1LX5B

Crystal structure of the bmp7/actrii extracellular domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
94
structure length
94
Chain Sequence
ETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bone morphogenetic protein 7
publication title The BMP7/ActRII Extracellular Domain Complex Provides New Insights into the Cooperative Nature of Receptor Assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor/growth factor receptor
total genus 20
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1lx5B00
1HC9A 1CCQA 2BHIA 2OFSA 2UWRA 1IDHA 2MUPA 2L5SA 2MJ4A 1BTEA 2UX2A 1TGXA 1F94A 1ONJA 2I9BE 1CVOA 2J8BA 1QM7A 1CDSA 1HOYA 4RUDA 1CREA 4DO8A 1FRAA 2GOOB 1CB9A 1LJZA 1KBAA 1LXGA 2MJ0A 1LXHA 1CTXA 1TFSA 2CCXA 1KL8A 2MHYA 1FSSB 1LSIA 1V6PA 1ERAA 4IYEA 4QTIU 2HLQA 1FFJA 1UG4A 2MFAA 2NBTA 1L4WA 1HAAA 2CRSA 1NYSA 1MR6A 1QKEA 2MJYA 4FAOE 2CDXA 5EBXA 1JE9A 1HAJA 1MAHF 1NEAA 2H64B 4UY2C 2PJYC 4XJJA 1IDGA 1ERGA 1ES7B 3EVSC 2QJ9C 2LA1A 5DU1A 4OM5A 1ZADA 2HLRA 1M9ZA 1NORA 2CTXA 2QJAC 2ABXA 1CXNA 3NEQA 1BXPA 1H0JA 3HH7A 3LAQU 1IKCA 2FD6U 2QC1A 5DO6A 1VB0A 2ERAA 4LFTA 1W6BA 6EBXA 3PLCA 1KS6A 1IDIA 1CODA 2H62C 1JGKA 1KXIA 4OM4A 1CDTA 1IK8A 1TXAA 2X8BB 1CXOA 1I02A 2BTXA 4P7UA 1IJCA 1KC4A 1RGJA 2PJYB 2H62D 1DRSA 2H7ZB 1KBSA 2GOOC 1TXBA 2N99A 1LX5B 2MUOA 4FAOC 1RL5A 2L03A 1NXBA 4HQPF 1YWHA 1G6MA 1QKDA 2CRTA 1ABTA 1FASA 1XT3A 1HC9B 3EBXA 2H8UA 4ZQYA 2K3GA 1CHVS 1IQ9A 1FSCA 4AEAA 1NTNA 4BDTB 1FF4A 4EY8B 1KFHA 3VTSA 1CRFA 5DZ5A 1IDLA 1COEA 3FEVA 1NTXA 1KBTA 4BIKB 2H64C 1NYUA 2JVEA 2QJBC 3ERAA 3U73U 3BT2U 2H5FA 1KTZB 1B41B 1PLOA 3KFDE 3U74U 2JQPA 1CDRA 1JBDA 1REWC 2LCRA 3KFDI 2H7ZA 5IMTD 5IMYC 3NDSA 1CDQA 3QB4B 3NH7A 2VLWA 1S4YA 1F8UB 1KU6B 3BT1U
chains in the Genus database with same CATH superfamily
1HC9A 1CCQA 2BHIA 2OFSA 2UWRA 1IDHA 2MUPA 2L5SA 2MJ4A 1BTEA 4KSNA 2UX2A 1TGXA 1F94A 1ONJA 2I9BE 1CVOA 2J8BA 1QM7A 1CDSA 1HOYA 4RUDA 1CREA 4DO8A 1FRAA 2GOOB 1CB9A 1LJZA 1KBAA 1LXGA 2MJ0A 1LXHA 1CTXA 1TFSA 2CCXA 1KL8A 2MHYA 1FSSB 1LSIA 1V6PA 1ERAA 4IYEA 4QTIU 2HLQA 1FFJA 1UG4A 2MFAA 2NBTA 1L4WA 1HAAA 2CRSA 1NYSA 1MR6A 1QKEA 2MJYA 4FAOE 2CDXA 5EBXA 1JE9A 1HAJA 1MAHF 1NEAA 2H64B 4UY2C 2PJYC 4XJJA 1IDGA 1ERGA 1ES7B 3EVSC 2QJ9C 2LA1A 5DU1A 4OM5A 1ZADA 2HLRA 1M9ZA 1NORA 2CTXA 2QJAC 2ABXA 1CXNA 3NEQA 1BXPA 1H0JA 3HH7A 3LAQU 1IKCA 2FD6U 2QC1A 5DO6A 1VB0A 2ERAA 4LFTA 1W6BA 6EBXA 3PLCA 1KS6A 1IDIA 1CODA 2H62C 1JGKA 1KXIA 4OM4A 1CDTA 1IK8A 1TXAA 2X8BB 1CXOA 1I02A 2BTXA 4P7UA 1IJCA 1KC4A 1RGJA 2PJYB 2H62D 1DRSA 2H7ZB 1KBSA 2GOOC 1TXBA 2N99A 1LX5B 2MUOA 4FAOC 1RL5A 2L03A 1NXBA 4HQPF 1YWHA 1G6MA 1QKDA 2CRTA 1ABTA 1FASA 1XT3A 1HC9B 3EBXA 2H8UA 4ZQYA 2K3GA 1CHVS 1IQ9A 1FSCA 4AEAA 1NTNA 4BDTB 1FF4A 4EY8B 1KFHA 3VTSA 1CRFA 5DZ5A 1IDLA 1COEA 3FEVA 1NTXA 1KBTA 4BIKB 2H64C 1NYUA 2JVEA 2QJBC 3ERAA 3U73U 3BT2U 2H5FA 1KTZB 1B41B 1PLOA 3KFDE 3U74U 2JQPA 1CDRA 1JBDA 1REWC 2LCRA 3KFDI 2H7ZA 5IMTD 5IMYC 3NDSA 1CDQA 3QB4B 3NH7A 2VLWA 1S4YA 1F8UB 1KU6B 3BT1U
chains in the Genus database with same CATH topology
1HC9A 1CCQA 2BHIA 2OFSA 2UWRA 1IDHA 2MUPA 2L5SA 2MJ4A 1BTEA 4KSNA 2UX2A 1TGXA 1F94A 1ONJA 2I9BE 1CVOA 2J8BA 1QM7A 1CDSA 1HOYA 4RUDA 1CREA 4DO8A 1FRAA 2GOOB 1CB9A 1LJZA 1KBAA 1LXGA 2MJ0A 1LXHA 1CTXA 1TFSA 2CCXA 1KL8A 2MHYA 1FSSB 1LSIA 1V6PA 1ERAA 4IYEA 4QTIU 2HLQA 1FFJA 1UG4A 2MFAA 2NBTA 1L4WA 1HAAA 2CRSA 1NYSA 1MR6A 1QKEA 2MJYA 4FAOE 2CDXA 5EBXA 1JE9A 1HAJA 1MAHF 1NEAA 2H64B 4UY2C 2PJYC 4XJJA 1IDGA 1ERGA 1ES7B 3EVSC 2QJ9C 2LA1A 5DU1A 4OM5A 1ZADA 2HLRA 1M9ZA 1NORA 2CTXA 2QJAC 2ABXA 1CXNA 3NEQA 1BXPA 1H0JA 3HH7A 3LAQU 1IKCA 2FD6U 2QC1A 5DO6A 1VB0A 2ERAA 4LFTA 1W6BA 6EBXA 3PLCA 1KS6A 1IDIA 1CODA 2H62C 1JGKA 1KXIA 4OM4A 1CDTA 1IK8A 1TXAA 2X8BB 1CXOA 1I02A 2BTXA 4P7UA 1IJCA 1KC4A 1RGJA 2PJYB 2H62D 1DRSA 2H7ZB 1KBSA 2GOOC 1TXBA 2N99A 1LX5B 2MUOA 4FAOC 1RL5A 2L03A 1NXBA 4HQPF 1YWHA 1G6MA 1QKDA 2CRTA 1ABTA 1FASA 1XT3A 1HC9B 3EBXA 2H8UA 4ZQYA 2K3GA 1CHVS 1IQ9A 1FSCA 4AEAA 1NTNA 4BDTB 1FF4A 4EY8B 1KFHA 3VTSA 1CRFA 5DZ5A 1IDLA 1COEA 3FEVA 1NTXA 1KBTA 4BIKB 2H64C 1NYUA 2JVEA 2QJBC 3ERAA 3U73U 3BT2U 2H5FA 1KTZB 1B41B 1PLOA 3KFDE 3U74U 2JQPA 1CDRA 1JBDA 1REWC 2LCRA 3KFDI 2H7ZA 5IMTD 5IMYC 3NDSA 1CDQA 3QB4B 3NH7A 2VLWA 1S4YA 1F8UB 1KU6B 3BT1U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HC9 A;  1CCQ A;  2BHI A;  2OFS A;  2UWR A;  1IDH A;  2MUP A;  2L5S A;  2MJ4 A;  1BTE A;  2UX2 A;  1TGX A;  1F94 A;  1ONJ A;  2I9B E;  1CVO A;  2J8B A;  1QM7 A;  1CDS A;  1HOY A;  4RUD A;  1CRE A;  4DO8 A;  1FRA A;  2GOO B;  1CB9 A;  1LJZ A;  1KBA A;  1LXG A;  2MJ0 A;  1LXH A;  1CTX A;  1TFS A;  2CCX A;  1KL8 A;  2MHY A;  1FSS B;  1LSI A;  1V6P A;  1ERA A;  4IYE A;  4QTI U;  2HLQ A;  1FFJ A;  1UG4 A;  2MFA A;  2NBT A;  1L4W A;  1HAA A;  2CRS A;  1NYS A;  1MR6 A;  1QKE A;  2MJY A;  4FAO E;  2CDX A;  5EBX A;  1JE9 A;  1HAJ A;  1MAH F;  1NEA A;  2H64 B;  4UY2 C;  2PJY C;  4XJJ A;  1IDG A;  1ERG A;  1ES7 B;  3EVS C;  2QJ9 C;  2LA1 A;  5DU1 A;  4OM5 A;  1ZAD A;  2HLR A;  1M9Z A;  1NOR A;  2CTX A;  2QJA C;  2ABX A;  1CXN A;  3NEQ A;  1BXP A;  1H0J A;  3HH7 A;  3LAQ U;  1IKC A;  2FD6 U;  2QC1 A;  5DO6 A;  1VB0 A;  2ERA A;  4LFT A;  1W6B A;  6EBX A;  3PLC A;  1KS6 A;  1IDI A;  1COD A;  2H62 C;  1JGK A;  1KXI A;  4OM4 A;  1CDT A;  1IK8 A;  1TXA A;  2X8B B;  1CXO A;  1I02 A;  2BTX A;  4P7U A;  1IJC A;  1KC4 A;  1RGJ A;  2PJY B;  2H62 D;  1DRS A;  2H7Z B;  1KBS A;  2GOO C;  1TXB A;  2N99 A;  1LX5 B;  2MUO A;  4FAO C;  1RL5 A;  2L03 A;  1NXB A;  4HQP F;  1YWH A;  1G6M A;  1QKD A;  2CRT A;  1ABT A;  1FAS A;  1XT3 A;  1HC9 B;  3EBX A;  2H8U A;  4ZQY A;  2K3G A;  1CHV S;  1IQ9 A;  1FSC A;  4AEA A;  1NTN A;  4BDT B;  1FF4 A;  4EY8 B;  1KFH A;  3VTS A;  1CRF A;  5DZ5 A;  1IDL A;  1COE A;  3FEV A;  1NTX A;  1KBT A;  4BIK B;  2H64 C;  1NYU A;  2JVE A;  2QJB C;  3ERA A;  3U73 U;  3BT2 U;  2H5F A;  1KTZ B;  1B41 B;  1PLO A;  3KFD E;  3U74 U;  2JQP A;  1CDR A;  1JBD A;  1REW C;  2LCR A;  3KFD I;  2H7Z A;  5IMT D;  5IMY C;  3NDS A;  1CDQ A;  3QB4 B;  3NH7 A;  2VLW A;  1S4Y A;  1F8U B;  1KU6 B;  3BT1 U; 
#chains in the Genus database with same CATH topology
 1HC9 A;  1CCQ A;  2BHI A;  2OFS A;  2UWR A;  1IDH A;  2MUP A;  2L5S A;  2MJ4 A;  1BTE A;  4KSN A;  2UX2 A;  1TGX A;  1F94 A;  1ONJ A;  2I9B E;  1CVO A;  2J8B A;  1QM7 A;  1CDS A;  1HOY A;  4RUD A;  1CRE A;  4DO8 A;  1FRA A;  2GOO B;  1CB9 A;  1LJZ A;  1KBA A;  1LXG A;  2MJ0 A;  1LXH A;  1CTX A;  1TFS A;  2CCX A;  1KL8 A;  2MHY A;  1FSS B;  1LSI A;  1V6P A;  1ERA A;  4IYE A;  4QTI U;  2HLQ A;  1FFJ A;  1UG4 A;  2MFA A;  2NBT A;  1L4W A;  1HAA A;  2CRS A;  1NYS A;  1MR6 A;  1QKE A;  2MJY A;  4FAO E;  2CDX A;  5EBX A;  1JE9 A;  1HAJ A;  1MAH F;  1NEA A;  2H64 B;  4UY2 C;  2PJY C;  4XJJ A;  1IDG A;  1ERG A;  1ES7 B;  3EVS C;  2QJ9 C;  2LA1 A;  5DU1 A;  4OM5 A;  1ZAD A;  2HLR A;  1M9Z A;  1NOR A;  2CTX A;  2QJA C;  2ABX A;  1CXN A;  3NEQ A;  1BXP A;  1H0J A;  3HH7 A;  3LAQ U;  1IKC A;  2FD6 U;  2QC1 A;  5DO6 A;  1VB0 A;  2ERA A;  4LFT A;  1W6B A;  6EBX A;  3PLC A;  1KS6 A;  1IDI A;  1COD A;  2H62 C;  1JGK A;  1KXI A;  4OM4 A;  1CDT A;  1IK8 A;  1TXA A;  2X8B B;  1CXO A;  1I02 A;  2BTX A;  4P7U A;  1IJC A;  1KC4 A;  1RGJ A;  2PJY B;  2H62 D;  1DRS A;  2H7Z B;  1KBS A;  2GOO C;  1TXB A;  2N99 A;  1LX5 B;  2MUO A;  4FAO C;  1RL5 A;  2L03 A;  1NXB A;  4HQP F;  1YWH A;  1G6M A;  1QKD A;  2CRT A;  1ABT A;  1FAS A;  1XT3 A;  1HC9 B;  3EBX A;  2H8U A;  4ZQY A;  2K3G A;  1CHV S;  1IQ9 A;  1FSC A;  4AEA A;  1NTN A;  4BDT B;  1FF4 A;  4EY8 B;  1KFH A;  3VTS A;  1CRF A;  5DZ5 A;  1IDL A;  1COE A;  3FEV A;  1NTX A;  1KBT A;  4BIK B;  2H64 C;  1NYU A;  2JVE A;  2QJB C;  3ERA A;  3U73 U;  3BT2 U;  2H5F A;  1KTZ B;  1B41 B;  1PLO A;  3KFD E;  3U74 U;  2JQP A;  1CDR A;  1JBD A;  1REW C;  2LCR A;  3KFD I;  2H7Z A;  5IMT D;  5IMY C;  3NDS A;  1CDQ A;  3QB4 B;  3NH7 A;  2VLW A;  1S4Y A;  1F8U B;  1KU6 B;  3BT1 U; 
#chains in the Genus database with same CATH homology
 1HC9 A;  1CCQ A;  2BHI A;  2OFS A;  2UWR A;  1IDH A;  2MUP A;  2L5S A;  2MJ4 A;  1BTE A;  4KSN A;  2UX2 A;  1TGX A;  1F94 A;  1ONJ A;  2I9B E;  1CVO A;  2J8B A;  1QM7 A;  1CDS A;  1HOY A;  4RUD A;  1CRE A;  4DO8 A;  1FRA A;  2GOO B;  1CB9 A;  1LJZ A;  1KBA A;  1LXG A;  2MJ0 A;  1LXH A;  1CTX A;  1TFS A;  2CCX A;  1KL8 A;  2MHY A;  1FSS B;  1LSI A;  1V6P A;  1ERA A;  4IYE A;  4QTI U;  2HLQ A;  1FFJ A;  1UG4 A;  2MFA A;  2NBT A;  1L4W A;  1HAA A;  2CRS A;  1NYS A;  1MR6 A;  1QKE A;  2MJY A;  4FAO E;  2CDX A;  5EBX A;  1JE9 A;  1HAJ A;  1MAH F;  1NEA A;  2H64 B;  4UY2 C;  2PJY C;  4XJJ A;  1IDG A;  1ERG A;  1ES7 B;  3EVS C;  2QJ9 C;  2LA1 A;  5DU1 A;  4OM5 A;  1ZAD A;  2HLR A;  1M9Z A;  1NOR A;  2CTX A;  2QJA C;  2ABX A;  1CXN A;  3NEQ A;  1BXP A;  1H0J A;  3HH7 A;  3LAQ U;  1IKC A;  2FD6 U;  2QC1 A;  5DO6 A;  1VB0 A;  2ERA A;  4LFT A;  1W6B A;  6EBX A;  3PLC A;  1KS6 A;  1IDI A;  1COD A;  2H62 C;  1JGK A;  1KXI A;  4OM4 A;  1CDT A;  1IK8 A;  1TXA A;  2X8B B;  1CXO A;  1I02 A;  2BTX A;  4P7U A;  1IJC A;  1KC4 A;  1RGJ A;  2PJY B;  2H62 D;  1DRS A;  2H7Z B;  1KBS A;  2GOO C;  1TXB A;  2N99 A;  1LX5 B;  2MUO A;  4FAO C;  1RL5 A;  2L03 A;  1NXB A;  4HQP F;  1YWH A;  1G6M A;  1QKD A;  2CRT A;  1ABT A;  1FAS A;  1XT3 A;  1HC9 B;  3EBX A;  2H8U A;  4ZQY A;  2K3G A;  1CHV S;  1IQ9 A;  1FSC A;  4AEA A;  1NTN A;  4BDT B;  1FF4 A;  4EY8 B;  1KFH A;  3VTS A;  1CRF A;  5DZ5 A;  1IDL A;  1COE A;  3FEV A;  1NTX A;  1KBT A;  4BIK B;  2H64 C;  1NYU A;  2JVE A;  2QJB C;  3ERA A;  3U73 U;  3BT2 U;  2H5F A;  1KTZ B;  1B41 B;  1PLO A;  3KFD E;  3U74 U;  2JQP A;  1CDR A;  1JBD A;  1REW C;  2LCR A;  3KFD I;  2H7Z A;  5IMT D;  5IMY C;  3NDS A;  1CDQ A;  3QB4 B;  3NH7 A;  2VLW A;  1S4Y A;  1F8U B;  1KU6 B;  3BT1 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...