1LX6A

Crystal structure of e. coli enoyl reductase-nad+ with a bound benzamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
243
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Discovery of aminopyridine-based inhibitors of bacterial enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 243
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lx6A00
5CHEA 4UVDA 4DBVO 5KKCA 3L6EA 3TQHA 1G1AA 4E31A 2H6EA 3JSAA 4IDCA 3PYLA 4IDGA 1EFKA 3DAFA 4OQZA 4L4SA 1EBFA 2J5QA 4HFRA 2CVOA 3W8EA 4D7AA 2AXQA 2JKVA 1LDMA 4BNIA 1BXKA 1BXZA 4LGVA 1B8UA 4IDFA 2FSSA 1PL8A 2ZKLA 5ITVA 3GVPA 4Y6SA 3W8FA 4CM9D 1WDKA 3ZU2A 5CDYA 4QO8A 2B5WA 2IZ1A 3LT1A 1ID1A 5TT0A 2XOXA 2FN7A 4J49A 4JP2A 3F4BA 1H0KA 2WSBA 4UEJA 3C1OA 4AJNA 1V8BA 3JYLA 3TFOA 4KTTE 3OFSA 1TEHA 2Q1TA 3VH4A 1U7HA 3IS3A 3VHRA 5HM8A 3HDHA 2X22A 5BNTA 3WXBA 1MUUA 1T2EA 4KZPA 4NJMA 3MJCA 3ZH2A 3ENNA 1VLLA 4HP8A 4YJHB 2AG8A 4WOKA 1NQAO 3LF1A 4NIMA 1DPGA 2GNAA 3A14A 2PGLA 5JPIA 3GNTA 5TX7A 2C5EA 3W6ZA 4CM8A 3DXFA 1D3AA 1M2WA 3H8VA 2O3JA 5FI3A 5H81A 2OOSA 4YYZA 3S1LA 1GQ2A 3ETDA 1LU9A 3DBVO 4BO7A 1XIVA 3GVIA 4CM4A 3W4JA 3DAGA 3GAFA 2GZ1A 3KZVA 1OBFO 2RH4A 3GZNA 3DZJA 1KEWA 3GY0A 3NAQA 4ZA2A 1R37A 1ISHA 2O3TA 3JQEA 2D3TA 5F21A 4LRSB 1QLHA 3ZI0A 4WCFC 4RF5A 5DULA 4L76A 4CMAA 5CPBA 1DHRA 2ZCVA 3P19A 2O4CA 5DZSA 3GEGA 1J4AA 4DQVA 3SVTA 5IXSA 4KDEA 2Y1FA 3WGQA 1NP3A 2C59A 3H5RA 2GO1A 3WGTA 2D1YA 2DBZA 2X1HA 3JQ8B 4B4WA 1PR9A 4KQWA 4XGNA 1CQIA 1ZSYA 4BO8A 3GFGA 1EVZA 1W73A 5IFLA 1VL0A 4N54A 2NVUB 5DDIP 2AEMA 2IZ0A 3VC7A 4DC1A 4ZQBA 2X23A 3CINA 1BRMA 2VYND 4NFYA 3RC2A 2R2GA 4CMGA 3GMSA 2B0JA 3RKRA 3KVOA 2JFHA 4AL4A 1GQQA 3GGPA 3AK4A 2EKLA 2QRJA 4P38A 5I8WA 1ZEMA 3SEFA 4RO0A 4DLAA 1E7WA 3DBLB 2G5CA 4YBZA 1GY8A 2HMSA 2X9NA 4R1UA 3ST7A 1PS9A 1BMDA 3WIDA 2J6IA 2IEDA 3DR3A 5COBA 3D4PA 3S2IA 1MC5A 2PR2A 3KETA 1SMKA 1UH5A 2FZEA 4FIZA 4A26A 5L7TA 1DB3A 4BO1A 1P9LA 1I5RA 5EPOA 4B3HA 4EEZA 4IPTA 4L9RA 1DAPA 1SB8A 2C82A 1Q0LA 4GLOA 2JJYA 3ZZNA 4FPXA 1DIAA 4WEOA 1HDCA 2OO5A 3RD5A 4LSMA 3RUCA 3WR5A 1YQXA 1R6DA 2BGKA 1UXKA 2HRBA 1DC5A 4YWJA 4RPLA 4O0LA 4BKPA 3AM3A 1DIHA 3VKUA 2B83A 3HJAA 4K26A 3KSZO 3ROQA 3QVSA 3BMNB 3HN2A 4CUJA 3K31A 4EW6A 1HZZA 4GQAA 1R4MA 1DRVA 1RM5A 3NDIA 4UULA 3WGZA 3VZPA 1QP8A 1X14A 1K6JA 2ZCUA 1ENYA 1EUZA 5GZ3A 1JKFA 2YYYA 4HY3A 5ER9A 4EDFA 1OOEA 4B8ZA 2NTJA 3QV1A 1PEDA 4DBZA 2P2SA 3V2HA 3R1IA 1RYDA 1KVQA 4WNIA 4HBGA 1KEVA 2C07A 1XCBA 2CSUA 4JQCA 2X58A 8ADHA 3F6YA 4M87A 1UR5A 5U4QA 4UREA 1GZ6A 1IOLA 1GYPA 5DCYA 4QTZA 3GVCA 3ZV3A 3JYQA 4YT4A 1Y8QA 4W6ZA 1HTBA 4BKOA 3DQPA 4GBJA 3WJ7A 2AQIA 4IJVA 4KP7A 4IQ0A 1MX3A 3CKYA 4E0BA 2XXBA 3KV3O 4PFJA 4FJ2A 4PG8A 5IG2A 5CP8A 2C2YA 4ROSA 3I6IA 2G76A 4AJOA 1M75A 3HDQA 4B8WA 4NR0A 5JAQA 1PJSA 5EMHA 4G5HA 4ESOA 1DFGA 3PJGA 3Q11A 3KRTA 4PLPA 4R51A 2WE8A 4UVEA 2ZTLA 2DU8A 4XD2A 4YACA 3G1UA 1ZMTA 3COSA 3FR7A 1HF3A 4G2NA 4PLCA 4UVIA 4GKBA 4ZU3A 4EJMA 3GHYA 1B26A 4A73A 2CF5A 1FXSA 4OL9A 4OXYA 5T64A 4Z3DA 2HDHA 5G0VA 1MB4A 3H6KA 2JD2A 4OXNA 1PGQA 4DYDA 3R3JA 3G49A 5T57A 2AW5A 1T25A 2Y99A 3RUFA 1KVSA 2BI7A 1JWAB 2PK3A 2BELA 1HYEA 4BNWA 3OF2A 2LDBA 4R9SA 2X0NA 1GFSA 1Z75A 5B12A 4RZIA 1NM5A 3WLFA 3F9IA 1T24A 2X5OA 3BXXA 2IODA 3KB6A 5FFFA 5BT9A 4W9NA 4I08A 3I9MA 3ZDFA 4HADA 2JL1A 2EG9A 5JY1A 5KWEA 1E1MA 5DP1A 4D41A 1LRLA 3LT0A 2Y1DA 5C7IO 2DUWA 1LSSA 2WEKA 4YJHA 2Y1OA 4YAKA 2ZK7A 4DGSA 3AU9A 4DREA 5HTOA 3P2OA 1I01A 4PVCA 4NK5A 3L4SO 4XQGA 4PLWA 4OHUA 1IUKA 4ID9A 1SAYA 3WICA 4M89A 3ZNOA 3OJEA 4OKIA 4DUPA 3DWFA 4MKZA 1YO6A 1NQTA 3SBOA 3E03A 1LRJA 3BTVA 4M54A 3K30A 3AY7A 1U5CA 4NBRA 1NVMB 3K6JA 3HDJA 3VH3A 4OGWA 4J90A 4F45A 4WLFA 1EEHA 1U1IA 4B7XA 3UUWA 2J5KA 3JTMA 1ZZEA 1DOHA 4K28A 3X2EA 4AICA 4BO4A 4AJIA 1YRLA 4FB5A 5KJFA 3LF2A 3EMKA 1HT0A 3FPLA 4QX6A 3DHYA 3ZHYA 1TVEA 1EVJA 3JQ8A 2ZYDA 3HE3A 4FFMA 4BO6A 3JQAD 3R3SA 4UUNA 5G2OA 1P1RA 2NVUA 1K0UA 4BNFA 4GSLA 4PG4A 4W82A 2QX7A 2CVZA 1JAXA 1H5QA 3NGXA 3WSVA 2ILTA 1CEQA 3ASVA 2I99A 2UYYA 2SCUA 3GZ4A 3OP4A 1IZ9A 4XB1A 1H93A 2V7PA 3QRWA 3N74A 2Y66A 3DBLA 1EZ4A 4XRRA 3BMCB 4K1LA 2BLLA 4CLEA 3F1LA 1O94A 5TS3A 1GCUA 4OQYA 4XRGA 2Y0EA 5JDIC 2FWMX 3RUAA 2OMEA 4IGEA 5LCXA 3KBOA 4IDEA 3DONA 1H2HA 1XDWA 2DT5A 3PQDA 3AM5A 5JDIA 4PLFA 3ADOA 2AE1A 2UUOA 4DTIA 1HDOA 1M6WA 2DTDA 3TL2A 4RPHA 2E6UX 4OKNA 4CR7A 1PZGA 3GGGA 4BNMA 2NU8A 2P9CA 3DOCA 1ZFNA 2CZCA 1AXGA 1GEGA 1GCOA 1ONOA 1XA0A 4YB8A 3NTRA 4RVSA 1PWZA 4E4YA 1LXCA 1ZSNA 2HMUA 4FFNA 1I36A 3PPIA 3VDQA 1GV0A 4JBGA 2B36A 3OEWA 3TNLA 1E7RA 3I52A 1U3UA 3TWOA 1HL3A 3CE6A 3Q1LA 1ULSA 2JCVA 3BMNA 3Q0EA 4U6SA 5CDSA 1DEHA 1RYEA 1Z82A 1QG6A 1VSUA 1L7DA 2BMAA 2WYUA 1ENZA 1PIWA 2IZZA 1N1EA 3VPFA 4UUMA 1B7GO 4CMEC 1E1LA 3BHIA 4YAJA 4CQMB 2EW8A 1JW9B 1V6AA 5IDXA 4QSMA 1OC2A 3AY6A 4F3YA 4CL8A 4CMEA 4ILKA 4R41A 4WCDA 3GLQA 1HE3A 1RJWA 4TVOA 3E5RA 2EWMA 4MVJF 1IZ0A 4LISA 4PRKA 2NADA 3I9KA 1XYGA 3ZGYA 2GN4A 1U8XX 5JY6A 1WLYA 3L6OO 1PL6A 2NU6A 2PFGA 1PJ4A 3PJEA 4AJPA 4BNNA 1LSOA 3WDSA 5IDYA 4PN3A 4Q3EA 2P91A 1SZJG 2PGJA 1EDOA 2VNAA 1H9BA 1JVBA 1MC4A 1KERA 2A92A 1H94A 2E82A 3WWZA 3S55A 1P1JA 5JS6A 1MV8A 2A9FA 2NV6A 4LVUA 2CFCA 3E6AA 1MXHA 4R69A 2AQKA 4HX5A 4JJFA 4WNCA 3JQCA 2DAPA 4FFRA 4FCCA 3JD4A 3F5QA 1A71A 3NDRA 4PLVA 4DLBA 3FBTA 4ZQEA 3DAPA 1HZJA 3EC7A 1K3TA 3JQ9C 4EI2A 4NHEA 3DZHA 5IXYA 3GUCA 2NLOA 3DMTA 1PL7A 2GD1O 3ZHZA 2DPGA 2Q45A 3E5MA 3FI9A 3JQ9A 5MDHA 3KOUA 3PGJA 1IPEA 4IQ8A 4PGFA 5A5FA 3ZNNA 3GNSA 3CZRA 2I9PA 1HYGA 2PZLA 2FHSA 3AOEC 4BL5A 5I7FA 3OQ6A 4XWYA 3I3OA 3INGA 3A06A 2Y1EA 2BF7A 3OA2A 4LRTB 3JYPA 1R16A 4CMBA 4CV0A 2Q2WA 4NQZA 2PKRA 3UICA 5DT9A 2BH9A 5G0UA 4YRBA 1YQGA 2EERA 4PLZA 2VT2A 4J16A 3K5PA 1NVTA 4J4HA 1P0CA 2A94A 2EKPA 1Q7GA 4RZHA 1DJNA 2DM6A 2YHIB 1ZO8A 4HFNA 4U7WA 1LBEA 4WECA 4MKXA 2TMDA 3ADPA 2YHUA 2FPGA 2ZB7A 4AJEA 4ZHSA 1YB4A 4IM7A 1KEUA 1E7YA 5BSHA 4OIMA 2PKQP 3IMFA 2FSVA 1DXYA 1K5HA 2X0IA 1G0NA 1VPDA 4FR5A 3W1VA 1L1FA 3BMQB 3ETGA 3GF4A 1PSDA 1A5ZA 1YE3A 2HJSA 2JHFA 2PH5A 3JQFC 4FOOA 3WB9A 4LW8A 3WFJA 4GX5A 1ADGA 3H65A 4DQUA 3JQFA 1ZKMA 1X0XA 4TVBA 1DIGA 3OA0A 1BVUA 1Y5MA 3C3XA 3NT4A 4FN4A 2QQ5A 3SLGA 1QORA 3VPGA 1ARZA 1BW9B 1GUFA 1ZH8A 4J6FA 3ZWXA 1F12A 3TFQA 2FMUA 4DVJA 2HMTA 3JV7A 4O5OA 1E3LA 2E37A 1P77A 1EDZA 1P1IA 1ADCA 3HB5X 5IDQA 4MO2A 4MPDA 4PLHA 3LDHA 3Q6IA 1H6CA 3V5NA 2Q3EA 3CSDA 3ZHBA 2AHRA 1XHLA 2JD1A 3OEYA 2BRUA 4L8VA 4E33A 2HJRA 5KJCA 1VKOA 2Q4EA 4G65A 3TPCA 3CIFA 3GR6A 1E1KA 2OP0A 1S6YA 1LDYA 4O1MA 3TZKA 2UUPA 1R0SA 3I9JA 1LJ8A 1NBOA 2W98A 4XYEA 3K73O 1PJLA 2QIOA 1X15A 3MJTA 4J0FA 4XJTA 1TT7A 1E3IA 3G3EA 5ER6A 3WQQA 2DVMA 1FDSA 1BXGB 3KLPX 1LLQA 1YL6A 4J4BA 3VTZA 1JAYA 3RBZA 3I4CA 4PIVA 3S8MA 4RCVA 5COAA 1ISJA 1DHTA 1HDXA 2DQ4A 3NUGA 3G79A 1WPQA 1F06A 3EZLA 4CMCA 4B4OA 1XWFA 5T8KC 3HN7A 3GAZA 5HA5A 1I0ZA 1ZUD1 3BMCA 3WS7A 2EGHA 5F5NA 1K6IA 3HHPA 1B8PA 5T8KA 1M76A 5KOIA 3MJ4A 3QVWA 2ZQYA 5ILGA 1F8FA 1MP0A 3AI2A 4R16A 4A2CA 4HXYA 1O95A 1GYQA 3RUEA 2GCGA 3UCFA 2GDZA 1E6UA 2GASA 2J3HA 2O3QA 2P5YA 4P4LA 3HSKA 4M86A 4GGOA 1HE4A 1PJTA 1O0SA 1ISIA 4MDHA 2C20A 3JQBC 1O9BA 3JYNA 2GYYA 4F46A 4XYBA 3EZYA 2Z5LA 3PEFA 1JKIA 5A4DA 3FHLA 1WNTA 3JYOA 4J4TA 1FDVA 4BGUA 3RJ9A 4NPCA 3RVDA 3WWYA 1RM4A 2PLAA 3DMYA 4BVAA 1KVRA 3SLKA 2VUUA 4R3NA 4F6CA 2YJZA 3E82A 4OH1A 2HLPA 1YB5A 4CQMA 2JD0A 3IUPA 3M6IA 3M2PA 1NPTO 5L45A 3RC1A 4NMHA 4ND3A 4CR6A 5JSFA 2VRCD 2A35A 5L4SA 4W99A 2Q50A 4BNKA 4PG6A 4RVGA 2F1KA 3U9LA 2JFGA 4YJGB 2BGMA 1QYWA 4Q39A 4CV2A 4FW8A 1LRKA 3TF5A 1EQUA 1C0KA 5AXBA 1O8CA 4HNGA 5JFOA 1NYTA 2C29D 3DO5A 3NJ4A 3H2ZA 5L51A 2EKQA 1G0OA 5TQVA 3M2TA 3ITDA 1UXIA 1VJTA 2FZWA 2ET6A 4QO7A 1LEHA 3C7AA 1V9LA 5AXDA 3PLNA 3WGGA 4J7XA 3C85A 3LQFA 1U4SA 3PFFA 4YT8A 2VHYA 4YEDA 1PZEA 3ZU5A 3RWBA 1JTVA 3I4FA 4Y98A 2O3UA 3OJOA 5BQFA 4TRRA 3VVBA 2POQX 4TQGA 3EYWA 3TL3A 2BFOA 1EVIA 1VKNA 3GH3A 2F00A 4LVCA 4BGIA 1A9ZA 2GZ2A 4JJGA 2NWQA 1I2CA 1Z7EA 3JQ6A 1ZMOA 3KO8A 2CDBA 4FFLA 4HWKA 4L73A 4MIYA 3WFIA 1W0CA 1NWCA 2Z1MA 1E92A 4DL9A 3OHSX 4JIGA 4WLVA 4FS3A 4YQZA 5TF4A 5JXWA 1MLDA 2G17A 2VYVA 3F46A 1NASA 4F6LA 1KYQA 2FR0A 4NU6A 3NGLA 5FWNA 1NR1A 1UAGA 3BZUA 4ZRMA 1HXHA 3GVHA 4U5QA 3ZWYA 2CD9A 4J1TA 5A3VA 4RL6A 1DRWA 3PXXA 4A10A 3U4DA 1N5DA 3AUUA 2VTDA 4IDBA 5THKA 1IHXA 4W7IA 3UGKA 2YHIA 3FTNA 5JCJA 3ONEA 1GZ3A 4U6QA 4TRJA 3I83A 5GY7A 4Y6RA 4HNHA 4R68A 3SJ7A 3DL2A 5DCUA 3WBFA 3HQ4O 2EJWA 5A9SA 1BHSA 2QYSA 4GH5A 4MVJD 1VI2A 3BMQA 4MP3A 4LCEA 1KEPA 1XSEA 3ASUA 4TZKA 3DFUA 4XR4A 2NVWA 3F3SA 4B7UA 2OZPA 2PZKA 1W8DA 4YCAA 3VPHA 4BNHA 3WGOA 2AE2A 5DF1A 4UEKA 1DC4A 1XG5A 2V6MA 4N5MA 1BW9A 5AQ1A 1Y7TA 3C24A 4NDNE 4J3FA 1T1RA 3L9XA 4FQ8A 3PZBA 3RUHA 2OP1A 2OHXA 1QXSA 2VN8A 3ANMA 3WTBA 4GVLA 2BFPA 4TMFA 4N18A 3TDKA 2G82A 4JGBA 1XQ6A 3CH6A 2NQ8A 1VRWA 3LYLA 3ZV4A 2WD8A 3PDUA 4XQEA 5CG1A 2CNBA 2O48X 1T2CA 1QYVA 3S2FA 2GERA 2VT3A 1O5IA 4GVXA 1E3WB 5JW6A 5G4KB 5CFZA 3KHUA 3MOIA 2I6TA 3KM0A 4KQXA 5ICSA 3PTZA 1NX6A 2EGGA 3WQRA 4BV9A 3O26A 4JROA 4D79A 9LDBA 5FF9A 3H3JA 3VZSA 3WIEA 4E6PA 3E48A 1EVYA 1MXFA 1BXGA 4GX2A 4R01A 2O23A 2UAGA 4NJOA 5L4NA 4Q3DA 2PV7A 4ONEA 3E18A 3P2YA 5I7EA 4CLDA 1J6UA 3NEPX 3OJ0A 5CDUA 4BNLA 1DC6A 3AOGA 4KUEA 3W4KA 4ZN6A 5DBIA 2PA3A 3FCOA 4QFCA 1KVUA 3OM9A 2AMFA 1RM3A 3B1JA 3QWBA 1UXGA 1I3MA 1ADFA 3PQEA 2YY7A 5IZ4A 3H7AA 3GGOA 2PWZA 2YFQA 4WLEA 2DBRA 2I67A 1ZNQO 2GR9A 3GUYA 2EF1A 3IQDB 3UHAA 2WE7A 2Q2VA 1XQ1A 4ZJUA 3A1NA 2P5UA 4KTVE 1Q1NA 2W8ZA 4XYLA 4FJ1A 4Z9YA 1N9GB 4J43A 3ZNPA 2IE0A 3ZWNA 1I30A 1X13A 3CPSA 4E30A 3JQGB 1NFFA 1ISGA 3DOOA 4BUCA 4NFHA 1V3VA 3V1YA 2AEJA 2VWPA 1SOVA 1JU9A 1V0JA 4I8XA 2GZ3A 4IS3A 4BQRA 2XAAA 3QVXA 4WLOA 2DUUA 3KSDO 1WVGA 1YL7A 3DBHB 4FFOA 1H9AA 2YV3A 5U9CA 1J0XO 5IN5A 5TJ9A 1B16A 4RF2A 2B4TO 5F1PA 3RUIA 3H9GA 1PR3A 1C0PA 4JBHA 1T2FA 2E49A 1YDWA 1KY4A 3IAHA 1LDGA 1XLTA 1XR3A 2J5RA 1TT5B 2HO5A 2YDYA 4ZVVA 5JBIA 2GUGA 3KYDB 4BGVA 3SC6A 1E1NA 4W4TA 3C8MA 3A28A 4M49A 4EBFA 4BNZA 4JXKA 4CM7A 4YJGA 2X9GA 1B14A 1FF9A 3MWDB 3DC2A 2YFHA 5JMPA 1YJ8A 3ZWBA 4WASA 1U28A 2NTNA 4W9NC 4Z9XA 2PD3A 1XKQA 2RHRA 3EW7A 4RF4A 4EUEA 4NBWA 4B4VA 9LDTA 1C0LA 3DBRB 3NV9A 3VZRA 1DIBA 3CUKA 4JP3A 2ZATA 3NTQA 2VWGA 1I10A 4L4RA 1HLPA 4WUVA 3OIFA 2YZ7A 4OXKA 4PG5A 1D4FA 5C5IA 3ICPA 3PYXA 4I9HA 1E3EA 1E77A 4X54A 4BMVA 2QHXA 1GQYA 3GDGA 4ZD6A 1ZK0A 2X4GA 2BHLA 1H2BA 4J1QA 4XQCA 2PNFA 1ZK3A 5IF3A 1NPDA 2WYWA 4WLNA 1J5PA 4ZQHA 3GMDA 3NT5A 1KC1A 4GI2A 1BG6A 2H1SA 4JK3A 4XYMA 4AJLA 4H15A 5ILOA 1IE3A 1QR6A 5A04A 5IZCC 1HETA 3UFXA 1A9YA 1LDBA 3W6UA 1OAAA 3TRIA 1UXJA 1YVEI 3BIOA 2HQ1A 2UDPA 5T6BA 5AVOA 5IZCA 4RVFA 1KBZA 1NFRA 3D5TA 3RC9A 3ORFA 2AG5A 2HKIA 3NRCA 4FDAA 3DOJA 5IN4A 4EGFA 5JNLA 3HADA 3QHAA 3M1LA 3LC7O 1FK8A 3FN4A 3WGYA 4OSPA 1BDMA 5GZ6A 1Q0HA 2FPPA 4BKRA 3MJSA 2X6TA 5F1KA 1BGVA 3K8ZA 2D5CA 4CQLB 1NNUA 1X7HA 3L0DA 3HUDA 3AI1A 1YL5A 2EP7A 4GPD1 1PGOA 4P8RA 2HU2A 4R9RA 1SNYA 1ZVMA 4WOJA 3BAZA 4FC6A 1QLJA 5A9TA 3TZ6A 1NAIA 1T2AA 3RU7A 3EDMA 2D2IA 4G81A 4INAA 4RF3A 4RORA 1VL6A 1N2SA 1NR7A 3B1FA 3H3FA 2FRDA 5I7SA 3T4XA 3P7MA 4YTEA 1DO8A 3Q9UA 3DZGA 3BHJA 2WYVA 5KVQA 2OFPA 5EQFA 1WAMA 4IXTA 4PG7A 3U4CA 1Q0QA 3AU8A 3UW3A 3D64A 4PRLA 4CMKA 4BKUA 2R00C 4RDHA 3GEDA 2O2YA 3KYBA 4PZDA 5DOVA 4J2HA 4BQPA 4OYRA 3LC2O 3QA9A 3R6DA 4R54A 2R00A 1P1KA 2PH3A 3NYWA 4J9VA 4RJTA 4OOFA 3OMLA 5CEEA 4WJZA 2V6FA 5EQDA 3FBGA 5BNFA 1MFZA 1QV6A 2BFMA 3TN7A 4GGPA 4IJWA 2PD4A 4D43A 1E3WA 2HMVA 3LK7A 2PY6A 5G4KA 2XF8A 2W2LA 3GRPA 3HFSA 3RJ5A 5JE8A 4XX0A 4YR9A 1E0DA 1EK5A 1ONNA 3G1TA 3WYCA 5JAZA 4ND4A 5L9AA 1RM0A 4NBVA 1R0KA 4IBOA 6LDHA 4ITUA 4MVJH 4DIOA 4OMUA 2EP5A 3Q3CA 1HDYA 1GDHA 1ZK4A 4NNJA 2IEBA 1Z6ZA 1P0FA 3PWKA 3WOHA 3ZHXA 2JAHA 3PWSA 1PJ3A 1ZJZA 1CJCA 2J3IA 2GPTA 2QW8A 4MJLA 4C7KA 3B6ZA 2FOIA 1KIFA 2Y05A 5LC1A 2VHVA 2I3GA 3ENKA 3OQBA 2GSDA 1X0VA 1AN9A 4E3ZA 5B37A 5B4VA 3QY9A 3DZKA 3GA0A 3STHA 4Q3NA 1QYDA 3DEYX 4DMLA 4L4XA 4IIVA 3NTOA 5DN9A 2EJVA 4GLLA 5B4UA 1CF2O 1MA0A 3SX2A 2ZB3A 1GR0A 4Z3KA 2NU9A 4II2A 1MFPA 3LLSA 4YRAA 3IIEA 4JNKA 4XQ9A 1ENOA 5FYDA 1HKUA 1V3UA 4TWRA 2PZMA 3OJLA 1P1FA 3WYEA 3TSCA 1N9GA 5I7VA 5TT1A 1Y1PA 4FC7A 3RFVA 1HE5A 4RVUA 4KWIA 4OAQA 3JQGA 2FR8A 1YQDA 3N7UA 2OBNA 3QLJA 1FJHA 3FNFA 5KKAA 4Y8VA 5C37A 2DFDA 3GT0A 4MP6A 4LN1A 2JCYA 3DMTC 3DTTA 3MJVA 3KEOA 3GHHA 4BOYA 1Q7BA 1U5AA 3DBHA 4U0JA 3PLRA 5CG2A 5A03A 1UP6A 4Q9NA 4FBGA 4B3JA 3LT2A 5IAAA 3Q2KA 2G0TA 2JAPA 3LC1O 3FD8A 2VCYA 3FNEA 4HFJA 4RLHA 3FTPA 1BVRA 1QYXA 2WD7B 1TT5A 2BGLA 3OH8A 4QT0A 4YAIA 1BTOA 1GUYA 3HDYA 3LZ6A 3KYDA 4C4OA 4QEDA 5IDWA 1D8AA 5L40A 2FP4A 5AYVA 3D4OA 4O63O 3OBBA 3FR8A 3PIDA 4D0SA 4BMNA 4D3SA 1GTMA 1C1XB 1C1DB 1I3NA 4M55A 1JA9A 2Q99A 3HFGA 4R1NA 5F1OA 3U0BA 5CEFA 2VUTA 1CWUA 2Q4BA 4D0RA 3DBRA 3NDJA 5FI5A 3KXDA 4YQYA 3B70A 3DZIA 5AXCA 5A9SB 1R0LA 3RI3A 1R4NA 1UXHA 2RBEA 5J23A 1CIVA 3H9JA 3VPXA 2H5LA 1BSVA 1LTHR 1P31A 1TA4A 1UUFA 2H9IA 3GQVA 4R1SA 5FEUA 5BR7A 3S2EA 5I9NA 3V2GA 5DCWA 1JLLA 3PYMA 3PJDA 3F4LA 4E2ZA 4AJ4A 4IMRA 4J1SA 3WLEA 5B1YA 2X8LA 4IXWA 2IRWA 3SXPA 3Q9NA 4PZEA 1A7KA 3K92A 1J49A 1SCUA 4ALIA 1DFHA 2HK8A 3ZW8A 1B3RA 3QWFA 4NBUA 2FY8A 2NU7A 2RAFA 4BB5A 4GKVA 1GUZA 3ITKA 1SEPA 1U3WA 2ZJ1A 1DFIA 3DZFA 2EHDA 2VHWA 2VZ8A 1XELA 4BNVA 3OETA 2Q2QA 4CLHA 3DHEA 3W4IA 4NFSA 4YT5A 4AJKA 2PTGA 3T7CA 2BKAA 5EERA 2JFFA 2ZB4A 4Z0HO 3ZWVA 1PJBA 4CLOB 1OZAA 1VC2A 1X7DA 4ZQGA 1LLDA 1OI7A 1YB1A 2Y93A 4H7PA 4CM6A 2P4QA 1ZEJA 3X2FA 2AQ8A 3HZZA 1CERA 3KYCB 1NHWA 4CQLA 3H5NA 5DP2A 5AXAA 4M1QA 1WDLA 2X5JO 4UVGA 1LA2A 5G4LA 4CM9A 2D5AA 3ZWAA 3CMCO 2NUAA 4TSKA 1LUAA 3A4VA 3IC5A 4QQRA 4R4JA 2D4AA 3IDSA 1S7CA 3IP3A 4DC0A 3IJRA 3B1KA 5JDCC 1H6AA 4FFPA 5B4TA 4HFMA 2W2KB 3KSUA 2CDCA 2J3KA 4NK4A 3ANLA 4QECA 1D1TA 1PJCA 3TZHA 5JDCA 2DKNA 3OQ1A 2V65A 3G17A 4E5NA 1ZW1A 1Y9EA 2P9EA 2UVDA 4OOEA 1C3VA 2CUKA 4KDFA 1T4BA 5A9RA 3GPDG 3ZV6A 2EIHA 1GZ4A 3E1KA 4QXMA 4YJFB 4IZIA 4J7CA 1EUCA 3QWIA 4IIUA 4E2YA 5CAEA 3F47A 2GN9A 4MVJE 4MINA 4WGGA 4MVJI 1GU7A 2ZIZA 2ZTUA 3OIDA 4AJJA 5G0WA 1HYHA 1JQBA 1PX0A 2O50A 4IJUA 3IOYA 1I3LA 3VVCA 2CMDA 1DLIA 3L77A 4ND2A 5TRTA 1B15A 4YXFA 1UDAA 4UAGA 2IXAA 3ZN2A 1Y6JA 5EJ2A 4E2WA 3AUAA 1JN0A 3H5AA 2VHZA 2Y0CA 3IUSA 4XGKA 3JQ7B 3RU9A 2OBYA 2FPIA 5BNIA 3FWNA 1I2ZA 1YS4A 2YQ5A 3GK3A 3VAZA 1TLTA 4I5FA 4MVJG 1Z7BA 4EUFA 1UDBA 1GL3A 4R5MA 3ROKA 4ALNA 1XGKA 4AJ1A 1FDUA 1DJQA 2J3JA 5ENDA 4TKMA 3JQAB 4EJ6A 2HRZA 1BWSA 3G0OA 1IL0A 4XZ3A 1KVTA 1WDMA 4E32A 3BHMA 1DIRA 1HEUA 2C54A 4WKGA 1AXEA 1GPDG 2VYNA 3VKVA 1ZIDA 2ZYGA 3EUWA 4LCJA 1V3TA 4EJ0A 3QP9A 1LC3A 4RQUA 4E5KA 4IMPA 1SOWA 3ONFA 3F5SA 4E5YA 1Q7CA 3H9QA 1NXQA 5EESA 3QIVA 1C0IA 5JAIA 1U3TA 4EEXA 4LMPA 3ON5A 2I5PO 1SB9A 1WZIA 4CLRB 4BIIA 3DTYA 4OM8A 4YJDA 4DIFA 4CUZA 3D3WB 3GN1A 4BO0A 2OL4A 3UCEA 2EEZA 3CZMA 4FGSA 2VTEA 2DTXA 3NT2A 4UVHA 3ZWCA 1WMBA 4YAEA 4DYVA 5F3RA 1YGYA 2NM0A 5I8ZA 3UVEA 1UAYA 3BMOB 1PQUA 3QW2A 4CJXA 5MGBA 5DNAA 4D46A 2WMDA 3WTCA 4MVJM 3GVXA 3F1KA 4GSKA 2PKQO 2WD7A 3JD0A 4E12A 5C7OO 5I9LA 2EW2A 3PHGA 3W8DA 3RBXA 4Z0TA 5L53A 3D4NA 1TI7A 1SC6A 4J7UA 5TLSA 1PZFA 1PWXA 3MWEB 2R6JA 5A06A 4RPJA 4RDIA 1D1SA 1VJ0A 2Y68A 1C1XA 1C1DA 3LT4A 3WGHA 2NVBA 4ND5A 1VJ1A 3TOXA 3DB2A 3INRA 2B37A 1WZEA 3B20A 5THQA 4KMSA 5L7WA 2HMWA 5DBGA 5A05A 3GFBA 4H3VA 1R66A 3LVFO 1PTJA 1VSVA 2Q1SA 3MEQA 1SO8A 2WWRA 4MKRA 5JMWA 4PLGA 2C5AA 3HG7A 4JLWA 2XPCA 1P3DA 3FNGA 3AFMA 2VZ9A 4IDAA 1Y5RA 4WCFA 4BNJA 4NBTA 4JN6B 5KIAA 4UUPA 4WE3A 3PK0A 3IP1A 4P4GA 4Y67A 4CQMD 2JCXA 2C0CA 4TZTA 1PGPA 1QSGA 3RKUA 1HDZA 1NTOA 1U2GA 3UKOA 1HDRA 1PU2A 3IKVA 3TZCA 3JD1A 3UXYA 5H82A 1EE9A 3EK2A 4K6CA 3C7CB 4BNGA 4ND1A 2B5VA 1AGNA 4CM3A 4OSOA 1UP7A 2RCYA 4IDDA 3TJRA 2GN6A 1FDTA 3VTFA 4RPGA 2Y67A 4FJ0A 3H2SA 2QZ9A 4WK6A 5LDHA 3OIGA 2Y1CA 4RVHA 4CLOA 2HAEA 3UN1A 4IZHA 3AUTA 1BDBA 1ULUA 4B3IA 4K9DA 3GG2A 1AHIA 3ANNA 4S1VA 4TRNA 3FNHA 4ZRNA 5JYDA 5TIIA 1MGOA 4XEHA 3IKTA 4UUOA 3KYCA 4DXHA 5JC8A 2QRKA 4BV8A 3OSUA 3GEMA 2LDXA 2VOEA 3INTA 1H6BA 2E48A 4E21A 4BKQA 5A02A 3EY4A 3RBVA 3WX0A 3TOZA 4A27A 3I1JA 3WJAA 2OXIA 1YXMA 3HWRA 1CQJA 4O6VA 2Z1NA 3TZQA 3QVTA 4J0EA 1ORRA 3GC6A 3WYBA 1W4ZA 4WLUA 1EK6A 1U9JA 2YQ4A 3CXRA 1EQ2A 5CDTA 1AUPA 3PJFA 2YUTA 2W2KA 4Y6PA 1AE1A 4ALLA 2VYVD 3I9LA 4CMIB 1OFGA 1NFQA 4TRMA 1F14A 1NHGA 2QRLA 2DFVA 1ZXLA 3D0OA 3V1TC 1CRWG 1LQUA 2DPHA 3AW9A 2X9VA 3U4IA 4Z0PA 5DOZA 7ADHA 3WSWA 4U8GA 2ZQZA 4XIYA 3K9QO 2NSDA 1LLCA 4YJFA 3ZU4A 1PQWA 5KJ1A 3IJPA 3K2EA 5JCJD 4Z6KA 4CUKA 3DHNA 1DAOA 3I23A 5JAMA 1KETA 5BSFA 2VZ0A 4RV9A 3ZV5A 3C1AA 3PIIA 3C7DB 1A27A 2B4RO 4GAEA 4Y9DA 4IGFA 1P74A 1HDGO 5CPFA 5C7LO 2PGDA 2E4AA 2O4UX 3WMWA 4J91A 5KVVA 5EIOA 2O3RA 3JQ7A 3UCXA 4D44A 4XKJA 3VDRA 5ENVA 3ICCA 4GX0A 3U3XA 5ICMA 3GOHA 4R1TA 2G1UA 3D1LA 7MDHA 2D0IA 3RC7A 1LDEA 2I3AA 2IXBA 2EXXA 5JYEA 1UDCA 2DC1A 1I2BA 1DC3A 2VWQA 3JQAA 1KS9A 1XEAA 2B35A 3H9EO 4Z9FA 4AJHA 3BTSA 1LC0A 5L3ZA 2AEFA 1IY8A 3K2BA 3KUXA 1LSUA 1DRUA 4ZQFA 1U2DA 3CMMA 3DZBA 2V6GA 2TMGA 3PP8A 1R15A 3QQPA 4IS2A 1B0AA 3OJFA 5HWSA 1A72A 3I9NA 4E13A 5HS4A 4JX8A 4N7RA 3Q2IA 3EVTA 4YDRA 3NX4A 2JHGA 1PGJA 1UJMA 3NKLA 1IHYA 1PZHA 4IINA 4KOAA 4WPGA 4BNTA 1IPFA 1X1EA 3AM4A 3RQSA 4OO3A 4AVYA 1Z73A 3O38A 1Y8RB 1AHHA 5COQA 4BS9A 4CLRA 1CYDA 1R4NB 1EFLA 4RLSA 4FGWA 3OICA 4MP8A 2IYPA 3AJRA 3D3WA 3E8XA 1SBYA 1ADBA 1RWBA 1LNQA 5CDGA 2VOJA 3I6QA 5GZ1A 3ZNQA 2ZB8A 1NAHA 3K96A 4URFA 3O8QB 1B3BA 1E7MA 4PLYA 1YOVB 5H83A 3QWHA 4NH4A 3BMOA 1GADO 1HSZA 2X0RA 3U49A 4PLTA 1I3KA 4I5DA 5JCXA 4CV3A 4PZCA 1X1TA 3PHHA 4YT2A 1HLDA 4NG5A 3IL2A 3U62A 4RQTA 4DWVA 3UH1A 1MG5A 1E6WA 5BSEA 4L0QA 5AOVA 4R5HA 1N8KA 4P22A 3ZWMA 2HSDA 3L07A 4YA6A 2DTEA 3L6DA 4DQXA 3PDJA 5KJ6A 2VNSA 3LLVA 1SEVA 2P68A 1O89A 4K6FA 4AJ2A 3RIHA 2VHXA 3E9NA 2WTBA 4DMMA 1WP4A 1HRDA 3KTDA 3WMXA 3S2GA 4GWKA 1B2LA 2ZYAA 4N5LA 2Y0DA 4L75A 4RPKA 2J8ZA 2C2XA 2O3SA 3V2UA 2I65A 4I9NA 4DPMA 1IYZA 4JBIA 4BMSA 2YDXA 2ZTVA 4XIJA 1R12A 1YONA 5T67A 3ZW9A 5LDGA 1PS0A 3GDOA 3WG9A 1K89A 4I5GA 2BD0A 2IYOA 1HE2A 3U4HA 2HK9A 1E5LA 2O2SA 2NNLD 3EVNA 1N7GA 3D5QA 1ONPA 2DBQA 5F5LA 5TGDA 1U8FO 2HUNA 4J2OA 4LSWA 3VZQA 3BA1A 3PFWO 4FD3A 1E7SA 1PJQA 1U7TA 2YW9A 1ISFA 1TXGA 3MJEA 3ULKA 1ZCJA 1T4DA 4CM5A 2VUSA 4XR9A 3HNPA 3PHJA 2WM3A 3R0IA 1M6HA 1LI4A 2H63A 1LDNA 2P9GA 1M66A 4M8SA 3MTJA 4IQGA 4BNUA 5KNLA 4CODB 1I8TA 2BFAA 2X0JA 2GF2A 2O7SA 3A9WA 3GG9A 4EUHA 3WNVA 4W7HA 1WW8A 4EITA 1YWGO 1DDOA 3E9QA 2EV9A 1A7AA 1OC4A 1ZBQA 2PZJA 4GMFA 1F17A 3N58A 3V8BA 4IJKA 5K0ZA 4BNXA 4MOWA 2NACA 6ADHA 5KJEA 1E6EA 5DBFA 4A7PA 1NWHA 4BO9A 4HV4A 3D7LA 2NQTA 5C3MA 4FOSA 4QFDA 4C7JA 2PD6A 1ISMA 2RH8A 3M1AA 2X86A 5I9MA 4B79A 3I5MA 3EHEA 3P5SA 4J1NA 3ZWPA 4B4UA 5A5EA 5IJZA 1LX6A 2Q1WA 4GMGA 4O59O 8LDHA 2Y1GA 5EN4A 3FPCA 2AA3A 3L9WA 1FDWA 1DLJA 2WJPA 4BO5A 5JO9A 2VRBA 4P4NA 1I32A 2RIRA 3T7EA 1GAEO 3BTUA 3T4EA 1WWKA 1GEEA 2O7QA 4RGBA 4J9UE 1SPXA 3EAGA 1B8VA 3CEAA 2OUIA 5GMOA 1YBVA 4CMIA 3VH1A 4CV1A 4MIEA 3LU1A 5KVCA 1WXDA 1Y81A 5L4LA 1QYCA 1DBVO 1C14A 3PI7A 4I1IA 3PRJA 4XYGA 4KWHA 2D8AA 1T2DA 3C1TA 3FF4A 1O6ZA 1YKFA 2IDZA 4I9UA 1A4UA 2CF6A 3ZWOA 1YJQA 4ALMA 1XU9A 3DDNA 3GNQA 1HSOA 1VE9A 4BGEA 2XXJA 3PZRA 4YAGA 3KLMX 1JWBB 1I33A 1L7EA 1NQOA 2C7VA 4DRYA 1T26A 1I24A 2BI8A 2OORA 5G0SA 3V1UA 1T1SA 4TROA 3E9MA 1UZNA 1UZMA 3MTGA 5JLAA 1ZSVA 4AG3A 1DSSG 2ZTMA 3QJ5A 1KOLA 4UEOA 5TSDA 5TNXA 4E5MA 5A3JA 3ETEA 1X7GA 1N1GA 3PHIA 4BB6A 3PHLA 3PVZA 2GN8A 3QVOA 5EINA 3RASA 4DPLA 1E5QA 1JKJA 2GGSA 2RHCA 2C7GA 5BSGA 4YPOA 2P4HX 4H16A 4KUHA 2Z95A 1YBMA 4MIOA 4ALKA 5HRUA 4NJMB 3O03A 4U0KA 3VPSA 2W90A 4NZ9A 1KY5A 3QE3A 1D7OA 2AQHA 3GDFA 2X5KO 1P33A 5JO0A 2HCTA 3ROPA 3BYZA 4CM8B 2I66A 4Q3CA 1RKXA 1ZK1A 1E3SA 2QG4A 5TC4A 1N92A 1EE2A 1GPJA 1YH3A 4XDYA 5HS6A 4B7CA 4BO3A 3L4BC 1VL8A 1U4OA 4WEQA 2GRAA 4CM4B 4HUJA 4L74A 1PQPA 3FWZA 3GZNB 3L4BA 4Q3AA 1QMGA 1Y8RA 2W2LD 2OGUA 3HB4X 3AOEA 4IUYA 4ZGWA 1PJ2A 3MZ0A 1CETA 1P1HA 3LSYA 4XGIA 4GX1A 4TKLA 3GRKA 1EUDA 1PS8A 2B4QA 3RFTA 4Q3BA 2HK7A 3JD2A 4BHTA 2VWHA 4WCFB 1YBAA 4YRDA 3O8QA 2QYTA 4XB2A 4FSHA 5K9ZA 3RSHA 1YOVA 4LK3A 4RVDA 1JVSA 1XU7A 4D3FA 4AFNA 5ITWA 1UZLA 1OMOA 1ZXBA 3BTOA 4JCOA 5A1TA 5L7YA 4CLXA 5ADHA 4NI5A 4IY1A 1GD1O 5L95A 3ONDA 1NQ5A 2VQ3A 4BO2A 2ZJ0A 1ZJYA 3DFZA 3AY3A 3MOGA 4MVJP 3D3EA 2GLXA 5U1PA 4XDZA 3ABIA 4S3MA 2Q49A 4A5OA 2I76A 3H4VA 4EZBA 2X7HA 1ZK2A 1WMAA 3QWAA 3WNQA 5K6AC 3CTMA 2VRCA 4PCVA 2B69A 3RROA 1QV7A 5K6AA 3PWZA 2WDZA 4D45A 3PQFA 4YVFA 1G6KA 1A4IA 3QSGA 1N7HA 1RPNA 1FMCA 3O9ZA 1K2WA 4LMRA 4GWGA 1F0YA 2W4QA 3SJUA 1EBUA 2QZZA 2CY0A 4NU5A 4ZICA 1EMDA 3RAJA 5KCZA 4EYEA 2Q1UA 3U5TA 4XCVA 1KC3A 3JCZA 1Z74A 4XJSA 1M67A 3AWDA 3UOGA 3AFNA 1V35A 1QRRA 1E7QA 2CDAA 1Z45A 2Q46A 3AUSA 3ROMA 4DPKA 5KVSA 1NVGA 3UF0A 4CL3A 1IB6A 3VOSA 1K6XA 3GPIA 1R4MB 3AI3A 1YDEA 3PGXA 5KTKA 4A03A 1Y9AA 1U3VA 4QUKA 3RCBA 1F8GA 1GV1A 1LSJA 3JQDA 3RFXA 4DA9A 5CEJA 5ES3A 4XA8A 4N5NA 3MCVA 3VH2A 4KUGA 4CMHA 4JJIA 5T5QA 1TB4A 3EGOA 2A4KA 4E2XA 5EL0A 2FR1A 1E3JA 5JC1A 1H6DA 5HBRA 3OECA 4II3A 2DBVO 2CVQA 3H9UA 1CDOA 3O4RA 3ZCXA 4D42A 1UP4A 3SC4A 3U09A 5TJHA 4GL4A 4BNYA 3JD3A 1VM6A 4CM1A 1P44A 2YV1A 3FRJA 4I5EA 1QKIA 1JDJA 3RUDA 4PVDA 1Y8QB 2YV2A 3WGIA 2NTVA 1W6UA 4HKTA 1ENPA 3ZWWA 4E5PA 4DIBA 4DLLA 3ZU3A 4OJNA 4CR8A 3NJ8A 4CPDA 1LQTA 4R3WA 4ALJA 3WQSB 4CMJA 3UAGA 3WBBA 1ML3A 3KEQA 1IULA 1MG0A 1HWYA 3GN2A 5G0TA 1PGNA 3FSRA 2DLDA 1Q2XA 4MVJA 3JQBA 1NPYA 4D3DA 2V6BA 4A0SA 1P45A 2UV8A 1GYRA 3I9OA 2D59A 1LLUA
chains in the Genus database with same CATH superfamily
4YAFA 5EHQA 1HTTA 2D5LA 1Q0UA 1YUMA 1KSJA 1G1AA 4E31A 4LYFA 2H6EA 1FVXA 2RHJA 3ZE9A 1QGZA 1EFKA 4B3BA 2R751 2WWYA 1EBFA 2J5QA 1TNDA 2CVOA 1L7PA 2Y2UA 3W8EA 2HCRA 4D7AA 2JKVA 3RG2A 1G21E 1QTRA 2J9RA 4BNIA 1ISRA 3C7KA 1BXZA 4LGVA 5EEHA 3R75A 4IDFA 4OQEA 2DHCA 4FT2A 4BQSA 4YR7A 2ZT8A 3DUFB 1XMIA 4U02A 4Q6BA 3W8FA 1SC1A 2J3EA 5ERGB 2VDMB 2RGNC 3EBPA 3JR7A 1AIPA 3R0ZA 3WDMA 2FV8A 2WA1A 4N82A 1XQXA 1T2NA 2TMKA 4J49A 2ORED 3ZS8A 5ALMA 4C06A 1BCSA 4UZFA 1L5QA 1OWOA 1W6RA 5J4YA 1OXUA 3FPFA 3QF4B 2AH5A 3RKRA 1TLFA 2ZBRA 3JZFA 3T3EA 4D4MA 4D9FA 2CKMA 2WVGA 4QOFA 1NBIA 3VH4A 3TR0A 5CB8A 3L8EA 3UAVA 4MMYB 3VJKA 3IS3A 2LCIA 2JASA 3VKGA 3OCVA 1JG4A 4RPIA 3GLGB 1MUUA 1T2EA 3T5MA 1LX7A 4ZI2A 1CDZA 5EJ6A 4HP8A 4YJHB 3RIYA 2IHZA 4CRWB 4H77A 3L0BA 3K0HA 1HQCA 2JARA 1R1DA 5LFAA 2DE0X 4ZOQI 4L8GA 5FL7D 4HH0A 1P3JA 1UMCA 3A7EA 1NI3A 1AG9A 1QOQB 1N9KA 1HA3A 1Z5ZA 2PGLA 2Q1YA 2ZWMA 3EIHA 3KJHA 5JPIA 3DXFA 3H8VA 3CVJA 1R0ZA 1T5DX 2BYTA 3A1FA 1L2TA 2HF2A 3ETDA 3KS9A 3TCNA 4BO7A 4JSTA 1XIVA 2M98A 3GVIA 1ZUNB 3DAGA 2R60A 1QKJA 3KK0A 2GZ1A 2AN3A 3G6WA 3KZVA 4IFBA 5FCDA 4ENWA 2RH4A 1JDSA 2MIIA 3GZNA 3N59A 5DNEA 1NULA 1C1YA 3EEQA 5CJPA 2QJOA 2RG7A 2O3TA 4M83A 5H8WA 4JLAA 2D3TA 4O3FA 5BV7A 5ELLA 2PUJA 3T54A 4WCFC 5D85A 2QL5A 3FCXA 2OILA 3DZCA 5DULA 4L76A 4U3JB 1C3JA 4I4TF 1AKWA 1I4TD 3W5CA 4KU4A 3B9PA 4LY0A 2JJ2D 4HDKB 2HEIA 2ECQA 3I37X 3ETJA 4KDEA 4G67A 3ZDXB 4YRZA 1KDTA 3DSRA 1HYQA 3M9LA 1JIKA 2NZ8A 2XUFA 1S1CA 2X1HA 1FU7A 3ILHA 3OX3A 2J32A 4KQWA 4XGNA 3ZGZA 1ZSYA 2BY4A 4FMCF 1JILA 3GFGA 5IFLA 1AS0A 1A8PA 1XRJA 2NN3C 3E3OA 1NMEA 2FF5A 3OUUA 4YAWA 3TW6A 4CCAA 1JYSA 4TS9A 3AIIA 3JTEA 4MEBA 2R0QC 2QX9A 3U6KA 3RU3A 2XNDD 2VL7A 4NFYA 3RC2A 3CLSD 4IH9A 1Z12A 5A6VA 1EFRD 1XP5A 3GMSA 1RQNA 5H3HA 2HLDA 3D8HA 4HGQA 1U7XA 3AK4A 1MO5A 4YK7A 1C50A 3BXFA 5TQ2B 5FOXA 2GCNA 4UBJA 4DIMA 4Q1FA 3V7UA 3H0EA 5JATA 4RO0A 3HB0A 4L7VA 1E7WA 4V2UA 5C51B 4LE0A 1GIAA 5C9ZA 2X13A 3DBOB 4NICA 2RGBA 4K40A 4HWPA 1QWSA 1BMDA 3A1TA 2M6RA 1UJ2A 3O91A 4KO4S 4PZ0A 2GEFA 3O4HA 5COBA 3S2IA 1QQ7A 4DQKA 1MC5A 3UATA 4IUBS 5FTNA 2WMNB 3G2OA 4ZGGA 2J6HA 5L7TA 2HC9A 1EX9A 1CULC 2WK1A 1P9LA 1VECA 5BV1A 4DUYB 1IBSA 5B7PA 4GXQA 2GA8A 1SB8A 2C82A 1BS2A 4AQDA 1E2FA 2IPAB 4Q9JA 5I7WA 1DAFA 4IGKA 1USWA 2ZWOA 4BJ5A 3ONVA 4N40A 3OFKA 1RIFA 3MCUA 2WLSA 4LSMA 3URMA 3LMKA 1KZ1A 5A3QA 2PMKA 2ZVQX 2VNHA 1H4QA 4ZO6A 1R6DA 3STVA 3UAOA 2BGKA 3O82A 4MPTA 2KS6A 2RH5A 1DC5A 2GOYA 4V0RA 1SWVA 3N2KB 1WNFA 2HBYA 4YWJA 5EVJA 3EUAA 1GRCA 3ZLJA 3ROQA 3MLAA 4OJTA 1YTUA 1ZR4A 4X8MA 3CR3C 4OP1A 4HQKA 4K9NA 1G8YA 2HMAA 2XKAA 3DLCA 4QJBA 4UULA 1W4RA 3KTAA 4X24A 4PF1A 4ASUD 2PUFA 3R5HA 3MA0A 1K6JA 1EUZA 1E2PA 3MD9A 3NTVA 3Q10A 1JKFA 5AKLA 3U6BA 4BEJA 4B6QA 2FDRA 3KPWA 1PEDA 4M36A 4RENA 2P2SA 3V2HA 3R1IA 4PM4A 3VU8A 1Z34A 3AUXA 1KEVA 2C07A 4GWLA 1XCBA 2CSUA 4C0KA 4JQCA 8ADHA 2BFFA 3G8CA 2QN3A 3BE8A 1O3YA 3CW2A 3DD5A 2VDLB 5U4QA 4UREA 4IHAA 1PFKA 4EMTA 3MJDA 4LKRA 3IEUA 4QTZA 1Y4ZA 1JHRA 3GVCA 3LBFA 1UMBB 3JYQA 3ZV3A 4EKIA 2V3WA 5DGHA 5L3SB 4CEHA 2MSKA 1PR6A 1UC9A 2RHMA 2W4MA 4BKOA 4D5EA 4K9SA 4DB4A 4YJ2B 1PBNA 1XMPA 1MB9A 2VHQA 5HM6A 3TOVA 1XI2A 2AL7A 2OZEA 3M3HA 2ODBA 2WIKA 2XXBA 4MRSA 1KHTA 4E0BA 3JALA 4EA7A 3AW8A 4FJ2A 1JDUA 3WKEA 2PQ2A 1SG0A 3TPFA 3OIVA 4RKFA 4DCVA 1AGRA 3I6IA 4F97A 3VMFA 2I2WA 3DE7X 4NCIA 3EZGA 4JB8A 3SDZA 3VTKA 4AJOA 3RVQA 4L72A 3H5IA 2Y1LA 1U2QA 1P7CA 4LHSA 5AKXA 3ZDCA 5K0TA 2Q0QA 1KZGB 1IY2A 2GEKA 4ESOA 1ZITA 5C1IA 2JHPA 3V7YA 2D1RA 5G02A 1R9GA 2ZTLA 2DU8A 4KZKA 3KBBA 4JHLA 4YACA 1IBCA 1Z26A 2H2DA 3DDZX 4FHZA 3COSA 3LCMA 3K8QA 4K3UA 3W78A 5KB3A 4HN9A 4BB0A 1HF3A 4KIFA 4S1NA 1M8PA 3OU7A 2LIPA 4YCLA 1W49A 4QYWA 1ULZA 4MQ5A 3USCS 3KKPA 2DH6A 2HLHA 3F9RA 3GHYA 3VNRA 3FDZB 4BLQA 1ZZGA 4Z1OA 1ZU4A 2EX1A 4OL9A 1QM5A 2G06A 1W4LA 3ISJA 1SBHA 4BVKA 4Z3DA 1EJ6A 3IPAA 1MB4A 3IUNA 4WK2B 3GJSA 5LWHA 1ZVQA 3SCZA 4GPAA 2WAAA 4A3SA 4L15A 2BI7A 1JDVA 2FZLA 2Y9MB 3FVRA 4BMXA 1F1BA 3VR3A 4BNWA 2LDBA 5EZ5A 2GHQA 3NOQA 2X0NA 3T9FA 4Q4CA 2OV4A 3O2JA 4RJ2A 2V96A 1QFMA 3TSWA 4FHDA 5HXAA 4L4ZA 1SXJB 3F9IA 2B4KA 2IXEA 1ISPA 3BXXA 4R1OA 1ODLA 1XDUA 1M2VB 3NBXX 4U2KA 4W9NA 4I08A 1JSRA 1T1EA 1HUQA 1L4GA 4LYHA 4MX8A 3RODA 4YRFA 2H1RA 2B8WA 2GM4A 5KWEA 5ALJA 3STTA 5BOSA 1KK3A 2BFNA 3R41A 3HCOA 5K8TA 4KRGA 1EUQA 3LT0A 5CBKA 1P72A 1TCAA 1Z35A 5C7IO 1OX5A 4E09A 1RU3A 2Q5CA 1LBQA 4YAKA 2EW1A 2PDAA 1OYOA 1RAIA 1EEXB 1QYRA 2ACWA 2ZK7A 4O4LA 2OFFA 3WV4A 4Y6QA 1SKBA 4C43A 4D81A 1PUIA 3I28A 5EJ8A 4PVCA 2I55A 3EWIA 3L4SO 4Y2UA 4PLWA 2VA9A 3N0TA 4ADSG 5LNK1 1ZA1A 4ID9A 4YHBA 3AHIA 1G8PA 4I4NA 4RKEA 3BD7A 3WICA 1C7RA 1XTTA 1THGA 3RS3A 1XTJA 3L40A 3G0DA 4OKIA 3ZHTA 1JB1A 4G89A 2A7XA 3ESYA 4JP8A 5LYYA 1N0HA 4DRXB 3E03A 1T4MA 2WOJA 4I6JA 5LP6B 4NYIQ 2P41A 3DTNA 3LIIA 4HHEA 3K0CA 2HRCA 5AMXA 5K5EA 4BMCA 1QGYA 1BEEA 1U1IA 3T1VA 2JG3A 3KUCA 3ZY5A 1H1DA 1XN1A 5LXTA 4BO4A 2D13A 2R44A 5DM60 2BBSA 2C04A 3FPLA 4KQHA 2VJBA 4H3SA 1CIPA 2AN9A 2A0UA 4C2TA 1WCWA 3WP0A 2ZRKA 5F7ZA 4COOA 4DMFA 3FDJA 3TNFA 2R1ZA 2ISQA 2V7VA 3C6MA 1JG2A 5CT6A 2VJOA 1CNMA 3HWSA 4FFMA 2B8TA 2JGDB 1JEYA 4MS1A 1TM1E 2NV0A 3OCUA 5G2OA 5FAKA 1QP4A 2NVUA 1GCIA 2OESA 1DEXA 1MZPA 4BNFA 4AQ7A 4ER5A 4PG4A 2RGEA 1QDLB 2H1FA 2CE2X 4BECA 2AFRA 1BXRA 2CVZA 3HCCA 5BMOA 1JAXA 1X9HA 1RIIA 2WTEA 1H5QA 1T9ZA 4LX0A 2UYYA 2SCUA 4OJMX 4ZYWA 5CXSA 3RYCA 2AFIE 3DV0B 1IZ9A 1PP4A 2JAOA 5EEGA 3REFA 3SICE 1DUVG 3ZZ0A 4L16A 3ED5A 1Z2DA 1L4KA 2QI9C 1U0NA 3NYQA 4KI0A 1C7QA 3DBLA 2QK4A 2W6OA 3OF3A 1K9VF 4NCKA 3TTXA 3ZKAA 1KWKA 3FJOA 2BGJA 1YZFA 3BD9A 3BMCB 3MMZA 4K1LA 4CLEA 1NR5A 2IDJA 4NV3A 1ZJ5A 3RUAA 1SUFA 1YR1A 2OMEA 2QE7D 3AR6A 2RK3A 1HV8A 3PVCA 4OG2A 2JK0A 4IDEA 1TZKA 3BL5A 3DONA 2J4DA 4Y9TA 4Q4JA 5HFNA 4L85A 4QL3A 3PS9A 3PQDA 5JDIA 1UKEA 4PLFA 3RC3A 1C30B 3IBYA 3P9PA 3ADOA 4GOJA 2UUOA 4DTIA 3MTEA 1M1NA 1M6WA 3QHPA 2FTKE 2HSZA 5IW8A 3OKCA 2BEVB 2VRWA 5HIJA 1ZFNA 4X9XA 1AXGA 1GEGA 1GCOA 1CY7A 3R76A 2AT1A 1PWZA 3J81A 2A5JA 1YGPA 1ZSNA 1BYIA 1ODCA 2Q6VA 4HDOB 1ZCFA 3VDQA 2H57A 4FYVA 4JBGA 4YJ3F 3OEWA 1RABA 2GK4A 2Q5JA 1G6HA 3LBAA 3LXXA 3BDIA 4OGKA 4TTVA 3FIUA 3TNLA 3TOCA 2CV2A 2WTNA 1JGTA 3TIXB 3TWOA 1HL3A 3FXAA 1WABA 2GWRA 4P7KA 3A27A 2JCVA 3BL6A 3BMNA 4KAXA 5DLQC 3U4QB 3WA6A 4NMWA 2IUYA 2IYWA 1A95A 5GM2A 1N6PA 1EVQA 1ZGJA 4FOTA 3DCYA 2WU4A 3HI4A 1ZN8A 3WWPA 3QYAA 2PGAA 1TCVA 1NG1A 2Y4OA 3EVFA 3BHIA 3RYIB 1AD2A 1O9GA 3B89A 4CQMB 2EW8A 2Q5OA 2ODPA 3CR8A 5IDXA 3BQMB 3IR7A 4DSNA 1KARA 4QSMA 4LNUA 3HY3A 1EP9A 2D5BA 3OD1A 2XRZA 5BSKA 5UKDA 1C7ZA 1P2FA 2VSXA 1I4DD 2OCPA 2XH8A 4JVOA 4R41A 3UM9A 1I7QB 1H1TA 4TVOA 2XDYA 1FTSA 4GICA 1GPLA 1FFCA 4MVJF 4LISA 4M99A 4PRKA 3JSXA 1OGYA 3AF3A 1CSEE 2VP4A 1GZHB 4X0EA 4GKJB 2OV3A 5B55A 2HW8A 4NCHA 4OCZA 4QHSA 5EJ5A 3L8MA 2I3ZA 4MYUA 4AJPA 4Z7QB 3C39A 3FVQA 3WI7A 1S9DA 1SZJG 4PN3A 3JQPA 2VKQA 1ZI9A 1NDQA 4DGQA 3WK4A 1XAHA 1JQAA 2E82A 2RJNA 5DWDA 3WWZA 4QIHA 3E9EA 4YRNA 5JS6A 2GBGA 3UPDA 2A9FA 2NV6A 4LVUA 1HFJA 5C31A 1MXHA 2VZLA 2ZDQA 3P9IA 3GRVA 5ERXA 3VVLA 2WZDA 3JQCA 3BSYA 4FFRA 1R8XA 5JUWA 1QB8A 3F78A 1A71A 3TBHA 3ZCVA 1XEWX 4UD2A 4ZQEA 1O6FA 1RLJA 1W9HA 1X2BA 1F60A 4DSAA 1GTVA 4EI2A 4NHEA 4RTLA 3ACCA 1EP1B 1TTTA 5PNTA 3ZHZA 2ECOA 3A4YA 4H4EA 1RP7A 3NOOA 4CKZA 3MWFA 2QRVA 2QUIA 3Q7SA 4XPIB 3VKWA 4RM2A 5D7BA 4R7ZA 1IPEA 3BX1A 3KQVA 3LUPA 3ZNNA 1QIMA 1PFWA 4EKEA 1ZJ6A 3MD0A 4RUKA 3AY0A 3U3ZA 3AOEC 3OZIA 1KP3A 1V5FA 2Q2NA 3UJHA 2LBPA 1T8WA 2G9UA 2F3TA 3WLJA 3NIFB 2GBIA 3I3OA 3INGA 1I2DA 1W96A 3A06A 3B53X 3N8HA 2HA6A 3ZY3A 3BWMA 2BF7A 4LRTB 5IABA 1VFNA 2YZGA 3DO8A 2ZIVB 1WB6A 2DJ5A 4JOCA 1FSPA 2BH9A 5K3CA 4F9EA 1RZRA 1YQGA 5SYNA 1AS3A 3DLBA 4P1ZA 2Z2YA 3TCKA 2A94A 1J22A 1Q7GA 2IU6A 2FN3A 2WM8A 3HVUA 5SV2A 5F2EA 1RQ7A 5FPSA 4POOA 3HBFA 4MKXA 2TMDA 3RE1A 1RRFA 1YB4A 4RVCA 2R8EA 5DM2A 3TLMA 2DHRA 5B3JA 1EB9A 3IMFA 3RHFA 1FBNA 2VDRB 3DEAA 3MAAC 3N07A 3VVMA 3EOAI 2LD4A 4MPPA 4RZUA 3RF7A 3W1VA 4B6PA 4NABA 2EG5A 3EISA 2HJSA 4YUWA 3FOFC 1VA4A 3JQFC 5FNZA 3CB4A 3AF1A 4FOOA 5HCUA 1UMDA 1L8QA 3CLTC 2VDOB 4OQPA 5BWOA 3G9UA 5INTA 4GRIA 1YS2X 3H65A 5CYFA 4EYGA 1XRRA 1X0XA 1YZQA 1W34A 1T91A 3ZKWA 3KEMA 4EW2A 4FN4A 1XTSA 1Y5MA 1M34E 1QONA 4LK2A 4RD4A 5JQWA 5AD1A 2CXOA 2W00A 1ZH8A 3ZWXA 1VL1A 2BF4A 1IATA 2FMUA 2BPOA 4TYQA 4ZO7A 2SBTA 2HMTA 3JV7A 3PD7A 5IH7A 1P77A 1QKKA 5C8DA 5LMUB 2HQOA 4KQ6A 1ADCA 1NXSA 2NV2B 3HB5X 2V7QA 5F52A 4JI5B 3F0TA 4WKCA 2CXQA 2WB4A 3BXZA 1NW8A 5AJWA 5BSUA 2BJWA 2A57A 4WRRA 2QQ0A 3U81A 3V5NA 2E18A 3NVKI 4HVTA 4C1BA 2GPWA 3VSBA 3MHTA 4EX6A 3QG5A 1KZ6A 1T36B 4L8VA 1J8FA 1NSTA 4MR8B 4UFNA 4E33A 4EWLA 2ICAA 2IYXA 3LHIA 3OLQA 3T3MB 1VKZA 4YPVA 1E0JA 4R8VA 5LZ4A 3N0RA 3F3YA 4MUHA 1E1QA 2W8BB 4C3OB 3TSAA 1RKUA 1CY8A 1T4CB 1S6YA 1LDYA 3JYHA 4O1MA 3TZKA 2UUPA 4GNKA 4RESA 4UOEA 3I9JA 2AB0A 5K8UA 4IFEA 1JHZA 3PC3A 5JJLA 2W98A 2PT9A 4XYEA 4DS3A 1A76A 3TL6A 3ETLA 1GNVA 2CLSA 3E0XA 3JVVA 1QPGA 3OWHA 5IMBA 1Z8HA 3RVPA 3L8DA 1X15A 5IK2A 4EPXA 2WJVA 3QPVA 1TT7A 1E3IA 3P45A 4Y2RA 2DQZA 4PZYA 4F7WA 3WGLA 4E1VA 1EJ2A 4LTMA 3Q3HA 4V0LA 3VDNB 3I8OA 1V7CA 1YL6A 4INOA 4MB6A 4UM9D 1DAIA 2H2HA 4U00A 4GQBA 2IF0A 3BGDA 1CP2A 4PYKA 2WWHA 4RCVA 4RQBA 1Q77A 3E05A 3PEWA 4RTQA 1WPQA 5DYIA 4IF4A 3EZLA 4Y1EA 3NW9A 4M8KA 5T8KC 4B4OA 2KYRA 1REQB 1XV5A 3GAZA 3HN7A 5HA5A 1II8B 3ZLTA 2R86A 3OQMA 4KXQA 4UEWA 5F5NA 1N6RA 1G6OA 3U56A 4F8EA 1SUAA 1NXOA 3QPAA 4Q1BA 2BTEA 3NWPA 3QVUA 1BDJA 1F8FA 1ZDMA 2CZQA 1MP0A 4I14A 4R16A 4XTCS 2BUBA 5C2JB 2W2TA 1O95A 2QVBA 4NZMA 1GYQA 3LP6A 3ZTTA 1JQLB 2GCGA 3RUEA 2ZSUA 2P9YA 1E6UA 1N1DA 2J3HA 4J0DA 4MRPA 2V54A 4GGOA 1BWPA 1PJTA 5CRIA 1O0SA 1ISIA 4MDHA 1F7UA 3JYNA 1E9RA 1KK0A 2GYYA 4JJZA 5IKEA 2UUBB 1QU3A 1M0SA 1VKJA 3Q0IA 4KLCA 3PEFA 5HZKA 4YDQA 3DM5A 2EZTA 1WNTA 2J4FA 2OGTA 1QE0A 4XB6B 1HO3A 2DERA 4BGUA 4CI0B 4HH3C 3RVDA 3KIPA 3OEEA 4DIDA 1BNCA 2QZ4A 4OBBA 3FG9A 2Y0PA 3NFYA 5BR8B 3UWMA 1TAQA 1MOSA 2YJ4A 1JR3A 4IJ6A 2O5RA 1KVRA 2P77A 1IN6A 3BGVA 4JYBA 3E82A 1RTKA 5BVHA 2HLPA 1JKXA 4PCUA 4QELA 1UQRA 3BGIA 1JDNA 1VCIA 3RJTA 1XZHA 1MJGA 3S0JA 3ZGLA 1MX1A 3G89A 3M2PA 2W37A 5AM5A 2KB0A 1HT3A 3C87A 1AKTA 3DE0X 4ND3A 4NMHA 2H4WA 4CR6A 5B7NA 1EXVA 2VRCD 4F5DA 4EOGA 2O0MA 2R1TB 4W99A 2Q50A 3EEYA 3U9LA 2QLBA 2HR1A 1VSTA 4YJGB 2CW5A 3RS5A 3Q7RA 5AH0A 1LRKA 2OCLA 4AZ0B 3TF5A 1EQUA 4C3UA 1LPBB 2F1JA 3HNOA 1D9XA 3CWCA 1EP2B 3KU1A 4HNGA 4PGGA 1L7OA 5AXBA 2RGRA 2C29D 2JDIA 1PJZA 3DO5A 3NJ4A 2EKQA 3LX8A 4KDRA 3GMIA 4DMHA 4E1AA 1RI1A 4RL4A 3P9NA 3AJ9A 2ST1A 4QTXA 1VJTA 5TPZD 3RV4A 1Z63A 5ARCA 1YA6A 4MUAA 5KPJA 4IIHA 4B34A 1OXBB 1ZOOA 2NTYC 5REQA 5C46F 2OC4A 2LW7A 5KWIA 1M73E 4U7TB 1QCZA 2NGRA 5AXDA 2GZDA 2HK6A 3WB1A 1SD5A 4CTKA 1XROA 1SH7A 3C6QA 1PZEA 3VR5D 5HBGA 1W4AA 3Q7IA 1EWKA 1JTVA 1GXSA 4TRRA 1G21A 3M9WA 3IKMB 3F6RA 2POQX 3CVOA 4TQGA 3EYWA 3RYTC 3TL3A 4PO3X 1XTVA 1DZIA 4PXAA 2MDTA 4O33A 4BGIA 2O8DA 1X38A 4K46A 4OMCA 4CEIA 3QEMA 3EBOA 4JJGA 5KYVA 5KAPA 4WK4B 4GO1A 3JQ6A 1L7AA 1WUJS 1GU1A 1I3OA 4PW0A 2A67A 4U7PB 1KDZA 2ONJA 4BBJA 4C21A 4AXBA 1G8SA 4DJTA 3MT8A 4RU1A 4BFUA 1WMDA 3R6GA 5ITSA 3V4RA 1KR5A 5TF4A 2YJTD 4HWTA 4EI7A 1M6VA 5JXWA 1J0CA 2CE7A 2VYVA 2O8NA 1IWBB 1DC7A 4NE2A 3K5IA 4EPRA 2ZZMA 1HEYA 2E0IA 1LB1B 4WK0B 1NR1A 2GFHA 1JDTA 4FDVA 2HHAA 1DI0A 4EMUA 2O8BA 1BHJA 5K8LA 1HXHA 1MU0A 4IIBA 1UEXC 3R6TA 4LECA 3NBYC 2BKUA 3OTQA 3H5WA 4RL6A 2PL5A 5EE1A 4A10A 2VTDA 4IDBA 4HEQA 3V8QA 3LX6A 1PVDA 4W7IA 1OV4A 1I9GA 3QUCA 3OTGA 4MAFA 2VAPA 2NYRA 3AGPA 5FO0A 1GZ3A 4U6QA 2RGCA 1AUQA 1SU4A 2WIJA 1IG3A 3I83A 4Y6RA 4HNHA 3KFLA 4R68A 5C8YB 2M6KA 3FDFA 3HB7A 1NNI1 5KHLB 1V1RA 4YNBA 1X19A 1YI0A 2QP3A 2QYSA 4MVJD 3DMFA 3PEEA 1BCRB 1NZDA 3FSEA 3R5SA 4MP3A 4HAXA 4DR3B 4C2AA 1GTRA 4FCVA 2YIDA 3LO8A 4TZKA 5FJIA 4WL0A 3KCNA 2PSSA 1DOAA 4B7UA 2B82A 2ZIXB 4I9GA 5EKTA 4CGYA 1OFVA 2X9LA 3HYSA 4FMDF 3RIEA 1GPNA 2AE2A 2IYNA 2PQMA 2DPLA 3KCQA 1WCXA 3AKDA 4YC7A 1XG5A 2Z1DA 1XT6A 3QX7A 5JWHA 1BW9A 2ATVA 5AQ1A 4HS9A 4I1UA 4MRMA 3MPOA 1QRDA 3R5FA 1E2KA 1T1RA 2AD1A 2MINB 4I6GA 2TS1A 3E8SA 3KJZA 1XTRA 1I2MA 2J9GA 1RHKA 3L4EA 4NBLA 4URWR 5FOWA 3L9XA 3OZ7A 3VR0A 1Z5NA 3VYSB 3PZBA 3RUHA 3RW9A 4V1CA 5J40A 2OP1A 2OHXA 2VN8A 1OI4A 4Q18A 3JZMA 3NAZA 1C8LA 3VR6A 4PZUA 4F9TA 3CH6A 3OCZA 2OO5C 5BYJA 3LYLA 5EIEA 5CYPA 1J25A 2BEWA 4KBFA 2WNHA 5HKAA 4BFZA 1CUXA 5HOQA 3PDUA 3AJEA 5DIFA 5AM1A 1J06A 4GR5A 5CG1A 3ESQA 4JLSA 2GBLC 2ZDHA 3CX3A 2BGTA 3MERA 4F7DA 1LKZA 1MPTA 1SOUA 5K3FA 1O5IA 3JATA 2W2QA 4GVXA 1OY1A 1E3WB 2FXIA 4JOQA 4PS1A 4S0XA 5G4KB 1G8AA 2V9ZA 5I3CA 5AXAA 1XTIA 4Q02A 1HZZC 2Q3MA 1XPJA 1WCIA 1NX6A 4HB0A 3USZA 2WT4A 4FNOA 1IM5A 3O26A 4JROA 4P93A 3VZSA 3WIEA 2VTVA 1X87A 1BXGA 2BCGY 1B1AA 1C4WA 1Z5UA 5KWVA 2XOKA 3PL5A 4G0YA 2NAFA 1AC5A 1OPRA 1ZM3A 3E18A 4G8DA 4PAQA 5A2GA 1EFPB 5I7EA 2KI5A 2XTZA 4ER3A 3LVRE 4H7KA 2F1RA 2VLIA 1R4ZA 3KKKA 3NEPX 3OJ0A 4LJYA 4DN6A 1JLHA 5JIBA 4M8NE 1G5IA 3I92A 3R3UA 3RAPR 1B93A 1I0LA 3AR8A 1GPUA 3OM9A 1Z0AA 4RIIA 4P34A 4JLVA 3ESCA 1UXGA 1I3MA 4RKWA 2JJ8A 4CQJA 3M4JA 2PH1A 3MRXA 2YY7A 3ZQUA 2QRMA 3EVAA 4BQFA 3W3AA 2DBRA 2P69A 1EI9A 4ZO9A 2YIJA 3SNHA 2Q2VA 4N8SA 2UZ0A 3TSOA 5E1OA 3VHLB 1XQ1A 2GAJA 1GLVA 4IO0A 2C7OA 2HT1A 3OPNA 3SC3A 3BSSA 1OHHD 3JAKA 5U9CA 1DX6A 1Q1NA 2W8ZA 3ACBA 5LZ2A 4YP6A 3ABZA 3V4LA 1GPBA 1U0LA 3AVYA 2RAPA 1HRKA 3OT1B 4MW5A 4KXXA 5BUCA 2AJLI 4FSXA 2CD7A 1J8DA 1MIOB 1X13A 5EIHA 1XAJA 1FBTA 1IZZA 1K6EA 4GR9A 3CGGA 4E30A 5IARA 5JNVA 3VSAA 3F7MA 3DEKA 3V1YA 2VWPA 4TV9A 1V0JA 1QC5A 4P3XA 4BQRA 4RTKA 2IZOA 1TVCA 4JUBA 2WJHA 4FFOA 1H9AA 5LJLA 4HUTA 5IN5A 5TJ9A 1E1RA 5IKXA 1GZDA 3HV0A 1II0A 1EXDA 1F2DA 2B4TO 5F1PA 1G7CA 2QN1A 5KREA 3JASB 4HLDA 3G0IA 2MSEB 5GINE 1H05A 3PDIB 4ESVA 5AKJA 1YDWA 1KY4A 2H5EA 2C9OA 3MMXA 1LDGA 4OUDB 3D6HA 3FPEA 3G2KA 4CKWB 4DVGA 2OCKA 5C8VA 1CEEA 3VMMA 4XQ0A 1DS6A 2CEAA 2DPXA 5A5DA 2J33A 4BJ3A 1IBKB 3O2QB 4M49A 3N9IA 1G8GA 3UWOA 3P32A 1B14A 2JI6A 2GCIA 3CN7A 2BFBB 1CUCA 2YFHA 1YJ8A 1YZUA 1Q84A 2XMGA 5AI8A 2I7VA 4C4PA 2PXAA 1TVKA 2RHRA 1CVLA 2C96A 3NP9A 2IELA 4W8GA 1ZM7A 2ID9A 3AGQA 3NVAA 4O4JB 3PQ4A 1F3LA 4BE7B 2ZOSA 4XWAA 4CLRA 3U3MA 5AKZA 5JH7F 5J1SB 5B2FA 2YRXA 4EW3A 1J33A 1IWOA 1FRVA 3AVPA 4LHXA 2YQZA 1TYDE 1DIBA 4TMTA 1R5BA 3B3AA 4O25A 3NTQA 4IHJF 2SKEA 3BEOA 3NIGB 1I10A 5EP4A 2CCJA 2CHEA 1HLPA 4PC6A 1RVV1 3DCIA 3DUWA 3QNUA 3WRVA 1RYYA 1K8XB 2GEUA 5KTTA 1W29A 4M8LA 3ITEA 3WO1A 2FW7A 2WABA 3HGMA 2DLCX 3N7AA 1DKNA 2V9PA 5FTLA 4ARAA 3CO0S 2QU8A 3ICPA 3WLPA 4HX9A 1E77A 2O2GA 1W8IA 4IL5A 2QHXA 3WOVA 3WK8A 3X1XA 4BMVA 1M33A 3A4LA 5P8WA 5E9QA 3L82B 1FZTA 1ZK0A 1WPGA 3THRA 3H2JA 1MJFA 2JAUA 3LPNA 1MAWA 5IF3A 1NPDA 1T0BA 4AY2A 4DLYA 1I94B 2RONA 4HQRA 3UMJA 5KDOA 3NFRA 3GMDA 3JRXA 4EF5A 1YDHA 1KC1A 2H1SA 4JK3A 4K9LA 4XYMA 4CKCA 3AETB 1IE3A 4FFWA 4S24A 5IZCC 1HETA 1XZPA 3VJLA 2LPMA 4BZWA 1LDBA 4WBNF 5CCEA 4ZDWA 2LV8A 1UXJA 5JVDA 5JNRA 4KO3S 1RYZA 2HQ1A 5DGIA 1PHRA 5ALUA 2PPVA 4UMEA 1E2LA 3IH5A 3QKSA 4HDNB 4UNNA 3EPLA 4OKSA 5J9FA 4ZV7A 1KJZA 2PFSA 2LP4Y 3D5TA 4UNIA 3TEFA 4Z0NA 2HGZA 1IXRC 1PD1A 1CZRA 4G85A 4ZV4A 2CEKA 4FDAA 1X1AA 2C31A 3SWWA 3DOJA 5IN4A 4KYIB 2V7GA 2WMOB 1YQUA 3GJYA 5JAOA 1FK8A 2HRQA 4Q4HA 4OSPA 2ZRIA 3WGYA 1NDUA 2QTLA 3WIUA 2OCYC 1BGVA 4TXJA 1X3SA 2X0KA 4TMWA 1NNUA 2D3WA 1YL5A 4GPD1 2MR6A 4RV4A 1IOWA 1HTWA 2V0GA 2O1WA 5C3UA 3D43A 3QELB 4FC6A 4F2GA 3LCCA 3NRBA 1NAIA 3MBOA 2GVZC 3C8DA 4HPJB 3UV7A 3EDMA 4I50B 4RF3A 4RIEA 5GIOE 2PUEA 5CYGA 3MBIA 2VF7A 5LR6A 1STOA 4ITRC 2FN9A 3ZXYA 1O4WA 3AWIA 3SR4A 3T4XA 5JAPA 2QIPA 4JR1A 4FEEA 1DO8A 4K5QA 1DT5A 5FWXA 2BV3A 2WW8A 1U4NA 2WYVA 5HCNA 5KVQA 4AO8A 5H68A 2OV1A 1YSCA 2VPPA 3C3WA 1OH5A 3QLEA 4PYMA 1YTLA 2G88A 4RWEA 5J2UA 2BFCA 1YHZA 1Q1EA 3P5BA 4BKUA 1UBCA 3IV9A 3UANA 3E3NA 3GLHB 4DLWA 2BBWA 1E4YA 4BQPA 3LC2O 2ZRFA 2YL2A 2R00A 2PH3A 4OOFA 1PZNA 1H2WA 3E7FA 1DV2A 5FBWB 2BH2A 2OYRA 1DWUA 2NZWA 3R5JA 5F2OA 1MFZA 4WZ6A 1KMMA 2ENWA 2BFMA 2AZMA 3LTEA 3CKKA 1EFTA 4GLJA 4G86A 3BN3A 1CR1A 2AFIA 2HMVA 2HF9A 2WAYA 3RTEA 2EFEB 3QH4A 1XVVA 4H1UA 2WSSD 4Q5IA 5CBPB 1KZ7B 3RJ5A 3IHLA 2IITA 3R0QA 4F2PA 3B1XA 4GM0A 3SF0A 4ND4A 1TX4B 3MT7A 3FPAA 1YRAA 3FOBA 4IIEA 2BTQB 4MI6A 2VNIA 2OK7A 1N2XA 6LDHA 1XA3A 3CJQA 4OMUA 4DIOA 2C1ZA 2EP5A 2XUGA 4JXXA 5EXTA 2GBFA 4EB6B 1YC2A 1ZK4A 3HO6A 4YJ2A 2XSZD 4WIAA 3ZHXA 3PWKA 1ZESA 5FO1A 4HXGA 4ZHQA 4F91B 3RVJA 1YBFA 3OZUA 1ZJZA 3ICVA 1CJCA 4EB3A 2GPTA 3DPSA 4C7KA 1J2YA 4OFBA 2FOIA 2VG8A 2V7WA 3MCWA 5CGQB 1JQ5A 4QPZA 2FSPA 5DHPA 2XB9A 3OHPA 4B74A 3H7IA 4HYEA 1AN9A 2GN0A 4E3ZA 1NUQA 1KJWA 1SBNE 5I7OA 1JSXA 1M54A 2PYDA 3O84A 3SXJA 3W5VA 3EQ6A 4FR2A 3DEYX 2C3OA 1LBTA 3CW8X 1F3OA 3EY9A 3BJIC 4GLLA 4M4SA 4OI2A 1IH8A 5LMCA 1KK2A 4KXUA 1KHHA 1GR0A 1XDGA 4OMFG 4TUYF 1JUDA 4TL7A 2O07A 2DWCA 4PWYA 1MFPA 1U0EA 4RHFA 4DA4A 4XQ9A 4PZ9A 1JFSA 5HK8A 1PD0A 1DX9A 4OHWA 4GOXA 2PZMA 3NWJA 4A8TA 3WYEA 3IERA 1H3FA 4UTRA 4N3AA 1PEYA 3BRWA 3VO8A 4LG1A 2FR8A 3LGXA 2OBNA 3QLJA 1QO0A 3LWNA 1HT1E 1UZAA 1T8TA 1TUEA 1W0KA 3TLGA 5FPKA 1ETUA 1JE0A 1OA1A 1YR9A 2JCYA 3MJVA 1CZUA 1Q92A 1MC8A 3DBHA 3ISVA 1R3UA 1SIBE 3PLRA 3HCBA 5CX4A 1LS6A 5EZQA 3IELA 4Y6LA 5EZYB 1Q1ZA 2R6DA 5A03A 4KSCA 4FBGA 4B3JA 4RACA 2Q0XA 2PZFA 4GG1A 2NO9A 3CONA 3HR4A 2O06A 1N57A 2J9ZB 4B87A 3O2SB 2KMLA 2VCYA 2YBDA 1T9BA 4PYIA 4PS0A 1NN5A 3G5AA 1B8OA 3EZ2A 3WBJA 5E3HA 4MDEA 3EPJA 1BVRA 1UT8A 1DEAA 2FMIA 3OH8A 4HPWA 4M46A 1N33B 3LIPA 1GUYA 2C9ZA 3JARA 4IDNA 1U7OA 2RBKA 5DNCA 4QEDA 1XL0A 4F2HA 3GZJA 3ANTA 3D4OA 3DOHA 1FFWA 2IK8A 4P7JA 2L18A 1K3UB 4JJ6A 3O0TA 1AMOA 3NCHA 5HKKA 5JCOC 1KYIA 4X41A 4ZOEA 3RGWS 1ZUIA 2RI6A 3I2JA 5EY5B 3L8YA 3C6KA 4D3SA 3RSCA 3V4ZA 1PDWA 3AT1A 3ROXA 2W6JD 1JA9A 1Z68A 3HFGA 4BATA 3UA4A 2CDRA 3GRCA 1XKXA 2ZXEA 4MWTA 4Z8YA 1L5YA 1NN1A 2ZE6A 5DYNA 4XCXA 2Q4BA 4IEIA 1X3LA 3DBRA 2JHCA 3NDJA 4QA9A 3KXDA 3SKVA 1OROA 4DEVA 3DZIA 3KKMA 1AA9A 2XWJI 3RI3A 5IJ9A 3LNTA 2PSFA 2JPDA 4QJ5A 1IDN1 2RBEA 5EE5B 5LWQA 2W48A 2QTVB 1KO4A 5K0CA 1I14A 1NQUA 1UUFA 2ZITA 3GQVA 2XBUA 1DKQA 3JWHA 1KI7A 2PL9A 3RQIA 5FEUA 5I9NA 3PL1A 4AKSA 1JLLA 1R8YA 3PYMA 4H4CA 1P6UA 3LQ1A 4B84A 4E2ZA 2BKVA 4RFLA 5B1YA 4OHFA 2X8LA 3QJGA 4BRSA 4P5PA 3SXPA 1GKUB 4NTZA 2NO1A 1AS2A 3F71A 1A7KA 3LBNA 2XCIA 4HZUB 1L5KA 1V26A 4NAUA 3X1KA 5I4BA 1B3RA 1KI8A 3TX2A 4BB5A 2NU7A 2RAFA 2FQWA 1KAEA 4S0ZA 2C4WA 2G07A 4RA9A 2ZG6A 1FQOA 1KI3A 1T6BY 4RYLA 4UM5A 1CB7A 1PWHA 4BNDB 5CJ2A 3DVRX 3DZFA 2EHDA 2VHWA 2VZ8A 2XQVA 4BEVA 4MV6A 4O2AB 5JZMA 3OETA 5A3SA 3H11B 2BKXA 4L95C 4GM4A 3UWSA 2B1JA 3AERB 4NFSA 4M1OA 2YVQA 2ZB4A 3KPJA 5ANRB 3HVJA 4BASA 3SOZA 4XVCA 4JVLA 1OZAA 1E8MA 4KXLA 1LLDA 5AOAA 3R7WA 4H7PA 3WLRA 5CVUA 4CM6A 4EUNA 1PNRA 2QLLA 2ETXA 3M6XA 1Y9ZA 2CLKB 1WB4A 1P0PA 1V7PC 1ULHA 3R44A 2VZEA 4J0JA 3VOBA 1M34A 3VHQA 3KYCB 1W44A 4E88A 3LBHA 4CQLA 4QATA 5BWCA 5DP2A 4R9NA 1WDLA 3GCDA 4BFYA 3FTFA 3D6NB 5DW0A 4EVQA 1Y6RA 2B3DA 1LA2A 2RGWA 2QVZX 1XTPA 4LGCA 3T5TA 4ECAA 1H3EA 3ZWAA 3QUQA 4M9SA 5B1HA 2NUAA 4MLDA 4KX5A 3O1IC 2IX9A 4MQUA 4QQRA 1AMUA 4R9UC 3S2YA 2D4AA 4A0QA 2X42A 1KTVA 1N7JA 3K1ZA 4TSRA 3NBFA 5MGBA 1KKUA 4FX5A 1SKYE 3CJTA 3OX2A 5JDCC 2ZYTX 1GNQA 3CZPA 3VC1A 4EAAA 5LM3A 2CDCA 2G0NA 3ANLA 4RVOA 1T3GA 5LLDA 1S01A 3H2KA 1XVUA 4PQFA 4EDHA 2V65A 3G17A 1ZW1A 3QMMA 2UVDA 2Q5FA 4JNCA 1FXUA 2CNWD 1XNGA 4OOEA 3SQLA 2Q9AA 1ZHOA 3GWGA 2JNWA 3HVRA 3H05A 4TSFD 4EBBA 1LI7A 1TQ6A 4QXMA 4UOQA 1MA3A 1TAHA 4IZIA 4XWTA 4ZCPA 1OH8A 3PHCA 5ALYA 5CA1B 1EUCA 3NHBA