1LX6A

Crystal structure of e. coli enoyl reductase-nad+ with a bound benzamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
243
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of aminopyridine-based inhibitors of bacterial enoyl-ACP reductase (FabI).
pubmed doi rcsb
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 84
structure length 243
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lx6A00
4BNGA 4BKQA 2Z95A 4WK6A 4BB6A 4ALMA 1GDHA 4EJMA 1QXSA 2YQ5A 1GYPA 4P4GA 1JAYA 3BTSA 3ZWMA 2VHYA 4XRGA 3GGOA 5BNTA 2I3GA 1I3KA 4YXFA 4B3JA 2WYUA 2PV7A 4ND1A 3S1LA 3OJOA 4ID9A 3DAFA 3MJTA 1MC5A 2QRJA 5DCYA 2J3KA 3VPFA 4KWIA 3JQ7B 2BGKA 1U5CA 1Y9EA 3PYXA 4IJUA 3LLVA 2O48X 4PCVA 4XYEA 5BNFA 3RFXA 1ULSA 2NM0A 5DBFA 3WQQA 2UUPA 3UUWA 4KWHA 1ZSVA 3ETEA 4AFNA 2FR0A 2AEJA 4J91A 3KHUA 5HBRA 4CPDA 1NR7A 2Q45A 3B1FA 1TB4A 2NWQA 1H0KA 3BTOA 1UZLA 2JL1A 4BNYA 1EFLA 2VYND 4IDGA 4R1SA 4DQXA 9LDTA 1GPDG 3PK0A 1YQDA 1K5HA 5JMWA 5ER9A 3WBFA 5BR7A 3HN2A 3TFQA 2ZTVA 5KJ1A 4JN6B 1VJ1A 2O3UA 4K6FA 1E5LA 1I0ZA 2P9CA 2Y1OA 4QEDA 4R3NA 2HDHA 1PJ2A 3BA1A 1UXHA 1VJTA 2WD8A 5CDSA 4TRNA 4LN1A 1M67A 3LSYA 2C7GA 1KOLA 1Y6JA 4FW8A 4E2YA 1EVYA 4YBZA 1Q7CA 4O63O 5COQA 3GMSA 1I3LA 4BIIA 1P45A 1EVJA 3PLRA 5ICMA 4ND5A 4YAIA 1EUZA 3RBVA 2G1UA 3E8XA 1HWYA 2NTNA 3PVZA 4IZHA 1ZK0A 1ML3A 3MOGA 1A4UA 3QY9A 4UVIA 3U9LA 1RM5A 1VL8A 4J6FA 2VWPA 3VPSA 2JJYA 2FR1A 3B6ZA 1A27A 4MVJE 1HETA 1MA0A 2E4AA 4BNTA 3W8DA 4F45A 1O95A 3EHEA 4RVUA 1LQTA 1EVZA 1R4NA 4Y6SA 1E3JA 3TF5A 1D7OA 2GYYA 1I2CA 2R2GA 3OMLA 3ZHYA 2H9IA 1B8PA 3IP1A 1E1LA 3RU9A 4A7PA 3CZMA 4CUZA 6ADHA 4K6CA 1VRWA 5I7SA 3V1YA 1P0CA 1NNUA 5A5FA 4JBIA 3JTMA 1YS4A 2AQHA 5JW6A 1ADBA 1NFFA 3NV9A 1F17A 1TXGA 4Y9DA 2AE1A 4DLAA 1NQTA 1J5PA 4B4OA 3C7CB 2CZCA 1HDZA 4FGSA 1OC4A 2VUSA 3T7CA 1PS9A 1ENYA 1H6DA 1ZMOA 2OOSA 4H3VA 5DCUA 4FOOA 1I33A 5A9SA 1Q2XA 1ZMTA 3MWEB 2IZ1A 1YE3A 1ISHA 3KSDO 2PGDA 3O38A 3S2EA 3GY0A 4AJNA 1XELA 1N2SA 4IIUA 2CVOA 1HZJA 1WNTA 4ALNA 5JCJD 3CMCO 4MO2A 3JQ6A 3FSRA 5A9RA 1H9AA 3IJPA 4WEOA 3DZFA 3FWZA 3D3WA 1C14A 2I5PO 3L77A 4XDYA 2XXBA 5T5QA 4B7CA 3H9EO 1YO6A 4EUHA 3FN4A 4XCVA 3SJ7A 5KIAA 1XU9A 2ILTA 2C2XA 5TF4A 1R4NB 3TNLA 3Q2KA 1P31A 4C4OA 3PXXA 3WGHA 2V6BA 1OC2A 3KTDA 1K89A 3A4VA 1IZ9A 1DJNA 3VTFA 1YDEA 3B1JA 3RUHA 4UEKA 4OO3A 1I24A 4ZGWA 3VHRA 3UGKA 1NQAO 1HDGO 2IEDA 5C5IA 3ROQA 2OO5A 3RC1A 3ZV5A 4M86A 3ZV6A 3GHYA 4IJVA 4J9VA 3AW9A 3SX2A 4JJGA 4Z3DA 4CQLA 4RQUA 1BG6A 1EQUA 3PHLA 5A03A 1GAEO 2O3QA 1BXGA 2VHXA 1X7GA 2UVDA 3NT4A 5A9SB 1T2DA 3DMTA 5HTOA 1P1KA 1J0XO 3LF1A 4XJSA 3K92A 1O94A 4PIVA 2VN8A 4JX8A 4D46A 4CM8A 3FPLA 3AK4A 1PJLA 4N7RA 3OQ6A 4OH1A 4XIYA 1XEAA 1UXJA 2DC1A 4BNZA 4MP6A 1LLCA 5KOIA 3QWIA 3C7AA 1VKOA 3HFSA 4DRYA 3D3WB 3PDUA 4AJHA 4Y6RA 3A9WA 4B3HA 6LDHA 3DBVO 3VKVA 3DBRA 3QVWA 3DOOA 1DLJA 1H2HA 4P38A 1JVBA 1UP7A 3QE3A 5TT1A 3T7EA 4A10A 3R0IA 1HDOA 3GAZA 3VH2A 3IP3A 3ZWAA 3GZNB 3HE3A 3BMNB 1JA9A 4WCDA 4UUPA 4GL4A 4JP3A 4S1VA 4XA8A 3WWYA 1LA2A 1LX6A 1ZH8A 2BMAA 2VUTA 2YV3A 4RPKA 5DBIA 1T4BA 5A05A 5DOVA 4D3DA 1EK6A 3GF4A 4NNJA 4E33A 1TT7A 5L7WA 1P1RA 4ND3A 2WE7A 3DAGA 3PJFA 3QLJA 4S3MA 5T8KC 3VC7A 3VTZA 4R5MA 2NU6A 1E77A 1NFRA 4I5EA 1CRWG 3FBGA 2PNFA 3ROMA 1EE9A 1KEVA 3MEQA 2GERA 5JE8A 3ANNA 1T2AA 2NTVA 1YGYA 4W4TA 3NGXA 2VOEA 1DHRA 1HE2A 3GGPA 4Q3BA 3U4CA 2QRLA 4DIBA 1EUCA 1P1FA 2ZQYA 4ZQEA 2W8ZA 2FHSA 4JLWA 1NVMB 4UUNA 4CM1A 4YRBA 1T2FA 1V6AA 4IDCA 2WWRA 1DSSG 4CM8B 3WGGA 2HLPA 4HFNA 2P91A 4PFJA 3KM0A 4OQZA 2BGMA 1VE9A 4GBJA 4LVCA 2EW8A 4EEXA 4E4YA 4BNWA 4BNJA 2HMWA 5EESA 1W0CA 3HWRA 2PY6A 3JD3A 2ZK7A 3O26A 4RPJA 1DBVO 2J5RA 1ZSYA 4HFJA 4OJNA 4ZQHA 1NAIA 1T26A 4CM6A 4D43A 2V6MA 4KZPA 4QUKA 4DA9A 1HLDA 3JQCA 2GN6A 4IDFA 1R0KA 1O5IA 2I99A 1Z82A 3GNSA 4L9RA 1NBOA 1GY8A 3PLNA 1B14A 1UAGA 3DFZA 3ROKA 4YAJA 3BMQB 3I83A 3BZUA 3JSAA 1NTOA 1IHYA 4WLUA 5B37A 3ZHXA 2Y93A 3VDQA 3AFNA 2X9GA 4JROA 1PIWA 1P3DA 3DDNA 1H9BA 4EI2A 3PHIA 2OBYA 3H2ZA 3KOUA 4GX1A 3GC6A 3OIGA 3JYNA 2RHCA 3M1LA 3QA9A 4E2WA 4RF4A 2AE2A 3SC4A 4QX6A 2PLAA 3AOEC 3W6UA 3WGOA 1KVQA 4BB5A 1GUZA 1W4ZA 3F5SA 2YHUA 2HKIA 4WGGA 5L53A 4MIOA 4DQVA 2V6GA 2OORA 1A9ZA 3JYOA 1E3EA 4ND4A 3ZV4A 4XQCA 4K28A 4M89A 5G0UA 4FIZA 2O50A 4P4NA 3GLQA 4ZRNA 1IYZA 2C82A 1LJ8A 5EL0A 2EP5A 1CETA 2EWMA 3C3XA 1PJ3A 3QRWA 4NU6A 4FCCA 4XYMA 4C7JA 2AQ8A 2GPTA 2AEMA 5TC4A 4DTIA 1V9LA 1B7GO 3EZYA 4E3ZA 5IZCC 3GFBA 1YQXA 3HG7A 3PWZA 2X0RA 5DOZA 1GEGA 1JLLA 1PQWA 3I9NA 4M8SA 1U5AA 2YQ4A 1K6XA 1WPQA 4IJWA 4IMRA 3ZWWA 2BHLA 5FEUA 4NJMA 1QYCA 1VM6A 3QWFA 4D3SA 4BHTA 3ANMA 2OZPA 3C7DB 3L6DA 1KETA 4DWVA 1PTJA 1JKJA 3L6OO 4XGKA 3JYLA 4OL9A 3DHYA 4GAEA 4FC6A 1XDWA 2ZTMA 2BLLA 1X0VA 2O3SA 1ENPA 2PGJA 3PQFA 3JQFA 2DT5A 4GKVA 2IZZA 3KYDA 5AXDA 2XF8A 1LQUA 2RH8A 4LSWA 4XGIA 3ITDA 2GN8A 1AXGA 5IDQA 4FD3A 1Y9AA 4PVDA 1GYRA 3WIEA 4CLOB 2Q49A 5KTKA 3QWAA 4AJOA 2YFHA 3SLKA 4L4XA 4YJHA 3CEAA 3OJEA 3S2IA 3JQGB 5AXBA 2HK7A 3IQDB 3F6YA 3VH4A 4PN3A 1DPGA 3ZW8A 2ZYDA 3VVCA 3E9QA 2VT2A 3LK7A 2J6IA 2VHWA 4U5QA 2GUGA 1EE2A 5U4QA 4BVAA 5AXCA 3I1JA 4AICA 4IM7A 3ZWBA 2HJRA 4ONEA 3AUSA 2A9FA 2H63A 3JQBA 4W9NC 4B4VA 1Q7BA 1KIFA 3CIFA 3H5RA 1KVTA 1QYWA 1GYQA 5LCXA 1WLYA 4XQEA 3ZWXA 2YW9A 2Q1SA 2AG8A 2D0IA 1E7MA 3RUFA 3F4BA 1HT0A 2B36A 4J49A 2I9PA 5HWSA 4FJ2A 4CLRB 1SOVA 4WPGA 3KRTA 4CMIB 3D5TA 4WLNA 3HDJA 3GEMA 4RLHA 4D7AA 1JVSA 1AHIA 4J3FA 3RASA 1H93A 5AQ1A 4IUYA 1XKQA 5DF1A 5JO9A 5IDWA 2VYVD 2YV1A 1T25A 4I5DA 4O59O 1DJQA 3UAGA 3GRPA 4YJHB 4N18A 5ENDA 3BMCA 1ZSNA 3AY3A 1DOHA 3U4DA 3ONFA 5G0WA 3ICCA 3TZQA 2Q1UA 1UZNA 3PGJA 3LT1A 4TQGA 4BKUA 4DPLA 4IBOA 5H83A 3PHHA 1GADO 1DFHA 3OFSA 3UN1A 2JHGA 2HMTA 2JFGA 3G49A 1XA0A 1GUFA 3RJ9A 2CF6A 3H9QA 4ZJUA 4EEZA 2ZCVA 3EUWA 5L9AA 1U2DA 5A3VA 1U9JA 4EBFA 4OAQA 3SVTA 3R3JA 5ES3A 5IDYA 3ZNOA 2DUWA 1PEDA 5EQFA 2NQTA 3DXFA 4PVCA 1JN0A 3ZW9A 4EGFA 4TZKA 4DBVO 1PZFA 4GLOA 2NACA 1OZAA 4YRAA 5L3ZA 4Y8VA 2HU2A 4MVJG 1MGOA 4BOYA 2BFPA 2VRCA 5JDCA 3DBLA 1YONA 1LDEA 1X14A 3Q6IA 4KDFA 4MVJI 4R9RA 3ZNPA 1PJQA 1OMOA 2DTDA 2O23A 4DIOA 4RF5A 1H2BA 4M49A 3NYWA 2AA3A 5CDGA 3NGLA 5IN5A 3K2BA 5L4LA 4J0FA 4RO0A 3PPIA 4DUPA 1P77A 3DZGA 4BO1A 1Z75A 1FDVA 1A7KA 3QW2A 5KKCA 5A5EA 5C7LO 4BMSA 3S8MA 2AXQA 4R1UA 2O7SA 1I32A 4WLEA 3LC7O 5U1PA 4YJFB 4B79A 1N9GB 1WMBA 4XR4A 3MCVA 2O4CA 1I3MA 4FDAA 4L4RA 3WGZA 2PKRA 3DTYA 1VPDA 4RZIA 2EEZA 4RZHA 2JCYA 3CE6A 2Y1CA 3IIEA 1RM4A 2D5AA 2IODA 2OFPA 4J7XA 1FDSA 4KTVE 3INGA 4ALKA 4LRTB 2IXAA 2VTEA 1H6BA 2NUAA 4QQRA 4DMLA 1F12A 3PQDA 2FPGA 2W2KA 4R16A 4CMBA 1YRLA 3KXDA 3ZDFA 3TRIA 1J6UA 1DRWA 1SZJG 3RSHA 4CL8A 2FN7A 3TFOA 3AUUA 2JAPA 5ILOA 4BQPA 4Z6KA 1BRMA 4RVFA 2GCGA 3DBLB 2P5UA 4ZRMA 4A03A 1NP3A 1TT5B 4GPD1 2B69A 2V7PA 2I76A 1DRUA 1SNYA 3D64A 2B4QA 3UW3A 4RPGA 3NDJA 3UFXA 1C3VA 4IXTA 2DBVO 3OJ0A 5THQA 4TMFA 1LC0A 3NEPX 4TVBA 3W1VA 2EF1A 3RVDA 1ONNA 2BGLA 1RWBA 1BXKA 3I9KA 3TJRA 5J23A 4J7CA 3H7AA 1E0DA 3RC9A 5CDTA 4GGPA 1DO8A 2OBNA 5DDIP 1QP8A 3E18A 3ZGYA 1ISJA 1C0IA 1CJCA 2X22A 5JY6A 1WDMA 4YRDA 3VZSA 3FTNA 2D3TA 4J9UE 1M6HA 1YWGO 5G0VA 3OIDA 2GO1A 1X1TA 4RDIA 3K96A 4U6QA 4J1NA 2GN4A 4R68A 1P0FA 1HSOA 5F3RA 4YAEA 1D8AA 3EGOA 2HRBA 2ZYAA 1A72A 2CD9A 2VOJA 3E1KA 3ZWNA 2GN9A 4IS2A 4U7WA 4DPMA 4R01A 1XSEA 2PD4A 2Z1MA 1UXGA 3OETA 1F06A 2E37A 2VZ0A 4LW8A 3BHMA 1HDXA 4DQUA 2Y1DA 4EJ6A 3PIIA 2YFQA 4U0JA 1QKIA 3N7UA 3V1TC 3C1OA 2C0CA 1LSOA 2SCUA 1ADCA 4XQGA 1ZO8A 3E9NA 4GVXA 3ZH2A 1LLQA 2DAPA 4BO7A 3Q0EA 3H3JA 3IAHA 4BMNA 3HQ4O 3EW7A 4NBVA 3GAFA 1NPTO 1PJTA 1WDKA 3JCZA 1XQ6A 2O3JA 1ISMA 2CVQA 4WLFA 4ZQFA 2BI8A 3BAZA 3JV7A 3K6JA 1PS0A 5CAEA 4MJLA 3PZRA 3F46A 1LBEA 4Y98A 3D3EA 4G81A 2VYNA 1NM5A 3HJAA 3AY6A 5A9TA 4CUKA 5T8KA 2RAFA 3DWFA 2IRWA 3ETGA 3I9MA 3JD1A 4LCJA 5MGBA 4XYLA 5U9CA 5FI3A 3N74A 4A26A 4R69A 1YL7A 4IDDA 1UP4A 1HYGA 2AHRA 3PWSA 4B7XA 3EK2A 3P19A 4KUEA 1PU2A 3BMOA 3MTJA 5B12A 3UCFA 1MB4A 2X9VA 3F9IA 4MKXA 1KVUA 3K31A 3ADPA 5JYDA 2VZ9A 2RH4A 2V65A 3EC7A 4E5KA 2Y0EA 1VI2A 2NADA 1SOWA 4NHEA 1R12A 4P4LA 4UREA 1GD1O 5JNLA 1IY8A 4BV8A 1SCUA 1WZIA 4DC0A 3NTRA 4E13A 3JD0A 1UJMA 2Y1EA 3HN7A 3JQAA 3KSUA 2B4RO 4FC7A 4L75A 1BSVA 3RBXA 4QT0A 4LMPA 4OSPA 2X0IA 2RHRA 1U3VA 4KQWA 4GVLA 3FCOA 1E3LA 2NNLD 2J3IA 4E5MA 4RVDA 3PJGA 1BDMA 4BKPA 3JQAD 1P74A 5I8WA 1BWSA 3VDRA 1CEQA 3RFTA 1DXYA 4PG6A 4FFNA 3OJFA 1YBAA 1UDCA 2Q99A 2Z5LA 2G17A 3ENNA 3P2YA 4KUHA 4X54A 1YDWA 3TZ6A 1O0SA 3B70A 4EDFA 1AHHA 3DAPA 5GZ1A 3GA0A 1E6WA 2DFVA 3M2PA 3ROPA 3BYZA 3HSKA 1BGVA 3VPHA 1YVEI 1DB3A 1DEHA 1PGJA 2HAEA 1YJQA 5CFZA 2BFOA 3AOEA 4OM8A 4A2CA 3JQ8B 1W8DA 3D4OA 3BMOB 3AY7A 3AM3A 4HY3A 5A4DA 2B5VA 3V8BA 2CDBA 4IS3A 2Y1GA 2B83A 1QRRA 1N92A 1TI7A 3GN2A 4Q39A 4FS3A 1P1IA 1N1GA 4CMEC 2RIRA 1GPJA 2PKQO 2Q4EA 3F5QA 5JLAA 3ZWYA 4IDAA 3CMMA 2Y68A 3WDSA 5JCJA 3KYCB 1E3SA 1MG5A 5B4UA 3JQAB 1DC6A 3FWNA 1J4AA 2LDBA 2HRZA 2CDCA 3WSVA 4ESOA 5T57A 4GX5A 3KUXA 1DLIA 3X2FA 3P5SA 1Y5RA 4C7KA 4Q3DA 1ZW1A 2BH9A 1EBFA 3FNGA 3ADOA 4EUFA 4YQYA 5GMOA 5IZCA 3U09A 1HDCA 2I6TA 3PP8A 2NU8A 1KBZA 1IUKA 1C0LA 4CM9D 1GR0A 1NR1A 1N1EA 4FPXA 4J2OA 4DYVA 4YA6A 4M1QA 4OIMA 1B3RA 1Y5MA 2EGHA 3WXBA 1IHXA 1Z45A 2VWHA 3FF4A 2WMDA 4FFLA 4RV9A 5FF9A 5JY1A 1NVTA 3GZNA 3H4VA 3BMNA 1GV1A 1E92A 1SEPA 4RQTA 1ENZA 4AJ4A 5TGDA 1H5QA 3CTMA 1LXCA 2VQ3A 4BNKA 4YAGA 3O8QB 4AJ2A 3NKLA 4ALIA 2IZ0A 3MJCA 3EMKA 2DBRA 1C0PA 2G76A 3NRCA 2G82A 3WQRA 3AM4A 2A35A 4WNIA 2Y0CA 3Q3CA 2OHXA 2J8ZA 5GY7A 4Y6PA 4Q3NA 2C59A 2I3AA 3M2TA 2W2LD 4BNMA 4CR7A 5JDIC 3JYQA 4TRJA 5A02A 5KJ6A 1KY4A 3W8EA 2X1HA 1GCUA 1VJ0A 4GLLA 3OICA 3EVTA 1LSSA 3WFJA 4B3IA 4FB5A 3INTA 4WCFC 1N8KA 1S6YA 2QW8A 3TQHA 3I4FA 2D59A 2PGLA 1JWAB 1JU9A 1GEEA 1GZ4A 1R0LA 1LSJA 3ON5A 3AOGA 3ZWCA 4W7IA 4D3FA 3D4NA 1ZUD1 4HNHA 4MVJP 4W6ZA 4JJIA 1HKUA 1U8FO 2VNSA 1WZEA 4FJ1A 5BSFA 2DTEA 4IIVA 1HRDA 3E6AA 3QSGA 5IFLA 3PTZA 3D5QA 2UDPA 4OXNA 5F21A 3I3OA 4WOJA 3L4BA 2CNBA 4DREA 4E5PA 3DZBA 3I6QA 5FI5A 4NBTA 3KLMX 4BNUA 4NFSA 3BMQA 3DOJA 3RFVA 3P7MA 4I9UA 3RKUA 3UCEA 5DP2A 4J1QA 1P1HA 1Q0LA 1XGKA 4CV3A 5KJFA 3WFIA 3WGYA 2YJZA 4MKRA 1NHGA 1F8GA 2CY0A 4CV1A 3CPSA 5IAAA 4EITA 3BIOA 3FNEA 3I9OA 8LDHA 1DIBA 1LRLA 2BI7A 2NVWA 4PRLA 4WUVA 1U4SA 1SPXA 4XKJA 3FHLA 2JKVA 4J4HA 4WLVA 2UUOA 1RJWA 3I6IA 5AVOA 5CEFA 3GPIA 1R4MB 3KO8A 4QFCA 4YCAA 1Q0QA 1OBFO 3BTUA 4KUGA 3DZKA 4NU5A 2PZKA 4D45A 1D1TA 1EBUA 4YJGA 3KV3O 2QQ5A 3E9MA 3HFGA 4YDRA 4M54A 4ALJA 3U0BA 4J43A 2Y05A 3GUCA 4HFRA 2PD3A 4PG4A 3BHIA 3H9JA 3IS3A 2O4UX 3K9QO 3Q2IA 1QV7A 3EVNA 4K1LA 4OSOA 2P9GA 4HNGA 4ZQBA 1YL6A 5I8ZA 4YQZA 3UHAA 2H5LA 3ZV3A 4H7PA 4WE3A 1PR3A 1LDBA 4AJKA 5TSDA 1ARZA 2JAHA 1PL7A 3OHSX 3ANLA 1H6CA 1HYHA 5T64A 3RU7A 3UKOA 2WYVA 3GR6A 5HS4A 2TMGA 3HB5X 4PLTA 3ST7A 3HNPA 3D1LA 4UEOA 4R9SA 1A4IA 1M66A 1LEHA 1VKNA 5KWEA 3NTQA 1EZ4A 4N5MA 4Q9NA 1HSZA 2VNAA 4PGFA 3ORFA 2B4TO 1EDOA 3ASVA 4LCEA 1DC5A 1GFSA 1I5RA 4M55A 4CLOA 1ZKMA 2BF7A 3V2GA 4CM5A 3PWKA 1ZZEA 4YJGB 2VWGA 4B4UA 1MX3A 4CMGA 3JQGA 4PLFA 4HKTA 3VVBA 5K9ZA 1K0UA 3GGGA 3UCXA 1YKFA 2Y66A 3CINA 4CV2A 3LT4A 2IE0A 5IDXA 3LYLA 1UH5A 4IJKA 1FF9A 1Z6ZA 4BO8A 5DBGA 4U6SA 1EMDA 3OJLA 3ZU3A 4BL5A 3NTOA 4G5HA 3WJ7A 1PL8A 3C1AA 3KB6A 3PRJA 3WR5A 1B26A 3AI3A 3WOHA 2QG4A 1I30A 1MG0A 4M87A 4QFDA 4E2ZA 3ZNQA 1K6JA 2JFFA 1T2CA 2O3TA 3GVHA 3O4RA 3O9ZA 4H15A 2GF2A 4MVJH 1SEVA 2YHIB 3GVXA 1YB5A 5IG2A 3EY4A 3QIVA 4CLRA 4CMIA 4GSLA 4XB2A 3RCBA 3CZRA 4XQ9A 3VZQA 2AQKA 1LI4A 4EUEA 2FZEA 5C7OO 4N5NA 4N54A 1DRVA 1WDLA 2D8AA 4FJ0A 3JD2A 4JP2A 1JW9B 4IQ8A 4L8VA 4YT4A 3ZWPA 2P4HX 3CSDA 1JDJA 5LC1A 2R00C 3F4LA 1EUDA 3AFMA 4PLPA 3PIDA 4MIYA 3WWZA 4CR6A 4RVSA 2V6FA 3DZJA 3RD5A 4R51A 4QTZA 1UAYA 3WQSB 3FI9A 5FWNA 1UXKA 1LDMA 3WICA 2Y0DA 4JGBA 4BNXA 3PEFA 3TZCA 4WEQA 1X7DA 2QIOA 1CWUA 3IUPA 1KEUA 4D0RA 3VH1A 1IULA 5H81A 4J2HA 9LDBA 2YYYA 2Z1NA 3GG2A 5C37A 4OMUA 3FBTA 1T1RA 1T2EA 3NT5A 1EDZA 3CUKA 2RBEA 3DMTC 1LLUA 3OECA 1A9YA 4FFOA 4BV9A 4YAKA 5IJZA 3MZ0A 1IL0A 2GNAA 3RBZA 3A1NA 4U0KA 2FP4A 4HXYA 3LC2O 5JAMA 1M76A 4GH5A 1BW9A 1HZZA 2VYVA 2WEKA 4CQMD 1GQQA 3TWOA 1U7TA 5EQDA 3I23A 4IDEA 2ZJ0A 4BUCA 2ZB7A 2I66A 1WMAA 3D4PA 4Z9XA 5ITVA 1ZK1A 3FRJA 4AG3A 4CMJA 4KDEA 3LC1O 4NDNE 2YZ7A 1I2ZA 2IYOA 4CR8A 3I5MA 3OA2A 3DFUA 3GG9A 2VHVA 5F1KA 3GDGA 3IUSA 1R16A 2J3JA 5L51A 4E5YA 4E2XA 3ZU4A 3V2UA 1MLDA 1NQOA 2XXJA 1ZNQO 3VZRA 3WIDA 1KC1A 4XJTA 5KKAA 3E03A 1U2GA 5C7IO 5COAA 1YBMA 4YJFA 1N9GA 3ZWOA 2ZYGA 3TL2A 2X86A 1VC2A 2NTJA 1ZJYA 2PZJA 4CJXA 3D7LA 3RJ5A 1ZEJA 2QZZA 4BGUA 4CMCA 3K73O 1D3AA 1R6DA 4OOEA 1JTVA 4KOAA 3AU9A 4CQMB 3OEWA 3SBOA 5JXWA 3TOXA 4D79A 2HMUA 3E5RA 4ILKA 5B4VA 1BW9B 1BHSA 2VTDA 3L9XA 2AMFA 1GV0A 3VOSA 2C29D 3KSZO 1NQ5A 3X2EA 1TT5A 4ZICA 3FNFA 2FPPA 4WOKA 1DAOA 3MTGA 3WGTA 4FQ8A 3RAJA 1PJCA 3WGIA 4EYEA 4CV0A 2CDAA 3NJ4A 3S55A 2Q2WA 2FPIA 4IINA 5G4LA 1HL3A 4D44A 1H94A 4AJLA 3GOHA 1ZXLA 4JNKA 4ZA2A 1JKIA 1W73A 2E6UX 3MJ4A 1KS9A 1UZMA 5KVVA 1PZEA 1ONOA 2BFMA 1HE3A 5DT9A 3WNQA 4MP3A 3H5AA 4RORA 1FDWA 3QV1A 5JAZA 3OSUA 5L7YA 3ICPA 2NV6A 1Z7BA 4CMEA 4L4SA 3ZI0A 4ZU3A 3HADA 2ZJ1A 2PA3A 1OAAA 4MVJD 1TVEA 4BKRA 2GZ1A 3QWHA 3R1IA 4OQYA 3HDQA 4QO8A 2OP1A 3B1KA 2HMVA 1ADGA 2OXIA 2G0TA 1C1DA 1LTHR 5JFOA 4CLDA 1K3TA 1I36A 3WBBA 2X0JA 1GQ2A 3CKYA 3LT0A 5T67A 2EKQA 3LF2A 5AYVA 3MJEA 2Q2QA 1SB9A 1ZK4A 1CERA 3K2EA 4TRRA 5JC1A 4NFHA 3QVSA 5IZ4A 4ITUA 3OIFA 3RUIA 1Q7GA 3NJ8A 4XYBA 4Z3KA 4LRSB 2EJWA 2PH3A 4HADA 1AGNA 4WECA 4A73A 1L7EA 3DONA 3U49A 5BNIA 2FOIA 3LZ6A 5TNXA 4XYGA 2FMUA 4DLLA 3A14A 3MJVA 4II2A 4NI5A 3WTCA 4BNFA 2DU8A 4MDHA 1RKXA 1F14A 2C07A 4CM4B 3H9UA 4TKMA 3VPXA 2F1KA 3SXPA 4R4JA 3WLEA 4PG5A 4QECA 2HJSA 4Z9YA 1JWBB 4TWRA 1LDNA 5TS3A 3S2GA 1E7YA 5I9NA 3LDHA 1BVRA 2DLDA 5I9LA 2DFDA 1PJSA 4KP7A 4A27A 5KVSA 1QR6A 4E30A 4J7UA 3WG9A 4P22A 4XZ3A 1T1SA 1Z74A 4OHUA 1DFGA 2C20A 3H8VA 1EFKA 4L76A 4D0SA 1NASA 1I2BA 4ZQGA 4BO5A 3UOGA 2D1YA 5ILGA 2F00A 1P44A 4DGSA 2I65A 1HDYA 2Y67A 4NPCA 1NVGA 1CQIA 1EQ2A 4ROSA 3JQ9C 1V3VA 2EKPA 1C1DB 2QYTA 4FFPA 3ZHZA 2O2YA 1PX0A 5DCWA 4OXKA 3GNTA 1Y8QA 4UULA 3DB2A 2CF5A 3RC2A 1DC3A 3MJSA 5CPFA 5KCZA 4O1MA 1HDRA 2DBQA 3UICA 4A0SA 4WLOA 2E82A 1PS8A 3PHGA 2C5EA 2Q1WA 5CDYA 1DIAA 2YUTA 1VSVA 2E48A 2PK3A 4YB8A 3KLPX 1JAXA 2Q1TA 5G2OA 1NYTA 1QV6A 3ONEA 4FSHA 4AJ1A 3PI7A 5EN4A 1MFPA 2E49A 2FR8A 3LQFA 3W8FA 1DHTA 1XR3A 3QQPA 3GH3A 5IXYA 3DOCA 3PFFA 5BT9A 3U4HA 4DLBA 1C1XA 3TDKA 3FPCA 4IMPA 5JAQA 3ENKA 4Z9FA 4B8ZA 3S2FA 4NMHA 1UXIA 4Z0HO 5F5NA 3GT0A 4WKGA 5JS6A 1ENOA 4PG7A 4NBUA 1Y8RB 4K9DA 1M75A 2GGSA 2P68A 4A5OA 2AW5A 4PG8A 4JXKA 2QZ9A 4O5OA 3Q9NA 2X23A 3AUTA 1E1MA 3OH8A 1ZEMA 4I5FA 1L1FA 3JQ8A 1VL0A 2GZ2A 3FNHA 3DBHA 3W6ZA 2VHZA 5F5LA 4BMVA 2PKQP 2PZLA 2IXBA 3OQ1A 2EV9A 1F8FA 3H6KA 3TPCA 3WGQA 4LVUA 4WCFB 4BNLA 3AWDA 3ZZNA 4E0BA 3TZHA 2ZTLA 1Y8QB 4I08A 2BD0A 4NK4A 1BXZA 3HHPA 3GHHA 2DQ4A 4DVJA 3KYCA 1X1EA 2H1SA 1XHLA 3KETA 1PWXA 4ALLA 3E48A 2XPCA 2XAAA 4JIGA 2B35A 4IY1A 1XU7A 4GWGA 1SB8A 4E6PA 3AI2A 5KJEA 1KERA 4AL4A 1NX6A 5CG2A 1E3WB 4RL6A 1PQUA 1QG6A 4P8RA 1MUUA 3R6DA 1RPNA 5K0ZA 1Y7TA 2D2IA 1GL3A 4FBGA 1DIRA 1P1JA 5G0SA 4PZEA 3L4SO 3DR3A 2FRDA 2WSBA 3G1TA 3QJ5A 4DIFA 4YT2A 1V3UA 1C1XB 2D4AA 1YB1A 4L0QA 4Q3EA 4XDZA 2OUIA 4FN4A 1R15A 1N7HA 3TOZA 2I67A 5L4SA 2C7VA 2B0JA 2Q2VA 5BQFA 5L95A 5HS6A 4BO2A 4LSMA 2IYPA 3M1AA 2HCTA 4L73A 3GZ4A 4PLGA 4URFA 4D42A 3Q9UA 5JSFA 1E6EA 3O8QA 3SLGA 2EIHA 5G0TA 5A04A 2DBZA 4MKZA 1U4OA 4RVGA 4YT8A 3DBHB 4LISA 3LU1A 4FFMA 5JDCC 4J16A 3RQSA 1HXHA 4UUMA 3I52A 5DNAA 1YQGA 5CDUA 4HV4A 4BO0A 4NJOA 1E7WA 4UEJA 3V2HA 4BQRA 4D41A 4YYZA 1QMGA 2GASA 3R3SA 3K30A 3COSA 1XIVA 3DMYA 4E5NA 4O6VA 2WJPA 5H82A 4CM9A 3OBBA 3C85A 5T6BA 4FFRA 1T24A 4PZDA 4Z0PA 1O9BA 3IOYA 1JKFA 3V5NA 4WNCA 4MP8A 3ITKA 2DKNA 1ISGA 1CQJA 3G79A 1FK8A 3DTTA 1A71A 4PLHA 3PHJA 1PGPA 5KJCA 2CVZA 4TROA 2ZTUA 2VWQA 5TIIA 3TSCA 2GRAA 3JYPA 1K6IA 4R1TA 4Z0TA 1RM0A 1EK5A 3A28A 1MFZA 1LUAA 3KEQA 1FXSA 3AI1A 3PYLA 1E6UA 3JD4A 3TL3A 3FR8A 4HP8A 4XGNA 3VPGA 4BO3A 4EZBA 2ZQZA 4F6LA 4BS9A 1R66A 3KZVA 1E1KA 4BNNA 1ZVMA 3GNQA 1AE1A 5BSEA 3U62A 4YT5A 2DPGA 5K6AC 5C3MA 2W2LA 1DIHA 4NG5A 5IF3A 3IC5A 3GRKA 5CEJA 1U3UA 1DDOA 2QHXA 3QWBA 4ND2A 2CFCA 2R00A 2UAGA 1PZHA 2ZB8A 3G0OA 2AEFA 2EHDA 2OL4A 2OMEA 1LSUA 1B8VA 1R4MA 2GR9A 3G1UA 2EJVA 2CUKA 4F6CA 4GX0A 4O0LA 4IDBA 2J5KA 4NZ9A 5JC8A 1ZCJA 3L9WA 3WMWA 3RUEA 3ULKA 2WD7A 3ZHBA 4DXHA 4EW6A 4RPHA 1OFGA 4W9NA 3AJRA 4YPOA 3MOIA 4RF2A 2P9EA 4R1NA 1YL5A 1NXQA 1E7RA 2X7HA 3NX4A 1WWKA 4LGVA 1KC3A 4B4WA 1BTOA 2JFHA 4E12A 1T4DA 2FWMX 5I7VA 1DC4A 3NT2A 4ZD6A 5COBA 2B5WA 2PWZA 3W4KA 2DPHA 1YJ8A 5MDHA 2TMDA 3QVXA 5KVCA 1LRJA 5TRTA 1NHWA 3C8MA 1O8CA 1QYDA 2YDYA 2EGGA 5CP8A 4OYRA 3OEYA 4KTTE 3WLFA 1S7CA 4MVJF 3LLSA 1LDGA 4JJFA 2P5YA 2O2SA 1LLDA 3PJDA 4J1SA 1HF3A 1PR9A 4I9NA 1O6ZA 1UR5A 4NBWA 1HYEA 3VH3A 1Y1PA 1ZXBA 5TJ9A 1GU7A 3WYBA 1PGQA 3H2SA 1SC6A 4I1IA 2Y1FA 4GX2A 5I7FA 1H6AA 2O7QA 1GUYA 4NK5A 4TVOA 1Z73A 1IB6A 5DN9A 4BGVA 1R37A 1ISFA 3GEDA 1VL6A 4BGEA 3UF0A 3L07A 3U4IA 4NBRA 3AM5A 3IJRA 4RF3A 1R0SA 3RKRA 4BO6A 2Q50A 3PFWO 2WD7B 4QSMA 1SBYA 4R54A 3EAGA 2CSUA 3H5NA 5TX7A 3SJUA 5KVQA 1PJBA 1XWFA 4CQLB 1NWCA 1WW8A 1V8BA 2VRBA 4UUOA 2LDXA 1FDTA 1BXGB 1C0KA 1WAMA 4BNVA 2FSVA 2Q46A 2GLXA 4MVJM 4KQXA 4JQCA 1ZFNA 5JPIA 3JQDA 1PQPA 1A7AA 2X0NA 3DHEA 5LDHA 4G2NA 1GQYA 3RC7A 2ZATA 4G65A 5TT0A 4K26A 4BO9A 1EVIA 3CH6A 2GZ3A 2JD2A 4GI2A 1I3NA 4NQZA 3PQEA 4MPDA 4IQ0A 3V1UA 3DBRB 4WASA 3EYWA 4GWKA 1BMDA 4IXWA 2YHIA 5BSGA 1K2WA 3GDOA 4UVEA 5I7EA 4DC1A 5EPOA 4GMFA 2YDXA 3DQPA 1SMKA 4OXYA 1UDAA 5F1PA 5THKA 3RUAA 1B15A 2X8LA 5FYDA 3WMXA 2W90A 4AJJA 1SAYA 3ABIA 5ITWA 3WNVA 2CMDA 3GDFA 2OGUA 4DPKA 2DM6A 2GDZA 4II3A 4B8WA 3HDHA 1AUPA 2ZIZA 7MDHA 4BNIA 3QP9A 3I4CA 5B4TA 2EXXA 3E82A 4R5HA 1ZJZA 4DL9A 3H9GA 4FR5A 1U1IA 3IKVA 1Q1NA 1E1NA 1WVGA 4F46A 1I8TA 2BKAA 1QSGA 4JK3A 4HFMA 5TLSA 1NFQA 4MOWA 2NU7A 5EJ2A 2HSDA 4AJPA 1AXEA 1ULUA 2WE8A 2ZCUA 4I9HA 3DZIA 2Q3EA 5G4KA 4IPTA 4XRRA 1I10A 1VSUA 4TRMA 3U3XA 3VAZA 5B1YA 1WP4A 1HEUA 2PFGA 3RROA 2P2SA 4GGOA 5L40A 5GZ3A 2PZMA 3MWDB 3ZU2A 4BKOA 2VT3A 3ZU5A 1YXMA 2UYYA 1PGOA 4CMHA 3PDJA 4B7UA 3P2OA 2IDZA 5L4NA 1ZIDA 1NWHA 4XIJA 3ZN2A 4R3WA 1HTBA 3NDIA 2VCYA 3N58A 5TJHA 3TN7A 2NLOA 2EW2A 4YEDA 4CMKA 3FTPA 1E7QA 3QHAA 2PH5A 3PJEA 3WX0A 4I5GA 4KMSA 1MV8A 3GVCA 1XLTA 2RCYA 4CM3A 1QLJA 5AOVA 2BFAA 1TA4A 1B16A 3I9LA 3TZKA 1Q0HA 2A92A 2C2YA 3JQEA 3LVFO 3PGXA 1XQ1A 4PLCA 3D0OA 2GD1O 3ONDA 4E32A 1U7HA 4PLZA 3W4IA 1XCBA 2ZKLA 1D4FA 1QYXA 5CG1A 1OI7A 1LRKA 1M6WA 3GK3A 3UXYA 4CLXA 2X5KO 2ET6A 1U28A 4R41A 4OKNA 2EG9A 3BXXA 4GQAA 1N5DA 3CXRA 3H3FA 1RM3A 1DIGA 1RYDA 3GUYA 2JD0A 3H65A 2NQ8A 3KEOA 1U8XX 2X9NA 1YOVA 4H16A 1E3IA 1O89A 4JCOA 5G4KB 1PGNA 1F0YA 1LNQA 2UV8A 2BRUA 1I01A 5HA5A 1GZ6A 1KVSA 3K5PA 3JQ9A 3BHJA 3BTVA 1G6KA 5JBIA 1UUFA 2XOXA 2HK9A 4J4BA 5HM8A 2POQX 4ZHSA 3O03A 4GSKA 4DYDA 2J3HA 2PD6A 3WB9A 2Q4BA 5IXSA 3L0DA 4DBZA 5I9MA 4L74A 3G3EA 3SEFA 4TKLA 2GSDA 2JCVA 2Y99A 3RUCA 4NFYA 1P9LA 4BGIA 1V0JA 1WXDA 4CQMA 1QYVA 2JHFA 4PLVA 3WS7A 3OA0A 4E21A 3AUAA 5BSHA 1MXHA 4IQGA 3NAQA 4GKBA 4GMGA 4UVDA 5JAIA 2FZWA 1CDOA 3G17A 1L7DA 2EERA 2PR2A 3NUGA 1IPEA 1IE3A 3OQBA 4YVFA 4CL3A 5EMHA 4ZN6A 2JCXA 2O3RA 4NJMB 4MINA 1AN9A 2X58A 4QO7A 3GFGA 2PTGA 1SO8A 4HX5A 4Q3CA 1YB4A 1B8UA 3L4BC 4AJEA 5A3JA 5ER6A 5JCXA 2HUNA 5EIOA 1ZBQA 4TZTA 1KVRA 5KNLA 1YOVB 1FMCA 3GN1A 3KYDB 3T4XA 4Y67A 4XWYA 1B2LA 2C54A 1P33A 3KVOA 4CMAA 4U8GA 4CUJA 2B37A 3QVTA 2EKLA 5DP1A 4W99A 4RVHA 1IPFA 3ZCXA 2X5OA 3QVOA 1W6UA 3IL2A 2NVUA 4J90A 3F47A 2WTBA 1ZK2A 3FD8A 3HDYA 5DZSA 5L7TA 4HWKA 1DAPA 3M6IA 3WJAA 3RWBA 1PZGA 3T4EA 1EEHA 3EDMA 2HMSA 3L6EA 5LDGA 3GVIA 3F1LA 3U5TA 5A1TA 4I8XA 3STHA 1KEPA 3FR7A 3IKTA 3Q1LA 4UVHA 4F3YA 3ZNNA 2AQIA 8ADHA 3E5MA 1ISIA 3GEGA 4W82A 1LDYA 1ID1A 3ASUA 2BELA 4QXMA 5HRUA 5ADHA 4XX0A 3A06A 3DZHA 2DVMA 1PJ4A 3NDRA 1MC4A 2J5QA 2W4QA 3EZLA 2VZ8A 1A5ZA 4OKIA 4W7HA 2DUUA 5GZ6A 2HK8A 1NAHA 4RCVA 1KY5A 1OOEA 1KYQA 2H6EA 2ZB4A 2W98A 3ETDA 4CM4A 1G1AA 1IOLA 3GVPA 1GZ3A 1J49A 3C1TA 4FOSA 3UVEA 1ADFA 4IGFA 4CODB 1BVUA 4CM7A 4AVYA 1U3TA 5EERA 4WJZA 4YTEA 4AJIA 1UP6A 4JBHA 1X13A 1B3BA 4NIMA 1PWZA 5CPBA 4NR0A 4BO4A 2VUUA 2DTXA 4MVJA 3C24A 2NVUB 4LK3A 1LC3A 2VRCD 1E7SA 3BMCB 4XB1A 1TEHA 4PRKA 3RI3A 2EP7A 4XR9A 1V3TA 3WSWA 1X7HA 5CHEA 4PLWA 2P4QA 1UDBA 2QRKA 4RLSA 4RGBA 1JQBA 2YV2A 3F3SA 3RIHA 3DHNA 3PZBA 3HUDA 4IGEA 3VZPA 4XEHA 2HQ1A 4XD2A 1YBVA 5A06A 4PLYA 7ADHA 2AG5A 1PSDA 3DEYX 1XYGA 1CF2O 2WM3A 5F1OA 1MP0A 4BNHA 4N5LA 4FGWA 1Y81A 1HLPA 4JBGA 1DFIA 1YH3A 3W4JA 1U3WA 5DULA 5AXAA 1M2WA 3OM9A 1LU9A 4ZVVA 2X4GA 2QYSA 3Q11A 3VKUA 3I9JA 3GMDA 3KYBA 2OP0A 1TLTA 1IZ0A 5JMPA 3HB4X 4IZIA 5ICSA 3LT2A 4DMMA 2FSSA 1ONPA 3GQVA 1VLLA 1B0AA 2NSDA 5JO0A 1MXFA 4UAGA 4HUJA 3WTBA 2NU9A 1X0XA 4CLEA 3DO5A 4E31A 2FY8A 3UH1A 3WYCA 5K6AA 2HO5A 2ZB3A 4OOFA 4RPLA 2X6TA 1BDBA 1Z7EA 1GTMA 3DC2A 4YACA 1GCOA 1Y8RA 5JYEA 3SC6A 3IMFA 3HZZA 2A94A 1N7GA 3RUDA 5JDIA 3JQFC 1D1SA 1E5QA 3IDSA 1CIVA 1V35A 3JQ7A 2QX7A 1HE5A 3KBOA 3WYEA 1QLHA 1NPYA 4J1TA 4CLHA 1CYDA 4PZCA 1X15A 4MIEA 4Q3AA 1FJHA 5L45A 2X5JO 4HBGA 4WCFA 3OF2A 5ENVA 4RDHA 1XG5A 4J0EA 4LMRA 2WDZA 2IEBA 3GPDG 2G5CA 2NVBA 1RYEA 1NPDA 2WYWA 4J4TA 1G0NA 1QORA 5EINA 1G0OA 2D5CA 1ORRA 4OGWA 4YR9A 1PL6A 4NH4A 4UVGA 3INRA 1FDUA 2R6JA 3B20A 5TQVA 5CEEA 1ZK3A 1KEWA 2A4KA 2JD1A 2C5AA 4YWJA 3DL2A 4YJDA 3ZWVA 5IN4A 1E3WA 2YY7A 3K8ZA 3PYMA 3JQBC 4EJ0A 4RJTA 1HE4A 3F1KA 2W2KB 3AU8A 4INAA 5FFFA 3OP4A 4TSKA
chains in the Genus database with same CATH superfamily
4MW1A 5HEKA 4BNGA 3E8MA 3EN0A 1L4HA 4WK6A 1VCOA 5FWYB 1N0VC 1GZ5A 1AS3A 4ALMA 1FJXA 4A8JB 4XPIB 4EJMA 2CV1A 3TUJC 1GYPA 3I01A 1FU7A 4P4GA 1Q0TA 1GNVA 3ZWMA 5GV7A 3K0FA 3AXSA 4DLRA 1G8AA 2P5TB 1P7VA 2QM8A 3GGOA 3NC0C 1WE2A 1G5FA 3AL2A 3I2KA 2JKYA 1IY1A 4KIFA 3TCNA 5M5BA 1TVKA 3LDAA 4B3JA 3BJZA 2PV7A 3LKVA 3QUQA 4UDOA 2B3DA 5CLLA 3N9IA 1TQ4A 4UBJA 5DIZA 5HCIA 3UFXB 1KYZA 3WLIA 4BLQA 5KYNA 4KWIA 3PPVA 5FV7A 2BGKA 4IIEA 4PCVA 5IABA 4XYEA 4DE5A 2WYHA 5TARA 1ULSA 1GILA 2VDLB 2F90A 2SKDA 3RFFA 5JLJA 4G37A 3VYRB 3ETEA 2A9KA 3WWDA 1OWMA 1ZZGA 4AN4A 1NR7A 2JI4A 4UFOA 4CPDA 1NUTA 2P9FA 1KMCA 1A2BA 2NWQA 4PYKA 3ACCA 3EXHC 3N7AA 4M0KA 4DQXA 4FM9A 3K6KA 3UMGA 1E1RD 2F59A 3UUEA 4L7QA 4KQ9A 2RDMA 1K5HA 1XYVA 2CCKA 2ZBRA 5E1DA 2X42A 2OCLA 3N70A 1WCIA 3BSWA 1I4EB 2QAGA 2RGXA 3HN2A 2ZTVA 4KXFB 4EJFA 3EARA 3RRBA 3IAM1 3TGLA 1M8JA 4KDRA 3MINB 1CJTC 3DFKA 4UTPA 1KGSA 2P9CA 2R8XA 4LY3A 2VNKA 2Y1OA 2QM7A 3N8GA 5D3MA 3GLHA 1G66A 1IH8A 2WWTA 5BSWA 4JKOA 1JTFA 1C3EA 1XTKA 1LBSA 3KEMA 3EMVA 4G5FA 4YYEA 3ZWKA 4RZQA 3N6XA 2C7OA 3KJFA 1M67A 3LSYA 1KOLA 3G9ZA 4MICA 1MAUA 2ZJ3A 3FBWA 2WU3A 4BAGA 1YI0A 2H2WA 1AQJA 3RU3A 4UNIA 5C1PA 1A04A 1P45A 1NURA 5AM3A 2R7KA 1IVSA 1M83A 2LXNA 1RIFA 3FTCA 1VHTA 3JWJA 4DUGD 4MYDA 1XMQB 4Y7DA 2H4WA 3RBVA 1I2DA 1Z3IX 2G1UA 5B1DA 1ZK0A 4D92A 4IF4A 1QP7A 1BU5A 2A0KA 4UEQA 5M29A 2JJYA 1DEOA 4IVQA 3HU1A 3IMCA 5JQGB 3A3PA 3RVKA 4DUYB 3V3TA 3B6ZA 4JYZA 1MENA 1QUFA 1DOZA 2E4AA 2IT1A 3TAXA 1HA3A 3RANA 3EHEA 1LQTA 2BN4A 4WK2B 5CBPB 4TTQA 5T6MA 3IEIA 4NYIQ 2R2GA 2Z04A 3R6LA 1B8PA 3T1HB 1E6KA 1L5WA 1EWRA 2QN1A 1E1LA 4A7PA 3FJ1A 4CUZA 2R97A 2H1CA 3TXYA 2XZDA 4G5QA 4IFIA 1HNWB 2ESRA 3T7RA 1FUEA 2QPAA 3IAFA 1JNXX 1NNUA 3ZE0B 5A62A 1M5TA 3SP1A 1YS4A 5JW6A 1ADBA 4BV2A 1YR7A 3WWOA 4DLAA 1NQTA 3M5DA 3M3DA 4KGVA 5IAKA 3VSEA 4TZ0A 3ZW7A 2ODBA 2CZCA 1S2NA 4A2PA 4KK3A 3PEWA 1OC4A 3RODA 1EDBA 2JGJA 4GR9A 4IWNA 5BUSA 2OOSA 1ENYA 1ZMOA 4K5QA 3NJRA 4EUNA 2WF9A 4FOOA 4JH0A 3LGSA 1ZMTA 3SJBA 2VTVA 3MWEB 4UNQA 4BNDB 1YE3A 1Y8ZA 1ISHA 1VSTA 1SM4A 2WJHA 2A30A 3TLJA 2ZSEA 4ARZB 1GPMA 3T52A 3GA5A 2VAXA 4B09A 4V1CA 2OCBA 3JQ6A 5INTA 1J8YF 2RBGA 4QHTA 5AICA 5A9RA 1H9AA 1M34A 3H11A 1XTQA 2AOVA 3CZ4A 5EJ9A 1U11A 3L3BA 1C14A 2HWKA 2ZI4A 4KXVA 4LCBA 1YASA 2FUG6 1HK7A 5E38A 3H9EO 2W6ID 5FDFA 4J0CA 4Z4GA 1T3HA 4M7PA 4XCVA 4Q16A 3KZOA 3FLBA 2BEVA 3OTOB 3WNZA 5TF4A 4Y2TA 1M8PA 1B0ZA 1R4NB 4Z49A 2C03A 1XMIA 2ZM5A 1AGRA 1SQ5A 4C4OA 4OG2A 1CJKC 3VDMA 3PXXA 2BDTA 3QMWA 1Z5PA 1K89A 4YRMA 3GLTA 3MMZA 4Z4EA 1L9XA 2ZVDA 2Z2XA 3N76A 4Y9SA 1Y98A 4NBLA 1TM2A 2KE5A 4UEKA 2IPAB 3VHRA 5IKXA 4G8BA 4Y9TA 2J7KA 3VFDA 3ROQA 5CURA 5K0CA 4F96A 3HXKA 3FYUA 1FOEB 2G25A 3HS3A 3UEOA 3WDMA 2WZCA 3ACBA 3ZV6A 4AUMA 5JI3E 3AW9A 3SX2A 4G07A 1KDTA 2QL6A 1BS1A 1V1RB 3HCCA 4BVEA 1BG6A 4CQLA 1H9CA 1EQUA 3JZFA 3URMA 1L8AA 5A03A 2O3QA 1BXGA 4Y6LA 5JXHA 2XT6A 3KX2A 1D6JA 3W3AH 4EARA 2FKNA 4EK9A 4X3OA 4LF9B 2X9LA 2J67A 2IITA 2B5OA 4AI6A 2H59A 3NHYA 1OPXA 4G9GA 1DV1A 1MX9A 4PYOA 2QGFA 4XJSA 1SVOA 3GLFB 1O94A 2FQXA 1BYUA 1G5QA 1GTVA 2VN8A 2K87A 3MUEA 4Y0AA 4D46A 3FPLA 5ITZA 2HT6A 4MYSA 4ARSA 3OQ6A 5DI3B 3I58A 4JC8A 3GCXA 1Z2EA 4EKYA 3IQZA 2JJMA 3O93A 5I7HA 3CUSA 3K09C 4MP6A 1JHZA 2DQYA 3OIUA 3QWIA 4K88A 5DXJA 3X1KA 3HRKA 1UMBB 3PDUA 5AKXA 5TGTA 3A9WA 5FTKA 4B3HA 2GQ0A 1G4AE 3LX6A 4RFSB 3ZLBA 1VJRA 4JVOA 5DTQA 4JYPA 2AG1A 1E2IA 1H2HA 2P6UA 2BJWA 5H59A 3GGJA 1CUZA 4LQCA 1C4OA 5K3CA 5KTMA 2XJ4A 2QT0A 4A10A 3RDPA 2QMEA 4P6VF 1TZCA 4BYGA 1LV8A 2HMAA 3HTXA 1C3OA 4OP2A 1GXSA 5DLEA 1D0VA 2BM8A 3THYA 4JP3A 4YIHA 2WJGA 3BK2A 3I6MA 1ZH8A 2VATA 1KOGA 4F2HA 2WHYA 3N59A 1F2TB 4CKEA 1DKLA 3GYBA 1SURA 2C94A 2J3QA 4LXYA 1NM5C 2FEOA 5IM4F 2WE7A 2XH8A 2DKOA 2P7HA 3DAGA 4LY9A 3QLJA 4OH7A 5LB4A 1QVVA 4YCCA 3SYMA 4WA7A 3PGKA 2KQUA 3VTZA 3I2IA 4N8SA 1E77A 2IYSA 2NXJA 3A1CA 4L27A 2ZG6A 2ZWIA 1PN3A 5JH7F 2WYOA 5JE8A 5JD3A 1X86B 3EVAA 2DP4E 3FKQA 1I2AA 1JL3A 1G98A 1T2AA 2NTVA 3PV0A 4OHVA 5EUCA 1ZDMA 3U4CA 2HW8A 1PQYA 3GFPA 2QRLA 1CLEA 3PUYA 3OLQA 3C0KA 4GNKA 1L5ZA 2XVXA 4KODA 4NS1A 1G2PA 2FHSA 3OZXA 4JLWA 3T3MB 4CM1A 4KWCA 1QJCA 4YRBA 4YRLA 1JV2B 2HUPA 4ND8B 2P6PA 1DSSG 3UO8B 4CM8B 4N65A 4HFNA 2P91A 1ZGJA 3I6ZA 4H27A 4QRHA 3N2EA 3ELUA 3EXFA 1H8ED 4GBJA 4U7TB 3ODPA 3RSCA 4COOA 1NA5A 2Q6OA 1XHFA 1Q74A 1R6UA 2EW8A 2EWWA 4C4PA 2J0UA 2D5IA 2HMWA 1ST3A 1LLFA 2WT8A 5EESA 3JD3A 2XQJA 5CM8B 4UHHA 1PSZA 4OGKA 2VIIA 4HFJA 4B43A 5EFZA 1JG1A 4F21A 2A0UA 1NAIA 2GJAA 2H3HA 1K7CA 9ATCA 1QO0D 5E3JA 4IGIA 4J0IA 3ISVA 4XM2A 3VOAA 4IDFA 4M1EA 1R0KA 3AT1A 3CBQA 3R7WB 1JPVA 4DHWA 3HGQA 1FYXA 1Z82A 4OHBA 4N7BA 3T5AA 1GKIA 1NBOA 1GY8A 1QCDA 3KKPA 1B14A 1UAGA 2IZ7A 2H0QA 3BIWA 5DM4A 1E63A 1G5HA 1XDZA 4I99A 5K0NA 2MYPA 2XTZA 3FDIA 1IHYA 2FRDC 4WLUA 3ETJA 1E79D 1W581 2O8VA 4F5DA 1P80A 2X9GA 3D2BA 4IWYA 3V33A 1PIWA 5G40A 4L5BA 3EF1A 2W2NA 2MMGA 1Q1EA 3BCRA 2JGKA 3RS9A 3VQTA 2J85A 4AO6A 4B9EA 1VHWA 2HTFA 5FWXB 4RF4A 3SZRA 1E1YA 5TQ0B 2AE2A 3AOEC 3W6UA 5B6JA 1X92A 3VYSB 1ZAYA 4GKKB 2UYHA 2Q8PA 3T6KA 2JW5A 1A9TA 2YHUA 3FMVA 5K6TA 3A10A 2FEKA 4DQ0A 1JPUA 1VG9B 3D2LA 5B64A 1YTLA 2V6GA 1SD1A 3GEIA 2EZUA 1A9SA 1QGUA 2PUEA 1RKVA 2PAFA 1ZINA 3UGTA 2ZRNA 4FIZA 4MNTA 1IHUA 3GLQA 4MUJA 1IYZA 4M0FA 5AM1A 4M7OA 3K0SA 2C82A 1JHRA 3TNYA 5LJLA 4FXOA 1CETA 2OXCA 2XX3A 3HCAA 3OCVA 4EYKA 4DXAA 3NAMA 4UBIA 4EB0A 1P2GA 1OI4A 2QVBA 1TW2A 2N46A 3QRWA 1D6NA 1KQ3A 3FCCA 4XYMA 2GPTA 3A27A 1RQGA 3TZEA 5JIBA 2AEMA 3C6BA 3Q10A 1R0YA 1V9LA 5GM1A 3D3KA 1YF3A 4JL8A 3NH9A 4FEYA 4FDTA 2QLTA 1RI1A 4ZARA 2Q4RA 1Z4QA 2AI1A 2PS3A 3OJXA 3UB3A 3KXIA 1ZNZA 1PQWA 1BGWA 1DRKA 3QNMA 3V9AA 4EHJA 3CX3A 2BHLA 5FEUA 4X65B 1EXDA 4WN9B 3QWFA 3DYVA 4L95C 5DNUA 1G3RA 2BUCA 1OH7A 3PKZA 3ANMA 2OZPA 3C7DB 4RS3A 4E88A 5JASA 5EWMB 4HS9A 3K8QA 3L6OO 4RD2A 1SCIA 4J94A 2YN0A 3KALA 4OL9A 5ESDA 3VDNB 1PG0A 2IS1A 2K7FA 1FQKA 1SWWA 2O3SA 1SU8A 3PQFA 1NOJA 2BL4A 4DEVA 4YPVA 1ZGHA 3IJEB 5AXDA 1P1CA 2RG7A 2XF8A 2RH8A 3NHJA 4P7FA 5HKKD 2AR0A 4XGIA 2GN8A 4N6NA 5JSZB 1AXGA 3FZNA 1Z2DA 4FFVA 3D0KA 4FD3A 4BN4A 1TF2A 1YCDA 3AHJA 2WP0A 5IANA 4JT9A 5EXSA 4YUAA 1F2VA 4PU0A 4CLOB 5KTKA 2RD2A 3DLBA 3IB6A 4AJOA 2YFHA 2ODPA 5CVJA 5DBHX 1DV2A 1PYGA 2AC2A 4KEAA 4UHCA 1NLYA 3RARA 5K2OA 5ECYA 3NB0A 4MWOA 4TVSA 1NXTA 2XGSA 4PN3A 3F4KA 3VVCA 3CLRD 3A4TA 2VT2A 3E9QA 3WYDA 9ABPA 1A8UA 2QTFA 1E1CB 2I1VB 2H1FA 4HX2A 5BW8A 1OX4A 3ZKWB 3SG0A 1YZVA 3LUKA 1RXUA 4RZUA 3BXHA 5L6MB 3CJQA 2ZTSA 4B4VA 5IMSA 1Q7BA 3FNIA 2GPSA 4REQB 5FOVA 1UT5A 2CYBA 5LMZA 2GVZC 1II0A 1ITZA 4WXHA 5TXGA 4LX0A 4DCUA 4BLWA 2BH2A 2Q1SA 1ILWA 2A2ZA 1T8SA 5FJJA 4ZYVA 1VLJA 1CQZA 1TTQB 1NMXA 3IALA 3RUFA 1W85A 3ME5A 1FFAA 1SKBA 2P27A 2QRVA 1QGED 3OPXA 2I29A 1WBJB 2I9PA 3IKJA 5HWSA 4CLRB 4YRKA 2BMEA 3L0PA 4MW9A 4NHOA 2V7XA 3PQ8A 1TZBA 2DR0A 3OTIA 3D5TA 3RKSA 2F8SA 5DNCA 3QKWA 4RLHA 4A15A 2I6UA 3SXJA 3CHYA 3ZOZA 3V1MA 4IUYA 3EPHA 2OBMA 1XKQA 1SFRA 1IQUA 1Y4DE 4MIKA 4FEAA 4JLBA 3PJRA 1VECA 1IJKA 1HMYA 3GBPA 1AM4D 3K5HA 3C5VA 5ERYA 3AKCA 2FWIA 3CISA 4E22A 2EJTA 2I22A 4HQFA 4MPJA 1SVIA 3G9TA 2FFJA 1CZRA 2ZAIA 2XMPA 2E1PA 3ICCA 3OCCA 1ULTA 2EFCB 4DLSA 2O8BB 1ORVA 2Y6VA 1OXSC 1E60A 1N6LA 1UZNA 5HJEA 3USES 3ICQB 4DPLA 4DMRA 2O8EB 3UMBA 4Q4CA 1GNLA 1CDZA 2ACVA 4ENWA 1UFOA 3O83A 2Q5CA 3GLVA 3P1JA 2PLRA 4ZHQA 2ZZNA 2CLKB 2JHGA 4ZYTA 4B5KA 2NYAA 2K2WA 2EIXA 1WO8A 4R8SA 2GKGA 1J1UA 1SC9A 3E61A 4IH4A 4ZJUA 1GRCA 3UC9A 1L4FA 1N6KA 4JODA 3F9CA 3DJFA 3O90A 1T91A 4ICIA 1I14A 2L18A 2VG8A 4JSRA 3WL3A 3A2LA 3VTKA 2IDMA 4MWDA 3QBVA 4KMMA 4QKQA 1V8OA 1NJGA 2OUKA 3WJ1A 5EQFA 4DT1A 1WMDA 2X8JA 2IY8A 3VNBA 5FLYA 1YUNA 4R8MA 3LQYA 4TV9A 2OY0A 3ZW9A 2AN1A 1M6NA 1K6EA 4M1OA 4R1OA 4DW8A 3FNRA 4BV3A 4TZKA 4EUSA 1NBME 4JKIA 4DBVO 2XZTA 3EEIA 4LZZA 4TTVA 1PZFA 1P39A 4GLOA 1SBIA 1NMEA 2Q21A 1SCQA 3H1PA 4JR0A 5BUCA 2HU2A 3QK7A 2AC4A 4UHKA 4Y3UA 1RI3A 2P9JA 3WGKA 2AOUB 5JDCA 4ECAA 1JDBC 3N0XA 2J3LA 5EKXA 2OG1A 3ZNPA 4LHYA 4ZEMA 4NVRA 4X8HA 2HPZA 3KV1A 3IUBA 2C9OA 2CVHA 4N40A 1G5IA 5HBGA 1XZIA 4M49A 1FNNA 2XCUA 3NYWA 3HXTA 3CT6A 1WUHS 3LYAA 1YMVA 2DECA 3P9YA 3D6NB 2XYPA 5AWFC 4BFVA 3M49A 5L4LA 3OJWA 1I1QB 4J0FA 3K0KA 1OBOA 3HJNA 3PPIA 4RO0A 2UXDB 3BB4A 4PQEA 4QPZA 1U8ZA 2X7XA 4D9KA 1O97D 5KWVA 1A7KA 4H6WA 5KKCA 2ZQ5A 1J2JA 4EZEA 1KZGB 5C7LO 1NYRA 3V4SA 2EZ9A 4WXEA 2ZRMA 5U1PA 3WHPA 4X7RA 2AKAB 4XR4A 3V9PA 1MPTA 1CRZA 2O4CA 5BW4A 4I6JA 3IOCA 1G20A 2ZWVA 4KG7A 4PR3A 2F1OA 2BTQB 3KT3A 5HILA 5KHAA 4RFLA 3ZDCA 3EVZA 1FVHA 3I64A 5AP9A 1YHYA 2Q28A 1B73A 2XECA 1IATA 2V0CA 1HY3A 1O03A 3B5EA 3IIEA 3EQ9A 4J7XA 3NORA 1W5FA 2J9GA 4E94A 3CX6A 2YWCA 4HAUA 4D5EA 4DMLA 4L6IA 3EA0A 4OXQA 4CTOA 4LGMA 1XVAA 4CQNA 2WM8A 4ML3A 3VI4B 3MAAC 3KL2A 4GS5A 1J6UA 1DRWA 1TVMA 2WU0A 3JVUA 3RSHA 1XYYA 4CL8A 1WSBA 1EUYA 1PKEA 4EVSA 4EG7A 2BFFA 1LVGA 2VBGA 1I6LA 3LY9A 2GZAA 2HLDD 1BRMA 3U9TA 4BVFA 2YYZA 1MIHA 3R7AA 2JGIA 3WZMA 1H2EA 3DBLB 1UF9A 4QBTA 1QKJA 1SC4A 1TD1A 1BX1A 4GPD1 1KZ4A 2B69A 3KUDA 2PWAA 4Y2XA 4B40A 1OXUA 2JG3A 4TLAA 2WJZB 4FZ3A 1JHPA 4YJ3F 4QZVA 2ECOA 3ZJVA 2QGNA 4RVOA 1C3VA 3MHTA 3VC2A 1Z2PX 2DBVO 4RD3A 3ZQ4A 4ER5A 3NEPX 3ZVRA 1KWKA 1MB9A 2C77A 1JQDA 3BORA 3OE4A 4Q7EA 2ODAA 1RWBA 1U1CA 2C2KA 3NXKA 3A05A 3I9KA 2W00A 4ER6A 1DKNA 2WIDA 4CDGA 1UBLS 1B1AA 2H4JA 3DGEC 2GEFA 4XASA 5T4BA 2M32A 1DO8A 5CDTA 5T3UA 3WWCA 3A36A 3SU8A 1ODTC 3ZGYA 4DR3B 3IKMB 3OHPA 1CJCA 2YWJA 2PJZA 4PZZA 2XR1A 4ZCSA 1ZH0A 2GHIA 1YZUA 5AVJA 1YWGO 3WB1A 1YB6A 1H2AS 1X1TA 1EKXA 1XZJA 2ZYWX 1VMEA 1GA1A 2GN4A 4U02A 2HF2A 4R68A 1MOSA 1KO1A 1P0FA 1HSOA 2V9PA 5ALMA 3CH7A 1YR9A 2FV8A 2NXCA 3G2LA 1SD2A 4OAOA 5JH7B 1D03A 1YIAA 3NPAA 3KLBA 3OBIA 2NUAB 2KX7A 4GZLA 5B1HA 2CD9A 1ZJ4A 3FOFC 1K66A 4PTYA 4DKXA 4E70A 2GN9A 1XKXA 3O3CA 3STVA 3B1WA 2FE4A 1SUBA 4QDTA 4EKNB 1I0LA 1LI7A 1F06A 2E37A 3T9FA 3K09A 4LW8A 3PQ2A 3BHMA 2H51A 3V8RA 2DKFA 1SCDA 4D0LB 1ZRNA 1Q1QA 3L92A 3BQMB 1XNHA 3N7UA 1UBJS 4KC0A 1JB1A 4PX5A 1ZJ5A 3C1OA 2C0CA 3ECAA 3IT2A 1A97A 2VTBA 4Y1RA 3R3ZA 3UV6A 4G0UA 2PEZA 1CY1A 4QG7A 4LTDA 1ZO8A 3A25A 4GVXA 1ZHHA 4HDNA 3QEKA 4Q4AA 3HQ4O 2WWVD 3OEED 3EW7A 3PENA 3PXBA 4M22A 2Y92A 2JFZA 1Z0UA 4HUTA 1HZZC 2O3JA 4MCIA 4WLFA 3IBFA 2BI8A 2IU4A 3BAZA 4C3VA 1PS0A 1I4TD 1O6CA 1JDZA 1NKVA 3K0AA 2VP4A 3PZRA 4MJLA 2Z8ZA 1XOIA 4NMMA 4PYIA 5A0FA 5HQJA 5KYYA 5ADWA 1G18A 3INYA 4G81A 4CWAA 1FMLA 1NM5A 3AY6A 1BCSA 3EDQA 3TH5A 2RAFA 3DWFA 5DGDA 1M6VB 2G9RA 1YACA 1EGAA 3F0TA 5K3FA 1HKHA 3ZY5A 2FW0A 1L6IA 2ZUDA 4U2BA 4JLOA 5MGBA 4XYLA 1SXQA 2OV8A 5LMCA 4WXRA 3BBLA 3PSAA 4G97A 3OZIA 5A3RA 2PVPA 1BROA 3PWSA 4GM1A 1YR8A 2DUJA 4NZMA 1KMNA 2HJGA 3P19A 3ZY6A 1QX4A 4B3MB 1TVCA 1Z39A 1QHSA 3CR7A 4WBNF 5IVPA 5B12A 4G5SA 2GNPA 1L7PA 3IAEA 4N0PA 1KVUA 2IUEA 1DJPA 2GBGA 1E2NA 2RH4A 3BWVA 1U2QA 2GCOB 3BCSA 5L3QB 2NADA 1QQ5A 1SOWA 2IHKA 121PA 2QR3A 3AM1A 2FHPA 5LA6A 4LDPA 4YCBA 1M2VA 2GEVA 5EJ7A 2XKAA 1SCUA 1UZUA 2FVYA 3GFRA 3MHPA 4KJXA 4K9KA 1C9NA 1GRNA 1U3GA 2CL7X 2FK8A 3NAGA 1U2SA 3HN7A 4DC0A 1O1YA 4CIAA 3JALA 2PYDA 4FC7A 4ARAA 4LMPA 1VZ2A 2BZ0A 1O87A 2CMHA 4E5MA 4A3SA 2YFKA 3SC2A 3SMVA 1Y34E 3UK2A 1YZKA 2CCJA 2VFAA 1X9IA 3LOPA 1P74A 3LUDA 2ZSHA 5JHHB 1QFXA 1GA6A 1IY2A 5AUNB 2WK1A 4PG6A 2HF7A 3A0UA 4HSGA 2C4MA 1OILA 3G2NA 2Q99A 3PQCA 5CCXA 2Z5LA 1DQNA 3WK7A 3CT4A 5J1SB 2TSYB 5I7UA 2EOAA 2ZI6A 2J08A 2CXSA 1QHGA 3C48A 3RFUA 5DMHA 1VG0B 2DFVA 4P34A 3HSKA 3KVNA 1BGVA 3OZVA 1OXKB 2BFNA 2IELA 3E1SA 4G1VA 3PLAE 4WESA 3T06B 4F4IA 1DEHA 2YWGA 5CFZA 2NP6A 1JG3A 3NM6B 2BFOA 3AOEA 2OV2A 5A4FS 4A2CA 2X1LA 4QRDA 2FRVA 5DEOA 5BV1A 4F3TA 1I4WA 4RA9A 2VKTA 3AY7A 3AM3A 3KJXA 4HY3A 4F5WA 1QOPB 1PEAA 2C4UA 3C98A 3MBIA 2UVPB 2CDBA 3ELDA 4DB4A 1QRRA 5K8TA 1N92A 2C97A 1LTKA 1UBEA 4PQFA 2AYYA 2F9LA 1CDDA 3PCTA 1L5LA 1M2NA 2C98A 3L8MA 2Q4EA 3T7IA 2Y68A 3GD7A 5JCJA 1J23A 2XCSB 3E9CA 1J4AA 3CKMA 2LDBA 4PNPA 4YQFA 2H54A 2PX3A 1THGA 4KPFC 2P2GA 2I2WA 4E2FA 4GX5A 3KZCA 3P5SA 4KDCA 3NIBA 1EBFA 3FHOA 3ADOA 1HFWA 5GMOA 3K4PA 2J9RA 5A5GA 3FIJA 1NLMA 4CKCA 4N5DA 2FPRA 1OIXA 1XV5A 2YVAA 1PWHA 2HPAA 2XUJA 4UJ3A 1GR1A 1KBZA 2LKDA 1IUKA 1OFVA 4JEMA 2L69A 1IG3A 2V98A 1M0TA 3E23A 4J2OA 1FNBA 1P9NA 4YA6A 4OIMA 3A6DA 4KHPB 2QR5A 5C32A 1Z45A 2VRWA 4L0MA 4F92B 1KI8A 2R6HA 3JVVA 5FF9A 3VR5D 5CVUA 2YBDA 1MJFA 3BMNA 4AJ4A 1SEPA 2XXAB 5DB4A 2Q3FA 1O6FA 4FYXA 1WQ4A 2R11A 4Q1VA 4XJXA 1H5QA 1XB2A 2VQ3A 1QCCA 5CIQA 4IOKA 5BXYA 1SG0A 1L1EA 3B3JA 2EP8A 3RV4A 4C6TA 2NUBA 2FX5A 3MJCA 1N4DA 3EMKA 2R1UA 2BC9A 1ZI9A 5E0OA 5H1YA 1BDIA 5H16A 4HDKB 1P5FA 3OPYB 3H9BA 5C8XA 2NSHA 4WNIA 1E9RA 1I1OA 3L7JA 3HY6A 3Q3CA 1P2SA 2DJ5A 4Q15A 4WSOA 1E9EA 1J99A 3EXAA 2Q0QA 3FPKA 1FU8A 2FZGA 4KR6A 1N33B 5AVKA 2XUQA 2DB3A 2FA9A 4BNMA 4CR7A 1FQOA 4OQNA 5E1BA 5AW1A 3ASYA 2FFAA 3GZJA 3AEUB 2ECKA 4ZXPA 4JGIA 4UE2A 1TADA 1LSSA 5C5DA 5KINB 2QTGA 3BB3A 4PCAA 4ZCPA 3HL0A 3WFJA 3W8RA 5EE5B 4FB5A 4P84A 1N8KA 1S6YA 2QW8A 3UPUA 1CT9A 3QHQA 2G5GX 1K8YB 1VBMA 1NLFA 1H1DA 4LBWA 4C5BA 4R2LA 4HDRA 4MWZA 4W7IA 1ZUD1 2CNDA 3OLVA 5LUBA 2HU8A 1CQJB 5JECA 1IXYA 1JR6A 3PGMA 2A1UB 3P97A 3QBEA 1R9NA 1YJAA 2XKKA 1L7NA 4F8JA 3AUKA 4QDXA 3GBVA 4U6NA 1SKYE 2DTEA 2JJ2A 2ZU6A 3E6AA 4X1IA 5IFLA 3LTNC 3PTZA 3MJRA 3D5QA 4OHXA 5BSKA 1FZQA 1YDHA 4MEAA 4F06A 5DPMA 1U0TA 1P9WA 3I3OA 4V0RA 3L4BA 2YXDA 5HR5A 4YV2A 4CKWA 2IXFA 3B9QA 4DV7B 4BNUA 4WERA 4NFSA 4F7WA 1V96A 3LA8A 5E9QA 3OZAA 1RVDA 4LE0A 1MX1A 3B9RA 1E8MA 2W93A 1Z6QA 4F4JA 2BM0A 2YJ5A 5KJFA 3WFIA 4ENRA 2PWBA 2YJZA 1W44A 3LOUA 2CY0A 3HGTA 1VLMA 5CNKA 5HZHA 1LRLA 1Z0JA 4PRLA 3NATA 3FOCA 1P19A 4WUVA 1P2TA 3KFXA 1UQUA 3CLKA 3STYA 4YX9A 3IEVA 3DHWC 4TN5A 2WOOA 4WLVA 1ZNYA 3QKSB 4QNNA 2WIGA 3F5DA 2BSAA 5AVOA 4GM0A 1R4MB 3BGDA 4L51A 1R9GA 1RKBA 4QFCA 5B1EA 1ZJWA 4YCAA 4HOYA 4X3PA 4O2AF 2Q2NA 3HNRA 4K7JA 3ZIAD 5LKRA 3AX6A 4EYSA 1URPA 1D1TA 2Q3DA 2GTHA 3N3AC 4CETA 3SKYA 5BYKA 1LK0A 1LH0A 4YDRA 2WHQA 3LDGA 4ALJA 2R0QC 2UZ1B 4J43A 3DTVD 4FI3F 5B58C 3IS3A 1OLUA 3NFRA 3Q2IA 2OHIA 1Z9BA 4OSOA 1NW5A 4M1KA 4WKOA 2FEXA 2FZ5A 2XA2A 2ZYIA 4Q1DA 4U3JB 2R8ZA 1LB1B 4PGAA 3TCXB 4P80A 2H5LA 1XHEA 4ZYWA 2BHTA 4H7PA 2OYCA 4J29A 4AJKA 1IPHA 1ARZA 2JAHA 3F7NA 2RMKA 2PPVA 3ANLA 4CE6A 1H6CA 3RU7A 3IODA 1AHNA 2MSNA 3N75A 4MR9A 5KX5F 1HL7A 2OCDA 4JQOA 1XQVA 3OFND 1TKAA 1PI3A 4BUZA 3U37A 3COYA 3LL4A 1RQPA 1XZQA 3MGGA 1DEXA 2GK6A 3HNPA 3D1LA 4UEOA 3O4JA 5K3SA 1XNQB 4DJ5X 4R9SA 3E9ZA 4UTXA 1FLDA 3BF7A 2VJAA 2ZSBA 2BHNA 3DFFA 4UEWA 2GXUA 3RTBA 4L22A 4UQLA 5HDBB 1LK5A 2DHEA 4FGJA 1EE1A 3BH6A 1LWOA 3VVMA 3K1ZA 1EZ4A 2IOFA 1BHQ1 2QS9A 4PBRA 4Q9NA 4ZALA 3LNTA 3CNLA 3ILVA 2XV1A 1CE8A 1H3NA 4QASA 4D6PA 3ORFA 4OK6A 4OUDA 3O8DA 2R751 1MKYA 4UARA 2C2GA 4GU5A 4C7VA 3ASVA 1WXWA 1GFSA 4W1SA 4N3NA 4ODIA 4FFBA 3O0DA 3QYPA 2GT1A 3DTVB 4PSVA 1ZKMA 3MFQA 1NMZA 4BMYA 1ZZEA 3KTAA 4YJGB 5HIJA 2H4YA 1JHAA 2DR3A 3DF9A 2PGNA 4JBNA 1SC3A 4UAUA 1H42A 4JI5B 3VVBA 4CVNA 4EABA 1EESA 3AGQA 2ZB2A 4JHLA 4L72A 4EX6A 3UCXA 1YKFA 4LXQA 1N0HA 3GRVA 4X8OA 4E1VA 4GC9A 3IQHX 4RV5A 4UU1A 4GXTA 3GRUA 3NBZC 4Z7QB 1IWOA 4IJKA 4OHWA 4X7MA 3BH7A 2Q5QA 4Q34A 4AZWA 1R4ZA 4LE2A 1NRIA 5DBGA 2IYQA 4U6SA 2L82A 5EJGA 1Y8AA 2ZUWA 3VDXA 3WV4A 2Q27A 2WFLB 3X1WA 1PL8A 3UW1A 1B26A 2AOTB 5K0JA 5M2QA 3LZCA 5E1MA 3AFGA 4MI9A 4YH1A 1MG0A 3U2QA 3TW8B 3NHUA 2E5WA 3ENQA 4H3SA 2UZ0A 2JAQA 3WGLA 1C8LA 3O4RA 1JHQA 1U6KA 1A8QA 4R7GA 1H0HA 2G3YA 4M0LA 1SEVA 3NNSA 2YHIB 4GI3A 3SC3A 1LVHA 4H1HA 1MAVA 2PZFA 3IFSA 3QIVA 4EM6A 2EC5A 4XSHA 3S1AA 3R5KA 3RGWS 5KQSA 2JIPA 2OR3A 3RCBA 3CZRA 3QJYA 1QVZA 4FX5A 2PYZA 1ZR4A 3IR7A 1LZKA 5C7OO 2YXLA 1OWNA 1O5TA 3KOMA 3WY9A 5DBEX 2D8AA 1X1RA 2P62A 1TCCA 4GP9A 4BBPA 4P0QB 2PS0A 2PGOA 1VGRA 1Y6QA 4RH3A 3QEBZ 1KEEB 1HEIA 3T9AA 4F7DA 1XCJA 3K1YA 1RJ9B 3N2NA 1L7QA 2FU5C 5A1JA 5KBYA 2P4HX 2ZW9A 1U99A 3FKSA 1G55A 4I4NA 4DGQA 2CXXA 2R00C 4DCVA 4ABYA 1Z0IA 3H8WA 4FNAA 1RKUA 4DR1B 2GJ9A 4L9AA 3WGUA 2I4MA 2NU7B 4B4KA 3K6SB 3DZJA 2C9MA 4EI8A 1EUQA 4AKGA 2VSXA 1K68A 4LYJA 3G9XA 2Z4TA 4OHYA 2X2FA 3WQSB 4EUKA 4MKGA 3QKTA 1KI4A 4I55A 4F9TA 3CF0A 3P32A 2VO1A 1J07A 5H9WA 2C83A 1FEZA 4FIDA 1R0WA 1CJUC 1FYWA 2G4VA 1X7DA 1U7UA 1PZXA 2XLBA 3IUPA 1QTNA 2B1QA 3BFJA 4LV6A 4C6RA 4X5OA 1Z17A 4MRAA 1JAZA 4OGLA 4YLGA 3OX2A 5JT1A 1XNJA 4K9OA 4WBNB 4IKPA 1AQNA 3GG2A 4JJ4A 3C6KA 2OZLB 3NT5A 4ZIRB 1WR8A 4D81A 1EDZA 4JU8A 4DYHA 1JHDA 1UJ2A 5T7BA 1LLUA 4TTRA 1W35A 4BV9A 1A9QA 3D3QA 4AZTA 4WY8A 3WIOA 2JDID 1IL0A 1F2UB 4QXPA 1Z5UA 3HPRA 3RBZA 1Y7LA 3A1NA 2WVAA 3CUUA 3C6ZA 2PRZA 4GLBA 4W1QA 5J5CA 1W19A 2LVBA 4UTVA 3RH0A 2BZSA 4DIEA 4GH5A 4IV8A 4KR9A 1QOZA 1HZZA 4B80A 1U7TA 3DOUA 4GYJA 2Y9MB 1SHUX 4B2LA 4CXMA 1H4SA 4LZOA 5BRJA 2YMQA 1CQXA 2I66A 1H0SA 2P77A 1RNLA 1ZUIA 2VEOA 3X1YA 1IN7A 2CKMA 5ITVA 1UKCA 1WF6A 3F6RA 3LC1O 1CVIA 4K6OA 4C22A 2YZ7A 3LUBA 4UOEA 2IYOA 2BM1A 4ZKDA 1CJSA 4CR8A 1EFTA 2VR1A 3F8WA 3HACA 2VJNA 4EWLA 1XZLA 1Y80A 1KZHA 2PGXA 3M1IA 3EFOB 3SMQA 5HOEA 4KQCA 2IDKA 3G0CA 3UYLA 1N1MA 3KKKA 4RNDB 1G3UA 3ZU4A 2II6A 2YZGA 4MULA 4F84A 1GPH1 2HF8A 4AMYA 5AW4A 1MORA 1WB4A 3EODA 4RKEA 2O0LA 1KC1A 2H1VA 1E9FA 3FUVA 3WIDA 3PL5A 2QA5A 2BKUA 4KE7A 1JJ7A 4Q1AA 4FHZA 4YJFA 1VGVA 4QYIB 5LZ5A 2JKZA 2BV3A 3AC0A 4LC0A 2ZYGA 2DHRA 4Y2YA 4PFKA 4ZEOA 1TJ3A 3LHSA 3W6NA 2AFHB 1YMQA 4YAOA 2NTJA 2BBTA 1T8RA 1CR2A 3H18A 1J00A 2Y2UA 4K9LA 1RPAA 4CJXA 2ZE7A 1XU4A 2QZZA 4BGUA 5EA2A 4DARA 5C7YA 1ZWLA 2OB1A 1R6DA 3OTQA 2P3SA 3VZQA 3AR2A 1N5MA 2I2FA 3NNNA 4KOAA 3EGDA 4JXXA 2WUGA 5KC9A 1S89A 2C58A 2FP4B 2WAOA 4JR2A 1EA7A 1Y5NA 5IUKC 3T5DA 2QG9A 3CIOA 4MS3B 4YS6A 2HMUA 3E5RA 4GRDA 4LNHA 4P81A 3H2YA 4ILKA 4QIHA 5B4VA 5KOHB 3MUNA 3DVAB 4QOHA 3S27A 1IN8A 1BHSA 4XTRA 4QXOA 2A57A 2VZEA 3VOSA 3H97A 3B8EA 4TLEA 1ZA2A 3PEUA 2AKEA 3CLSD 1ZGCA 1V5IA 2XE4A 3EBPA 3X2EA 1TT5A 3P9RA 4ZICA 1H1TA 1GFZA 2E0IA 4WOKA 2QMQA 3UT6A 3MTGA 4RTQA 2AR7A 1OHHA 4ZVLA 3WGIA 3V8VA 1QOQB 3EQ6A 2HEIA 3I0NA 1U1DA 2GLUA 3SDBA 3NJ4A 3S55A 1PV4A 3H2BA 2RFLA 2D1QA 1QQ7A 1UBNA 1QHIA 4MQFA 4IINA 4M3NA 3WL7A 3ZK9A 4D44A 4RK5A 4ASUA 1QQTA 4WIAA 3GOHA 4MDFA 3MJ4A 1LCIA 1UZMA 4ES6A 1GRRA 3RSLA 1KI6A 1VXRA 4RHCA 3LZDA 2IQIA 2BFMA 3CNNA 3V7WA 4EQ6B 1HE3A 3BA6A 4PV7A 4US1R 4U7FA 5DJ5A 3NTXA 4R0MA 1BAPA 4TS9A 4BX0A 2ZXEA 2RE8A 2ZRFA 2PH1A 1RFGE 3H0CA 3P2EA 1RWOA 3M6AA 4LFAB 3OSUA 1FP6A 4FXPA 5BO5A 1X70A 5HTKA 4XOUA 3TECE 4ZU3A 3Q85A 1II9A 4FZRA 1OAAA 2XMBA 3CKKA 2E21A 3VGPA 2HHJA 5FLXA 2GZ1A 4NMXB 5JYBA 3LHFA 3O8BA 1HGXA 4QELA 4UUAA 5CA0F 2HMVA 1D2MA 4QICA 5FOUA 3KOXA 1YZTA 1C1DA 4GYYA 5AT1A 3VPDA 3P2KA 1K3TA 4CLDA 3E0XA 1SA0B 5A7FA 1B43A 5ALRA 2D1SA 2KB0A 4IVRA 3LT0A 4PAOA 4RIIA 5LBIA 3MW8A 4GM4A 5KNDD 5FP0A 1IZZA 3G89A 4YXWD 5A6SB 2X5NA 1CERA 5I47A 1RCFA 3RK1A 4KHZA 4F6RB 4TZ6A 2IPOA 1V48A 1XMSA 4TRRA 1H65A 1FFXB 2YNMA 3RUIA 4XX0B 3NJ8A 4XYBA 4AX8A 3SCZA 4X9XA 4GKJB 2QM3A 2O5RA 4GWLA 2PZEA 1L7EA 3DONA 3U49A 1GNSA 2BTOA 2A0FA 2FN4A 4DLLA 2OYRA 3A14A 2OZVA 2CNLA 4POAA 4R0NA 4S1OA 1DWQA 1THTA 5HIMA 3WTCA 2ATEA 3LXUX 2C8VA 4R3UC 1TU4A 1Z0ZA 3IDQA 2CYCA 5JBNA 2QXUA 2XBLA 3LLMA 4KYUA 5T4EA 2W2TA 2H5IA 3MG9A 4DY4A 3SXPA 5C5CA 3DW1X 2V7QA 2HJSA 2QM0A 1JWBB 3NBAA 2ZBUA 3TLYA 1QCYA 4WDQA 5KC8A 1R5JA 1U28C 2PXXA 2ZIWB 4XSVA 1DWPA 3RFCA 3ROGA 6CHYA 5LP6F 3O4VA 5KVSA 4WZBA 1K7EB 1S3FA 3BWCA 1TEVA 2TYSB 4OHUA 4H7JA 1RXEA 2GN2A 5JV5A 2C20A 3H8VA 2JGMA 2XB9A 4L76A 5BN3A 1NASA 4IILA 2JI8A 3DDOA 4ARUA 3UOGA 1WEHA 2D1YA 1I6KA 1XD2A 3FSGD 2OAEA 1JAIA 4G0ZA 2R4TA 1HDYA 4MPRA 5LPNA 3E7XA 1EQ2A 3M4YA