12A 2JH3A 1LWEA 2CPJA 2VOOA 2AKWB 5B0BA 5KFXA 3M6XA 4USHA 4CT9A 4BC7A 2MLYA 4B02A 1VBZA 4JI7J 3ENWA 4FYVB 3CCQS 4CLSA 4JUZA 1HWKA 4DV1J 3CSKA 4PRFA 1U1MA 2CPEA 3BREA 4QWBA 3HDSA 3TZXA 4NCAA 1QAIA 1QAYA 2RS8A 2G1DA 2HS4A 3W64A 1N34F 3V81A 3DRRA 4B3SF 1YRXA 5DDRC 1CJTA 3M2RB 4F7VA 3OFGA 3PRDA 2XC9A 1VDHA 4ATNA 3QPIA 3NGTA 3E51A 7AT1B 5E3PA 2K3IA 2UP1A 1DJ0A 3BKFA 2CQ2A 4ZN3A 2UVRA 4RNNA 2E1RA 2F8MA 1UWBB 3HHEA 1M5SA 4A8WA 3C6TB 4ZVGA 2FGCA 3KNAA 2KG1A 1GMVA 4C11B 1UFWA 3SFUA 1HQEA 3RAXA 3D66A 1B0VA 3MEDA 4HTIA 1F5BA 1MNEA 4Q0BB 2EG2A 5A0YB 5KG5A 1SBRA 3CD0A 4MMOA 5C42A 1RKJA 2BQRA 1RDRA 4IKAA 4IG0A 3FBEA 3WDOA 3H4DA 3DRYA 4HDGA 2GQQA 1I5OB 3R6LB 1TKDA 3NCQA 2RQKA 2GMLA 1IKWB 2GNKA 2J8SA 3UQSA 5F8LA 3DLBA 3RJMB 3FDSA 3IP0A 1Q82T 4M63A 5KFGA 2UXCF 1U1NA 1TQLA 3P5TL 3ONQA 4K8RA 3DKDA 3V6JA 3BQ2A 2DR6A 1EQMA 1FXDA 3W61A 4X4SA 4ZIWA 1KQSR 4GVLA 1KN6A 4I68A 3ISNC 1R8BA 2ZITA 1BQNB 3N9UC 3W2VA 3HPOA 2FPHX 2KT5A 1LQ9A 5CXTA 4USTA 5KOWA 1RGVA 3PV8A 3QAUA 3FCVA 1MWQA 3L7UA 4KBIA 1DFDA 1YJRA 1VQ9S 4MKVA 2PIIA 2VQEJ 4ECTA 1LK7A 2WBMA 2ROEA 3MM6B 2QA1A 2YPYA 4TY9A 2MQMA 1RHKB 2I5JB 2V69A 1NKEA 2GHPA 2YNFB 3TZYA 3PYEA 2V8HA 1X9SA 1RJJA 1H3DA 2Y1LB 2Q43A 3DC2A 3MMJA 4TN2A 4ECWA 1L5UA 5KOXA 5KG3A 4DI6A 2V2QA 3CJ8A 3SCLE 3JSRA 2B5JB 2W2MP 3CD5A 2K1RA 1HKAA 2LMIA 4I7FB 2ZH4A 1K47A 1Q53A 2QN6B 2ZM6J 3ZTPA 4LIWA 2B9WA 1GH8A 5H9FK 3QSIA 5ADZA 2HRTA 4FP9A 4PXDA 4DCOB 1WC5A 1H38A 4OI0A 4LT6A 5HVFA 2ZBCA 1M5OC 3KNGA 1TL5A 2V2VA 3LP1B 3K57A 2GZOA 1RT1B 3UI3A 3RW7A 3L09A 4NZ7A 5HL7Q 2OH2A 4Y65A 4LRBA 1NK0A 4HHHA 4DG1B 1MROB 1UA0A 4OJGA 2N82B 4I1TA 2I1RA 2DCLA 4IDKA 1WHYA 3OTDA 1XIQA 1CJVB 2WZ1A 1FWKA 1TK8A 2CG4A 3G2XA 3VQTA 4ICLB 5IQQA 1XR7A 1RA7A 3MAAA 1HARA 1LW2A 1M5VC 4K0KJ 4L3KA 1FRLA 2YKOA 3CCTA 5DQGA 3OHBA 1SIWB 2UUAF 1HBOB 3CCZA 4QIWD 4RL1A 1SH3A 3FCWA 1IQTA 2YNHA 4JV5J 3MGJA 1W2BR 2EKNA 3H2UB 1OSDA 3P5BP 2HZVA 2C3UA 4NL5A 3H5SA 4ZP9A 4KHMA 2B9EA 1FWLA 2HNYB 5AE1A 2P8IA 4RW4B 3H0PA 1EZZB 2W4DA 4K5SA 1LWFA 2OPPA 3GIRA 3IXQA 6FD1A 2EFVA 1K44A 2AV5A 4FVMA 2YNGB 4BDPA 3WC0A 1VBYA 4J9QA 3T41A 3QJPA 1WSVA 1WOOA 1UPMB 4OYXA 1N5SA 2FVQA 2CZVC 5KFFA 3TX8A 3IO1A 1IR2A 4ZCKA 2K06A 2HQGA 4GMKA 1WC4A 2D9OA 2W4CA 4FNHA 4XDDA 4O0NA 3QO9B 3D6MB 2XEXA 1CSJA 5B7WA 2YQ3A 5LJ3Y 2OEKA 2MZRA 4WU2A 1GMWD 3B78A 4LF9J 4AL7A 2JLFA 1PG5B 5HK4A 2UU9J 5J2QA 2WVCA 3CC2S 2DHSA 1HI8A 3C66A 1ACMB 3V4IB 3N0VA 2BR0A 2CQ0A 2DNMA 1VHIA 3LOUA 2VA2A 1JKHA 2ZH9A 1RT7A 2HIYA 2OD4A 3MFIA 3LH2S 2DGWA 5KFRA 5CD4A 1SJ1A 3M05A 2W2QP 1RHQB 4UZCA 2QE5A 2DPJA 2GS8A 1Y0HA 1NK4A 2BJ1A 2XWYA 3K59A 3BKUA 2JEIA 2AYBA 2M52A 3AJ1A 4DX7A 3QYYA 2R8HA 3C14A 2X3GA 1OS5A 3EGVA 3P49B 4L75A 3IRXA 1HWLA 3W5ZA 3KK3A 4U7UD 1IUJA 2CPIA 3HHLB 1LXNA 3S7RA 5T41A 4DV7F 2OSRA 4DL7A 3ZZPA 1KSPA 1S1UA 3CD7A 1K0TA 2G2OA 2QSWA 4FYYB 2KKHA 5KFAA 2NSCA 4KV8B 3C16B 3VHQA 2MZQA 4OJ3A 2Z57B 5A2QY 2J7UA 3NNCA 4NPOA 2V8DA 1FFWB 3DOMA 3MFHA 1RTDA 2BA9A 4PCQA 2DO4A 2HHSA 4JB8B 2ZH6A 4P74A 1N36J 1HD1A 3GIMA 3V4MA 2ZH8A 2CJ9A 2FGOA 3BN7A 3ZC4A 1RCXB 3G8SA 4IOAQ 3DI6B 2J0QD 4HKQA 2O66A 1ZZFA 3GJRB 5KFKA 3I5AA 3I0SA 3AD8C 1TR0A 5FD1A 3KMQA 1BGXT 1S4EA 1WKJA 2CPDA 3L3CA 1VC0A 3PG9A 1Q8LA 4H4MB 1U1RA 5KT2A 1BXNA 2PI5A 3H2VE 5M2RA 3OUYA 1F6TA 3KHGA 1TL7A 1VQPS 1ZAVA 2FHKA 2R7UA 1VK8A 3KXDA 5AE2A 1G1XA 1Q78A 5JXSA 3AB2B 4A8MP 4U96A 3A4TA 1AFIA 2IMOA 4ES1A 4QR0A 4DR7F 3LANA 2HNZA 3TO8A 3TOQA 4CP5A 1FNMA 5DDQC 3HHLC 3ZTQA 4DV1F 2YX7A 5HBMA 2HS0A 1VQ4S 1S77D 1U6ZA 3F0NA 3TA1A 3IC1A 4LRFA 1G4CA 1KP6A 3AD7C 2V4JB 4DZDA 1N48A 2FHMA 4Z37A 5LSOA 1RTZA 1RT4A 5J1EA 1CS4A 4A47A 4U8YA 1HI0P 5KT4A 2IVMA 1VLOA 3WZ0A 4OLPA 1WF2A 4U67Q 3T6JA 4ZVQB 3PYDA 5KFLA 1VBXA 5J2NA 4QJVA 1Z2LA 2ROGA 4IUFA 4FPRA 3ENVA 4WIIA 4M5NA 5I3QA 1CG2A 3L4BC 4XTTA 2YWKA 3DRSB 2RSQA 1ZM2A 5ETTA 4CO5A 3PRBA 4Q5VA 3OR2A 3W7BA 3TI0A 5C25A 1FK9B 1VLYA 2QSFA 1U8SA 1NK9A 2HS3A 1P9QC 1BE4A 1RLCL 4UY85 2GO9A 4OZJA 5C2GA 4HL9A 1GTEA 3KLIB 1CVJA 2RQMA 2XMAA 1KVKA 5E3RA 2U2FA 4DOZA 4HI1A 5DZ6A 4HHJA 1RT5B 3DOKA 4Q2LA 1U4BA 4USVA 1U26A 2AIRB 2Z56B 3PZPA 1FE0A 2V50A 4JI1J 4DV3F 5KAKA 5EGYA 3KUHA 2QTWA 4RW6A 1C0UB 4TY8A 5DRKA 2VQFJ 4CH7A 1R27B 2KFYA 1APSA 2F65A 3PFOA 5A8WB 3NOGA 3W9JA 2L48A 3S8SA 2GIQA 4HVZA 3IR5B 1HPZA 2BRLA 2D3OR 4NX9A 2X3DA 1U09A 1WD6A 3B6BA 3BN4A 4QW9A 4DXLA 2ZVIA 1XERA 1IKVB 4NA2A 4QW8A 3UPFA 1DY3A 3BZQA 5EUHA 4CLYA 1ELOA 1WTBA 1RXOB 2KO1A 1C0TA 3CJ3A 1VBKA 3BSAA 2WK4A 2IYGA 2DB1A 3Q8PB 3IFEA 1IJEB 1F1BB 1RT3A 2W2OP 2AJ1A 1H73A 3DLHA 2A3JA 1TL3B 5F3ZA 1LK5A 3K17A 3DRPB 1PJ7A 4ZN1A 3MCSA 4Y6IA 1KRPA 1VQ5S 5EX3A 1QE1B 2DYAA 5LOQA 1K9MT 4RW8B 4P75A 5A6WA 3K2YA 2MQLA 1HNZJ 4KGXB 1N0UA 5C24B 3DFEA 1SQGA 4Y2IA 1L3UA 1A6LA 2OI2A 1OQ6A 4PAAA 2V5HG 1ZA1B 2IDLA 2IIHA 4LSLA 4UTGA 4USUA 1HNVA 1U1OA 2ZOGA 3N6NA 1REGX 2H65B 1V5VA 1A7GE 4K4WA 4HR2A 4RJVA 5AJ3J 5THWA 1S10A 1YI2S 3AY0A 2A1BA 1OYEA 4NZ0A 1FDBA 3GU0A 3UFCX 4ZPWR 2UZAA 3PO4A 3POTB 1HMVA 2P9EA 4A8XA 4F04B 2MQNA 5L1IA 3KOAA 1LFPA 1TMMA 1AZSA 3D2WA 3OFEA 2VOPA 2QGFB 5D4PA 2OUGA 2I9SA 3CCVS 3IN5A 5ETVA 2DGTA 1PBUA 3T1YF 2MZ1A 4GKJJ 4GVBB 1JJ4A 1RWKB 2FLLA 4LR9A 2D3O1 3FMWA 1SKRA 2BQ3A 3MXHP 1S48A 4F67A 1VRTB 2IRYA 4DX8H 2B9XA 4R5PB 2XLIA 3LA0A 1PGZA 3GV5B 1GAOA 2GHWA 3QWPA 5AXLA 5E41A 4CO1A 2N3OA 5IS2A 4Y00A 3G96A 1PYOB 3MCOA 2MJNA 2YY3A 4C11A 4NMXA 4A8YA 4TU8A 2XNQA 4JV5F 5T14A 4Q0BA 1SUQA 2X7IA 2OPRA 3ILIA 3O1LA 1FNOA 3D3BJ 5F8GA 2LXUA 4P6QA 1OY9A 4E0DA 1Y7PA 1Q86T 4C3LA 3VGTA 2NYIA 1R0CB 2CZ4A 4F02A 3J81Y 4DR6J 2QA4S 1M0SA 1VR6A 4RUBA 1F2GA 3R97A 4IFYA 1SPBP 4OV6A 3O8WA 3HF5A 3HX9A 1IKWA 2XMMA 4OLOA 5D8HB 5CYQA 3W66A 1DZ5A 4GC7A 7FD1A 1U2RA 4ZHRA 2CQGA 3UN3A 1SJQA 2BJDA 4I6WA 3SCKE 1RU2A 3NOCA 1FKPB 3ET6B 1JLAA 2J9CA 2DY9A 2Q66A 4AXIA 5HQMA 1HQUB 3G9CA 2VG6B 1S0OA 5FLXY 3TJAA 2QFJA 1C4AA 4DL3A 2YH0A 1ZS6A 1V6HA 4U7UK 1XC9A 3BGUA 5A8KA 4CZCA 2KTQA 4LF9F 1VC6A 2CNNB 4DFMA 1MWYA 3BEGB 1JK9B 1BD6A 3UD4P 4I56A 4ANDA 3AXMA 3BBCA 4E98A 2DT9A 3NWRA 3A8EA 1UCNA 4YHHF 2RD5C 3Q8UA 1U45A 1RBOB 5BR8J 3AOAA 2BE9B 4MIWA 2ZH2A 2MSTA 3MCMA 4KFBA 1HR0F 5K14B 3OL7A 4DUYF 2E5LF 2LQBA 2GMJA 2V94A 3Q0AA 4HYKA 4N8OA 2YNFA 1IR1A 4N47A 3ENQA 1PBAA 2DKOB 4I2QA 2V63A 1N52B 2LA4A 1RE1B 3N6MA 5DLGA 2HHVA 3ZXWA 3OTOF 2G0IA 3HZEA 2ADBA 1B99A 1NSKL 3GMGA 4L73A 2JDJA 3D1OA 1P6TA 2CNOB 1NKBA 1XR5A 1VC5A 4C7QA 3HULA 3MAQA 4G6VB 3EJMA 4WFAQ 4H4KA 4DPXA 2F40A 1BQMA 3G4SS 1Q7YT 4X64J 3LP1A 1RT1A 2DISA 3KDOA 4UY8T 2J76E 1X4DA 4DG1A 3SV3A 5IOLA 2DGOA 1Y5IB 2OFGX 1V9OA 1U1QA 3QGHA 3MPUB 4BWMA 2FC8A 2SXLA 2GAGC 3QRQA 5HQLA 1RWUA 2CPXA 2ZE2B 2PN6A 3OLAA 2MKSA 1U25A 2W4PA 1YK9A 1VS3A 1WDTA 1K1SA 1X9WA 2W8KA 1QTNB 1B0PA 3M8QA 4QR1A 2ZHOA 4ED2A 3MMAB 5D3GA 1CJKA 5IT4A 1N4LA 2DNZA 3CJKB 1LEOA 2HNYA 5ETRA 1XBWA 3LF0A 1NB2A 3QNWB 3PIPQ 2PI4A 3UWTA 2MGZA 2DGXA 1S49A 3H7HB 1R0BG 1S1TB 3IBFB 3W9HA 5KG4A 4DQIA 5DGAA 1RU1A 3KLEB 4DV4J 1JMTA 1S1VB 4BCAA 2MJUA 3MR6A 3MEGA 1Q0NA 3ISZA 2P5VA 2PFFB 3L7PA 3QGGA 3SSQA 4ILLA 4OX7A 1WC3A 1BWEA 3QO9A 3MD1A 3IGVA 5HJYA 2M7SA 1R8PA 2M5YA 1C1CB 3HT3A 2F8EX 5KFTA 2FLNA 2B3TB 2R2UA 4IOCQ 1WF0A 3H59A 3JAMU 1Y11A 3NS5A 3JSMB 2KXHA 3BR8A 2HVDA 4KE5A 1XTZA 2AX0A 2JEJA 3HKWA 1YZ6A 4MYUA 3W8GA 3PHEA 1NSQA 3ETOA 4LUBA 4JI8F 4PKDB 2CQIA 3NAHA 3PX6A 3V4IA 1UKUA 4JI4J 2OPSB 2XWXA 3IAS9 3OL9A 1M1KT 4DBQA 5KFOA 1CBKA 3O5TB 3VVUA 3NGDA 1N32J 1SH0A 3D68A 4YR3A 1I94J 5F41A 4NYOA 3A13A 1FJCA 1HBNA 3ZZOA 3Q89A 4A48A 3MPVA 4J9SA 3AJDA 2VPYB 1KTVA 2CQ3A 1HYSB 2LDYA 4NZ6A 1PSDA 3EGNA 1W7WA 3C6UA 1PILA 4CQ1A 2XCAA 1UETA 1NMEB 1DLOB 2ZH1A 4NLRA 3JSYA 3CDUA 4FBTA 3CVKA 3SDEB 2FLOA 3HHLA 3TAMA 2F9JA 4EBEA 3GR1A 2K2PA 4I0WA 3AT1B 2DEIA 3NCRA 3GYNA 4DV2J 2IM1A 4NI2B 2IFXA 4GKKJ 1RP5A 2DNRA 3C16A 1TKZB 3H5XA 2IVFB 2QYGA 2LXIA 2W2NP 3M6VA 5A6PA 1T9UA 3Q8YA 5SUHA 1IBCB 3QJLA 2UUTA 2HQ3A 4OX9F 4WKRA 1VCTA 2NR0A 1VQSA 3Q2SC 2OTJS 3DI6A 1YHQS 2R2SA 1YJVA 3GTYX 3OD2A 1N8RT 3UNGC 2WSEC 1WEZA 5D4OA 1ZM3A 4PYDA 1HD0A 4M5IA 4B9VA 4H4MA 2R9LA 2Q1LA 3JTNA 1S9GA 2A6OA 4EGLA 1JLFB 3MPWA 2YVSA 1OYDA 2W24A 2IM0A 2EW9A 4DUZJ 4RNFA 3PJ9A 4DSEA 3SIPB 2PC6A 4HI2A 3LUYA 2VHGA 2QRRA 2QT7A 4QWCA 1N0VC 3TARA 2DR7A 4HACB 4WTYA 4OHZA 1U1KA 4EMDA 3VWSA 3DGPB 1RLDA 4EUVA 3MMBA 5DJBA 2V4JA 3FRYA 3I5CA 2AZ3A 1FESA 3NBPB 2W1BA 5D15A 2BE2A 1CC7A 4GKJF 3IG1B 2VPXB 3OR1A 1R6VA 3MD3A 3H42A 2ZBRA 4OI1A 2FTRA 3QT8A 4QZVB 4LF4F 3KYLA 1PCAA 3DHWC 4C4WA 2V8VA 1S0MA 4DS4A 2B6AA 1ULRA 2GW8A 3UDEA 4YUDA 2R2RA 2R7QA 1G7CB 4DMZA 2DIUA 5GVQA 4V1Ak 2QX0A 3Q8QB 2G0CA 3RB3A 2JJ4D 1OMSA 4M8LA 5D77A 1UEVA 3EM1A 1S6UA 3PFEA 3BM7A 3QAEA 1KQGB 4CTAB 1QDUB 4QOTA 4CT8A 1Q81T 2H48B 3H4BA 5LSRA 2J9DA 1RHUB 3H90A 5D6GA 4OZ3A 5AXKA 1JXVA 2NXEA 2DXDA 4ES3A 2CUYA 1VFJA 1NH8A 1UFKA 1N5YA 7FDRA 1TK5A 2QEXS 1TAQA 3GB0A 1NCLA 2V8PA 3ITHB 3JYTB 2ZD1B 3C3LA 4DR2F 2J7WA 1WC6A 1JLCB 4CO4A 1S59A 1C0UA 4XAKA 4WXWA 2VG5A 2M8HA 3MDFA 3TX0A 2FIUA 2VUGA 3NCPA 1WG5A 1T03A 4NWBA 1SJ4P 4QWAA 1FRJA 2HHHJ 4Q8EA 2BE7D 3KKFA 2WBRA 1U6FA 2J0XA 3NNHA 1TKTB 3R7BB 4RZRA 4W92B 2MTLA 1HLWA 1UW9A 3CW2C 4YR2A 1TFYA 3FSXA 2RRNA 4RWWA 1VQKS 1YITS 1VQ8S 1RBLA 2C2OB 3CC7S 2VJUA 2B7CB 4I6YA 3V6KA 4PR6A 1YZ7A 3GIKA 3DRRB 5K8PA 1CJTB 4K4ZA 1U2CA 1CEZA 1WKLA 4J7CA 5HLFA 5BYQA 2DGUA 3BSCA 1UW4A 5CZVA 2BM0A 3ELHA 1JWWA 3HT0A 2UXBF 4HT7A 3MI7X 1ZAXA 2CAJA 1DAXA 1FTRA 4RW8A 1T9VA 1M90T 3OW2R 1X0FA 3QRRA 2HEKA 3PW4A 4CRJA 3K5NA 3ZZTA 4IRDA 1U24A 5C24A 3SEOA 3PCOB 1SC6A 4B3RF 3QRPA 1UZHA 4OZ5A 4J9UE 4PG8A 4ZA1A 3G6YA 3CIZA 4LRDA 3HO1A 1FFGB 4C48A 4PG5A 2WVFA 1U6BA 4WWSA 1FI4A 4FKXA 4QCLA 2DH8A 3HFVA 2EK1A 3AA8A 2O5DA 3TAQA 2DXFA 1WEXA 2UUCJ 3OJUA 3DU6A 4M5DB 1NJXA 1FJGF 3V5RA 2IJNA 4DPTA 4IFVB 2FB0A 1VHFA 2CG8A 2XB2D 1RAGB 3LPEA 4OI3A 3BO2A 2FVSA 4GVBA 3CCWA 3IS9B 5K20B 4KHPF 2CPHA 4UW2A 1JB0C 1WNEA 4V19J 2ROPA 1SKSA 2G2YA 4IO9Q 1NDKA 4R5PA 2OIHA 1U0SA 3IR6B 2YKQA 5L9XA 2RU9A 1X4GA 4KKOA 2M9KA 2LU1A 5JVGQ 4PXCA 2HFUA 4O4RA 4DSFA 3OL8A 2F5GA 2IMWP 2DNHA 2PO4A 2E1PA 3CIMA 5K5MA 1EP4A 5IWAF 2IJFA 2KZZA 4KYZA 2YTCA 4J9MA 1DQ8A 2E7VA 1FE4A 4U8VA 4ECQA 3DLLQ 2XYPB 3DM2B 2V6AA 2KG0A 3EVMA 3G71S 3X3UA 5CCMA 2D7SA 3W2VB 4KIAA 2MQOA 4XPEA 4F3MA 4NXMJ 3ZNUA 4LFAJ 2IM2A 2PMWA 1WG1A 3I4PA 2J0WA 2EK6A 4R0JA 2ZEJA 2H5EA 3N28A 1WORA 2R8KA 1EX8A 1W25A 2NXUA 2F7VA 4KH0B 2AEMA 1FKPA 3HFZB 3B82A 4F50A 3EGWB 3ET6A 1UFLA 2VZ9A 3OSNA 4C0OC 2VG6A 3V2UC 4DPOA 2D3ZA 2ZKUA 4M1KA 3UN2A 3T6BA 2ACMA 2DCUB 2PDAA 3W65A 2FJWA 1Q79A 2JEFA 4O44A 2CQ4A 5J2PA 2APOA 5KT6A 2EEYA 4L6V3 1T8EA 3P8BB 3K89A 5J1PA 3NL0A 1QVFR 3I56S 4C8ZA 1SKWA 1IM4A 2ZKTA 4KJIA 4PWUA 3T9NA 3Q8SB 5E3CA 4DU8A 3D6TB 3O2IA 4NXNF 1N32F 4QYRA 1ZZNA 1LWXA 5DETA 4Y2CA 2VPZB 2AW0A 3UDCA 1NB7A 1IXKA 2MKHA 2XMUA 1TUWA 4IDKB 2IBKA 3IBWA 3C46A 2JRSA 2Z0GA 2CNKB 4NRTA 4B9LA 2QLFB 3MAAB 3OL6A 1LW2B 3V6DA 3DDNA 1KC8T 1EETB 2XSFA 1XEZA 4LBHA 5CYMA 3HJFA 4TQRA 1S9FA 4C6AA 2MEWA 2COLA 1AUSL 1SJ3P 5IV3A 2E29A 4DV2F 1QLNA 4DQSA 5L1LA 2PE8A 1OPIA 1VRUA 4JI3J 3EUNA 4KGVB 4GKKF 3OTCA 3WBZA 4X4RA 1RHMB 3RBDA 4TLQA 3VV2B 5C7PA 1MMNA 3GJQB 2BKNA 4DL2A 3OTEA 1J27A 1R8AA 2KT2A 2OPPB 3WX8A 4B17A 1Z2ZA 2FJVA 4OIXA 1NO8A 1TZ0A 4DPUA 2XS7A 2DGQA 3DRXA 3ULHA 4R8UB 4JI0J 5RUBA 1HHTP 2DXEA 2EVZA 3FC9A 2KT3A 5JMNA 1RTIB 2DNPA 2XMJA 4ID8A 2JLGA 1F2HA 4DQPA 2XY5A 1Y5NB 1OY8A 1L3VA 4EO8A 2VICA 1JJ2R 3JTPA 2HNDA 3D1QA 4JI2F 3SI8A 3M8WA 1XK8A 2HZAA 1HHQA 2MKKA 4DR3J 4WFBQ 2RB7A 2GIFA 3SQGB 3PW7A 1SXLA 2GMHA 3OXLA 5HI7A 2AMCB 2PEHA 3C2PA 1JLGA 4FPIA 4A8FA 3FK4A 2H1YA 1DURA 1BUXA 3PW5A 1XMQF 1XNQJ 1FX4A 4OL8A 1T0TV 5IC6B 1JXLA 3PR4A 3PRVA 1S1TA 3BDPA 4ZOSA 3FZBA 4YY3J 1VQYA 1P27B 2DR5A 3O6QA 1RT7B 3N5BA 2BJ8A 2Y1IA 4IQXA 4DF8A 5CCLA 1T9XA 3HMJG 2XULA 3FBBA 3CCES 1C1CA 4RBTA 1N5TA 3FFIA 2L9DA 3GZ7A 2AYGA 1U1LA 3C14B 2VA3A 1S6QB 3RAMA 1O8BA 5K9FA 4DU7A 1M5KC 3JSMA 3BO3A 3IRXB 2HW3A 1U02A 2EFNA 2Z58B 5LMNJ 5HMXA 3RBZA 2ZC3A 4RWXA 4RNOA 2FVRA 1RWNB 4WU3A 4CNZA 1PIEA 4TU9A 3LALA 2H3EB 2ILZA 1Y3KA 4FN5A 1KOHA 4ZCMA 2OPSA 4DFPA 5A8RB 3SSRA 3QQCD 5J1NA 3MEKA 3DOMB 2RRAA 3BBBA 1WG4A 2V9WA 4ETXA 3J7YU 4LFBJ 4LF6J 2VFUA 2MPUA 2VIHA 2PT0A 2VFRA 1VJQA 2QL7B 3QSYB 1REVA 4TNOA 2KYZA 2XMWA 1OPZA 2V2KA 2E1AA 4ES2A 2R7SA 4QIEA 4K4TA 2JEGA 1SV5A 3I0SB 1B7FA 3JQJA 4X4PA 3HVRA 4EI2A 1NRKA 1QM9A 3F56A 3SDEA 4F4AA 4P10A 1GMWA 2AYMA 3QT7A 1OQ3A 3OUYB 4F4ZA 3HCXA 2NUHA 4J5OA 1TL7B 2F4VF 5B0EA 1XMOJ 1HNIA 4NI2A 3DYAB 1FKOB 3BF4A 2F8HA 2OMLA 4PQUB 1TKZA 4LQ3A 4HLBA 1X4BA 2HNZB 5KFWA 4NE9C 3J80Y 2MY7A 3QWUA 4QIGA 2VH7A 2Y1JA 3D0GE 2X1FA 3GSDA 2O3DA 3BQ0A 3D9BA 5HBMB 3M6UA 1JNRB 1ZH5A 1U0HA 3DDKA 1T02A 1TFWA 1S6PA 3UDVA 3OFHA 4QR2A 1RT4B 5J1EB 1HQ2A 1CS4B 2NPFA 2FJEB 3A3PB 1UVKA 2D9PA 2VL1A 2NXCA 1N54B 3OPKA 5ETPA 3NP5A 1HNWF 4OYOA 2WB4A 1VQLS 3IR7B 5J2NB 3I4HX 3HD2A 4ECYA 5F9NA 1UZDA 3SSSA 5KT3A 3HM9A 1D8YA 2LEBA 2QMWA 2DNYA 2W9BA 5GMDA 1SIZA 1Q95G 1MW7A 3ZZRA 1C4CA 2BYCA 4EBCA 2UUBF 3OR2B 3I31A 3G87A 4HACA 4YDDB 5C25B 4LF7F 2R8JA 3ZTOA 1Y10A 3Q86A 3QFWA 2UUCF 3TUPA 2YQ0A 1GK8A 3EVOA 1F9HA 2E7WA 1KVIA 2DRDA 3KJFB 4B3TJ 1NXIA 2B4UA 3UDLA 2ASLA 5H9EK 3CCSS 3NBPA 3SFGA 3NS6A 3K0JA 3IG1A 1VIOA 2IC3A 3AJ2A 4BLGA 2G9OA 2CRLA 1RWOB 1IBLF 2B51A 4GRSA 1TL1A 3D1HA 2IBOA 1FD8A 2CPFA 3DOLA 3R1HA 3KLFB 3CDWA 4LF1A 4CIOA 3EDRB 1UVNA 4RW6B 4ZPDA 5A76A 3WIVA 4K4YA 4MIAA 1DRZA 2VD3A 2MY8A 4X66F 4OYZA 3KG4A 4K2JA 2BX6A 3QGIA 2CXEA 2JC0A 5BYSA 1YJNS 1FRKA 1HHSA 4DN9A 2GFFA 3KUGA 1SJRA 1SCJB 4U6PA 2VKRA 5L8RC 2KN4A 4QQBA 2OJ3A 3TANA 2FJBB 2Q6CA 3DU5A 3I5BA 1ROFA 2LU2A 4EBDA 3JB9k 4DR1J 2OLWA 4LRAA 4LFCF 3LAMA 1RT3B 4AQYJ 3ITHA 3JYTA 3ADAC 2BW2A 3JSBA 1SQFA 3IWNC 3M8SA 1BWVA 4C3MA 2EI5A 2W2PP 3CDBA 1Q5VA 2HRYA 1KDNA 2AF6A 4WYWA 1H6KX 2MZTA 1Q8IA 4DR5F 4ID5A 1KBRA 3VAFA 4HH1A 2CJAA 4O3OA 4FKYA 3FCHA 4CI0B 4TQSA 3EVWA 4OQJA 3QZ7A 2CQ1A 5GAGI 4EK2A 3CWJA 4WE1B 4KQZA 2VU5A 3MM9A 4LSLB 2CADA 1HNVB 1CQMA 2GC8A 2FZGB 3JTOA 1TKTA 3ICLA 4N7TA 4G1QA 1EKSA 1FDNA 4LREA 2HVHA 3DNCA 4NLOA 3G8TA 2IA6A 1FRHA 4J90A 2C2MB 2JC1A 5KFHA 4D3GA 3HFKA 1HMVB 1HI1A 4DSLA 1A0OB 4ECXA 1AZSB 1TUGB 2UV8A 2UXDJ 2R4FA 3TW0A 4BBYA 3IA0A 3M6WA 1J5OB 1RZMA 1N33F 5G0RA 2QA2A 1TAUA 2FZKB 4DR4F 4LJMA 3NG8A 5JJBA 1WOPA 3MM5B 5F9LA 2E5HA 2ZNZA 5F8MA 1RAJA 1Y4ZB 1FCAA 3R5CA 2VBZA 1NPPA 3O3LA 1RBAA 4LF2A 1XJWB 4I2PA 2R7XA 4Y3CA 4L3NA 2DVIA 3BH7B 1SUQB 2FQQB 2OPRB 5BJRA 3H20A 4NLXA 5K8OA 2LKZA 5B09A 4A8OA 2AEJA 4F4WA 2MQQA 3K5PA 4M5DA 3M9NB 4ZIVA 3GYGA 6FDRA 3KLHA 2ADCA 4IFVA 1S4FA 1ZPWX 2XQCA 4ZPTR 2ZVSA 2DO0A 1X31C 4IFYB 1PYTA 1AA1B 4DV6J 4X2BA 3IS9A 3LGNA 1P1TA 1BC6A 2Z2ZA 5MAOA 5CYQB 4NLWA 4ZVSB 4LVOP 1NHVA 4ZHRB 3M32A 1U2FA 2WOMB 4Q44A 4AXJA 3QFHA 2FJDB 4MIBA 2GQ2A 4O3QA 3FVYA 4URSA 1JLAB 4K4SA 1RA6A 3A8JA 4JOUA 3W5XA 3ILJA 2W8LA 2OPQB 4JI6J 1GX5A 3EXYA 2ATCB 1C2PA 1WOSA 4XO0A 2MB0B 1RAHB 4NLDA 1WUUA 2DNOA 4LF5J 5A8KB 1KLNA 4WP9A 4DLGA 4DS5A 3DM2A 1TUVA 4YFUA 4M5HA 1C1BA 4WCEQ 4NLQA 3K58A 5I4MA 4YY3F 4IG3A 3VGSA 2MMYA 4K59A 2VG7A 3RU0A 1NPRA 4ED3A 5B0GA 1TTHB 4KFBB 4OZLA 2A2CA 2HQIA 1H72C 3AH6A 2V4RA 4DL0C 3TUIC 2AD9A 3R8YA 3H5YA 3LP0A 3TNVA 3NKYA 3N6LA 5IXUA 4I2QB 2IRXA 4LBIA 3U1LA 4ETZA 1YG0A 4PQAA 5DGBA 1YJTA 3H8YA 4Q7AA 4X84A 4PABA 2ZHBA 2C2ZB 3K8WA 3GG0A 2BV3A 3IBCB 3P6YC 1T9TA 2CJKA 4BWJA 1YBUA 4WFZA 5KFMA 3CCUS 3QJJA 4ELUA 3M8PA 1NZAA 2R7OA 3MM7A 2XO6A 4CDIA 2J7KA 2WVEA 3TAPA 1BQMB 1GFWB 4ECSA 5IT9Y 4LF6F 1KVJA 3MUVP 4PXEA 1UVIA 4ZKAA 3VTIA 1D09B 4KC5A 1UMJA 2YX4A 1Q8BA 5KFVA 1S57A 1E6YA 2BDPA 1I51B 3BO4A 4IR1A 4RW7B 2PD1A 1UWAA 5E33A 3CJ4A 3CJ2A 2W7AA 1X0PA 2CIMA 2EG1A 2QLWA 4DQQA 1EETA 3T5KA 3C8YA 2CNLB 4DV0J 5JVHQ 3ZZYA 5EX0A 1HBMB 2EWHA 2N7YA 3VGVA 1FHTA 1HNXF 1YJ7A 1ZM9A 2VDIA 3M8ZA 4AUKA 3BPDA 3M8QB 5D3GB 1CJKB 1NLKL 4M5MA 1S72S 1KS2A 3CB4A 1N5QA 5LMUJ 3ZZZA 2MGZB 4DCJB 1KD1T 4ELVA 4R8UA 1X4EA 2GVZA 5HMWA 3D3CJ 1KFDA 3BB5A 1IKYA 5B0CA 3A3OB 4DLEA 1RTIA 4H4KC 5KFEA 3MEGB 2FHJA 4Q43A 2W9CB 3PJWA 1SC4B 2M0GB 2BVZA 2EC0A 3GE9A 1DBDA 4EZ6A 2HHQA 4UOCA 2H4WB 3PW2A 4CO2A 2BM1A 3F44A 4WYLA 3PTWA 1N34J 3HHDA 3RB4A 5D0HA 1ICEB 1WTFA 4GC6A 4LR7A 3SQGA 1R3NA 2G13A 4CO0A 2HFNA 1M5PC 3KLGA 3T1AA 3P45B 4F8RA 1CPZA 1QVGR 1XNRJ 4FYXB 2D1CA 4M5JA 2E5IA 5IQ6A 3R9LA 2DBBA 4JI5J 3CF5Q 3NGRA 5F8HA 3DGVA 4CO3A 4PG6A 2DPIA 3W1YC 3PEJA 3J7ZT 4JYAF 2HFZA 4OZNA 4PPZA 1R31A 2MKYA 4IH6A 2KXNB 1HBNB 1KKHA 3TEHB 2H5JB 2PGCA 2YX1A 4KO0A 1H7WA 4JV0A 4Y2KA 2HG4A 4RUAA 1CJUA 1S6QA 2V9KA 3C6UB 2KFNA 3GLJA 1IJFB 2DHAA 3K8VA 2KYXA 3BBFA 3TAMB 5C2CA 4JBCA 1N6QA 3M30B 2BACA 4KPYA 2ILYA 1FO1A 2B7BB 3N79A 5A8RA 3M7VA 2KRBA 1CQNA 5AXNA 2CYYA 4ED7A 2WVBA 2ZNYA 2CA9A 1CC8A 3I96A 4RPFA 3ZFVA 2UXCJ 1BY9A 4PWWA 2W01A 3TVZA 1RWVB 2DNNA 3VQSA 2GVDB 2H4YB 1RT6A 2WCXA 2CZ9A 1J5EF 1GXUA 2JVOA 4R0EA 4H4OB 1NKCA 1FVQA 5T7LB 4TKTA 2KZMA 3CTRA 4TU7A 1TVRA 2WONA 4K7QA 1FJ7A 2P2CB 2RH3A 4YOEA 4EZ9A 1IBKF 5LXRA 1NEEA 1S9GB 1YX2A 1RWPB 4ED0A 4RLEA 4UQTA 3QT6A 5KG7A 2FJXA 3DYAA 1VMBA 1FKOA 1JNZB 3H2LA 5EWEA 3BPSP 4PQUA 2AJQA 1X5PA 2LLZA 5D0EA 1UEKA 1T11A 4D3HA 1IKXB 4JI7F 2MSSA 2NS1B 2UVVA 4FBUA 1OWXA 3CUNA 4OV1A 5FDLB 2RE1A 4ZCIA 2BANA 3I55S 1NDCA 1WEYA 1TU0B 3HLUA 3MMBB 5LL6d 2M88A 2AWZA 3PO5A 3EGZA 2CVEA 3NNAA 1VGYA 3TZZA 2HURA 5DG7A 5L1JA 4DQRA 5DQHA 2BE2B 4CWBA 2PEBA 1S5ZA 4ECVA 3OR1B 2ZHAA 3TVYA 1WDDA 5HQ8A 3H40A 2LCWA 4BHQA 4AD6A 2BEFA 5ETMA 3Q24A 2VBXA 1JX4A 1YLXA 3KK1A 2R3VA 3HHNB 5ETNA 3J81j 1RADB 4MT1A 4CLZA 4KGKA 2AJ4A 4ZVFA 1TKXA 4F3OA 2B6AB 5DG8A 1NDPA 4AYBD 3NGUA 1UJ5A 3A8IA 5H9FJ 2CWXA 2J6SA 1T9WA 3CULA 2OFHX 3MHYA 3VAGA 2DRAA 3GV8B 3W2WB 1FD2A 3DXBA 2UUAJ 1SVDA 3CCRS 2QFIA 4UUXA 1TK0A 2B56A 1W2IA 1QJHA 2LDIA 2YBVA 4DL6A 2YH1A 2NQPA 2YKAA 4C8LA 5HMYA 4DV6F 1X5TA 1BQXA 4Y2AA 3CPWR 1N5YB 2IAJA 2BABA 3NRBA 4ER8A 3UNYA 3FSIA 5DDOC 2KRRA 5IFMA 3KLFA 2ASYA 4LIRA 4ZVHA 2VG5B 2Y3YA 2KVIA 4ALZA 2ERRA 2QYCA 1T03B 4CNYA 1NAQA 2Z2YB 3ENAA 3KK2A 2GJFA 3D0HE 4ZDNA 5B0FA 2A10A 3OXFA 2JFKA 3E3XA 5GAHI 3HZGA 3RGIA 5GAEI 4YMEA 4X4VA 3BJYA 5SZTA 1AFJA 3KWMA 3NXZA 1F60B 1YDLA 3TJ8A 1B3TA 5DQIA 2LECA 1BLUA 2VQEF 2JVRA 3EYZA 4AL6A 2GJ2A 4FF2A 5HLFB 2HLTA 3UD3P 3CJ0A 2J0SD 2WW4A 4J91A 2KU7A 2QO3A 4KGMA 3GWCA 3QLHA 4QU6A 1T9YA 3NMAA 3L7OA 3TQEA 1NBEB 1HBUA 1RK8A 4Z7YA 3CCLS 3KHRA 2HVZA 2CPYA 2WTFA 3K5OA 2HGMA 1FTCA 2RAQA 4WE1A 4NMLA 1KWMA 3GPAA 3DLJA 2ZH5A 2KHCA 1H2VZ 3GFHA 5HVGA 2HGNA 1M5HA 4IOBA 1YJWS 3R5DA 2I0XA 1WF1A 3KMSA 2ZM6F 2JX2A 4RUHA 2FY1A 3X1LB 4DPWA 3Q83A 1Q5YA 3EZ5A 2H9ZA 1DARA 3PX4A 2UVUA 1OY6A 4U9RA 4KTQA 4ED5A 1AB8A 4DV7J 5LXYA 4CH0S 2A0FB 4MKYA 2KM8B 4NCGB 3CMES 1J5OA 3MR3A 1R8CA 1FDDA 4OI2A 3HVTB 2N4DA 3KJQB 3W5YA 3U27A 2HQCA 2QMXA 2VV5A 1X4HA 4LRCA 1BHNA 3MM5A 2VFTA 4OFZA 2C2NA 2GX8A 4RW9A 1AW0A 2HFVA 2HQDA 2B8QA 4ED6A 4H54A 4K0KF 3WC2A 1VQ6S 4USWA 4ZVUB 3HJVA 1SL0A 1JLEB 4KKOB 1NJWA 1QUPA 3CCJS 2V8GA 1Q8KA 3BH6B 2FDNA 4A4JA 3T9ZA 2KHDA 3BS9A 1ZOTA 2HBRB 2XS5A 2BJEA 3W9IA 4RUCA 3MPDA 1EP4B 4O4GA 4F4KA 2B0GA 4Z7CA 4WJBA 3VZIA 5DM6Q 2HMIA 1O5JA 5KG2A 1RACB 5LMUF 3PR5B 2JNJA 2Z8QA 4IRKA 3QMQA 4FXWA 4QU7A 4N5SA 2Y1RI 3UVJB 4K50A 2EBGA 4OMFG 1VQ7S 4DR7J 2M4MA 1H98A 2WOMA 2XHWA 2XSJA 1FKAF 1B7YB 3AB4B 1S1WA 4USMA 4KSEB 2KM8C 2JLEA 1Z4UA 1RCOB 4USIA 3Q8VA 3MAHA 1ZTTA 3TYTA 3R7SB 2OPQA 1MMLA 4U7CA 4J9NA 3HXMA 4B08A 2QLBB 4OYIA 3MECA 1D1UA 3C15A 1O0PA 2UV8G 4R25A 4L74A 2UU9F 2QMUB 1KONA 1XNRF 1PYSB 1HWUA 4O44B 1RWXB 2EPIA 2RNEA 5J2PB 4UF4A 4LF8J 2ASDA 2VC1A 2X1GA 4JI5F 2F1FA 4RU9A 4RU2A 3TA2A 1G2EA 3DN9A 3K5LA 1EJ7L 2M3DA 2BOPA 1DQ9A 2CQBA 4QIVA 1K1QA 4ED4A 4BC9A 2ZJRQ 3I87A 2FHJD 2XLJA 4C0HA 2HYIB 3NAIA 5HO4A 3V6DB 1U1PA 2J8AA 1TMJA 5CYMB 1R0AA 2NZ4A 8AT1B 2K8GA 2A6MA 2B4OA 2Z30B 3G82A 2P6SA 5KFYA 4WF9Q 4C2MA 3T5HA 4DV3J 5ETOA 4DSKA 1VRUB 4N8NA 4C97A 3ZNJ1 2Q3PA 2HKEA 2NREA 4OZ1A 4ZVTB 1LV5A 5HROA 4PWDA 1IBMJ 1JIHA 4FS1A 2OP5A 2FHOB 4OX8A 4J9LA 1N36F 3KTQA 1TELA 4P72A 3KLVA 1GQEA 2HFSA 5L1KA 1LW0B 3F41A 1RQ0A 1E6VB 2AJFE 4J9VA 3SV4A 4RW7A 4DL4A 4DN0A 1GNKA 4S0MA 2DY1A 3A1YG 5GADI 2J9DE 2C2RA 2DD8S 3ZTSA 2UVWA 2EFGA 3CO9A 2KL8A 3FZ2A 3VZHA 4AFFA 1QSYA 1UTAA 4WK3A 3J7A1 1HBMA 5IT0A 2XYGB 2HNDB 4M94A 2DNQA 3KHLA 4ITSA 2IYIA 5A2QU 2L08A 3VAHA 1NPKA 2DTJA 1JLGB 3OBIA 4O3RA 3UR3C 4IYQA 1R7IA 3M4XA 2CJYB 3PYFA 1N5VA 2BUNA 4P2XA 4WBFA 1ZA2B 4J9KA 2KXFA 2CDRB 1S0NA 1FFSB 5KG1A 2ATLA 1XQIA 4P73A 5KFIA 2W9CA 1U7LA 3H98A 3SCJE 3LPYA 4C8KA 2BJ9A 2PSZA 4UQGA 3K7RA 4YQWA 5L39A 2O1PA 1NJZA 4LSNA 1RSCA 3FFIB 3UCUP 2VJVA 3CJRA 2CVIA 5ITHA 2FLPA 1N88A 3CNQP 4F25A 1YTYA 2BZ2A 4OX6A 2E9TA 2GA7A 3T1YJ 2N3LA 3FUYA 1G6BA 1JLQA 5CQGA 1NK8A 2RF2B 4Y0FA 1VI7A 2E7XA 2VDHA 2IJRA 1CULB 4FYDA 4I4BA 5KFBA 1Q4RA 3VALA 2HHWA 1T05A 5ETLA 1YWXA 3FEZA 3HVAA 4KT0C 3UCGA 2Y8YA 4XPCA 1REVB 1SJFA 1PC4A 3HSZA 4JI1F 1FT8A 3MR7A 5E3QA 4B3OB
chains in the Genus database with same CATH topology
3EJMA 3FCVA 3BBFA 3L7UA 1PKUA 1NUEA 3VGUA 3FKBA 1NHKL 4ANDA 1S59A 4ANEA 4HR2A 3BBCA 1HIYA 5CABA 3VVTA 4S0MA 1XIQA 1UCNA 4DUTA 1BUXA 3VGVA 3GP9A 3VGTA 1WKKA 2ZUAA 3B6BA 3BBBA 3Q89A 5C7PA 1F6TA 3DDIA 3Q8UA 3G2XA 4O0NA 4UOGA 1KDNA 1F3FA 3ZTSA 1NDCA 3PRVA 5IOLA 1NLKL 4KPCA 1VYAA 3WX8A 1U8WA 1BHNA 1W7WA 4FKYA 5BXIA 4FKXA 3EVMA 3NGTA 3EVWA 3R9LA 1BE4A 4CP5A 3Q8VA 3NGRA 2B8QA 3FBFA 3NGSA 3EMTA 2DXFA 3ZTQA 1HLWA 3FCWA 2HURA 1B4SA 3PJ9A 2DXEA 3ZTRA 3BH7B 4EK2A 3FC9A 3FBCA 4DI6A 1LWXA 2HVEA 2VU5A 2CWKA 4ANCA 3FBBA 2NCKL 3JS9A 3ETMA 4UOFA 1S5ZA 3EM1A 2BX6A 1NSPA 3DKDA 3BH6B 4F4AA 1NPKA 2HVDA 2DY9A 2BEFA 4DZ6A 1MN9A 2B8PA 4F36A 3EICA 1B99A 1NSKL 2DYAA 1NSQA 3GPAA 1PAEX 1JXVA 3MPDA 2DXDA 3ZTPA 1K44A 3VGSA 4ENOA 1LEOA 1MN7A 1WKLA 3EE3A 3ENAA 1S57A 4WBFA 1ZS6A 1NDLA 3Q8YA 1HHQA 1NDKA 3ZTOA 3ELHA 5CAAA 1NB2A 1EHWA 2AZ1A 3Q86A 1NCLA 1NDPA 2AZ3A 4UOHA 4C6AA 4W98A 3B54A 1XQIA 3NGUA 3FBEA 3Q83A 3EVOA 3VVUA 1WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJM A;  3FCV A;  3BBF A;  3L7U A;  1PKU A;  1NUE A;  3VGU A;  3FKB A;  1NHK L;  4AND A;  1S59 A;  4ANE A;  4HR2 A;  3BBC A;  1HIY A;  5CAB A;  3VVT A;  4S0M A;  1XIQ A;  1UCN A;  4DUT A;  1BUX A;  3VGV A;  3GP9 A;  3VGT A;  1WKK A;  2ZUA A;  3B6B A;  3BBB A;  3Q89 A;  5C7P A;  1F6T A;  3DDI A;  3Q8U A;  3G2X A;  4O0N A;  4UOG A;  1KDN A;  1F3F A;  3ZTS A;  1NDC A;  3PRV A;  5IOL A;  1NLK L;  4KPC A;  1VYA A;  3WX8 A;  1U8W A;  1BHN A;  1W7W A;  4FKY A;  5BXI A;  4FKX A;  3EVM A;  3NGT A;  3EVW A;  3R9L A;  1BE4 A;  4CP5 A;  3Q8V A;  3NGR A;  2B8Q A;  3FBF A;  3NGS A;  3EMT A;  2DXF A;  3ZTQ A;  1HLW A;  3FCW A;  2HUR A;  1B4S A;  3PJ9 A;  2DXE A;  3ZTR A;  3BH7 B;  4EK2 A;  3FC9 A;  3FBC A;  4DI6 A;  1LWX A;  2HVE A;  2VU5 A;  2CWK A;  4ANC A;  3FBB A;  2NCK L;  3JS9 A;  3ETM A;  4UOF A;  1S5Z A;  3EM1 A;  2BX6 A;  1NSP A;  3DKD A;  3BH6 B;  4F4A A;  1NPK A;  2HVD A;  2DY9 A;  2BEF A;  4DZ6 A;  1MN9 A;  2B8P A;  4F36 A;  3EIC A;  1B99 A;  1NSK L;  2DYA A;  1NSQ A;  3GPA A;  1PAE X;  1JXV A;  3MPD A;  2DXD A;  3ZTP A;  1K44 A;  3VGS A;  4ENO A;  1LEO A;  1MN7 A;  1WKL A;  3EE3 A;  3ENA A;  1S57 A;  4WBF A;  1ZS6 A;  1NDL A;  3Q8Y A;  1HHQ A;  1NDK A;  3ZTO A;  3ELH A;  5CAA A;  1NB2 A;  1EHW A;  2AZ1 A;  3Q86 A;  1NCL A;  1NDP A;  2AZ3 A;  4UOH A;  4C6A A;  4W98 A;  3B54 A;  1XQI A;  3NGU A;  3FBE A;  3Q83 A;  3EVO A;  3VVU A;  1WKJ A; 
#chains in the Genus database with same CATH topology
 4KGZ B;  4CLW A;  2EFP A;  1SV5 B;  2QLX A;  2VQF F;  1EAR A;  3W60 A;  5KG0 A;  3FEY B;  2N4C A;  4OYA A;  2YWF A;  4P7V A;  2HBY B;  1OIA A;  4P2F A;  2RJZ A;  3M30 A;  2ZJP Q;  4OYM A;  4KPC A;  4JV1 A;  1GXT A;  1HNI B;  4PUO A;  3FRZ A;  2YQ1 A;  2ZH7 A;  4IO1 A;  2MHE A;  4GO5 X;  3AD9 C;  4M95 A;  2DEJ A;  4HDH A;  2LA6 A;  2YKN B;  4IRC A;  5IM0 B;  2XM3 A;  1U0H B;  5DS7 A;  4EU0 A;  2GVD A;  1M1G A;  3PW0 A;  4HTJ A;  4ZCL A;  2RUS A;  2QLJ B;  3GV7 B;  1S6P B;  5F0U A;  4H4O A;  3W8P A;  1RT2 A;  5T7L A;  1EB0 A;  2GGP B;  2VOD A;  4LMZ A;  3LP2 A;  4C0B A;  1NSA A;  1AXQ A;  2P6T A;  3BGO P;  2B43 A;  4YHH J;  1HNZ F;  3E8O A;  4QYZ J;  2D3U A;  4AT1 B;  2G2Z A;  3UCZ P;  2J5A A;  2RVJ A;  4X62 J;  3IM8 A;  5KFC A;  9ATC B;  4WIQ A;  2M2B A;  1WC1 A;  4MTP A;  1HR0 J;  3IRW P;  4DUY J;  2D74 B;  2E5L J;  1IKX A;  2W9B B;  2K7J A;  2IRU A;  3CT9 A;  5AJ3 F;  2EKY A;  4ILM A;  4KY3 A;  5L46 A;  5HP1 B;  5FDL A;  3KDN A;  2BRK A;  3M2V A;  3TZW A;  2E5J A;  3OTO J;  4E8U A;  4WFX A;  4F4Y A;  3RRH A;  3PJX A;  2XYH B;  4QWD A;  1MLA A;  1KNZ A;  5F8N A;  3EWG A;  1WWH A;  4MH8 A;  4WFY A;  5KFZ A;  4DFK A;  4MYT A;  5BYR A;  2C28 A;  3PIO Q;  3DMJ B;  4A8S A;  4NLP A;  5GME A;  3PVX A;  2JHE A;  2IC3 B;  4URQ U;  3THV A;  1VRQ C;  3D6H B;  2UUW A;  2Y9H A;  4MK9 A;  1TL1 B;  2ASJ A;  3ILO A;  3DOL B;  3CMQ A;  4L72 B;  2HWH A;  3FQK A;  2YWG A;  1YKW A;  1WSR A;  2GO8 A;  1ARO P;  4RR5 A;  1KHW A;  3FKB A;  2E44 A;  2CJB A;  2BJ7 A;  1T95 A;  3VVT A;  3WQP A;  1FDA A;  3MM8 A;  4HHU A;  2HVI A;  4ED1 A;  8ATC B;  4DCP B;  1UPP A;  5EWG A;  4TLR A;  1SKU B;  1Y9O A;  3W2W A;  5FJ4 A;  4HT5 A;  3G6X A;  3M1V B;  3OXG A;  3BGF A;  2IM3 A;  3B4M A;  4DR6 F;  3M2U A;  5H1S V;  1X5O A;  2CFX A;  5D0R A;  1B4S A;  2HAF A;  3UO0 A;  2J6T A;  3JAM Y;  1I6J A;  3CJQ A;  1HWJ A;  3QIP B;  2XGQ A;  2QIF A;  2I6W A;  1QSL A;  4WPA A;  2MKC A;  1Z1Z A;  3G6E S;  4NLU A;  1YJ9 S;  5D4L A;  5KTQ A;  4C98 A;  4ID5 B;  2XY7 A;  1KLM B;  2ZZT A;  4NEY A;  4F0K A;  4ZJO A;  3DLE B;  4O0I A;  5C5J A;  2YWH A;  5M2P A;  2RML A;  1PAU B;  5I42 A;  1NUE A;  1RTJ B;  4FS2 A;  2VB6 A;  2NLW A;  3MM9 B;  3I0R B;  3E01 A;  4I6A A;  3TJ9 A;  2LEA A;  3AA9 A;  4G1Q B;  4QBU A;  2WAQ D;  1RWW B;  5DM7 Q;  4LF8 F;  3J81 U;  2HLU A;  3KHH A;  4N77 A;  2VON A;  3AOC A;  2HBZ B;  2OAU A;  1KR4 A;  4OJ1 A;  3TA0 A;  2PA3 A;  4ZK7 M;  3C19 A;  1F5A A;  2J9E A;  5BR8 F;  1IM6 A;  2ZOF A;  1JLB A;  3CD6 S;  3IM9 A;  3P96 A;  3VCD A;  3V6H A;  4MK7 A;  4JI8 J;  5CD4 H;  3EPI A;  2XZT B;  3HKZ D;  5G0R B;  3ILL A;  1NK7 A;  4NYP A;  4F26 A;  3S1T A;  2MZJ A;  3OTB A;  3PKM A;  2LVW A;  4NOH A;  3U1M A;  4K2X A;  3U02 A;  2QJ3 A;  5HAT A;  3RRG A;  5FLX U;  4ECR A;  3M8Y A;  2OEJ A;  1PJ5 A;  5E2Q A;  2NZC A;  3FEX B;  2XMK A;  1ITP A;  2EFO A;  4TYA A;  5J2M B;  4I2P B;  4DJB A;  5EWF A;  4O3N A;  1D9A A;  5F8J A;  3EZO A;  1M1H A;  2BOA A;  4LR8 A;  1YGY A;  3OVS A;  4ILR A;  1IBM F;  1VQM S;  2A18 A;  3NMR A;  5CHC B;  4X64 F;  1SC1 B;  3KLH B;  4F2R A;  2C2E A;  5FII A;  4OYP A;  4NCG A;  1DTQ B;  3BYP A;  3EDQ B;  3RZA A;  4WP3 A;  2W7O A;  3HVT A;  2Y0S D;  3NEK A;  3IMQ J;  2MKJ A;  3QBC A;  2NUU G;  5IC4 B;  4USJ C;  4WFN Q;  2YPZ A;  3M32 B;  1URR A;  2DNG A;  1F9E B;  1H74 A;  1RAO A;  1YBA A;  1B70 B;  2XGP A;  1JLE A;  4F36 A;  2KH9 A;  1K8A T;  3BSN A;  2YXL A;  4OX9 J;  2FD2 A;  3I82 A;  4LQ9 A;  1S6O A;  3TUZ C;  5IV4 A;  3NWG A;  2DIT A;  1NDL A;  3RBX A;  5HVH A;  4CYU A;  2BJ3 A;  1RAI B;  1MWZ A;  3SBM A;  2ALZ A;  2L9W A;  1S97 A;  2R7R A;  5JUM A;  3RAQ A;  3S6E A;  3MMC B;  2X1B A;  4XK8 C;  1C1B B;  3A8K A;  3MCN A;  2IY5 B;  1YRU A;  3UVJ A;  3MPY A;  4IG3 B;  3N4W A;  3T5J A;  1U8W A;  3VAJ A;  2NXN A;  4DV4 F;  2VG7 B;  1KEK A;  5ETS A;  1T7P A;  1L3S A;  2H5I B;  2U1A A;  3BDE A;  1UVM A;  3B8H A;  1S76 D;  4YDX A;  3SZ2 A;  4ANC A;  5HAO A;  1YJU A;  3HSJ A;  1SL1 A;  3GR0 A;  3LP0 B;  1QD1 A;  3A3N B;  3M2R A;  4J9O A;  1T94 A;  3DLG B;  3AQO A;  4TYB A;  3R5G A;  5DDP C;  3AQP A;  5CAA A;  3U7J A;  1RHJ B;  2RHS B;  2R2T A;  3M8P B;  1NU4 A;  1ZPV A;  4JI4 F;  4DUT A;  2ZUG A;  3CDE A;  4LF4 J;  3L9Z A;  3LWM A;  1UWB A;  4P2M A;  3VGU A;  1NHK L;  3C6T A;  4ZP7 A;  3MM7 B;  2AU0 A;  2XLK A;  2N7C A;  3OV7 A;  1RHR B;  8RUC A;  3MEE B;  2DJW A;  2WSC C;  1RYS A;  4ZLN A;  3MZI A;  1ZAW A;  3GQC A;  2QL9 B;  5A0Y A;  1I94 F;  1RIS A;  4OHY A;  2XI3 A;  2XHC A;  2VBW A;  3CMA S;  3HSD A;  3THP A;  2P9C A;  4XIU A;  4DX6 A;  2BW7 A;  3HK2 A;  4FZV A;  3R1L A;  4NA1 A;  1E6Y B;  2F9D A;  4YB7 A;  1NH7 A;  3W63 A;  3NGS A;  4Q45 A;  4WZM A;  1Q1K A;  4C8O A;  1X7V A;  2W7P A;  2IPO B;  4G65 A;  2C3O A;  2VF3 A;  3TWZ A;  2QV6 A;  3DHX A;  4NLT A;  4OJH A;  4OI6 A;  1H0H B;  1R43 A;  1I1G A;  2HHP A;  2FVC A;  4DR2 J;  2F4F A;  4DX5 A;  1MN7 A;  4A46 A;  2E66 A;  3R5A A;  1UAW A;  1GXL A;  2AP6 A;  5LJ5 Y;  1S1X B;  4W98 A;  3M9M B;  3FMB A;  3BV8 A;  1P1L A;  1V3S A;  4Q2M A;  5K8N A;  2CQH A;  4QYZ K;  4L76 A;  1HW9 A;  5DLF A;  3LGM A;  2GVZ B;  3CJ5 A;  3MUM P;  1LW0 A;  2LQJ A;  1IKY B;  1Y5L B;  4W90 B;  3HD1 A;  1E6V A;  1FJE B;  4X65 J;  3CXC R;  1BQN A;  4PEO A;  3VAI A;  3AHP A;  2K3K A;  2XBP A;  5IZH A;  4RNM A;  1NK5 A;  2R7T A;  3FBF A;  2HGL A;  4HH0 A;  4X62 F;  4UOF A;  2YNI B;  3N5F A;  2GHV C;  4NRU A;  4DUZ F;  1T3N A;  5KFU A;  3MM6 A;  4DZ6 A;  1L3K A;  2AX1 A;  2UXB J;  2C3Y A;  4FF3 A;  1UP1 A;  3W3S A;  2I5J A;  3MOZ A;  3R6G B;  2XZW A;  3KLG B;  1SQE A;  5F0W A;  3D6F B;  2IHR 1;  2WVD A;  4BS2 A;  4B3R J;  2F63 A;  2D41 A;  3ZZU A;  2B5J A;  3SQO P;  2AQ4 A;  2HWI A;  2XG8 A;  3D0I E;  3M9O B;  4PYA A;  4I7F A;  1DQA A;  4ZP8 A;  4OZ2 A;  5L38 A;  2ZUA A;  1L3T A;  4OYW A;  2OMO A;  2MXY A;  1RTH B;  1LWC B;  4CM0 A;  1FJG J;  4KO0 B;  4CM2 A;  1AUD A;  4DV5 J;  3MF5 A;  3EMT A;  3BGR B;  1CJU B;  4ZLL A;  4ERD A;  1YQH A;  1MRO A;  2WRM A;  4B9U A;  3CCM S;  4ELT A;  3W62 A;  2EFQ A;  1CJV A;  1PO6 A;  2RU3 A;  4KHP J;  1X60 A;  1N6Q B;  4P2S A;  4J9P A;  2RF2 A;  4ICL A;  1MN9 A;  4ZPC A;  2EBE A;  2LFV A;  1CUL A;  3PM9 A;  4PG4 A;  5EHH A;  3KJV B;  1HBO A;  1KOO A;  2KJV A;  5B08 A;  2AGO A;  2R8G A;  2CQP A;  1S0V A;  2EXU A;  2LEP A;  1I3O B;  2YKM B;  4M5L A;  3NGK A;  2O67 A;  2ALY B;  5I3U B;  5IWA J;  3PDN A;  4LSZ B;  1RT6 B;  4FVC A;  4RW4 A;  1EKR A;  4F3Q A;  1FVS A;  4CLK A;  1EAY C;  4B3O A;  4PZV A;  3LO3 A;  2KFZ A;  1TVR B;  2WON B;  2YNG A;  3R7N B;  5GAG U;  3KG0 A;  1P9Y A;  2DHX A;  3BR9 A;  1V5I B;  5MLC V;  2L41 A;  2HHH F;  1URN A;  4ZJL A;  1D9D A;  3OVB A;  4B3M J;  2G0J A;  3FBC A;  2HHT A;  1H2T Z;  1FF2 A;  3PYG A;  2DR9 A;  2ZBQ A;  2HIQ A;  1EIY B;  2YKN A;  1X5S A;  1D9F A;  4NLY A;  4GO7 X;  5IM0 A;  2BAN B;  1MSW D;  3RW6 A;  2Q6B A;  4E2F B;  2MKI A;  2LQ9 A;  2POK A;  1S9E B;  2Z4P A;  2CKW A;  1QAX A;  5CYJ A;  4FXV A;  1SL2 A;  1B0T A;  2GGP A;  4LBP A;  1S79 A;  2HFO A;  4YS2 A;  5CZX A;  2VPW B;  1LFW A;  1QTM A;  4MKA A;  1RUS A;  2ZDP A;  2WB1 D;  1QSS A;  3KK1 B;  4NXN J;  1KFS A;  4KHR A;  1DTT B;  2DIV A;  1U47 A;  1TKX B;  1AYE A;  2FC9 A;  1VQO S;  4F2S A;  2DHG A;  3OFF A;  4J9R A;  3OJS A;  5HP1 A;  2C3P A;  4FXD A;  1NZ8 A;  3GCX P;  3I6P A;  3CE8 A;  2FUG 9;  1PC5 A;  2RQ4 A;  3GCW P;  3L95 X;  2DNL A;  2HK3 A;  3QT5 A;  2Y8W A;  2LQ8 A;  1UEU A;  3DMJ A;  4M5G A;  2RKI B;  4P71 A;  3E2E A;  4KV8 A;  5KFS A;  4CLT A;  1H7X A;  1Y00 A;  4DEZ A;  3UR0 A;  1RKI A;  4WTO B;  2IAJ B;  1LNQ A;  2YWW A;  5KFQ A;  2I38 A;  4C8Y A;  1UVL A;  4Z2X A;  1D0E A;  2ZC4 A;  1FA0 A;  1FWP A;  3ZZ0 A;  2FY8 A;  1HIY A;  2B4P A;  4DSJ A;  3WX4 A;  3R5B A;  2FZC B;  4X4N A;  1TP7 A;  2R8I A;  3DLK B;  1NK6 A;  4ZMM A;  4N56 A;  3LW5 C;  4B9T A;  3KK2 B;  4EFA C;  2KJW A;  2GV1 A;  3EPG A;  4CLU A;  4EO6 A;  4I69 A;  2VC0 A;  3VF0 B;  3M1V A;  2JWN A;  4YN3 B;  4RBV A;  3P3D A;  3R3T A;  1S7H A;  3HI9 A;  3QAT A;  4JI2 J;  3MTK A;  5B0A A;  4NXM F;  3EIC A;  4LFA F;  1VQN S;  3GJS B;  5KFN A;  3KG1 A;  2VFV A;  4N76 A;  2LYV A;  2FJA B;  3QIP A;  2LQ5 A;  3OQ2 A;  4DDF A;  4NLV A;  3FQL A;  3LQV A;  4B9N A;  2BBE A;  1W26 A;  2RQC A;  2GJI A;  1FRI A;  1TV6 B;  3D7S B;  3TQ1 A;  1NM2 A;  4MAK A;  4C8M A;  1XMQ J;  4PPD A;  3BKT A;  3PNI A;  3QLH B;  3RB6 A;  3SMZ A;  4X4T A;  4ANE A;  1KLM A;  1VIS A;  2DRB A;  3DLE A;  1HBU B;  4FF4 A;  4WXO A;  5EDW A;  1LOU A;  3OHA A;  1KHV A;  1F3F A;  2HBQ B;  1RTJ A;  2RDD A;  3LGH A;  4NCB A;  4NEZ A;  3I0R A;  4P9S A;  1XWL A;  1AT1 B;  4NA3 A;  4QPT A;  2FYX A;  1IN0 A;  1X4C A;  2DGS A;  3F73 A;  1MU2 B;  1UJ4 A;  3TP2 A;  3B4D A;  2V4Q A;  2XO7 A;  1VK3 A;  2RRB A;  4OYB A;  2E1C A;  2E5G A;  3MUT P;  3O44 A;  1HA1 A;  5KFJ A;  2HVE A;  3MR2 A;  3J7Z 5;  4JP8 A;  3DRS A;  4C8N A;  4CH1 A;  4DFJ A;  3HHK A;  1FK9 A;  2VKZ G;  3GII A;  2F3J A;  4DWI A;  2DHH A;  2QA4 G;  2OEM A;  2OEL A;  2MLX A;  1S7I A;  1EHW A;  2R7W A;  2IVY A;  3RBE A;  1WJ9 A;  2PMH A;  4RW9 B;  4EEY A;  3AXK A;  4CLF A;  3KLI A;  5KT5 A;  1UL3 A;  5DO2 A;  1PKU A;  2G1H A;  3I9V 9;  3H25 A;  1FRM A;  1RT5 A;  4ECZ A;  4ZJQ A;  4RNH A;  3HVW A;  2VFS A;  4HEA 9;  4FF1 A;  4FYW B;  5J2M A;  2RHQ B;  4WKY A;  1N56 A;  1IR0 A;  1FEH A;  4MFB B;  4JI3 F;  1RAA B;  2XNR A;  2XI2 A;  3LWL A;  1R8H A;  4O4G B;  1MG7 A;  5ETQ A;  2HMI B;  3GSI A;  5HMZ A;  1WAC A;  2CDQ A;  4KAI A;  5CH7 B;  2YWE A;  4YR0 A;  5A8W A;  2RIL A;  1T3O A;  3ZTR A;  3IAM 9;  3FNN A;  2RT3 A;  1GX6 A;  3ISN D;  3D4J A;  1DTQ A;  2F4V J;  3PEH A;  1LWE B;  3DXS X;  4JI0 F;  2ZJQ Q;  5HN0 A;  3CDA A;  2QZ8 A;  4G1I A;  3P4U B;  1IKV A;  4X65 F;  1GT8 A;  2HRU A;  3JQM A;  3LTO A;  4ZLP A;  5DG9 A;  3M8R A;  3Q2T C;  4K4X A;  2RIJ A;  5HSP A;  2Z2M A;  3RTV A;  2XSJ B;  2O01 C;  1S1W B;  2AZ1 A;  4UOH A;  4RX6 A;  1FNX H;  3N01 A;  1TL3 A;  5AXM A;  1NJY A;  4QPX A;  3V81 B;  4X4O A;  4CCH A;  5F8I A;  2RUG A;  5E3A A;  2V67 A;  4M5K A;  3DRP A;  4DR3 F;  3AOB A;  3GFY A;  2MHN A;  2GAH C;  2KI2 A;  1QE1 A;  3MEC B;  3C15 B;  3QGP A;  2A2D A;  3OVA A;  5M2U A;  1HNW J;  2V2Z A;  2C2K B;  5LT5 A;  1XNQ F;  3MMC A;  4UT4 A;  2AHO B;  3HP6 A;  3RR7 A;  3R2D J;  2BXJ A;  3T1H J;  2JFD A;  4JV2 A;  2MLZ A;  2BMB A;  1HQE B;  2CWK A;  2ZBI A;  2XZD B;  3MED B;  1O51 A;  2C2D A;  4QIF A;  2UUB J;  1F5C A;  1NJI T;  4LF7 J;  4CLP A;  1K0V A;  5C42 B;  3POT A;  3OSP A;  1X8D A;  4IG0 B;  2HAI A;  2DH9 A;  4Y2M A;  3CO0 P;  3D28 A;  4ZVR B;  3RUB L;  4DV5 F;  2E9Z A;  4WZQ A;  3PKY A;  4I67 A;  4LVN P;  3VAM A;  3MTJ A;  1GEH A;  3US5 A;  3DLG A;  1R0A B;  2L3M A;  3R2C J;  5LMN F;  4N41 A;  2ZWP A;  3AAW B;  1IBL J;  2PA8 D;  3G82 B;  2M8D B;  4PXB A;  5CAB A;  1UA1 A;  1VRT A;  1SC3 B;  3UE2 A;  2ZDO A;  4C3K A;  2V0N A;  4UOG A;  2AGP A;  3AOD A;  2C22 A;  4K4U A;  4G1P A;  1F9F A;  2QG9 B;  4IH5 A;  2AT1 B;  1LKZ A;  4ZP6 A;  5H9E J;  5HRO B;  4PWD B;  1RI7 A;  3MEE A;  4UUW A;  4LFB F;  4ZVE A;  4X66 J;  2W9A A;  1B64 A;  3T5L A;  1TL4 A;  2ZFH A;  1WC0 A;  4NLG A;  3NS7 B;  2JSX A;  4ZVO B;  1QAJ A;  3VR1 A;  4K4V A;  2ZOM A;  2HK2 A;  4YP3 A;  2DK2 A;  2KB2 A;  2OTL S;  1JXE A;  1VIX A;  1KQK A;  4PG7 A;  4EYI B;  1XMB A;  3IWX A;  3T3F A;  3CED A;  2MYF A;  3BGL A;  5GMK a;  1CLF A;  4LFC J;  6AT1 B;  4U95 A;  2H51 B;  3G86 A;  3B54 A;  4B3M F;  5E7O B;  1XMO F;  4IH7 A;  3PAC A;  2OHD A;  4W4M A;  1RB0 A;  2X1A A;  3I9Z A;  1RAB B;  1WHX A;  5L9N A;  1S1X A;  1FER A;  3QZ8 A;  4URG A;  2QC3 A;  3BYR A;  4DR5 J;  2OSQ A;  2B9Y A;  3MR5 A;  1Q16 B;  4ZPB A;  1HQU A;  1J2V A;  4K5R A;  3PXG a;  3CJS A;  1PJ6 A;  1YVF A;  2AEF A;  1VYA A;  2DGV A;  1F3V A;  2XS2 A;  2XTJ P;  2MDA A;  4NAS A;  2MZS A;  2KVQ E;  2K1R B;  2DH7 A;  5D4N A;  2RDI A;  1OJ4 A;  3GFX A;  2PFD A;  3ETM A;  1R6Y A;  1RAE B;  3WHI A;  3MUR P;  3UN5 A;  4LSN B;  1JJC B;  1IWG A;  2Y0B B;  2CQD A;  2YNI A;  1IQZ A;  4B3S J;  4ENO A;  2AGQ A;  2ACY A;  3OLB A;  5F3T A;  3EE3 A;  4G3I A;  5K14 A;  3UW1 A;  5EN1 A;  2ZZM A;  4A8K A;  1JJH A;  1N33 J;  4O23 A;  1ZM4 A;  4P7T A;  2OD6 A;  4DR4 J;  3J80 U;  1HFE L;  2L9N A;  3EX7 B;  4UZB A;  2R7V A;  1JLQ B;  2XY6 A;  2JZ5 A;  4X4U A;  4USK A;  3RRK A;  4OHX A;  2HWT A;  3IWL A;  3MWB A;  4A8Q A;  4B3T F;  3BSO A;  4B9S A;  1T05 B;  2JL9 A;  3CJT A;  2YNH B;  3WIU A;  3KJN B;  3ZO7 A;  1O6X A;  2WSF C;  1RWM B;  5D78 A;  2NYH A;  1WI6 A;  1UVJ A;  5KFD A;  1P8G A;  1RTH A;  1LWC A;  4EWT A;  2HHU A;  4P52 A;  4DHV A;  1LWF B;  5K8M A;  3JS9 A;  5HAN A;  2J6U A;  4ZS6 A;  2NSB A;  3BGR A;  3J7A N;  1U48 A;  4ZPV R;  3SYZ A;  1UJ6 A;  5U47 A;  2HPU A;  1ZBT A;  2YKP A;  1OSC A;  4PUO B;  5B0D A;  5GAH U;  2ZE2 A;  1KQF B;  5GAE U;  1YSJ A;  3KJV A;  4ZIT A;  1RAF B;  5HJX A;  3EXC X;  2AJ2 A;  3PY8 A;  2HZC A;  2ZZN A;  2YKM A;  3A12 A;  3MMA A;  2XMT A;  3GIJ A;  3G6V A;  5I3U A;  4DR1 F;  4WP8 A;  3HHL D;  4O3S A;  3CJK A;  4AQY F;  4V19 X;  1GTH A;  4IQM A;  1FRX A;  2VAS A;  3TEG A;  1RT2 B;  5J2Q B;  4TVA B;  4RO0 A;  3GG1 A;  3LP2 B;  3D54 A;  2G4B A;  1JQG A;  4YEA A;  1F0X A;  5CA5 A;  4ED8 A;  3UD5 A;  1ZTW A;  4O3P A;  1DHM A;  3KLE A;  1NSP A;  3HSG A;  1JKH B;  1S1V A;  4J37 A;  4QWE A;  1V3R A;  2R42 A;  2BKO A;  1NND A;  2AJ0 A;  3GIL A;  2CQC A;  1SB6 A;  4Y34 A;  1MMD A;  2W25 A;  3FJ2 A;  1U49 A;  3K5M A;  3OT9 A;  2CPZ A;  4Q8F A;  4WK1 A;  2C1E B;  3KUE A;  4C9D A;  2K7K A;  3NY0 A;  4ECU A;  3M2V B;  2MQ8 A;  1RYR A;  1VJW A;  4ZLJ A;  3BQ1 A;  1FX2 A;  3KK3 B;  1SI9 A;  1S9E A;  1WHV A;  2LXF A;  1KTQ A;  2UXD F;  1S1U B;  2BKP A;  2IA0 A;  1WKK A;  3VAK A;  3Q8R B;  1WEL A;  3U1N A;  1D8Z A;  3KFW X;  3THT A;  2WW8 A;  3T19 A;  1ZET A;  2C3M A;  3R27 A;  1RTD B;  3Q22 A;  2NPI A;  5KG6 A;  3SXL A;  3FSY A;  4OZ0 A;  2RDJ A;  1DTT A;  1V3Z A;  4XDC A;  3D5M A;  4F0H A;  1EQ0 A;  4KH1 B;  1OO0 B;  3EZU A;  1HYS A;  3MM8 B;  5G4D A;  2HQF A;  4MKB A;  2I8E A;  2ZBP A;  2FVP A;  4YB5 A;  1HW8 A;  1DLO A;  1Y3J A;  4ZPA A;  4EYH B;  5E0O A;  3IGN A;  3I32 A;  1HNX J;  3M2U B;  2PMZ D;  5E5N A;  2RKI A;  2ABY A;  3Q23 A;  5AT1 B;  4DPY A;  1GMU A;  9RUB A;  3RYL A;  1H2U X;  3GJT B;  3CC4 S;  1R89 A;  1YIJ S;  2WHO A;  3DDI A;  4FDF A;  2LP4 A;  2OGU A;  2GCF A;  2E9R X;  3GON A;  5ETK A;  2HSE B;  1X4A A;  2OKQ A;  1YRT A;  1NHU A;  3H5U A;  2VBY A;  4JI6 F;  3PHT A;  3DLK A;  2NCK L;  2OO4 A;  3TRG A;  1X4F A;  5I42 B;  1WI8 A;  2P9G A;  4LF5 F;  5LSL A;  3FGV A;  1Q7L B;  4NLS A;  2XCP A;  3E01 B;  5AE3 A;  2V68 A;  1IVZ A;  3SCI E;  1JLF A;  1HWI A;  5LM7 E;  3TR5 A;  3RB0 A;  3T1H F;  1IWA A;  1LXJ A;  1ZYQ A;  3QID A;  3PX0 A;  1FXL A;  4KR0 B;  4MJK A;  2I2Y A;  4RBU A;  1XN9 A;  4YB6 A;  1JLB B;  3GFZ A;  1TV6 A;  1VOM A;  1G3O A;  2HHX A;  1D3W A;  2GQC A;  1YBT A;  2EC2 A;  1FEE A;  3DGP A;  2CJQ A;  2XMV A;  3TUJ C;  4OHW A;  2GIR A;  4AL5 A;  2QL5 B;  3MOJ B;  4OHV A;  3LAK A;  2M70 A;  1BMQ B;  3G8Q A;  3GYX B;  4KRW A;  3AFG A;  4JYA J;  1WHW A;  1FXR A;  2V34 A;  3DOK B;  5KFP A;  1MU2 A;  2MQP A;  2AYE A;  2DNK A;  3RR8 A;  2B4V A;  5DZ7 A;  4MK8 A;  5D0G A;  4Y28 C;  4OI4 A;  1QY7 A;  2B8P A;  4TY8 B;  4DF4 A;  1HL6 A;  2E1M C;  4AE5 A;  2RS2 A;  4YB1 P;  1HPZ B;  3R5J B;  3NLC A;  5GAD U;  4I64 A;  2DR8 A;  4ZVP B;  1X9M A;  3JQK A;  2IDE A;  1XR6 A;  4CTA A;  2Q79 A;  1SH2 A;  4F0M A;  3GP9 A;  4DSI A;  1C0T B;  2D69 A;  4NYZ A;  3RG6 A;  4FNI A;  4DV0 F;  3DCA A;  4F4X A;  4CLL A;  2Z2L A;  2KDO A;  2BQU A;  1J5E J;  5BXI A;  3J7Y I;  3TVK A;  1K73 T;  2ZD1 A;  1A9N B;  2ZWO A;  3JXO A;  2C42 A;  4MFB A;  2NXJ A;  1S99 A;  3D67 A;  4X4Q A;  4IR9 A;  2H54 B;  4CYU B;  1JLC A;  5I3P A;  4DL5 A;  2JOQ A;  2ZH3 A;  4KB7 A;  4TXS A;  2X51 A;  1IBK J;  5IT9 U;  4B9M A;  2CJX B;  1QUV A;  4RKU C;  3CGI A;  3S01 A;  1PAE X;  5KT7 A;  1S12 A;  2JH3 A;  1LWE A;  2CPJ A;  2VOO A;  2AKW B;  5B0B A;  5KFX A;  3M6X A;  4USH A;  4CT9 A;  4BC7 A;  2MLY A;  4B02 A;  1VBZ A;  4JI7 J;  3ENW A;  4FYV B;  3CCQ S;  4CLS A;  4JUZ A;  1HWK A;  4DV1 J;  3CSK A;  4PRF A;  1U1M A;  2CPE A;  3BRE A;  4QWB A;  3HDS A;  3TZX A;  4NCA A;  1QAI A;  1QAY A;  2RS8 A;  2G1D A;  2HS4 A;  3W64 A;  1N34 F;  3V81 A;  3DRR A;  4B3S F;  1YRX A;  5DDR C;  1CJT A;  3M2R B;  4F7V A;  3OFG A;  3PRD A;  2XC9 A;  1VDH A;  4ATN A;  3QPI A;  3NGT A;  3E51 A;  7AT1 B;  5E3P A;  2K3I A;  2UP1 A;  1DJ0 A;  3BKF A;  2CQ2 A;  4ZN3 A;  2UVR A;  4RNN A;  2E1R A;  2F8M A;  1UWB B;  3HHE A;  1M5S A;  4A8W A;  3C6T B;  4ZVG A;  2FGC A;  3KNA A;  2KG1 A;  1GMV A;  4C11 B;  1UFW A;  3SFU A;  1HQE A;  3RAX A;  3D66 A;  1B0V A;  3MED A;  4HTI A;  1F5B A;  1MNE A;  4Q0B B;  2EG2 A;  5A0Y B;  5KG5 A;  1SBR A;  3CD0 A;  4MMO A;  5C42 A;  1RKJ A;  2BQR A;  1RDR A;  4IKA A;  4IG0 A;  3FBE A;  3WDO A;  3H4D A;  3DRY A;  4HDG A;  2GQQ A;  1I5O B;  3R6L B;  1TKD A;  3NCQ A;  2RQK A;  2GML A;  1IKW B;  2GNK A;  2J8S A;  3UQS A;  5F8L A;  3DLB A;  3RJM B;  3FDS A;  3IP0 A;  1Q82 T;  4M63 A;  5KFG A;  2UXC F;  1U1N A;  1TQL A;  3P5T L;  3ONQ A;  4K8R A;  3DKD A;  3V6J A;  3BQ2 A;  2DR6 A;  1EQM A;  1FXD A;  3W61 A;  4X4S A;  4ZIW A;  1KQS R;  4GVL A;  1KN6 A;  4I68 A;  3ISN C;  1R8B A;  2ZIT A;  1BQN B;  3N9U C;  3W2V A;  3HPO A;  2FPH X;  2KT5 A;  1LQ9 A;  5CXT A;  4UST A;  5KOW A;  1RGV A;  3PV8 A;  3QAU A;  3FCV A;  1MWQ A;  3L7U A;  4KBI A;  1DFD A;  1YJR A;  1VQ9 S;  4MKV A;  2PII A;  2VQE J;  4ECT A;  1LK7 A;  2WBM A;  2ROE A;  3MM6 B;  2QA1 A;  2YPY A;  4TY9 A;  2MQM A;  1RHK B;  2I5J B;  2V69 A;  1NKE A;  2GHP A;  2YNF B;  3TZY A;  3PYE A;  2V8H A;  1X9S A;  1RJJ A;  1H3D A;  2Y1L B;  2Q43 A;  3DC2 A;  3MMJ A;  4TN2 A;  4ECW A;  1L5U A;  5KOX A;  5KG3 A;  4DI6 A;  2V2Q A;  3CJ8 A;  3SCL E;  3JSR A;  2B5J B;  2W2M P;  3CD5 A;  2K1R A;  1HKA A;  2LMI A;  4I7F B;  2ZH4 A;  1K47 A;  1Q53 A;  2QN6 B;  2ZM6 J;  3ZTP A;  4LIW A;  2B9W A;  1GH8 A;  5H9F K;  3QSI A;  5ADZ A;  2HRT A;  4FP9 A;  4PXD A;  4DCO B;  1WC5 A;  1H38 A;  4OI0 A;  4LT6 A;  5HVF A;  2ZBC A;  1M5O C;  3KNG A;  1TL5 A;  2V2V A;  3LP1 B;  3K57 A;  2GZO A;  1RT1 B;  3UI3 A;  3RW7 A;  3L09 A;  4NZ7 A;  5HL7 Q;  2OH2 A;  4Y65 A;  4LRB A;  1NK0 A;  4HHH A;  4DG1 B;  1MRO B;  1UA0 A;  4OJG A;  2N82 B;  4I1T A;  2I1R A;  2DCL A;  4IDK A;  1WHY A;  3OTD A;  1XIQ A;  1CJV B;  2WZ1 A;  1FWK A;  1TK8 A;  2CG4 A;  3G2X A;  3VQT A;  4ICL B;  5IQQ A;  1XR7 A;  1RA7 A;  3MAA A;  1HAR A;  1LW2 A;  1M5V C;  4K0K J;  4L3K A;  1FRL A;  2YKO A;  3CCT A;  5DQG A;  3OHB A;  1SIW B;  2UUA F;  1HBO B;  3CCZ A;  4QIW D;  4RL1 A;  1SH3 A;  3FCW A;  1IQT A;  2YNH A;  4JV5 J;  3MGJ A;  1W2B R;  2EKN A;  3H2U B;  1OSD A;  3P5B P;  2HZV A;  2C3U A;  4NL5 A;  3H5S A;  4ZP9 A;  4KHM A;  2B9E A;  1FWL A;  2HNY B;  5AE1 A;  2P8I A;  4RW4 B;  3H0P A;  1EZZ B;  2W4D A;  4K5S A;  1LWF A;  2OPP A;  3GIR A;  3IXQ A;  6FD1 A;  2EFV A;  1K44 A;  2AV5 A;  4FVM A;  2YNG B;  4BDP A;  3WC0 A;  1VBY A;  4J9Q A;  3T41 A;  3QJP A;  1WSV A;  1WOO A;  1UPM B;  4OYX A;  1N5S A;  2FVQ A;  2CZV C;  5KFF A;  3TX8 A;  3IO1 A;  1IR2 A;  4ZCK A;  2K06 A;  2HQG A;  4GMK A;  1WC4 A;  2D9O A;  2W4C A;  4FNH A;  4XDD A;  4O0N A;  3QO9 B;  3D6M B;  2XEX A;  1CSJ A;  5B7W A;  2YQ3 A;  5LJ3 Y;  2OEK A;  2MZR A;  4WU2 A;  1GMW D;  3B78 A;  4LF9 J;  4AL7 A;  2JLF A;  1PG5 B;  5HK4 A;  2UU9 J;  5J2Q A;  2WVC A;  3CC2 S;  2DHS A;  1HI8 A;  3C66 A;  1ACM B;  3V4I B;  3N0V A;  2BR0 A;  2CQ0 A;  2DNM A;  1VHI A;  3LOU A;  2VA2 A;  1JKH A;  2ZH9 A;  1RT7 A;  2HIY A;  2OD4 A;  3MFI A;  3LH2 S;  2DGW A;  5KFR A;  5CD4 A;  1SJ1 A;  3M05 A;  2W2Q P;  1RHQ B;  4UZC A;  2QE5 A;  2DPJ A;  2GS8 A;  1Y0H A;  1NK4 A;  2BJ1 A;  2XWY A;  3K59 A;  3BKU A;  2JEI A;  2AYB A;  2M52 A;  3AJ1 A;  4DX7 A;  3QYY A;  2R8H A;  3C14 A;  2X3G A;  1OS5 A;  3EGV A;  3P49 B;  4L75 A;  3IRX A;  1HWL A;  3W5Z A;  3KK3 A;  4U7U D;  1IUJ A;  2CPI A;  3HHL B;  1LXN A;  3S7R A;  5T41 A;  4DV7 F;  2OSR A;  4DL7 A;  3ZZP A;  1KSP A;  1S1U A;  3CD7 A;  1K0T A;  2G2O A;  2QSW A;  4FYY B;  2KKH A;  5KFA A;  2NSC A;  4KV8 B;  3C16 B;  3VHQ A;  2MZQ A;  4OJ3 A;  2Z57 B;  5A2Q Y;  2J7U A;  3NNC A;  4NPO A;  2V8D A;  1FFW B;  3DOM A;  3MFH A;  1RTD A;  2BA9 A;  4PCQ A;  2DO4 A;  2HHS A;  4JB8 B;  2ZH6 A;  4P74 A;  1N36 J;  1HD1 A;  3GIM A;  3V4M A;  2ZH8 A;  2CJ9 A;  2FGO A;  3BN7 A;  3ZC4 A;  1RCX B;  3G8S A;  4IOA Q;  3DI6 B;  2J0Q D;  4HKQ A;  2O66 A;  1ZZF A;  3GJR B;  5KFK A;  3I5A A;  3I0S A;  3AD8 C;  1TR0 A;  5FD1 A;  3KMQ A;  1BGX T;  1S4E A;  1WKJ A;  2CPD A;  3L3C A;  1VC0 A;  3PG9 A;  1Q8L A;  4H4M B;  1U1R A;  5KT2 A;  1BXN A;  2PI5 A;  3H2V E;  5M2R A;  3OUY A;  1F6T A;  3KHG A;  1TL7 A;  1VQP S;  1ZAV A;  2FHK A;  2R7U A;  1VK8 A;  3KXD A;  5AE2 A;  1G1X A;  1Q78 A;  5JXS A;  3AB2 B;  4A8M P;  4U96 A;  3A4T A;  1AFI A;  2IMO A;  4ES1 A;  4QR0 A;  4DR7 F;  3LAN A;  2HNZ A;  3TO8 A;  3TOQ A;  4CP5 A;  1FNM A;  5DDQ C;  3HHL C;  3ZTQ A;  4DV1 F;  2YX7 A;  5HBM A;  2HS0 A;  1VQ4 S;  1S77 D;  1U6Z A;  3F0N A;  3TA1 A;  3IC1 A;  4LRF A;  1G4C A;  1KP6 A;  3AD7 C;  2V4J B;  4DZD A;  1N48 A;  2FHM A;  4Z37 A;  5LSO A;  1RTZ A;  1RT4 A;  5J1E A;  1CS4 A;  4A47 A;  4U8Y A;  1HI0 P;  5KT4 A;  2IVM A;  1VLO A;  3WZ0 A;  4OLP A;  1WF2 A;  4U67 Q;  3T6J A;  4ZVQ B;  3PYD A;  5KFL A;  1VBX A;  5J2N A;  4QJV A;  1Z2L A;  2ROG A;  4IUF A;  4FPR A;  3ENV A;  4WII A;  4M5N A;  5I3Q A;  1CG2 A;  3L4B C;  4XTT A;  2YWK A;  3DRS B;  2RSQ A;  1ZM2 A;  5ETT A;  4CO5 A;  3PRB A;  4Q5V A;  3OR2 A;  3W7B A;  3TI0 A;  5C25 A;  1FK9 B;  1VLY A;  2QSF A;  1U8S A;  1NK9 A;  2HS3 A;  1P9Q C;  1BE4 A;  1RLC L;  4UY8 5;  2GO9 A;  4OZJ A;  5C2G A;  4HL9 A;  1GTE A;  3KLI B;  1CVJ A;  2RQM A;  2XMA A;  1KVK A;  5E3R A;  2U2F A;  4DOZ A;  4HI1 A;  5DZ6 A;  4HHJ A;  1RT5 B;  3DOK A;  4Q2L A;  1U4B A;  4USV A;  1U26 A;  2AIR B;  2Z56 B;  3PZP A;  1FE0 A;  2V50 A;  4JI1 J;  4DV3 F;  5KAK A;  5EGY A;  3KUH A;  2QTW A;  4RW6 A;  1C0U B;  4TY8 A;  5DRK A;  2VQF J;  4CH7 A;  1R27 B;  2KFY A;  1APS A;  2F65 A;  3PFO A;  5A8W B;  3NOG A;  3W9J A;  2L48 A;  3S8S A;  2GIQ A;  4HVZ A;  3IR5 B;  1HPZ A;  2BRL A;  2D3O R;  4NX9 A;  2X3D A;  1U09 A;  1WD6 A;  3B6B A;  3BN4 A;  4QW9 A;  4DXL A;  2ZVI A;  1XER A;  1IKV B;  4NA2 A;  4QW8 A;  3UPF A;  1DY3 A;  3BZQ A;  5EUH A;  4CLY A;  1ELO A;  1WTB A;  1RXO B;  2KO1 A;  1C0T A;  3CJ3 A;  1VBK A;  3BSA A;  2WK4 A;  2IYG A;  2DB1 A;  3Q8P B;  3IFE A;  1IJE B;  1F1B B;  1RT3 A;  2W2O P;  2AJ1 A;  1H73 A;  3DLH A;  2A3J A;  1TL3 B;  5F3Z A;  1LK5 A;  3K17 A;  3DRP B;  1PJ7 A;  4ZN1 A;  3MCS A;  4Y6I A;  1KRP A;  1VQ5 S;  5EX3 A;  1QE1 B;  2DYA A;  5LOQ A;  1K9M T;  4RW8 B;  4P75 A;  5A6W A;  3K2Y A;  2MQL A;  1HNZ J;  4KGX B;  1N0U A;  5C24 B;  3DFE A;  1SQG A;  4Y2I A;  1L3U A;  1A6L A;  2OI2 A;  1OQ6 A;  4PAA A;  2V5H G;  1ZA1 B;  2IDL A;  2IIH A;  4LSL A;  4UTG A;  4USU A;  1HNV A;  1U1O A;  2ZOG A;  3N6N A;  1REG X;  2H65 B;  1V5V A;  1A7G E;  4K4W A;  4HR2 A;  4RJV A;  5AJ3 J;  5THW A;  1S10 A;  1YI2 S;  3AY0 A;  2A1B A;  1OYE A;  4NZ0 A;  1FDB A;  3GU0 A;  3UFC X;  4ZPW R;  2UZA A;  3PO4 A;  3POT B;  1HMV A;  2P9E A;  4A8X A;  4F04 B;  2MQN A;  5L1I A;  3KOA A;  1LFP A;  1TMM A;  1AZS A;  3D2W A;  3OFE A;  2VOP A;  2QGF B;  5D4P A;  2OUG A;  2I9S A;  3CCV S;  3IN5 A;  5ETV A;  2DGT A;  1PBU A;  3T1Y F;  2MZ1 A;  4GKJ J;  4GVB B;  1JJ4 A;  1RWK B;  2FLL A;  4LR9 A;  2D3O 1;  3FMW A;  1SKR A;  2BQ3 A;  3MXH P;  1S48 A;  4F67 A;  1VRT B;  2IRY A;  4DX8 H;  2B9X A;  4R5P B;  2XLI A;  3LA0 A;  1PGZ A;  3GV5 B;  1GAO A;  2GHW A;  3QWP A;  5AXL A;  5E41 A;  4CO1 A;  2N3O A;  5IS2 A;  4Y00 A;  3G96 A;  1PYO B;  3MCO A;  2MJN A;  2YY3 A;  4C11 A;  4NMX A;  4A8Y A;  4TU8 A;  2XNQ A;  4JV5 F;  5T14 A;  4Q0B A;  1SUQ A;  2X7I A;  2OPR A;  3ILI A;  3O1L A;  1FNO A;  3D3B J;  5F8G A;  2LXU A;  4P6Q A;  1OY9 A;  4E0D A;  1Y7P A;  1Q86 T;  4C3L A;  3VGT A;  2NYI A;  1R0C B;  2CZ4 A;  4F02 A;  3J81 Y;  4DR6 J;  2QA4 S;  1M0S A;  1VR6 A;  4RUB A;  1F2G A;  3R97 A;  4IFY A;  1SPB P;  4OV6 A;  3O8W A;  3HF5 A;  3HX9 A;  1IKW A;  2XMM A;  4OLO A;  5D8H B;  5CYQ A;  3W66 A;  1DZ5 A;  4GC7 A;  7FD1 A;  1U2R A;  4ZHR A;  2CQG A;  3UN3 A;  1SJQ A;  2BJD A;  4I6W A;  3SCK E;  1RU2 A;  3NOC A;  1FKP B;  3ET6 B;  1JLA A;  2J9C A;  2DY9 A;  2Q66 A;  4AXI A;  5HQM A;  1HQU B;  3G9C A;  2VG6 B;  1S0O A;  5FLX Y;  3TJA A;  2QFJ A;  1C4A A;  4DL3 A;  2YH0 A;  1ZS6 A;  1V6H A;  4U7U K;  1XC9 A;  3BGU A;  5A8K A;  4CZC A;  2KTQ A;  4LF9 F;  1VC6 A;  2CNN B;  4DFM A;  1MWY A;  3BEG B;  1JK9 B;  1BD6 A;  3UD4 P;  4I56 A;  4AND A;  3AXM A;  3BBC A;  4E98 A;  2DT9 A;  3NWR A;  3A8E A;  1UCN A;  4YHH F;  2RD5 C;  3Q8U A;  1U45 A;  1RBO B;  5BR8 J;  3AOA A;  2BE9 B;  4MIW A;  2ZH2 A;  2MST A;  3MCM A;  4KFB A;  1HR0 F;  5K14 B;  3OL7 A;  4DUY F;  2E5L F;  2LQB A;  2GMJ A;  2V94 A;  3Q0A A;  4HYK A;  4N8O A;  2YNF A;  1IR1 A;  4N47 A;  3ENQ A;  1PBA A;  2DKO B;  4I2Q A;  2V63 A;  1N52 B;  2LA4 A;  1RE1 B;  3N6M A;  5DLG A;  2HHV A;  3ZXW A;  3OTO F;  2G0I A;  3HZE A;  2ADB A;  1B99 A;  1NSK L;  3GMG A;  4L73 A;  2JDJ A;  3D1O A;  1P6T A;  2CNO B;  1NKB A;  1XR5 A;  1VC5 A;  4C7Q A;  3HUL A;  3MAQ A;  4G6V B;  3EJM A;  4WFA Q;  4H4K A;  4DPX A;  2F40 A;  1BQM A;  3G4S S;  1Q7Y T;  4X64 J;  3LP1 A;  1RT1 A;  2DIS A;  3KDO A;  4UY8 T;  2J76 E;  1X4D A;  4DG1 A;  3SV3 A;  5IOL A;  2DGO A;  1Y5I B;  2OFG X;  1V9O A;  1U1Q A;  3QGH A;  3MPU B;  4BWM A;  2FC8 A;  2SXL A;  2GAG C;  3QRQ A;  5HQL A;  1RWU A;  2CPX A;  2ZE2 B;  2PN6 A;  3OLA A;  2MKS A;  1U25 A;  2W4P A;  1YK9 A;  1VS3 A;  1WDT A;  1K1S A;  1X9W A;  2W8K A;  1QTN B;  1B0P A;  3M8Q A;  4QR1 A;  2ZHO A;  4ED2 A;  3MMA B;  5D3G A;  1CJK A;  5IT4 A;  1N4L A;  2DNZ A;  3CJK B;  1LEO A;  2HNY A;  5ETR A;  1XBW A;  3LF0 A;  1NB2 A;  3QNW B;  3PIP Q;  2PI4 A;  3UWT A;  2MGZ A;  2DGX A;  1S49 A;  3H7H B;  1R0B G;  1S1T B;  3IBF B;  3W9H A;  5KG4 A;  4DQI A;  5DGA A;  1RU1 A;  3KLE B;  4DV4 J;  1JMT A;  1S1V B;  4BCA A;  2MJU A;  3MR6 A;  3MEG A;  1Q0N A;  3ISZ A;  2P5V A;  2PFF B;  3L7P A;  3QGG A;  3SSQ A;  4ILL A;  4OX7 A;  1WC3 A;  1BWE A;  3QO9 A;  3MD1 A;  3IGV A;  5HJY A;  2M7S A;  1R8P A;  2M5Y A;  1C1C B;  3HT3 A;  2F8E X;  5KFT A;  2FLN A;  2B3T B;  2R2U A;  4IOC Q;  1WF0 A;  3H59 A;  3JAM U;  1Y11 A;  3NS5 A;  3JSM B;  2KXH A;  3BR8 A;  2HVD A;  4KE5 A;  1XTZ A;  2AX0 A;  2JEJ A;  3HKW A;  1YZ6 A;  4MYU A;  3W8G A;  3PHE A;  1NSQ A;  3ETO A;  4LUB A;  4JI8 F;  4PKD B;  2CQI A;  3NAH A;  3PX6 A;  3V4I A;  1UKU A;  4JI4 J;  2OPS B;  2XWX A;  3IAS 9;  3OL9 A;  1M1K T;  4DBQ A;  5KFO A;  1CBK A;  3O5T B;  3VVU A;  3NGD A;  1N32 J;  1SH0 A;  3D68 A;  4YR3 A;  1I94 J;  5F41 A;  4NYO A;  3A13 A;  1FJC A;  1HBN A;  3ZZO A;  3Q89 A;  4A48 A;  3MPV A;  4J9S A;  3AJD A;  2VPY B;  1KTV A;  2CQ3 A;  1HYS B;  2LDY A;  4NZ6 A;  1PSD A;  3EGN A;  1W7W A;  3C6U A;  1PIL A;  4CQ1 A;  2XCA A;  1UET A;  1NME B;  1DLO B;  2ZH1 A;  4NLR A;  3JSY A;  3CDU A;  4FBT A;  3CVK A;  3SDE B;  2FLO A;  3HHL A;  3TAM A;  2F9J A;  4EBE A;  3GR1 A;  2K2P A;  4I0W A;  3AT1 B;  2DEI A;  3NCR A;  3GYN A;  4DV2 J;  2IM1 A;  4NI2 B;  2IFX A;  4GKK J;  1RP5 A;  2DNR A;  3C16 A;  1TKZ B;  3H5X A;  2IVF B;  2QYG A;  2LXI A;  2W2N P;  3M6V A;  5A6P A;  1T9U A;  3Q8Y A;  5SUH A;  1IBC B;  3QJL A;  2UUT A;  2HQ3 A;  4OX9 F;  4WKR A;  1VCT A;  2NR0 A;  1VQS A;  3Q2S C;  2OTJ S;  3DI6 A;  1YHQ S;  2R2S A;  1YJV A;  3GTY X;  3OD2 A;  1N8R T;  3UNG C;  2WSE C;  1WEZ A;  5D4O A;  1ZM3 A;  4PYD A;  1HD0 A;  4M5I A;  4B9V A;  4H4M A;  2R9L A;  2Q1L A;  3JTN A;  1S9G A;  2A6O A;  4EGL A;  1JLF B;  3MPW A;  2YVS A;  1OYD A;  2W24 A;  2IM0 A;  2EW9 A;  4DUZ J;  4RNF A;  3PJ9 A;  4DSE A;  3SIP B;  2PC6 A;  4HI2 A;  3LUY A;  2VHG A;  2QRR A;  2QT7 A;  4QWC A;  1N0V C;  3TAR A;  2DR7 A;  4HAC B;  4WTY A;  4OHZ A;  1U1K A;  4EMD A;  3VWS A;  3DGP B;  1RLD A;  4EUV A;  3MMB A;  5DJB A;  2V4J A;  3FRY A;  3I5C A;  2AZ3 A;  1FES A;  3NBP B;  2W1B A;  5D15 A;  2BE2 A;  1CC7 A;  4GKJ F;  3IG1 B;  2VPX B;  3OR1 A;  1R6V A;  3MD3 A;  3H42 A;  2ZBR A;  4OI1 A;  2FTR A;  3QT8 A;  4QZV B;  4LF4 F;  3KYL A;  1PCA A;  3DHW C;  4C4W A;  2V8V A;  1S0M A;  4DS4 A;  2B6A A;  1ULR A;  2GW8 A;  3UDE A;  4YUD A;  2R2R A;  2R7Q A;  1G7C B;  4DMZ A;  2DIU A;  5GVQ A;  4V1A k;  2QX0 A;  3Q8Q B;  2G0C A;  3RB3 A;  2JJ4 D;  1OMS A;  4M8L A;  5D77 A;  1UEV A;  3EM1 A;  1S6U A;  3PFE A;  3BM7 A;  3QAE A;  1KQG B;  4CTA B;  1QDU B;  4QOT A;  4CT8 A;  1Q81 T;  2H48 B;  3H4B A;  5LSR A;  2J9D A;  1RHU B;  3H90 A;  5D6G A;  4OZ3 A;  5AXK A;  1JXV A;  2NXE A;  2DXD A;  4ES3 A;  2CUY A;  1VFJ A;  1NH8 A;  1UFK A;  1N5Y A;  7FDR A;  1TK5 A;  2QEX S;  1TAQ A;  3GB0 A;  1NCL A;  2V8P A;  3ITH B;  3JYT B;  2ZD1 B;  3C3L A;  4DR2 F;  2J7W A;  1WC6 A;  1JLC B;  4CO4 A;  1S59 A;  1C0U A;  4XAK A;  4WXW A;  2VG5 A;  2M8H A;  3MDF A;  3TX0 A;  2FIU A;  2VUG A;  3NCP A;  1WG5 A;  1T03 A;  4NWB A;  1SJ4 P;  4QWA A;  1FRJ A;  2HHH J;  4Q8E A;  2BE7 D;  3KKF A;  2WBR A;  1U6F A;  2J0X A;  3NNH A;  1TKT B;  3R7B B;  4RZR A;  4W92 B;  2MTL A;  1HLW A;  1UW9 A;  3CW2 C;  4YR2 A;  1TFY A;  3FSX A;  2RRN A;  4RWW A;  1VQK S;  1YIT S;  1VQ8 S;  1RBL A;  2C2O B;  3CC7 S;  2VJU A;  2B7C B;  4I6Y A;  3V6K A;  4PR6 A;  1YZ7 A;  3GIK A;  3DRR B;  5K8P A;  1CJT B;  4K4Z A;  1U2C A;  1CEZ A;  1WKL A;  4J7C A;  5HLF A;  5BYQ A;  2DGU A;  3BSC A;  1UW4 A;  5CZV A;  2BM0 A;  3ELH A;  1JWW A;  3HT0 A;  2UXB F;  4HT7 A;  3MI7 X;  1ZAX A;  2CAJ A;  1DAX A;  1FTR A;  4RW8 A;  1T9V A;  1M90 T;  3OW2 R;  1X0F A;  3QRR A;  2HEK A;  3PW4 A;  4CRJ A;  3K5N A;  3ZZT A;  4IRD A;  1U24 A;  5C24 A;  3SEO A;  3PCO B;  1SC6 A;  4B3R F;  3QRP A;  1UZH A;  4OZ5 A;  4J9U E;  4PG8 A;  4ZA1 A;  3G6Y A;  3CIZ A;  4LRD A;  3HO1 A;  1FFG B;  4C48 A;  4PG5 A;  2WVF A;  1U6B A;  4WWS A;  1FI4 A;  4FKX A;  4QCL A;  2DH8 A;  3HFV A;  2EK1 A;  3AA8 A;  2O5D A;  3TAQ A;  2DXF A;  1WEX A;  2UUC J;  3OJU A;  3DU6 A;  4M5D B;  1NJX A;  1FJG F;  3V5R A;  2IJN A;  4DPT A;  4IFV B;  2FB0 A;  1VHF A;  2CG8 A;  2XB2 D;  1RAG B;  3LPE A;  4OI3 A;  3BO2 A;  2FVS A;  4GVB A;  3CCW A;  3IS9 B;  5K20 B;  4KHP F;  2CPH A;  4UW2 A;  1JB0 C;  1WNE A;  4V19 J;  2ROP A;  1SKS A;  2G2Y A;  4IO9 Q;  1NDK A;  4R5P A;  2OIH A;  1U0S A;  3IR6 B;  2YKQ A;  5L9X A;  2RU9 A;  1X4G A;  4KKO A;  2M9K A;  2LU1 A;  5JVG Q;  4PXC A;  2HFU A;  4O4R A;  4DSF A;  3OL8 A;  2F5G A;  2IMW P;  2DNH A;  2PO4 A;  2E1P A;  3CIM A;  5K5M A;  1EP4 A;  5IWA F;  2IJF A;  2KZZ A;  4KYZ A;  2YTC A;  4J9M A;  1DQ8 A;  2E7V A;  1FE4 A;  4U8V A;  4ECQ A;  3DLL Q;  2XYP B;  3DM2 B;  2V6A A;  2KG0 A;  3EVM A;  3G71 S;  3X3U A;  5CCM A;  2D7S A;  3W2V B;  4KIA A;  2MQO A;  4XPE A;  4F3M A;  4NXM J;  3ZNU A;  4LFA J;  2IM2 A;  2PMW A;  1WG1 A;  3I4P A;  2J0W A;  2EK6 A;  4R0J A;  2ZEJ A;  2H5E A;  3N28 A;  1WOR A;  2R8K A;  1EX8 A;  1W25 A;  2NXU A;  2F7V A;  4KH0 B;  2AEM A;  1FKP A;  3HFZ B;  3B82 A;  4F50 A;  3EGW B;  3ET6 A;  1UFL A;  2VZ9 A;  3OSN A;  4C0O C;  2VG6 A;  3V2U C;  4DPO A;  2D3Z A;  2ZKU A;  4M1K A;  3UN2 A;  3T6B A;  2ACM A;  2DCU B;  2PDA A;  3W65 A;  2FJW A;  1Q79 A;  2JEF A;  4O44 A;  2CQ4 A;  5J2P A;  2APO A;  5KT6 A;  2EEY A;  4L6V 3;  1T8E A;  3P8B B;  3K89 A;  5J1P A;  3NL0 A;  1QVF R;  3I56 S;  4C8Z A;  1SKW A;  1IM4 A;  2ZKT A;  4KJI A;  4PWU A;  3T9N A;  3Q8S B;  5E3C A;  4DU8 A;  3D6T B;  3O2I A;  4NXN F;  1N32 F;  4QYR A;  1ZZN A;  1LWX A;  5DET A;  4Y2C A;  2VPZ B;  2AW0 A;  3UDC A;  1NB7 A;  1IXK A;  2MKH A;  2XMU A;  1TUW A;  4IDK B;  2IBK A;  3IBW A;  3C46 A;  2JRS A;  2Z0G A;  2CNK B;  4NRT A;  4B9L A;  2QLF B;  3MAA B;  3OL6 A;  1LW2 B;  3V6D A;  3DDN A;  1KC8 T;  1EET B;  2XSF A;  1XEZ A;  4LBH A;  5CYM A;  3HJF A;  4TQR A;  1S9F A;  4C6A A;  2MEW A;  2COL A;  1AUS L;  1SJ3 P;  5IV3 A;  2E29 A;  4DV2 F;  1QLN A;  4DQS A;  5L1L A;  2PE8 A;  1OPI A;  1VRU A;  4JI3 J;  3EUN A;  4KGV B;  4GKK F;  3OTC A;  3WBZ A;  4X4R A;  1RHM B;  3RBD A;  4TLQ A;  3VV2 B;  5C7P A;  1MMN A;  3GJQ B;  2BKN A;  4DL2 A;  3OTE A;  1J27 A;  1R8A A;  2KT2 A;  2OPP B;  3WX8 A;  4B17 A;  1Z2Z A;  2FJV A;  4OIX A;  1NO8 A;  1TZ0 A;  4DPU A;  2XS7 A;  2DGQ A;  3DRX A;  3ULH A;  4R8U B;  4JI0 J;  5RUB A;  1HHT P;  2DXE A;  2EVZ A;  3FC9 A;  2KT3 A;  5JMN A;  1RTI B;  2DNP A;  2XMJ A;  4ID8 A;  2JLG A;  1F2H A;  4DQP A;  2XY5 A;  1Y5N B;  1OY8 A;  1L3V A;  4EO8 A;  2VIC A;  1JJ2 R;  3JTP A;  2HND A;  3D1Q A;  4JI2 F;  3SI8 A;  3M8W A;  1XK8 A;  2HZA A;  1HHQ A;  2MKK A;  4DR3 J;  4WFB Q;  2RB7 A;  2GIF A;  3SQG B;  3PW7 A;  1SXL A;  2GMH A;  3OXL A;  5HI7 A;  2AMC B;  2PEH A;  3C2P A;  1JLG A;  4FPI A;  4A8F A;  3FK4 A;  2H1Y A;  1DUR A;  1BUX A;  3PW5 A;  1XMQ F;  1XNQ J;  1FX4 A;  4OL8 A;  1T0T V;  5IC6 B;  1JXL A;  3PR4 A;  3PRV A;  1S1T A;  3BDP A;  4ZOS A;  3FZB A;  4YY3 J;  1VQY A;  1P27 B;  2DR5 A;  3O6Q A;  1RT7 B;  3N5B A;  2BJ8 A;  2Y1I A;  4IQX A;  4DF8 A;  5CCL A;  1T9X A;  3HMJ G;  2XUL A;  3FBB A;  3CCE S;  1C1C A;  4RBT A;  1N5T A;  3FFI A;  2L9D A;  3GZ7 A;  2AYG A;  1U1L A;  3C14 B;  2VA3 A;  1S6Q B;  3RAM A;  1O8B A;  5K9F A;  4DU7 A;  1M5K C;  3JSM A;  3BO3 A;  3IRX B;  2HW3 A;  1U02 A;  2EFN A;  2Z58 B;  5LMN J;  5HMX A;  3RBZ A;  2ZC3 A;  4RWX A;  4RNO A;  2FVR A;  1RWN B;  4WU3 A;  4CNZ A;  1PIE A;  4TU9 A;  3LAL A;  2H3E B;  2ILZ A;  1Y3K A;  4FN5 A;  1KOH A;  4ZCM A;  2OPS A;  4DFP A;  5A8R B;  3SSR A;  3QQC D;  5J1N A;  3MEK A;  3DOM B;  2RRA A;  3BBB A;  1WG4 A;  2V9W A;  4ETX A;  3J7Y U;  4LFB J;  4LF6 J;  2VFU A;  2MPU A;  2VIH A;  2PT0 A;  2VFR A;  1VJQ A;  2QL7 B;  3QSY B;  1REV A;  4TNO A;  2KYZ A;  2XMW A;  1OPZ A;  2V2K A;  2E1A A;  4ES2 A;  2R7S A;  4QIE A;  4K4T A;  2JEG A;  1SV5 A;  3I0S B;  1B7F A;  3JQJ A;  4X4P A;  3HVR A;  4EI2 A;  1NRK A;  1QM9 A;  3F56 A;  3SDE A;  4F4A A;  4P10 A;  1GMW A;  2AYM A;  3QT7 A;  1OQ3 A;  3OUY B;  4F4Z A;  3HCX A;  2NUH A;  4J5O A;  1TL7 B;  2F4V F;  5B0E A;  1XMO J;  1HNI A;  4NI2 A;  3DYA B;  1FKO B;  3BF4 A;  2F8H A;  2OML A;  4PQU B;  1TKZ A;  4LQ3 A;  4HLB A;  1X4B A;  2HNZ B;  5KFW A;  4NE9 C;  3J80 Y;  2MY7 A;  3QWU A;  4QIG A;  2VH7 A;  2Y1J A;  3D0G E;  2X1F A;  3GSD A;  2O3D A;  3BQ0 A;  3D9B A;  5HBM B;  3M6U A;  1JNR B;  1ZH5 A;  1U0H A;  3DDK A;  1T02 A;  1TFW A;  1S6P A;  3UDV A;  3OFH A;  4QR2 A;  1RT4 B;  5J1E B;  1HQ2 A;  1CS4 B;  2NPF A;  2FJE B;  3A3P B;  1UVK A;  2D9P A;  2VL1 A;  2NXC A;  1N54 B;  3OPK A;  5ETP A;  3NP5 A;  1HNW F;  4OYO A;  2WB4 A;  1VQL S;  3IR7 B;  5J2N B;  3I4H X;  3HD2 A;  4ECY A;  5F9N A;  1UZD A;  3SSS A;  5KT3 A;  3HM9 A;  1D8Y A;  2LEB A;  2QMW A;  2DNY A;  2W9B A;  5GMD A;  1SIZ A;  1Q95 G;  1MW7 A;  3ZZR A;  1C4C A;  2BYC A;  4EBC A;  2UUB F;  3OR2 B;  3I31 A;  3G87 A;  4HAC A;  4YDD B;  5C25 B;  4LF7 F;  2R8J A;  3ZTO A;  1Y10 A;  3Q86 A;  3QFW A;  2UUC F;  3TUP A;  2YQ0 A;  1GK8 A;  3EVO A;  1F9H A;  2E7W A;  1KVI A;  2DRD A;  3KJF B;  4B3T J;  1NXI A;  2B4U A;  3UDL A;  2ASL A;  5H9E K;  3CCS S;  3NBP A;  3SFG A;  3NS6 A;  3K0J A;  3IG1 A;  1VIO A;  2IC3 A;  3AJ2 A;  4BLG A;  2G9O A;  2CRL A;  1RWO B;  1IBL F;  2B51 A;  4GRS A;  1TL1 A;  3D1H A;  2IBO A;  1FD8 A;  2CPF A;  3DOL A;  3R1H A;  3KLF B;  3CDW A;  4LF1 A;  4CIO A;  3EDR B;  1UVN A;  4RW6 B;  4ZPD A;  5A76 A;  3WIV A;  4K4Y A;  4MIA A;  1DRZ A;  2VD3 A;  2MY8 A;  4X66 F;  4OYZ A;  3KG4 A;  4K2J A;  2BX6 A;  3QGI A;  2CXE A;  2JC0 A;  5BYS A;  1YJN S;  1FRK A;  1HHS A;  4DN9 A;  2GFF A;  3KUG A;  1SJR A;  1SCJ B;  4U6P A;  2VKR A;  5L8R C;  2KN4 A;  4QQB A;  2OJ3 A;  3TAN A;  2FJB B;  2Q6C A;  3DU5 A;  3I5B A;  1ROF A;  2LU2 A;  4EBD A;  3JB9 k;  4DR1 J;  2OLW A;  4LRA A;  4LFC F;  3LAM A;  1RT3 B;  4AQY J;  3ITH A;  3JYT A;  3ADA C;  2BW2 A;  3JSB A;  1SQF A;  3IWN C;  3M8S A;  1BWV A;  4C3M A;  2EI5 A;  2W2P P;  3CDB A;  1Q5V A;  2HRY A;  1KDN A;  2AF6 A;  4WYW A;  1H6K X;  2MZT A;  1Q8I A;  4DR5 F;  4ID5 A;  1KBR A;  3VAF A;  4HH1 A;  2CJA A;  4O3O A;  4FKY A;  3FCH A;  4CI0 B;  4TQS A;  3EVW A;  4OQJ A;  3QZ7 A;  2CQ1 A;  5GAG I;  4EK2 A;  3CWJ A;  4WE1 B;  4KQZ A;  2VU5 A;  3MM9 A;  4LSL B;  2CAD A;  1HNV B;  1CQM A;  2GC8 A;  2FZG B;  3JTO A;  1TKT A;  3ICL A;  4N7T A;  4G1Q A;  1EKS A;  1FDN A;  4LRE A;  2HVH A;  3DNC A;  4NLO A;  3G8T A;  2IA6 A;  1FRH A;  4J90 A;  2C2M B;  2JC1 A;  5KFH A;  4D3G A;  3HFK A;  1HMV B;  1HI1 A;  4DSL A;  1A0O B;  4ECX A;  1AZS B;  1TUG B;  2UV8 A;  2UXD J;  2R4F A;  3TW0 A;  4BBY A;  3IA0 A;  3M6W A;  1J5O B;  1RZM A;  1N33 F;  5G0R A;  2QA2 A;  1TAU A;  2FZK B;  4DR4 F;  4LJM A;  3NG8 A;  5JJB A;  1WOP A;  3MM5 B;  5F9L A;  2E5H A;  2ZNZ A;  5F8M A;  1RAJ A;  1Y4Z B;  1FCA A;  3R5C A;  2VBZ A;  1NPP A;  3O3L A;  1RBA A;  4LF2 A;  1XJW B;  4I2P A;  2R7X A;  4Y3C A;  4L3N A;  2DVI A;  3BH7 B;  1SUQ B;  2FQQ B;  2OPR B;  5BJR A;  3H20 A;  4NLX A;  5K8O A;  2LKZ A;  5B09 A;  4A8O A;  2AEJ A;  4F4W A;  2MQQ A;  3K5P A;  4M5D A;  3M9N B;  4ZIV A;  3GYG A;  6FDR A;  3KLH A;  2ADC A;  4IFV A;  1S4F A;  1ZPW X;  2XQC A;  4ZPT R;  2ZVS A;  2DO0 A;  1X31 C;  4IFY B;  1PYT A;  1AA1 B;  4DV6 J;  4X2B A;  3IS9 A;  3LGN A;  1P1T A;  1BC6 A;  2Z2Z A;  5MAO A;  5CYQ B;  4NLW A;  4ZVS B;  4LVO P;  1NHV A;  4ZHR B;  3M32 A;  1U2F A;  2WOM B;  4Q44 A;  4AXJ A;  3QFH A;  2FJD B;  4MIB A;  2GQ2 A;  4O3Q A;  3FVY A;  4URS A;  1JLA B;  4K4S A;  1RA6 A;  3A8J A;  4JOU A;  3W5X A;  3ILJ A;  2W8L A;  2OPQ B;  4JI6 J;  1GX5 A;  3EXY A;  2ATC B;  1C2P A;  1WOS A;  4XO0 A;  2MB0 B;  1RAH B;  4NLD A;  1WUU A;  2DNO A;  4LF5 J;  5A8K B;  1KLN A;  4WP9 A;  4DLG A;  4DS5 A;  3DM2 A;  1TUV A;  4YFU A;  4M5H A;  1C1B A;  4WCE Q;  4NLQ A;  3K58 A;  5I4M A;  4YY3 F;  4IG3 A;  3VGS A;  2MMY A;  4K59 A;  2VG7 A;  3RU0 A;  1NPR A;  4ED3 A;  5B0G A;  1TTH B;  4KFB B;  4OZL A;  2A2C A;  2HQI A;  1H72 C;  3AH6 A;  2V4R A;  4DL0 C;  3TUI C;  2AD9 A;  3R8Y A;  3H5Y A;  3LP0 A;  3TNV A;  3NKY A;  3N6L A;  5IXU A;  4I2Q B;  2IRX A;  4LBI A;  3U1L A;  4ETZ A;  1YG0 A;  4PQA A;  5DGB A;  1YJT A;  3H8Y A;  4Q7A A;  4X84 A;  4PAB A;  2ZHB A;  2C2Z B;  3K8W A;  3GG0 A;  2BV3 A;  3IBC B;  3P6Y C;  1T9T A;  2CJK A;  4BWJ A;  1YBU A;  4WFZ A;  5KFM A;  3CCU S;  3QJJ A;  4ELU A;  3M8P A;  1NZA A;  2R7O A;  3MM7 A;  2XO6 A;  4CDI A;  2J7K A;  2WVE A;  3TAP A;  1BQM B;  1GFW B;  4ECS A;  5IT9 Y;  4LF6 F;  1KVJ A;  3MUV P;  4PXE A;  1UVI A;  4ZKA A;  3VTI A;  1D09 B;  4KC5 A;  1UMJ A;  2YX4 A;  1Q8B A;  5KFV A;  1S57 A;  1E6Y A;  2BDP A;  1I51 B;  3BO4 A;  4IR1 A;  4RW7 B;  2PD1 A;  1UWA A;  5E33 A;  3CJ4 A;  3CJ2 A;  2W7A A;  1X0P A;  2CIM A;  2EG1 A;  2QLW A;  4DQQ A;  1EET A;  3T5K A;  3C8Y A;  2CNL B;  4DV0 J;  5JVH Q;  3ZZY A;  5EX0 A;  1HBM B;  2EWH A;  2N7Y A;  3VGV A;  1FHT A;  1HNX F;  1YJ7 A;  1ZM9 A;  2VDI A;  3M8Z A;  4AUK A;  3BPD A;  3M8Q B;  5D3G B;  1CJK B;  1NLK L;  4M5M A;  1S72 S;  1KS2 A;  3CB4 A;  1N5Q A;  5LMU J;  3ZZZ A;  2MGZ B;  4DCJ B;  1KD1 T;  4ELV A;  4R8U A;  1X4E A;  2GVZ A;  5HMW A;  3D3C J;  1KFD A;  3BB5 A;  1IKY A;  5B0C A;  3A3O B;  4DLE A;  1RTI A;  4H4K C;  5KFE A;  3MEG B;  2FHJ A;  4Q43 A;  2W9C B;  3PJW A;  1SC4 B;  2M0G B;  2BVZ A;  2EC0 A;  3GE9 A;  1DBD A;  4EZ6 A;  2HHQ A;  4UOC A;  2H4W B;  3PW2 A;  4CO2 A;  2BM1 A;  3F44 A;  4WYL A;  3PTW A;  1N34 J;  3HHD A;  3RB4 A;  5D0H A;  1ICE B;  1WTF A;  4GC6 A;  4LR7 A;  3SQG A;  1R3N A;  2G13 A;  4CO0 A;  2HFN A;  1M5P C;  3KLG A;  3T1A A;  3P45 B;  4F8R A;  1CPZ A;  1QVG R;  1XNR J;  4FYX B;  2D1C A;  4M5J A;  2E5I A;  5IQ6 A;  3R9L A;  2DBB A;  4JI5 J;  3CF5 Q;  3NGR A;  5F8H A;  3DGV A;  4CO3 A;  4PG6 A;  2DPI A;  3W1Y C;  3PEJ A;  3J7Z T;  4JYA F;  2HFZ A;  4OZN A;  4PPZ A;  1R31 A;  2MKY A;  4IH6 A;  2KXN B;  1HBN B;  1KKH A;  3TEH B;  2H5J B;  2PGC A;  2YX1 A;  4KO0 A;  1H7W A;  4JV0 A;  4Y2K A;  2HG4 A;  4RUA A;  1CJU A;  1S6Q A;  2V9K A;  3C6U B;  2KFN A;  3GLJ A;  1IJF B;  2DHA A;  3K8V A;  2KYX A;  3BBF A;  3TAM B;  5C2C A;  4JBC A;  1N6Q A;  3M30 B;  2BAC A;  4KPY A;  2ILY A;  1FO1 A;  2B7B B;  3N79 A;  5A8R A;  3M7V A;  2KRB A;  1CQN A;  5AXN A;  2CYY A;  4ED7 A;  2WVB A;  2ZNY A;  2CA9 A;  1CC8 A;  3I96 A;  4RPF A;  3ZFV A;  2UXC J;  1BY9 A;  4PWW A;  2W01 A;  3TVZ A;  1RWV B;  2DNN A;  3VQS A;  2GVD B;  2H4Y B;  1RT6 A;  2WCX A;  2CZ9 A;  1J5E F;  1GXU A;  2JVO A;  4R0E A;  4H4O B;  1NKC A;  1FVQ A;  5T7L B;  4TKT A;  2KZM A;  3CTR A;  4TU7 A;  1TVR A;  2WON A;  4K7Q A;  1FJ7 A;  2P2C B;  2RH3 A;  4YOE A;  4EZ9 A;  1IBK F;  5LXR A;  1NEE A;  1S9G B;  1YX2 A;  1RWP B;  4ED0 A;  4RLE A;  4UQT A;  3QT6 A;  5KG7 A;  2FJX A;  3DYA A;  1VMB A;  1FKO A;  1JNZ B;  3H2L A;  5EWE A;  3BPS P;  4PQU A;  2AJQ A;  1X5P A;  2LLZ A;  5D0E A;  1UEK A;  1T11 A;  4D3H A;  1IKX B;  4JI7 F;  2MSS A;  2NS1 B;  2UVV A;  4FBU A;  1OWX A;  3CUN A;  4OV1 A;  5FDL B;  2RE1 A;  4ZCI A;  2BAN A;  3I55 S;  1NDC A;  1WEY A;  1TU0 B;  3HLU A;  3MMB B;  5LL6 d;  2M88 A;  2AWZ A;  3PO5 A;  3EGZ A;  2CVE A;  3NNA A;  1VGY A;  3TZZ A;  2HUR A;  5DG7 A;  5L1J A;  4DQR A;  5DQH A;  2BE2 B;  4CWB A;  2PEB A;  1S5Z A;  4ECV A;  3OR1 B;  2ZHA A;  3TVY A;  1WDD A;  5HQ8 A;  3H40 A;  2LCW A;  4BHQ A;  4AD6 A;  2BEF A;  5ETM A;  3Q24 A;  2VBX A;  1JX4 A;  1YLX A;  3KK1 A;  2R3V A;  3HHN B;  5ETN A;  3J81 j;  1RAD B;  4MT1 A;  4CLZ A;  4KGK A;  2AJ4 A;  4ZVF A;  1TKX A;  4F3O A;  2B6A B;  5DG8 A;  1NDP A;  4AYB D;  3NGU A;  1UJ5 A;  3A8I A;  5H9F J;  2CWX A;  2J6S A;  1T9W A;  3CUL A;  2OFH X;  3MHY A;  3VAG A;  2DRA A;  3GV8 B;  3W2W B;  1FD2 A;  3DXB A;  2UUA J;  1SVD A;  3CCR S;  2QFI A;  4UUX A;  1TK0 A;  2B56 A;  1W2I A;  1QJH A;  2LDI A;  2YBV A;  4DL6 A;  2YH1 A;  2NQP A;  2YKA A;  4C8L A;  5HMY A;  4DV6 F;  1X5T A;  1BQX A;  4Y2A A;  3CPW R;  1N5Y B;  2IAJ A;  2BAB A;  3NRB A;  4ER8 A;  3UNY A;  3FSI A;  5DDO C;  2KRR A;  5IFM A;  3KLF A;  2ASY A;  4LIR A;  4ZVH A;  2VG5 B;  2Y3Y A;  2KVI A;  4ALZ A;  2ERR A;  2QYC A;  1T03 B;  4CNY A;  1NAQ A;  2Z2Y B;  3ENA A;  3KK2 A;  2GJF A;  3D0H E;  4ZDN A;  5B0F A;  2A10 A;  3OXF A;  2JFK A;  3E3X A;  5GAH I;  3HZG A;  3RGI A;  5GAE I;  4YME A;  4X4V A;  3BJY A;  5SZT A;  1AFJ A;  3KWM A;  3NXZ A;  1F60 B;  1YDL A;  3TJ8 A;  1B3T A;  5DQI A;  2LEC A;  1BLU A;  2VQE F;  2JVR A;  3EYZ A;  4AL6 A;  2GJ2 A;  4FF2 A;  5HLF B;  2HLT A;  3UD3 P;  3CJ0 A;  2J0S D;  2WW4 A;  4J91 A;  2KU7 A;  2QO3 A;  4KGM A;  3GWC A;  3QLH A;  4QU6 A;  1T9Y A;  3NMA A;  3L7O A;  3TQE A;  1NBE B;  1HBU A;  1RK8 A;  4Z7Y A;  3CCL S;  3KHR A;  2HVZ A;  2CPY A;  2WTF A;  3K5O A;  2HGM A;  1FTC A;  2RAQ A;  4WE1 A;  4NML A;  1KWM A;  3GPA A;  3DLJ A;  2ZH5 A;  2KHC A;  1H2V Z;  3GFH A;  5HVG A;  2HGN A;  1M5H A;  4IOB A;  1YJW S;  3R5D A;  2I0X A;  1WF1 A;  3KMS A;  2ZM6 F;  2JX2 A;  4RUH A;  2FY1 A;  3X1L B;  4DPW A;  3Q83 A;  1Q5Y A;  3EZ5 A;  2H9Z A;  1DAR A;  3PX4 A;  2UVU A;  1OY6 A;  4U9R A;  4KTQ A;  4ED5 A;  1AB8 A;  4DV7 J;  5LXY A;  4CH0 S;  2A0F B;  4MKY A;  2KM8 B;  4NCG B;  3CME S;  1J5O A;  3MR3 A;  1R8C A;  1FDD A;  4OI2 A;  3HVT B;  2N4D A;  3KJQ B;  3W5Y A;  3U27 A;  2HQC A;  2QMX A;  2VV5 A;  1X4H A;  4LRC A;  1BHN A;  3MM5 A;  2VFT A;  4OFZ A;  2C2N A;  2GX8 A;  4RW9 A;  1AW0 A;  2HFV A;  2HQD A;  2B8Q A;  4ED6 A;  4H54 A;  4K0K F;  3WC2 A;  1VQ6 S;  4USW A;  4ZVU B;  3HJV A;  1SL0 A;  1JLE B;  4KKO B;  1NJW A;  1QUP A;  3CCJ S;  2V8G A;  1Q8K A;  3BH6 B;  2FDN A;  4A4J A;  3T9Z A;  2KHD A;  3BS9 A;  1ZOT A;  2HBR B;  2XS5 A;  2BJE A;  3W9I A;  4RUC A;  3MPD A;  1EP4 B;  4O4G A;  4F4K A;  2B0G A;  4Z7C A;  4WJB A;  3VZI A;  5DM6 Q;  2HMI A;  1O5J A;  5KG2 A;  1RAC B;  5LMU F;  3PR5 B;  2JNJ A;  2Z8Q A;  4IRK A;  3QMQ A;  4FXW A;  4QU7 A;  4N5S A;  2Y1R I;  3UVJ B;  4K50 A;  2EBG A;  4OMF G;  1VQ7 S;  4DR7 J;  2M4M A;  1H98 A;  2WOM A;  2XHW A;  2XSJ A;  1FKA F;  1B7Y B;  3AB4 B;  1S1W A;  4USM A;  4KSE B;  2KM8 C;  2JLE A;  1Z4U A;  1RCO B;  4USI A;  3Q8V A;  3MAH A;  1ZTT A;  3TYT A;  3R7S B;  2OPQ A;  1MML A;  4U7C A;  4J9N A;  3HXM A;  4B08 A;  2QLB B;  4OYI A;  3MEC A;  1D1U A;  3C15 A;  1O0P A;  2UV8 G;  4R25 A;  4L74 A;  2UU9 F;  2QMU B;  1KON A;  1XNR F;  1PYS B;  1HWU A;  4O44 B;  1RWX B;  2EPI A;  2RNE A;  5J2P B;  4UF4 A;  4LF8 J;  2ASD A;  2VC1 A;  2X1G A;  4JI5 F;  2F1F A;  4RU9 A;  4RU2 A;  3TA2 A;  1G2E A;  3DN9 A;  3K5L A;  1EJ7 L;  2M3D A;  2BOP A;  1DQ9 A;  2CQB A;  4QIV A;  1K1Q A;  4ED4 A;  4BC9 A;  2ZJR Q;  3I87 A;  2FHJ D;  2XLJ A;  4C0H A;  2HYI B;  3NAI A;  5HO4 A;  3V6D B;  1U1P A;  2J8A A;  1TMJ A;  5CYM B;  1R0A A;  2NZ4 A;  8AT1 B;  2K8G A;  2A6M A;  2B4O A;  2Z30 B;  3G82 A;  2P6S A;  5KFY A;  4WF9 Q;  4C2M A;  3T5H A;  4DV3 J;  5ETO A;  4DSK A;  1VRU B;  4N8N A;  4C97 A;  3ZNJ 1;  2Q3P A;  2HKE A;  2NRE A;  4OZ1 A;  4ZVT B;  1LV5 A;  5HRO A;  4PWD A;  1IBM J;  1JIH A;  4FS1 A;  2OP5 A;  2FHO B;  4OX8 A;  4J9L A;  1N36 F;  3KTQ A;  1TEL A;  4P72 A;  3KLV A;  1GQE A;  2HFS A;  5L1K A;  1LW0 B;  3F41 A;  1RQ0 A;  1E6V B;  2AJF E;  4J9V A;  3SV4 A;  4RW7 A;  4DL4 A;  4DN0 A;  1GNK A;  4S0M A;  2DY1 A;  3A1Y G;  5GAD I;  2J9D E;  2C2R A;  2DD8 S;  3ZTS A;  2UVW A;  2EFG A;  3CO9 A;  2KL8 A;  3FZ2 A;  3VZH A;  4AFF A;  1QSY A;  1UTA A;  4WK3 A;  3J7A 1;  1HBM A;  5IT0 A;  2XYG B;  2HND B;  4M94 A;  2DNQ A;  3KHL A;  4ITS A;  2IYI A;  5A2Q U;  2L08 A;  3VAH A;  1NPK A;  2DTJ A;  1JLG B;  3OBI A;  4O3R A;  3UR3 C;  4IYQ A;  1R7I A;  3M4X A;  2CJY B;  3PYF A;  1N5V A;  2BUN A;  4P2X A;  4WBF A;  1ZA2 B;  4J9K A;  2KXF A;  2CDR B;  1S0N A;  1FFS B;  5KG1 A;  2ATL A;  1XQI A;  4P73 A;  5KFI A;  2W9C A;  1U7L A;  3H98 A;  3SCJ E;  3LPY A;  4C8K A;  2BJ9 A;  2PSZ A;  4UQG A;  3K7R A;  4YQW A;  5L39 A;  2O1P A;  1NJZ A;  4LSN A;  1RSC A;  3FFI B;  3UCU P;  2VJV A;  3CJR A;  2CVI A;  5ITH A;  2FLP A;  1N88 A;  3CNQ P;  4F25 A;  1YTY A;  2BZ2 A;  4OX6 A;  2E9T A;  2GA7 A;  3T1Y J;  2N3L A;  3FUY A;  1G6B A;  1JLQ A;  5CQG A;  1NK8 A;  2RF2 B;  4Y0F A;  1VI7 A;  2E7X A;  2VDH A;  2IJR A;  1CUL B;  4FYD A;  4I4B A;  5KFB A;  1Q4R A;  3VAL A;  2HHW A;  1T05 A;  5ETL A;  1YWX A;  3FEZ A;  3HVA A;  4KT0 C;  3UCG A;  2Y8Y A;  4XPC A;  1REV B;  1SJF A;  1PC4 A;  3HSZ A;  4JI1 F;  1FT8 A;  3MR7 A;  5E3Q A;  4B3O B; 
#chains in the Genus database with same CATH homology
 3EJM A;  3FCV A;  3BBF A;  3L7U A;  1PKU A;  1NUE A;  3VGU A;  3FKB A;  1NHK L;  4AND A;  1S59 A;  4ANE A;  4HR2 A;  3BBC A;  1HIY A;  5CAB A;  3VVT A;  4S0M A;  1XIQ A;  1UCN A;  4DUT A;  1BUX A;  3VGV A;  3GP9 A;  3VGT A;  1WKK A;  2ZUA A;  3B6B A;  3BBB A;  3Q89 A;  5C7P A;  1F6T A;  3DDI A;  3Q8U A;  3G2X A;  4O0N A;  4UOG A;  1KDN A;  1F3F A;  3ZTS A;  1NDC A;  3PRV A;  5IOL A;  1NLK L;  4KPC A;  1VYA A;  3WX8 A;  1U8W A;  1BHN A;  1W7W A;  4FKY A;  5BXI A;  4FKX A;  3EVM A;  3NGT A;  3EVW A;  3R9L A;  1BE4 A;  4CP5 A;  3Q8V A;  3NGR A;  2B8Q A;  3FBF A;  3NGS A;  3EMT A;  2DXF A;  3ZTQ A;  1HLW A;  3FCW A;  2HUR A;  1B4S A;  3PJ9 A;  2DXE A;  3ZTR A;  3BH7 B;  4EK2 A;  3FC9 A;  3FBC A;  4DI6 A;  1LWX A;  2HVE A;  2VU5 A;  2CWK A;  4ANC A;  3FBB A;  2NCK L;  3JS9 A;  3ETM A;  4UOF A;  1S5Z A;  3EM1 A;  2BX6 A;  1NSP A;  3DKD A;  3BH6 B;  4F4A A;  1NPK A;  2HVD A;  2DY9 A;  2BEF A;  4DZ6 A;  1MN9 A;  2B8P A;  4F36 A;  3EIC A;  1B99 A;  1NSK L;  2DYA A;  1NSQ A;  3GPA A;  1PAE X;  1JXV A;  3MPD A;  2DXD A;  3ZTP A;  1K44 A;  3VGS A;  4ENO A;  1LEO A;  1MN7 A;  1WKL A;  3EE3 A;  3ENA A;  1S57 A;  4WBF A;  1ZS6 A;  1NDL A;  3Q8Y A;  1HHQ A;  1NDK A;  3ZTO A;  3ELH A;  5CAA A;  1NB2 A;  1EHW A;  2AZ1 A;  3Q86 A;  1NCL A;  1NDP A;  2AZ3 A;  4UOH A;  4C6A A;  4W98 A;  3B54 A;  1XQI A;  3NGU A;  3FBE A;  3Q83 A;  3EVO A;  3VVU A;  1WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...