1LX6A

Crystal structure of e. coli enoyl reductase-nad+ with a bound benzamide inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
243
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Discovery of aminopyridine-based inhibitors of bacterial enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 84
structure length 243
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lx6A00
1AHIA 3ZWXA 1P0FA 2P91A 2Z1MA 3INRA 1ZSYA 4PLTA 1LDEA 4IDEA 2WE7A 1GR0A 4PG6A 4NBRA 2E6UX 1N1GA 2IDZA 3F4LA 4FC6A 2P9CA 4WLVA 4XYBA 1U3WA 4YBZA 3FRJA 4UEKA 5HWSA 2EJVA 5C3MA 4D44A 4ZJUA 4LRTB 3ROKA 4IDDA 2J5QA 3VPHA 2PNFA 1XQ6A 4MJLA 3ANNA 2D5CA 3WJ7A 1DAPA 4CMGA 1BDMA 1YDWA 4DYVA 5ILGA 2NNLD 4DBVO 1JDJA 4HFJA 1DIRA 4D43A 1P44A 2R6JA 3PGJA 3B20A 1OI7A 4IUYA 1PL6A 1ONPA 1R15A 1VKOA 1EVYA 2C0CA 4JK3A 3GC6A 4BO8A 5AOVA 3T4EA 4D3SA 3U4DA 4CM8B 2YHIA 4PCVA 2Y93A 4WOKA 3QWAA 4XQGA 2EEZA 1DIBA 3GGOA 4UULA 4DC1A 3VPFA 3GDGA 3GEMA 2E82A 1VJ1A 4OXKA 3R0IA 1HETA 1DB3A 1RM3A 2Y66A 5TJ9A 4E2XA 3JD4A 1QLJA 5I9NA 4KMSA 3E8XA 2HLPA 3I9NA 3QWIA 4W6ZA 3RJ9A 2YFQA 3QQPA 4UEJA 2B4TO 3RWBA 2NADA 4BIIA 4FFLA 4YYZA 2CZCA 1H9AA 3GGGA 3AOEC 2GGSA 3DBRA 4I5FA 4YCAA 4QFCA 3BMCB 2D4AA 1OC2A 5A9SA 4J1TA 4JBIA 3LYLA 2LDBA 3UHAA 3D0OA 1UJMA 2WMDA 1GQYA 3HN7A 4BO0A 1Q1NA 5TS3A 2C20A 5FYDA 2FZWA 4E2YA 1JW9B 2VOEA 3OJLA 2RH8A 3GZNB 2DAPA 5IN4A 3V1UA 1GYRA 2DUWA 3RFVA 1X7DA 1DIGA 4KQWA 4LSWA 1I10A 3UH1A 2ZQZA 3FNHA 1DC3A 1BXGA 2OBYA 3RSHA 1F17A 4E5PA 3UGKA 4RCVA 2RHCA 5KVQA 2CUKA 3C7CB 4Y6RA 4W7HA 5JDCC 3K96A 4EZBA 3EY4A 1GTMA 2GPTA 1WWKA 4OKNA 3ZV3A 3BTOA 1PJSA 3AI3A 1ULUA 2JKVA 3TOZA 3QRWA 3DXFA 2HMTA 1SMKA 1HYHA 1LRKA 1O8CA 1EUCA 1QMGA 2VTDA 3L0DA 4RDIA 5B4TA 4EEXA 2DM6A 1X13A 2YZ7A 3X2EA 4A2CA 3U49A 3PIIA 3QWFA 5KCZA 1X7GA 1LX6A 4TMFA 1M2WA 1XHLA 1TA4A 2VHZA 1X0VA 1ISFA 4KWIA 3UCXA 2B5WA 3H4VA 1VJ0A 4CQLA 3PLNA 3P7MA 3JQ9A 4ND3A 1D8AA 4PLHA 5KKCA 1KS9A 1VKNA 2V6FA 4CV1A 5JXWA 1MC5A 4ZQEA 5IAAA 1V9LA 5L95A 4MIEA 3BHJA 3CE6A 4Q3AA 5EINA 1GZ3A 1ONNA 3PJEA 2IEBA 4YJFB 4CLDA 4JXKA 2EERA 4FD3A 3RIHA 4FB5A 3NKLA 3AM3A 1OC4A 4MVJE 3PDJA 1QV7A 2AQIA 4J4TA 1GV0A 3ZU5A 1XCBA 3QSGA 2XF8A 5EESA 3WBBA 3V8BA 4DIFA 1N9GB 1X1EA 1T4BA 1GV1A 3QVWA 5EIOA 3AUAA 4LK3A 4MVJH 1PGQA 2GN9A 5CG2A 4R41A 1RPNA 1C0KA 3ZU4A 4O63O 5JDIC 2HJRA 5A03A 4XQCA 2G5CA 1M6WA 5K6AA 2D0IA 4L4SA 4TVBA 5ICMA 2RH4A 3WLEA 1I2CA 4GGPA 3B1JA 3HFSA 3L6EA 4GMGA 4IMRA 4I08A 4DIOA 4KQXA 1EQ2A 5G0TA 5G0SA 1CYDA 4BKPA 3E1KA 3ROMA 3GNQA 1C1DA 1HDRA 4JN6B 4J43A 1P77A 3MJTA 3TSCA 5KTKA 3E9QA 1NM5A 3DHNA 2CF5A 3PJDA 4TROA 3DAPA 3ON5A 4W9NA 5IG2A 4XGKA 4BO5A 3FD8A 4YAGA 1WMAA 3TL2A 1C3VA 2ZJ1A 2F00A 2JAPA 3PQEA 2A92A 3JQGB 4XEHA 4XYLA 4P4NA 2BFAA 3NTQA 4ND5A 1Y9EA 3MTJA 3PI7A 4E30A 2C07A 4B79A 1L7EA 3FNEA 1LRLA 3GG2A 5FFFA 1H2HA 1UXKA 1NFFA 1QYDA 2O2SA 3PPIA 4B7UA 1UUFA 1V6AA 3BHIA 4Q39A 4EJ0A 5L40A 4CM4B 4N5LA 5JW6A 4RL6A 4M49A 3OSUA 5CDSA 1V8BA 2AXQA 3ROPA 4BNWA 1M67A 1QKIA 4L4RA 4E31A 3O4RA 5J23A 1XSEA 1YKFA 5H83A 3ZH2A 3C1AA 3JQFC 2OXIA 3ZWMA 3FN4A 2HK8A 4KDFA 4XKJA 4FW8A 5EJ2A 4OOFA 3ETDA 5A9TA 4LVUA 4Q3NA 3SC6A 3DEYX 4E6PA 1Y1PA 5KVCA 2BKAA 4XX0A 3VC7A 1YE3A 1N8KA 2EKPA 1WDMA 3TL3A 5BSHA 5TJHA 5I7SA 5L53A 2Z1NA 3VZRA 5HA5A 3RC2A 1EEHA 2ZCVA 3IAHA 4RDHA 2R2GA 2OZPA 1YO6A 1B8UA 1PJBA 2W2KB 3K2BA 2NQ8A 4WCFC 4BNMA 2OORA 4WJZA 1ZK0A 3ZV4A 4IDAA 4J9UE 3WDSA 1HZZA 3GHYA 4PLFA 2YW9A 1EBFA 1EVIA 1E3SA 5TC4A 1A9ZA 4AJ2A 2AEJA 1ZO8A 3VOSA 3DL2A 4JJFA 2CVOA 1YDEA 4WLNA 3PQDA 3O38A 3IJPA 1NR7A 4L9RA 1MGOA 4RV9A 3UW3A 1KVUA 3RCBA 3F9IA 1DC5A 3TZCA 1U5CA 2A35A 2VHYA 4H3VA 3EW7A 4HP8A 1O94A 3WXBA 4ZU3A 2RBEA 2GYYA 3PQFA 1ZMTA 4ALMA 3F47A 1A7AA 4MO2A 1C14A 2VWHA 4A7PA 3D3WA 1PX0A 3HSKA 3JTMA 2AA3A 3BZUA 4PFJA 5G4KB 1K6IA 3IUSA 2NUAA 3QA9A 4QT0A 3SC4A 4IY1A 4RLSA 4Y6SA 4D7AA 4YACA 3JYOA 3DBVO 2OL4A 3PYLA 3SBOA 1U3VA 3ZWWA 3JV7A 2UUPA 5C37A 1K6JA 5U4QA 1DC4A 1J0XO 5JAIA 5L9AA 1E3WA 5FEUA 1AN9A 3GVXA 2PD3A 5A3JA 4YXFA 1O0SA 3FI9A 3I9MA 1H9BA 3D5QA 3GN1A 3PGXA 3ADOA 3I52A 3NTOA 5IFLA 4MVJI 4R5MA 2CMDA 1QV6A 3WYCA 4P8RA 1DLJA 3H7AA 4ZA2A 5I7VA 1EBUA 2PGDA 5L4LA 1LDBA 2NTVA 4H16A 1DFHA 2PD4A 1M75A 2BI7A 1NVTA 1FXSA 1E7SA 4FBGA 3EDMA 3D4NA 1NHWA 4AVYA 3E9NA 1DXYA 1JN0A 3BXXA 2AEFA 4UVDA 3FWNA 5B1YA 1T2CA 1GD1O 2H9IA 4LCJA 3WTBA 1SO8A 4S1VA 3N74A 3GDOA 4XIJA 5JS6A 3ANMA 3PP8A 1BXKA 3CUKA 3QHAA 2NM0A 3VH2A 4L75A 1HDXA 2Z95A 2ZK7A 4JLWA 2BH9A 2X0JA 1SEVA 2DQ4A 1HE3A 2O48X 1U8FO 4BGVA 5CDUA 3VZSA 2BRUA 1YOVA 1ADFA 2GN6A 2D5AA 4C7KA 1GUYA 4EJMA 1YGYA 2JJYA 2FPPA 2GNAA 3RQSA 3WLFA 4TRNA 3DOJA 4A03A 1EVZA 4MVJG 4B7CA 1ORRA 2G76A 4CV2A 4KUEA 4NBUA 3GMDA 1PJ4A 1ZVMA 3H9EO 3HJAA 4FJ2A 1PR9A 3RFXA 2C2YA 2IXBA 3NDJA 4INAA 5L3ZA 4WK6A 1OOEA 3OMLA 5KWEA 3AUUA 5DP2A 3DTYA 4DWVA 4YRAA 3A9WA 1Q0QA 4CMEA 1QYVA 4ESOA 5B12A 2QHXA 4RJTA 4YB8A 2CNBA 2VRBA 5EN4A 1XU7A 3JQ6A 3AI2A 3NDRA 3MOGA 4LW8A 4PG8A 1O95A 4CLOA 4BMSA 1PGOA 2VCYA 3Q9NA 1KEPA 3WBFA 3HN2A 5T8KC 3KSUA 2JFGA 2G1UA 2VZ8A 2E49A 2HDHA 1ZZEA 5JSFA 5K9ZA 2TMDA 1AGNA 3IIEA 3PRJA 4NBTA 3I1JA 4MPDA 1EMDA 1BMDA 1TT5B 4MVJD 1Z73A 3K8ZA 5JY6A 3ONFA 4IDGA 1A7KA 4J49A 3AM4A 4J2HA 5C7OO 3F46A 3GVHA 4Y8VA 2ZKLA 1BHSA 1EUDA 1PQWA 1YH3A 1PU2A 1YL7A 4ND4A 4ALLA 4PG7A 1E1LA 4ROSA 8ADHA 2FPGA 2NWQA 4L74A 2PA3A 3RBXA 2P68A 2O3UA 2E4AA 5IN5A 1QG6A 3EUWA 3BHMA 4B4OA 4BOYA 4EYEA 3NGLA 3GF4A 4IQ8A 4QO7A 4CQMB 3SVTA 4FGWA 1HL3A 2NU6A 4MIOA 1Q2XA 2WTBA 3KHUA 2AEMA 5IDXA 1YQGA 3BMQB 2B69A 1DRWA 4R1UA 2RIRA 5H81A 2P2SA 3VDQA 3WNVA 1HE2A 4RO0A 2I6TA 3DHYA 4F46A 3TPCA 5DNAA 2AQ8A 1FDSA 5CAEA 1E3EA 2ZB8A 4YAEA 1UP6A 4YAIA 1EUZA 4RF2A 2DPGA 2BMAA 1PL7A 4A10A 1JLLA 4CUZA 4IXWA 4HXYA 4QFDA 5I8ZA 1I3KA 4WEOA 3O26A 3UN1A 4RVDA 2GSDA 1AUPA 3O8QB 4YRDA 4CMBA 4XIYA 1ENZA 3ENNA 4J1NA 2XOXA 2Y1EA 3S2FA 4HADA 3AUTA 1N7GA 2NVWA 3QV1A 2ZB3A 4S3MA 4UUOA 4Y67A 4YJGB 5JCXA 1B16A 1NQOA 3PWSA 3ZI0A 3GR6A 3TJRA 5FI5A 4R51A 5BSEA 2IRWA 1HDCA 5TT1A 2ZQYA 3U0BA 3DBHB 1E7YA 3IKVA 4Y98A 1S7CA 1A9YA 3I3OA 1B26A 2CF6A 2X5JO 3F3SA 1P1IA 2I67A 4AJKA 5I7EA 4URFA 3BMCA 3AFNA 1Z45A 4FGSA 3WYBA 1VSUA 4DQVA 5DZSA 4EUFA 3W8EA 3WGHA 2BI8A 4CQMD 1JKIA 1W4ZA 1E1MA 1E77A 1PS8A 3H9JA 2GLXA 3KVOA 1XWFA 4XRRA 4BNUA 5BNIA 3QIVA 1BXZA 4RVSA 4E21A 1Z7BA 4Z0HO 4CLRA 1T4DA 2Q46A 1NVGA 3ZNPA 4MVJF 1W73A 3H9QA 3Q2IA 1DLIA 5DBGA 1RKXA 5TF4A 1PWXA 5IF3A 1JKFA 2EWMA 5T5QA 1I8TA 3RKRA 2D1YA 4XYEA 2W2LD 3PZBA 5ILOA 2EF1A 2QRKA 1CRWG 1E5LA 4U7WA 4FR5A 3PJFA 4ZD6A 2DPHA 4FC7A 1N1EA 3ST7A 4PLCA 1NASA 3WG9A 4O1MA 3DO5A 2LDXA 2QIOA 2QRJA 3QVOA 1XELA 2GERA 2HMUA 5T6BA 3JQAB 3KSDO 5AXDA 5KKAA 3W6UA 3KSZO 1EE2A 1TEHA 1ZW1A 3TWOA 1LUAA 4FFPA 3HE3A 2YHUA 5B37A 4YQYA 4EI2A 3WGGA 4AJ1A 1GZ6A 4BV8A 4J7CA 3RFTA 3INGA 5IJZA 2H1SA 3S2IA 3BA1A 5JYEA 4R1SA 5JNLA 2D2IA 4M54A 4RPKA 1RM0A 1T2DA 4AL4A 1P33A 3DB2A 3L6DA 2DLDA 5LDGA 5A4DA 3TFOA 4YJFA 1TVEA 3ZHXA 1FK8A 9LDTA 2AE1A 1GUZA 1R66A 4E3ZA 1MV8A 1C1XB 1F06A 4IBOA 4ZGWA 3R1IA 2VZ0A 2PZKA 1QYWA 4OL9A 3OJFA 1DC6A 1N9GA 2X6TA 2Y0CA 4UUPA 5IDYA 3DONA 3UFXA 3ZN2A 4R68A 1GCOA 4GPD1 3KV3O 1B7GO 2B83A 4IIVA 3RUHA 2IYPA 1IL0A 2IZ1A 4YT2A 3LT4A 3D4PA 4OJNA 4CV3A 1HF3A 2PTGA 4LISA 4RQTA 3WGTA 1B3BA 2CDCA 2R00C 3ADPA 4XWYA 4CMKA 1H0KA 1K0UA 2PKRA 2J5KA 3OJOA 3VAZA 4AJIA 2P4QA 3VZQA 4AJ4A 4UVEA 3C7AA 1LDNA 1E1NA 4BMNA 1LU9A 1ENPA 3JQAD 4FS3A 1KY4A 1CWUA 4HNGA 4IPTA 2QZ9A 3HNPA 3L4BA 4HKTA 2VOJA 2HCTA 3C3XA 4ZHSA 2OFPA 3NV9A 1MC4A 4IGFA 1LLQA 1TI7A 4HWKA 1PZEA 2TMGA 2B36A 4MP8A 3KB6A 1C0PA 2Q1TA 4LGVA 4EUEA 1GCUA 1D7OA 5F3RA 3ZHYA 3TDKA 5L4NA 1ISGA 4BMVA 1LXCA 1R0KA 2FP4A 1KYQA 4Q3CA 4O59O 3AY3A 1W0CA 4YTEA 1S6YA 3CEAA 4OMUA 1MX3A 3WQQA 3AU8A 4EUHA 3GY0A 4XYGA 4UVHA 4OQYA 3WQRA 4CM4A 1NX6A 1IHYA 3ZWNA 3DOCA 2NTNA 5DCYA 2IXAA 1GADO 2VUSA 4U0KA 4RPJA 5JMWA 3VZPA 4E33A 1YBAA 3DZJA 5AXBA 4RZIA 3D3EA 4RF5A 4CL8A 1WNTA 5MDHA 4F6CA 1U7HA 2NTJA 4JX8A 2D3TA 4WGGA 2JHGA 2NVUA 1SCUA 3JD2A 3B1KA 2X5KO 2BFOA 2YYYA 1ISHA 4H7PA 3EZYA 4FJ1A 4C4OA 1DPGA 3D5TA 4NBWA 1PS9A 4JROA 1WDKA 1Y8QB 3RI3A 5JO0A 2HK9A 4WLFA 5KJ1A 1B2LA 2I9PA 2PD6A 3PWKA 3S1LA 3DZIA 2W2KA 4CMCA 3DQPA 4A73A 3H9GA 4IXTA 4D3FA 3AOEA 3WIDA 4Z3KA 1X1TA 3BMOB 3KYCB 4PG4A 3BMNB 2PKQO 1FF9A 1D4FA 1E6WA 3LZ6A 5EQDA 4BO9A 4LRSB 1C0LA 4CUKA 1NQ5A 3I6IA 2V6BA 1ENOA 1LLCA 1IY8A 2I5PO 2YY7A 1U4OA 2I65A 3GPDG 2W98A 1XLTA 1G0OA 1WZEA 4XDZA 1JTVA 3HWRA 2QX7A 2EW8A 4BO1A 2AE2A 4F6LA 5TRTA 1U28A 5COAA 1E7MA 3GNSA 4GAEA 4MOWA 2VHWA 3WMXA 3KO8A 4IM7A 4TRMA 1YXMA 4BKOA 1ADCA 2YV2A 4U8GA 4P4LA 2EGHA 3W4JA 4W4TA 2W4QA 2WM3A 2VWGA 3AI1A 1MXHA 1KEWA 3GT0A 1MFPA 3D7LA 3EHEA 1Y8RB 3JQ7A 3ZHBA 3PFFA 4BNKA 1MP0A 5G4KA 3RC9A 2WD7A 4J2OA 4DPLA 2C7VA 5JAZA 1SOWA 1ZK2A 1XQ1A 2A9FA 1ISJA 3ETEA 1PJ3A 3CZRA 3NT2A 4I5GA 4BQPA 4DQUA 2CSUA 5LCXA 3GEDA 1ZIDA 1K89A 1NFRA 4B4WA 3I23A 3M1AA 3N7UA 1LA2A 1YS4A 1UDAA 3RUIA 1PEDA 4IJWA 3WMWA 4R54A 3IS3A 2DUUA 2IZ0A 1V3TA 3CKYA 2FWMX 3OBBA 4QO8A 2QW8A 4HUJA 1ZJYA 3MJSA 2QZZA 4CR6A 4E2WA 2P9GA 1UZLA 1PSDA 4AICA 4UVIA 4PZCA 4R3WA 3I83A 2P5YA 5A02A 2HMSA 3PYXA 5ITVA 4J1QA 4ZQGA 3C24A 3RASA 2B35A 5LDHA 4B7XA 1QORA 4I9UA 5CFZA 1GQ2A 1P0CA 1AXEA 1PR3A 2A94A 3KYDB 3OQ1A 4IINA 2VN8A 4MVJA 3V1YA 5TT0A 1T1SA 3OFSA 5ENDA 4E0BA 3MWDB 1LRJA 4WNCA 4Z9XA 1VL0A 1DJQA 4YDRA 4BNYA 1R4MB 4NBVA 3C7DB 3GRPA 1F12A 5HBRA 5KJFA 2D59A 4QXMA 1AXGA 4QUKA 3ZU2A 2X0NA 4KUHA 4UUMA 4CM1A 1DIAA 4K6CA 5TIIA 1JVBA 2I3AA 1UAYA 3FPLA 5HTOA 3WYEA 1ZJZA 1HT0A 1QXSA 3W4KA 1NVMB 2VYND 3TOXA 3VPSA 3JQ9C 2IZZA 4Y6PA 5L51A 1X0XA 4DUPA 3IP3A 3EYWA 5CDYA 1M66A 1TB4A 2FMUA 5EERA 3G1TA 4U6QA 2O3TA 2EKQA 3H2ZA 2P5UA 5T57A 3ULKA 1JA9A 3NJ8A 1Y5MA 1P9LA 2O23A 4XR4A 2VT2A 1X7HA 1GEEA 3KEOA 2PZLA 1HLDA 1FDWA 4FFRA 5I8WA 4BNXA 1NHGA 3CINA 3GVIA 4ND2A 5A05A 2C5EA 2OMEA 4BKQA 3T7EA 1AHHA 4J90A 1DOHA 1SEPA 4DYDA 3UXYA 4KDEA 1P45A 2HU2A 5U9CA 4BNLA 1LLUA 2BD0A 1BGVA 1HTBA 4QEDA 4BNJA 2B37A 4WLEA 1TT5A 2UVDA 3QLJA 5U1PA 3V2HA 5K6AC 1MLDA 2YUTA 3IP1A 1YRLA 3ZWAA 4XCVA 2CFCA 3IQDB 3KLMX 4FQ8A 4CM5A 2D8AA 3ZNQA 1Y9AA 3JQBA 5T67A 2JHFA 4MINA 3LT2A 1FDUA 4OYRA 4AG3A 4RORA 3PIDA 3F6YA 3KXDA 1N92A 3QWHA 4L76A 3TFQA 3GQVA 5HM8A 4HNHA 4D41A 1CQIA 4B8ZA 5A1TA 3EMKA 3HZZA 4GLOA 3ZHZA 5ENVA 4CM9D 4O0LA 4W9NC 4CQMA 1ZCJA 3G1UA 4UEOA 1LDYA 1KC1A 1U5AA 1NR1A 3DR3A 4RVGA 4BHTA 3BMQA 1KY5A 2X23A 4E2ZA 3G79A 1K6XA 1KEVA 5AXCA 1P31A 2E37A 4BNVA 5GZ6A 4IJKA 2B4QA 3K30A 1NTOA 7MDHA 3OQ6A 4Z9FA 4ALJA 4M87A 3SXPA 5TLSA 1MG0A 3E18A 3U9LA 5IZCC 2W2LA 3BTUA 4BNHA 5C7LO 1HDOA 3GGPA 2RCYA 1A27A 1JU9A 2JCYA 2J3IA 4A27A 1WXDA 1I33A 1JVSA 3LLSA 1J49A 1I3MA 3OIFA 3PLRA 3ROQA 3RU7A 5L7YA 1Q7CA 4NQZA 5TX7A 4YJGA 1EDOA 2H5LA 3A4VA 2PZJA 3G3EA 3K92A 1ZK3A 1G0NA 3LC2O 2WYVA 4MP3A 3UVEA 3WTCA 3HDHA 5HS6A 3DBHA 1B8VA 1FJHA 3JCZA 3GAFA 5C7IO 1YB5A 1YWGO 3FCOA 1VL8A 1LSUA 3AY6A 4H15A 2AQKA 3EK2A 4BO7A 5AVOA 2I3GA 3DZHA 4U5QA 1Y6JA 3GOHA 1KIFA 1ZEJA 3DBLB 4GVLA 3PHHA 4IQGA 3OA0A 4OQZA 3SEFA 1HE5A 4R3NA 1GYQA 4TSKA 3L9WA 4NI5A 2JFFA 1E6UA 4WE3A 3DC2A 1I30A 1FDTA 4J0EA 4R1NA 4QTZA 4R69A 4D0RA 1Y5RA 3S2GA 3DBRB 1TT7A 2GCGA 5BNFA 1ARZA 3ONEA 1EQUA 1YB1A 2PFGA 4I9HA 4BNGA 2EXXA 3K6JA 4JJIA 5CDTA 4RF3A 4JBGA 4DLAA 1P3DA 2WYWA 4LN1A 2FOIA 1VPDA 2Q3EA 1EFKA 1VE9A 4P22A 1BXGB 3LC7O 2VQ3A 3NX4A 4YVFA 4GH5A 5ITWA 4Q9NA 2O7QA 1GZ4A 1HDGO 3JQAA 4ID9A 3TZQA 2DC1A 2HJSA 5DCWA 1SC6A 2X8LA 3CZMA 4TKMA 1C0IA 4J0FA 2Q99A 3NRCA 1IE3A 1HE4A 1NQAO 4L73A 4W99A 2PLAA 3GNTA 4RF4A 3ASVA 4E4YA 4XDYA 1MA0A 3RUDA 4WECA 3WFIA 1H5QA 1NWCA 4PZEA 3KETA 5IDQA 4R4JA 3NGXA 3DMTA 1E5QA 1RM4A 3BTVA 4NK5A 2IYOA 2FZEA 1UXJA 5JCJD 1BDBA 1C1XA 5JY1A 2YFHA 3AFMA 3LK7A 4GX0A 4CQLB 4MVJM 3HDJA 2PY6A 2C82A 3OA2A 4HBGA 2Q50A 4OAQA 4LSMA 5JYDA 2O3JA 3QJ5A 3FWZA 4AJEA 1YJ8A 1HYEA 1ONOA 3TQHA 4ALKA 1XU9A 1HWYA 9LDBA 4F45A 1BWSA 5EMHA 4AJNA 5DF1A 1P1KA 2AG5A 3E82A 2SCUA 4NJMB 4BUCA 3DTTA 2C7GA 3WGYA 4CMIA 3H5AA 1ML3A 2Q4EA 4GWGA 2NACA 1ISIA 1SPXA 4OGWA 3V1TC 1YL6A 4J4BA 1U7TA 4A0SA 3E9MA 2HK7A 3MEQA 3GVPA 1HLPA 3TN7A 4K28A 3V2GA 5KVVA 4F3YA 1RWBA 2DKNA 4Q3DA 3K31A 3WB9A 3JYLA 2V65A 3ENKA 5F5LA 4JJGA 5TSDA 1NPYA 1E7WA 1R37A 3GUYA 4BB6A 2AHRA 3CIFA 1ZK1A 1J6UA 2BFMA 2HAEA 4RZHA 3UF0A 1M6HA 4NDNE 4IZIA 4MKRA 1ZEMA 4HFNA 5CEJA 1UXGA 1V0JA 1A4IA 2EP7A 2F1KA 1I32A 1KEUA 2VUUA 4BNNA 4FCCA 5L7TA 1ZFNA 4FIZA 4N7RA 3S8MA 1I5RA 3DWFA 1ADGA 5JC1A 3WWYA 1FMCA 4XGNA 4YJHB 1V3VA 1DAOA 1O89A 2Y1OA 3GPIA 3X2FA 1LSOA 2HKIA 3GH3A 4DQXA 4J9VA 4N18A 1ADBA 4BGEA 4CMEC 1EK5A 2JCXA 1AE1A 4HFRA 1QYCA 1BW9B 5KVSA 2XPCA 3JQ8B 4NHEA 4LMPA 4PLVA 3Q3CA 1CDOA 1GDHA 3F4BA 3WFJA 4E5KA 3E03A 2QYSA 2FR1A 2I66A 3ZWBA 4ZQBA 2DVMA 2OP0A 3B70A 2X58A 4WCFB 4GSLA 4X54A 4E5NA 2JD0A 4YT4A 3LF1A 4J6FA 3IUPA 4CR8A 5CPFA 3K2EA 3H65A 3IJRA 3FNFA 4TRRA 1Y8QA 3ZV6A 3MJVA 1XYGA 4YPOA 1EFLA 1PZFA 4YJDA 2HO5A 2QYTA 4XJTA 2X9VA 1DRVA 1JWAB 4RPLA 6ADHA 4AJPA 4CM8A 4M86A 4NFSA 1U3UA 2FPIA 3RUEA 2RHRA 1HXHA 1ISMA 1UDCA 3BMOA 2B4RO 3KYCA 4HX5A 3WOHA 2O3QA 4BVAA 5L45A 4G81A 1XIVA 5KJCA 2OP1A 2VWQA 2GD1O 4GKVA 3GEGA 5DOVA 2OO5A 3E5RA 4E13A 4EJ6A 4W7IA 1MB4A 1KC3A 2UYYA 2X0IA 3A28A 3IC5A 1NAIA 3H5NA 3IKTA 4PLGA 5G0VA 3ZWOA 4PIVA 1UZNA 2DTEA 1E3LA 1IOLA 4HV4A 2C54A 4WLUA 3GZNA 4ALIA 3LSYA 2I99A 4EDFA 4BNIA 3ANLA 3I4FA 4A5OA 3H9UA 3I4CA 1PL8A 1SZJG 3H3JA 2FHSA 2BGKA 3E6AA 3C8MA 3GK3A 1WVGA 4CLEA 3W4IA 3JQDA 5CG1A 1T2FA 3GLQA 4KTVE 3UCFA 4CM3A 4GQAA 4GX1A 4DBZA 4N54A 3GG9A 4ZQFA 5K0ZA 3W8DA 4I5DA 2GN4A 1HZJA 5A04A 2VYNA 5EPOA 1IULA 4KP7A 1H6AA 3JD0A 3ITDA 4KZPA 4NFYA 1M76A 2Y99A 1UP7A 4FJ0A 4DTIA 4L0QA 3VKUA 5KOIA 4GLLA 2PZMA 4E32A 3IOYA 2Q2VA 4NZ9A 3GMSA 3HB4X 1E7RA 4KWHA 5A3VA 4ND1A 1G6KA 2CD9A 1PIWA 5DT9A 5BSGA 1HDYA 2EV9A 2EKLA 3Q11A 4FPXA 3LDHA 4Z0PA 4XQ9A 2FSSA 3KBOA 3L4SO 3DZGA 3SLGA 3RD5A 3W6ZA 1BG6A 4YAKA 3JSAA 1X14A 1PZGA 1ZMOA 2YDYA 1LQTA 4R16A 1WLYA 4DA9A 3KUXA 3ABIA 4XGIA 3KYDA 1V35A 3ZV5A 3F5QA 3UUWA 2Y1FA 1R4MA 1ZXLA 3R6DA 1DBVO 3VKVA 2R00A 4G2NA 4LVCA 2GZ3A 2IODA 3AWDA 3EVNA 4C7JA 1P1RA 4D42A 2Y0DA 3DZBA 2J3JA 3CH6A 4O5OA 1Q7BA 4R01A 3F5SA 3Q9UA 3DDNA 3OEYA 3QVSA 3BIOA 4CM9A 1K3TA 4EITA 1NWHA 3VVCA 3FHLA 3FPCA 1W6UA 2VHXA 1I24A 2O2YA 5DP1A 3DHEA 4XA8A 3W1VA 3FSRA 1YOVB 3RKUA 1LI4A 1HEUA 3OJEA 2X9NA 3H5RA 4Z0TA 3OHSX 5KJ6A 4IQ0A 1MG5A 4OH1A 1OFGA 3P5SA 1UAGA 1PJ2A 2J5RA 2YV3A 5F1PA 1YB4A 4GBJA 2CDAA 4P38A 4CM6A 3BYZA 4JQCA 1SOVA 2V6MA 1PGNA 5I9LA 3HDYA 3JQGA 4J3FA 3OICA 3LT1A 2W8ZA 1PTJA 2HMVA 1GY8A 3NAQA 1BRMA 3MJCA 4PG5A 1Y7TA 4NR0A 5BQFA 3ICCA 1WDLA 1HSZA 2ILTA 4QSMA 4OHUA 4NH4A 4BO3A 3PK0A 2O4CA 1U4SA 4R9RA 1NXQA 4UREA 5DBFA 3K73O 1CEQA 2VTEA 1A4UA 4AJOA 1DFIA 4DC0A 2XXJA 4DMLA 3C1OA 3D64A 1YQXA 2ZB4A 2AG8A 3KM0A 1ZH8A 2QQ5A 4QQRA 4W82A 2GUGA 2ZIZA 5F21A 4HY3A 3L4BC 5HS4A 5GZ3A 3DZKA 2VT3A 4YT8A 4KTTE 3V2UA 4D0SA 2CDBA 3UOGA 2WYUA 3GDFA 2EHDA 2J3HA 5CDGA 4BS9A 3OIGA 2X22A 4Q3EA 2GZ1A 2ZTLA 1I3NA 1YBVA 1Z7EA 3HUDA 4CR7A 5TQVA 4XD2A 1MUUA 5JO9A 4NNJA 4EW6A 3GRKA 4E12A 3QWBA 3U3XA 3T7CA 3UCEA 5B4VA 1R6DA 5JPIA 5COBA 1Q0HA 4UVGA 2DFVA 3MTGA 4AJHA 3LVFO 4K26A 1DJNA 3I6QA 2Q49A 2PR2A 2ZYDA 4PVDA 1DEHA 2DFDA 3AUSA 4B3IA 4R9SA 1QSGA 4UUNA 3G49A 5I7FA 1PJLA 3QP9A 3V5NA 3WNQA 1D1SA 2NV6A 2PV7A 3JYQA 5G4LA 3EC7A 5DOZA 1B3RA 3R3SA 4IJUA 4IGEA 1T1RA 5TNXA 4RVFA 4BO2A 4BQRA 3U4IA 1XA0A 4IDCA 3O9ZA 2EW2A 2Q1SA 4GL4A 4I1IA 3WX0A 5FWNA 3DBLA 3NTRA 3UKOA 1YBMA 5JDCA 2VZ9A 5GMOA 3RVDA 1GL3A 4RVUA 5JCJA 1IPFA 4ZRMA 2DT5A 2X86A 3IDSA 1U2DA 4Z9YA 2BF7A 3CMCO 1PWZA 3DFUA 1WPQA 2DBQA 3HG7A 3ZWVA 3EAGA 4OM8A 2PK3A 4M8SA 3PYMA 1KVSA 2VNAA 2Y0EA 4ZRNA 5LC1A 2GR9A 2HMWA 1J5PA 4AJLA 1SB9A 3R3JA 2WSBA 2Y67A 5BNTA 1T25A 1IZ0A 1U3TA 3G17A 4ITUA 3C85A 4JBHA 3PFWO 3H8VA 5DULA 4CMHA 1RYEA 5B4UA 3WQSB 1Z75A 2Q45A 5DN9A 4NMHA 2OBNA 3T4XA 3FBTA 3S55A 3S2EA 4CLRB 5G0WA 4BGUA 7ADHA 3COSA 4E5YA 3K5PA 2DTDA 4FOOA 5DDIP 3BTSA 4YA6A 3A1NA 1Q7GA 4M1QA 3SJ7A 3NT4A 4PLZA 2EJWA 4Q3BA 4CM7A 4D79A 1T2AA 4JCOA 1XDWA 1KBZA 2DBRA 5FF9A 3OEWA 3WGIA 2DBVO 4TZKA 4WEQA 1KVTA 2PGJA 2VUTA 1R4NB 5JDIA 5ER6A 5ICSA 1R12A 4YQZA 1D1TA 3OECA 1X15A 3PHIA 3I5MA 4NIMA 4CMJA 1PGPA 1LDGA 3ORFA 1PJCA 2PWZA 4TZTA 3WJAA 4GWKA 2WJPA 2Q2WA 3KZVA 3ZWYA 5F1KA 1DO8A 4NJMA 1VSVA 1QLHA 2C59A 3AY7A 5JLAA 1ZBQA 4WCDA 2IE0A 1B15A 3MOIA 4PZDA 5A06A 3M2TA 4I8XA 4ZQHA 1B14A 4WOJA 3ZW9A 1QR6A 2QRLA 3VPGA 1E3IA 2E48A 3GFBA 4XRGA 2GZ2A 8LDHA 4PLPA 3Q0EA 2DTXA 2O3RA 3PXXA 2A4KA 5CP8A 4OIMA 1NPTO 2ZJ0A 1GU7A 4PVCA 1EVJA 1CF2O 3MJEA 1VL6A 4NK4A 1GUFA 3LLVA 4M89A 3KRTA 2NU8A 3VDRA 1PQUA 1NP3A 1TXGA 4OOEA 4J7XA 3QE3A 3OIDA 1OAAA 3JQFA 2JCVA 4K6FA 1I2ZA 4YJHA 3ZWCA 4HFMA 3RC1A 3KLPX 1UXIA 1ZSVA 5BT9A 2Y1CA 3EGOA 1VI2A 3FTNA 4DLBA 4MP6A 3GN2A 1HRDA 2O7SA 1NPDA 4MKXA 1CIVA 1BW9A 3AK4A 4II2A 4CLXA 1XEAA 3JQ8A 2AQHA 1F8GA 3I9KA 3QW2A 4BL5A 2BHLA 3NEPX 2BLLA 4XB2A 2G0TA 1R0LA 1V3UA 3L9XA 4XQEA 1P1JA 5IZCA 4NU6A 2Y68A 1B0AA 3G0OA 4CUJA 4WCFA 1WZIA 1Z74A 1H6BA 1XGKA 5THQA 2JFHA 3F1KA 3VTZA 3I9JA 3ZZNA 2FN7A 3E48A 3I9LA 1LSJA 4GSKA 4NJOA 3ZNOA 1R16A 5FI3A 3VH4A 1U8XX 4FDAA 4IJVA 1PQPA 3JQBC 3O8QA 4B3JA 2G82A 1UR5A 4BNFA 3E5MA 4FFMA 3FBGA 2NVUB 3PWZA 4CL3A 1K5HA 2J8ZA 3HB5X 2YJZA 4UAGA 4OXYA 4DLLA 3RJ5A 4JP3A 4BO4A 2WD8A 2P9EA 1LLDA 3HDQA 4A26A 1O9BA 1YONA 3RUCA 2HRZA 4IS2A 3RC7A 2VRCD 1VLLA 1HDZA 1OBFO 3U4CA 2YHIB 3WIEA 3QVTA 1SNYA 5JAMA 2YV1A 4GMFA 3WGOA 1I2BA 3RROA 5L4SA 1XG5A 4WNIA 2WE8A 4O6VA 2VYVD 2UAGA 3AM5A 2WWRA 3TZHA 1HYGA 1UXHA 4BV9A 1QRRA 4PN3A 3ZNNA 3SJUA 4TWRA 3VPXA 3M1LA 2ZTMA 4OXNA 5H82A 3DAFA 3UICA 3CXRA 2Q2QA 1LTHR 2X9GA 4YWJA 1Z82A 1N7HA 2BGMA 3FF4A 5A9SB 2X1HA 1CETA 3INTA 3PHLA 3ZDFA 2WEKA 2FR0A 2PKQP 3H6KA 2X7HA 5IZ4A 4EEZA 3SX2A 3NYWA 4DGSA 3GA0A 4DIBA 1HKUA 2ZB7A 3DMYA 3IL2A 4N5NA 4DPKA 4Z6KA 5A9RA 3GZ4A 4R5HA 3JQ7B 4NG5A 3RUAA 3NUGA 3OP4A 3VTFA 5ADHA 1RYDA 3RBVA 5KJEA 3VH3A 4E5MA 1JAYA 3U4HA 4D3DA 3PHJA 2VWPA 2WD7B 3L77A 1Q0LA 1E0DA 1IZ9A 1CQJA 4NU5A 3TZ6A 2JAHA 3TRIA 3P2YA 3WSWA 4CJXA 4XYMA 2V7PA 3O03A 5AYVA 4MVJP 4N5MA 2GN8A 5JBIA 6LDHA 1Z6ZA 3PHGA 2C5AA 4BO6A 3HQ4O 1LC3A 3CPSA 1E92A 2ET6A 1NNUA 1YVEI 1B8PA 3PJGA 1IYZA 2JL1A 4RGBA 3WSVA 3CTMA 3B1FA 3KOUA 3MWEB 3OETA 5MGBA 1QP8A 3F1LA 5A5EA 4KOAA 5DBIA 3SLKA 4I9NA 2J6IA 1GFSA 2Y1DA 3GHHA 3I9OA 3Q1LA 5CHEA 3ZGYA 4BKUA 1NYTA 3PDUA 2X4GA 3RBZA 4BNZA 2Z5LA 1XKQA 3MJ4A 1RJWA 3OM9A 3KEQA 1T24A 2GASA 1A71A 4DL9A 1L1FA 2ZYGA 4EGFA 1GPJA 2Q4BA 3STHA 5T8KA 4DVJA 1UP4A 2Y1GA 3ZWPA 3WGQA 3DMTC 3U5TA 1OMOA 4BNTA 1EE9A 3AOGA 4DPMA 5JMPA 1ZK4A 2AMFA 2OGUA 4MDHA 1F0YA 2OOSA 4PGFA 3N58A 3WR5A 3WGZA 1P74A 1BTOA 1RM5A 3RUFA 2EIHA 2GDZA 4OKIA 3CMMA 4Z3DA 4XZ3A 1F8FA 5T64A 2NVBA 1SB8A 2AW5A 3ITKA 1HSOA 3UAGA 4XJSA 2ZTVA 1C1DB 1I01A 2WDZA 5F5NA 4DRYA 4I5EA 5JE8A 1EZ4A 2EGGA 1IB6A 2B5VA 2X0RA 1A72A 1H93A 1A5ZA 3JYNA 2QG4A 3PVZA 1OZAA 5TGDA 4B4UA 4L4XA 5AXAA 4DXHA 1T2EA 1VM6A 4DREA 3NJ4A 1LBEA 1KOLA 1GAEO 1TLTA 1JQBA 2NLOA 3ZCXA 1L7DA 4OSOA 4QECA 4G65A 5F1OA 4J16A 3NDIA 4RPHA 2GF2A 4M55A 4MIYA 3LU1A 2YDXA 1H2BA 3OJ0A 3GAZA 1YJQA 4DMMA 4ONEA 1FDVA 4P4GA 5L7WA 3L6OO 4OSPA 2POQX 3NT5A 3QY9A 1IUKA 1WW8A 2VNSA 4U6SA 3D4OA 4WPGA 4GGOA 2FR8A 3JD3A 1KVRA 1GQQA 2O3SA 2ZTUA 4ZN6A 3MCVA 4B8WA 4PLWA 2YQ4A 1E6EA 2JD1A 1GEGA 3GVCA 3M6IA 2B0JA 3RAJA 2DBZA 3RU9A 4TRJA 4XB1A 4ZVVA 2EP5A 3A14A 3DOOA 2ZYAA 1H94A 4WLOA 2O4UX 1R0SA 4IDFA 1E1KA 4YRBA 1I3LA 4NPCA 5HRUA 3BMNA 1QYXA 1P1FA 4WKGA 4LCEA 1JAXA 3IMFA 4RVHA 1UH5A 4NFHA 5G2OA 1Y81A 1ZUD1 1ZSNA 1D3AA 4PLYA 4PRLA 2YQ5A 3FTPA 2BGLA 5JFOA 4WUVA 5KIAA 2Q1UA 5ER9A 1J4AA 2HQ1A 1W8DA 2UUOA 3QVXA 1NQTA 1U1IA 3KTDA 4FN4A 3C1TA 3GFGA 4YEDA 1CJCA 3HHPA 1SAYA 3ZW8A 3GUCA 3KYBA 2HUNA 1N2SA 4KUGA 2XXBA 1BSVA 4YAJA 2BFPA 1NFQA 3P19A 4CPDA 4XR9A 4CMAA 4K1LA 1Y8RA 3Q6IA 3MZ0A 3TF5A 2VHVA 4EBFA 5BSFA 3PZRA 1DHTA 2UV8A 4CODB 5CEEA 4IIUA 1LQUA 3JQCA 1NBOA 2P4HX 2ZATA 4CV0A 3AJRA 3CSDA 1WMBA 1WP4A 1LSSA 1P1HA 3DZFA 2RAFA 1N5DA 3ZU3A 3ETGA 3A06A 4GI2A 5CPBA 4ALNA 4RPGA 1EK6A 3ASUA 3WICA 1U9JA 5EQFA 1WAMA 3FR7A 1GPDG 2HRBA 4AFNA 3AU9A 1LEHA 1LDMA 1ENYA 2OUIA 3D3WB 1MFZA 4TVOA 1LNQA 1CERA 4JP2A 1VJTA 1E7QA 4CLHA 1PJQA 5IDWA 5ES3A 1IHXA 4ZICA 4K9DA 5A5FA 3OF2A 1G1AA 4Y9DA 1ZKMA 2W90A 3DFZA 1MXFA 3WS7A 3OH8A 2CVZA 1E3WB 3DAGA 4JGBA 3U09A 2NU9A 3M2PA 1YQDA 1JWBB 2PH5A 3PEFA 1LJ8A 2FY8A 1UDBA 3H2SA 4YR9A 4MKZA 2C2XA 3OQBA 1JKJA 4TQGA 5GY7A 4BGIA 1YL5A 4BB5A 4L8VA 3U62A 5KNLA 3PTZA 4D46A 1R4NA 1NAHA 4GX2A 2I76A 4GKBA 5BR7A 1VRWA 1EDZA 3HADA 3Q2KA 1E3JA 1ZNQO 5JC8A 2GO1A 2C29D 3D1LA 2DU8A 2CVQA 1PGJA 3JYPA 4JIGA 1DHRA 1DDOA 1BVRA 1DIHA 2UDPA 2XAAA 1O5IA 4J7UA 2HSDA 4GX5A 4IS3A 5THKA 2BELA 1PS0A 4ILKA 4RQUA 1I0ZA 3LT0A 5DCUA 1PJTA 2NU7A 3TNLA 2H6EA 4WASA 3EZLA 2NQTA 1SBYA 5AQ1A 2X5OA 4J91A 2NSDA 4B3HA 4PRKA 1BVUA 1O6ZA 4B4VA 1KVQA 1ULSA 4BKRA 5C5IA 2PH3A 3LC1O 3W8FA 1I36A 5JAQA 4IMPA 3JD1A 1IPEA 3BAZA 1DRUA 3EVTA 4G5HA 4IDBA 2FRDA 4J4HA 3H3FA 2Q1WA 4J1SA 3B6ZA 2GRAA 5EL0A 1GYPA 4FFOA 2CY0A 2FSVA 2G17A 4D45A 3TZKA 3ONDA 4CMIB 1KERA 3JQEA 3P2OA 1U2GA 4YT5A 4FSHA 2Y05A 3L07A 1DSSG 1VC2A 1PZHA 5GZ1A 3FNGA 4FFNA 1UZMA 2J3KA 4OO3A 4GVXA 3VH1A 4U0JA 1LC0A 4LMRA 4JNKA 4QX6A 2EG9A 1DFGA 1ZXBA 5COQA 4CLOB 1H6DA 4IZHA 5G0UA 2V6GA 3ICPA 1K2WA 2VRCA 3VVBA 5IXYA 1XR3A 2IEDA 4FOSA 2ZCUA 1H6CA 2OHXA 1ID1A 2JD2A 3LQFA 4AJJA 5IXSA 3WWZA 4R1TA 4TKLA 5I9MA 2VYVA 3K9QO 4II3A 2PGLA 4RLHA 3FR8A 2H63A 1KETA 2O50A 1F14A 3HFGA 3LF2A 3AW9A 5CEFA 3VHRA 1T26A
chains in the Genus database with same CATH superfamily
3GZJA 1R6AA 1NXXA 2QL5A 3ZWXA 1P0FA 2P91A 4H6PA 3INRA 1DUSA 1ZSYA 4PLTA 5EIBC 1L7BA 1G63A 2OAP1 5H4HA 1WF6A 1MPTA 4LQ4A 1QH1B 2IDZA 3GJ5A 4YBZA 3EFOB 4YP7A 3TM4A 2A9VA 2OFXA 3A10A 5BR8B 4QQNA 3WNDA 4AMBA 1QPBA 5JNVA 1LB1B 2NSLA 1KR2A 2WILA 3WRYA 1BKYA 2ZVQX 3U6BA 1JQ3A 3Q6NA 1VG9B 5JQWA 4OYYA 2BCGY 3QX3A 4MJLA 3ZC3A 4Q7JB 3AHJA 2D5CA 2ZJOA 2FSIA 4KFRA 4BBZA 4E09A 1QZTA 4KV9A 16PKA 4BV3A 4HLNA 5KSZA 5JMTA 5ILGA 5CH8A 5KSPA 2IIPA 4ENVA 4OBBA 1KAOA 2ZZNA 2MSLA 2WG2A 3K1TA 3TD2A 1POXA 3NONA 4DLWA 1EFPB 1AO3A 1PWEA 3AETA 1VZ2A 1ZUNB 3B6JA 4C0JA 3B20A 1MB0A 1PL6A 1ONPA 2C0CA 1VKOA 1VHQA 1XJWA 1OLXA 2BJVA 4KXLA 2OAEA 4Q18A 4V0NA 3SCZA 2P6NA 3UTCA 4ER7A 4PCVA 3BL8A 3QWAA 2BMVA 1QHHA 4R9VA 3EXHC 4QGGA 4CCYB 2RGGA 2EQ5A 2E3JA 3C97A 1NMXA 1NI5A 1PR4A 5GM2A 3OLQA 5KPDA 4W8GA 3OKAA 4UC0A 3VA7A 1RQRA 2H65A 3HO8A 2H4ZA 2IH2A 2GPNA 2V0NA 4W6ZA 2HLPA 3QWIA 4JUIA 3RJ9A 2YFQA 4H6WA 3WLOA 1PJRA 4I50F 2G70A 2CZCA 4ASUA 1H9AA 3GGGA 3KPVA 2GGSA 2WVHA 5B1DA 4DJDC 1Z6TA 3BA6A 1VMDA 1M3SA 3GT3A 5J2UB 4C4RA 4P54A 4TWIA 1GPUA 1GTL1 4J1TA 4JBIA 5DGCA 4GKJB 2G9ZA 1MBZA 2WMDA 3D0OA 1GQYA 3HN7A 4O0MA 2ONJA 5TS3A 3ZEAA 5IU6A 1S8OA 2G04A 3BCUA 4V0QA 3VYWA 1JW9B 4RK0A 4CDGA 1RWWA 1LNSA 2ODWA 1BEUB 2DPMA 1KEEA 4XCQA 2V7WA 1DZ3A 3FCCA 5DTRA 2O5VA 4II7A 4L9SA 4UJ3A 4F2GA 5BNZA 3B2EA 3UH1A 4ZOLA 4IFIA 2QZPA 3UWDA 1MNQA 4IRUB 4IIHA 2IIQA 3RSHA 2ZYIA 1F17A 1RLIA 4RCVA 5JH7B 2CL6X 2IKSA 3QPCA 4GEKA 4W7HA 4US2R 4DCMA 2FFBA 3UQZA 1ODTC 4ABYA 1C30B 4JBXA 3HVUA 2WKWA 3LY8A 1PJSA 5EP4A 2JHAA 3OY7A 4M0PA 5DN6A 3AI3A 1ULUA 5HG0A 2Z6AA 3BJIC 4RIGA 4UM8B 1CXZA 5FBRB 3TOZA 3QRWA 3TR6A 1SMKA 1TECE 4B3SB 1HYHA 5JAPA 2XTNA 5E95A 1O8CA 1WV1A 2F48A 4IILA 2VTDA 4RDIA 1UK8A 1VFNA 1Y8AA 2DM6A 1X13A 1CULC 1TF7A 5T6MA 3X2EA 4A2CA 2AI2A 4BYMA 2JRCA 3HO1A 4TMFA 5LBUA 3T1OA 1M2WA 4KMMA 3N1UA 5F76A 4PFKA 4Z53A 3ZDYB 3LPLA 2B82A 2B5WA 3FX2A 3UCXA 4TXMA 1XWWA 4QPNA 3ZZ1A 5BQ3A 2IDJA 2P8JA 1JT9A 4PXYA 1PCXA 4CQLA 3PLNA 3JQ9A 3WK6A 1J0CA 1S96A 3STXA 4Z1MA 1I6WA 3AYZB 3D3QA 2QF7A 3NC4A 4IH4A 5FXMA 1QBKC 5B3AA 1UDXA 1G9SA 4ZQEA 2FDRA 1V9LA 5CFMA 1YJAA 2CXSA 4RIEA 3QY0A 3VYSB 4JA2A 3TNFA 1L5HB 1GZ3A 1ONNA 5IEBA 2QBYA 1MH1A 3NBFA 1N1DA 3PJEA 4YJFB 1XAHA 4JXKA 2EERA 4RMIA 3RS7A 1Q50A 4FD3A 4MYUA 3RIHA 3NKLA 4FB5A 2OHHA 1F6DA 1OC4A 4MVJE 3UQYS 4E14A 1N6RA 1RQXA 3O47A 4D8VA 5K03A 1YFKA 4P0PB 1Y89A 2O59A 3BB3A 2XF8A 4TVKA 1N9GB 1X1EA 1RJEA 1J2JA 2GHQA 4RFSB 4EGSA 1PFWA 1WCYA 2X0KA 3IMEA 2I6XA 1UMDA 4LK3A 3I0NA 5K3CA 5CG2A 5KWSA 1U7XA 2OBBA 2GO7A 1RPNA 3TLBA 1OWMA 3SKXA 2PBLA 4N5HX 3ZU4A 4IVQA 3ZXYA 5JSZA 2REOA 3EVFA 3V7FA 3S8EA 5AK6A 1TJYA 2UYCA 4FGKA 3TRDA 8GPBA 5E7JA 4LFBB 2D0IA 1HRKA 2PUWA 2R6AA 4HAZA 4C2TA 3CCBA 4NX2A 3ROFA 5ICMA 4C3VA 4F0JA 2EVWX 3LLCA 5CCDA 3B2QA 2GF9A 2H06A 4R8VA 1A82A 3L6EA 2QQEA 4L5JA 1NI4A 3BBPA 4I08A 2VP4A 4KQXA 4KVGA 5TVGA 1D9XA 1C9DB 3TSZA 1OLOA 3D6FA 5G0SA 4BKPA 2QN3A 3U7QB 4CGYA 2P6RA 4XARA 3IO5A 1TJNA 4AULA 4BNDA 4DCCA 1E69A 2H51A 3JYHA 3KDPA 1P77A 3MJTA 3TSCA 4RQBA 3UJ7A 5C8YB 5IM4F 4V02A 2WIBA 1MRZA 4P3XA 2P11A 4YRFA 3UHJA 4AZ0B 2FWBA 2ATEA 2AX3A 4QREA 1EE1A 2V7UA 2QVZX 3TL2A 3JZIA 3B53X 1MNAA 3LQ1A 1CIPA 2FQQA 3L6BA 4XEHA 3SHWA 4XYLA 3ANYB 3E1SA 3SN6A 3L2OB 2OCLA 2AV6A 2JIMA 2HXSA 3KDAA 2VXOA 4HAVA 3TDNA 3AEQA 1ABBA 2FDCA 3FNIA 3MTJA 3PI7A 2LXNA 5HFNA 5BUSA 3K0AB 3WKAA 1LRLA 1RMQA 1SBNE 3AXTA 3KEMA 3M6FA 3NCHA 5HMMA 2PX3A 3DPSA 3TLCA 5JJKA 1G5PA 3C6XA 4ZCIA 2X9QA 1I5EA 5GP1A 2WR8A 4Q1FA 1PTKA 4B7UA 3OEHA 3DO6A 1V6AA 1B6SA 1YZQA 1KP3A 2WOJA 3BHIA 5AOAA 3MHTA 4RH0A 1QV9A 1U94A 1WU8A 1H8ED 2A8YA 4KI7A 3RVMA 2JLWA 5JW6A 1JYEA 1TCCA 3OSUA 1QS0B 4HSGA 1Q0TA 1T5BA 2JLVA 3S5UA 4NYJQ 4BNWA 1W93A 5M29A 1E9CA 1CQWA 1QKIA 3CJQA 4W1RA 1O0BA 3RNOA 4E31A 3O4RA 1L4BA 1XSEA 1RP7A 3JQFC 4ADSG 3ZWMA 1E62A 3FN4A 4XKJA 2O2EA 2QTVA 2YOFA 3TECE 3GAAA 4KLZA 1G8MA 2QY9A 4LVUA 5A9TA 4CKEA 3DEYX 3NOOA 3TTYA 5AKHA 5CA1F 1B76A 4BWFB 4QOIA 1ZX1A 2CFIA 3IIMA 5B7GA 4M9CA 3OLXA 3EGCA 1YE3A 2FQ1A 4UEQA 2G5GX 5BSHA 5I7SA 1RU3A 4X63A 4MRAA 3VZRA 4Z8XA 5HA5A 3B9RA 3RC2A 1QFMA 4U2FA 1KMNA 1T0JB 4F21A 3KCQA 5HDBB 1P39A 2WJAA 4RDHA 3HXQA 1N2CB 1PNRA 4Z4CA 3GFOA 1MJHA 2IBMA 3H1BA 1UKVY 3WE7A 2Q5CA 4FR0A 1RRGA 4WCFC 3OP1A 5IABA 2BTOA 4EIWA 2AK3A 3K9LA 2XGJA 1ZK0A 2C1XA 3W3AH 2YOHA 3KR1A 4OHRA 5EWJA 2GMWA 2AYZA 1TM7E 2L42A 1JV2B 5HF8A 4BGVA 3F8TA 3SX4A 4TT3A 4IR7A 1ISSA 2XUJA 2AEJA 3G2KA 3JALB 5KQPA 1UINA 2CVOA 1SR8A 1T2VA 3HCEA 2IT1A 1GGEA 4L9RA 3ZGLA 5DMHA 2Q6TA 1GG2A 2I22A 4D26A 3W5HA 1XQWA 3KWMA 4HK4A 4P84A 5ELMA 4HGZA 4ESVA 2PGXA 2RK4A 2I7CA 4RGVA 3PEEA 1U5BB 2RI0A 1BGWA 3EOBI 4HP8A 1VECA 1O94A 3FUTA 4IVNA 4OM7A 4Y2JA 3VO9A 5F77A 3ZKWA 3CNLA 4ZOEA 3H2IA 2GYYA 4C87A 1IRXA 2V7BA 4ALMA 1T8WA 3ILYA 1A7AA 4MO2A 3SYRA 4A7PA 3D3WA 2PUJA 1H8HD 1U7UA 1MD9A 1PX0A 3WAKA 1K8XB 2AA3A 3A04A 1K6IA 2NUAA 3SJBA 1SA0A 1OBCA 3DAHA 4JELA 3VSBA 3KC2A 3DBVO 4G5RA 4D8UA 4F11A 3ZKAA 1KYZA 1DDIA 1SHUX 5DU2A 5KO2A 2OV3A 2V0GA 2JKYA 1NNEA 3K72B 5LXTA 4MNTA 4AB1A 1J0XO 5JAIA 5L9AA 2XGGA 4GOND 5DYGA 4FFVA 4WZBB 3EDQA 3GVXA 5FEUA 4KPEC 1ZG3A 3FI9A 1SUIA 2HIGA 2AZ4A 4HNAB 4TYPA 1VXOA 4G1FA 5IFLA 2HYDA 4MVJI 5FPYA 2CMDA 5JOQA 1QV6A 3WNZA 3ZLBA 1V45E 1PV1A 2CDNA 2B6HA 3DKIA 3H7AA 4EVIA 2OHVA 5DWVA 4C4PA 1DQSA 1JIKA 5TPWA 3C5CA 4L8FA 1C9KA 1KPHA 3H1AA 5DI3A 3QOWA 5L4LA 3U3ZA 1LDBA 5AJHA 3JQRA 3GYGA 4H16A 2BI7A 1UADA 4O2AF 4LY0A 1VKRA 3G85A 4JJ7A 1VHJA 1IXRC 2J5BA 3EDMA 5BV1A 4AVYA 4X3CA 4A1OA 4Q19A 1JN0A 2DSNA 4MVWA 4UVDA 4A6PA 4DIKA 4PV7A 3QPWA 4JFAA 4J94A 4XWWA 1SUAA 1GD1O 2H9IA 2AOUB 5CGQB 2Q3BA 3TAUA 1SO8A 3WTBA 4S1VA 3EPLA 5LQJA 1SC1A 4C43A 5IHPA 5EY5B 1U0BB 4XIJA 2RKBA 1SG9A 3PP8A 4G1EB 3QHAA 1Z2CA 2NM0A 3QNMA 3TSWA 4WJLA 1K86A 2ZWVA 4L75A 1ZVVA 2NYRA 2AXPA 2Z95A 3HB0A 1YZFA 1EX7A 1VJRA 3JWIA 4H1VA 1C3XA 2PL1A 2DQ4A 1HE3A 4HCJA 3FCAA 3SZGA 1ICEA 3VZSA 2OUKA 4YJ2A 2GN6A 2X5XA 2QXTA 1U3FA 2VJOA 4R0MA 1YGYA 3OZAA 4RKWA 2K6GA 1M0SA 3C3DA 4JKIA 4AZWA 5GJVC 4B7CA 1B0PA 3ZDBA 4CV2A 4UD2A 1Y5NA 2C2BA 1CY8A 2XT0A 4BFUA 3CLVA 1XPUA 3REGA 1HMPA 1QUEA 2YRXA 1DQYA 3DDZX 2CL5A 4GR5A 4GC9A 5HFJA 5DYTA 5AKJA 4INAA 1OOEA 2HPVA 4MR7B 2DFNA 2C42A 1W6RA 3R5SA 3LNTA 3COZA 4O4HB 4TMWA 2X15A 1E1RD 3A1FA 1DUVG 4V2IA 3SXUA 1IZ7A 3T5GA 3K70C 2CB9A 3SR0A 1P8JA 1Q0QA 2AS0A 1DDGA 2QHXA 2BGTA 1VYUA 4YB8A 4LXXA 1OV4A 1P6QA 1YA8A 2CMFA 1KNQA 4LW8A 3QPUA 4BMSA 2PYDA 1E6CA 1YFLA 4KGDA 3QKWA 3RK0A 1T3HA 2C00A 4MHSA 4KQ9A 4XDHA 2P9YA 2X1LA 1K66A 1PK9A 3GRFA 2O0LA 2VZ8A 2QTZA 4LOIA 4TOIA 3TBHA 1NXTA 4Q4HA 4RNCA 1T8SA 1AGNA 3I1JA 4JHXA 4MPDA 5AW7A 4Z5XA 2A1UA 2EX4A 2D0PB 1SOUA 1W30A 1J1UA 4MQFB 4O4IF 1XTIA 3BFXA 3K8ZA 3U7EB 1OAKA 3PFIA 1XTRA 4R84A 2YXNA 4J49A 1T5DX 3T5TA 1MDBA 2XMCA 1ZUWA 2HTEA 3R3UA 4J2HA 2XMQA 4R81A 4MUIA 1RRCA 1PQWA 2TMYA 1VMKA 2W6IA 1YL7A 2RK6A 3CU5A 3P2MA 4D1YA 1WMDA 3QU9A 2VP5A 3BIWA 8ADHA 3M6LA 3PQ5A 2FPGA 2Z5GA 2NWQA 3I9V1 1EZZA 1ICIA 3SR3A 2BEJA 3FY4A 3NHRA 1TA0A 2P68A 4N6OA 4OK6A 2FSUA 3L7OA 1E3QA 1QG0A 5SY6A 9ABPA 3JWJA 5DNDA 1HL3A 2IOHA 5KQLA 4MIOA 4ARVA 5C4GB 1Q2XA 3ZV7A 2VF8A 5IDXA 1IOVA 1YQGA 5A6SA 1THZA 2D62A 2XB6A 2B69A 3BMQB 3REFA 3STTA 4R1UA 2RIRA 5K7SA 4H7EA 4GUDA 3D43A 1VG8A 4ILEA 2ZT8A 1DKRA 3FMOB 3TPCA 2WAAA 2WM9B 2GRJA 3F73A 1ADJA 2IHYA 4QODA 2QM3A 3ETJA 1FUUA 3Q72A 4URZR 4B3BA 4G0WA 1FDSA 4QC2A 5TARA 3O4VA 2F1IA 1C4KA 2VQSA 2QX8A 1DKLA 1UP6A 2ONZA 3EUFA 4RANA 2Z4TA 4RF2A 1FYVA 1QJCA 4QFDA 2ECKA 4HXYA 2C96A 2PUVA 1RLOA 3R7WA 5BRNA 4BRUA 3UN1A 3LUFA 4RVDA 4ZI7A 5AVQA 5FLKA 4AECA 1GAQA 5JVDF 1I0LA 4EM6A 1ENZA 1TIKA 2PH1A 3ECSA 3ENNA 2RGUA 2WJ3A 4J1NA 4W7SA 4J0KA 3S2FA 1FFXB 3TSYA 4DMFA 3QV1A 4UUOA 1I6MA 1NDHA 2Z8ZA 5T7BA 1XJQA 1Y1LA 4KAFA 2DPYA 5JCXA 1B16A 4NFLA 1UKCA 2Z56A 4MRMA 1PYGA 1KIMA 3I53A 2WIKA 4UCWA 3USCS 1RI1A 2RDMA 3ESRA 2Q7DA 3DBHB 2QDXA 1R7RA 3R77A 1CNFA 4HQRA 4UAVA 3VC1A 2CF6A 1R64A 1HE1C 4RXTA 1P1IA 2ZWIA 3L49A 3KEGA 3BH0A 3HBNA 4M1EA 4AJKA 4F92B 2OFWA 4U1RA 4AM8A 4OGLA 4DQDA 1VHDA 3I01A 4A6EA 1WD5A 1NXOA 3L84A 3JASB 3BZBA 1FP6A 4Q3OA 1ZGBA 5EHNA 3W8EA 5KOHA 3NYIA 2HJHA 4RD6A 3DWGA 2AYXA 3TFWA 1VJDA 5IMBA 4N3NA 1PS8A 2A1TR 4AY6A 3TTWA 5BNIA 3MINA 3I2JA 1ZGZA 3QIVA 4HPWA 4HT3B 3UBTA 3BHNA 5CFPA 1Z7BA 4Z0HO 1YF3A 4BZPA 1T4DA 4LK2A 1UKZA 1NVGA 1Y6RA 4G5XA 3KXLA 1JFFB 3H9QA 1TD9A 1DLIA 4FLMA 4RKFA 1PWXA 3K9FC 2AN4A 1IHUA 3W3AD 2EWMA 2E18A 3C4JA 2WAOA 3KQQA 3QU2A 4RADA 4K6OA 3RKRA 1CQXA 1GZ5A 3U17A 4B6SA 1C8VB 2OPBA 2COEA 4IJ5A 2W2LD 2GZRA 4RD1A 2PS9A 3OLZA 4LDAA 1E9FA 3CRQA 5ILOA 1CRWG 1F6WA 2EQAA 1S01A 5CB4B 1Y1SA 1UT5A 2YXDA 2VA9A 4FR5A 5K0CA 3PJFA 1FXUA 4JI5B 1N1EA 3QHPA 1CV2A 3ST7A 1NASA 1CB7A 3RFCA 3V8MA 3TO5A 3G02A 2QRJA 3A3PA 2OV6A 3IIKA 5KNDH 1XNHA 4QYSA 4WK0B 4EY3A 5AXDA 5IKPA 2BE7A 3W6UA 2G40A 3NO4A 5LIRA 1TEHA 3TWOA 1LUAA 1FS6A 4PNPA 3DBOB 2PLNA 4YQYA 1P7YA 3BG5A 4Y2TA 2W22A 4F8EA 4UBIA 1ZCBA 4J7CA 2ZJFA 1XXHA 2XITA 3FFAA 4S35A 3CIOA 3S2IA 1HQCA 1RBQA 2PL3A 2M6LA 2Y27A 3A7EA 1SKYE 4FP9A 3CUVA 4M54A 1R8JA 1RTTA 3AJEA 4TV8F 2DB3A 3KFLA 4URWR 1M2OA 5A2GA 4HPXB 5LDGA 2EWVA 1FTNA 3H17A 3C3YA 3ZHXA 2IXGA 2ODBA 2AE1A 5ARDA 4RS3A 1BROA 2QN8A 4QU8A 2QRQA 4FGLA 3R1IA 1XVIA 4IL5A 3KQLA 4NCXA 2AG0A 3WK8A 2LWIA 2IBSA 4BFCA 3G59A 1DC6A 2GTIA 1XDUA 1ODIA 2RGXA 3HMKA 3OJFA 2ORYA 3FUXA 4C4TA 1KRWA 3NDBB 3DONA 3IGFA 3OCCA 4PBTA 3RUHA 2J0VA 1IL0A 2IYPA 3E3LA 3ZWDA 3K70B 4K1XA 1RHKA 2JASA 3D4PA 4FYJA 4OJNA 4YCDA 2NV2B 1UKBA 2XDAA 3D4BA 3ETCA 4LISA 2CD7A 2PS0A 2WAMA 4C1BA 4WI1A 2H4XA 1FSGA 1JQAA 3NANA 2JGAA 1K0UA 2PKRA 3AF0A 5TVKA 2ERCA 2GLTA 2EKBA 5HJ2A 1A2OA 2P4QA 4NBKA 3SSAA 4AJIA 1KHTA 1RSZA 4FX5A 2WW8A 1UOQA 2N3ZA 2R96A 3J7AC 1Z0ZA 3IBCA 1K63A 2OV4A 3JQAD 4Z8YA 4HNRA 3SYLA 2BFFA 2E4ZA 4HDMA 4PE5B 5KC9A 4WLEA 3VSCA 3UGJA 5JQGB 3QYPA 1UJ2A 3I0MA 1B74A 3HNPA 3OWHA 4IPTA 3W2TA 2W8BB 4B7AA 2X2FA 2OFPA 3VSDA 1GUDA 1E5VA 1LLQA 3OZTA 4BFVA 2QS9A 1N2HA 2SKCA 3ROTA 3PNYA 3KB6A 2Q1TA 4I36A 1II9A 1MJFA 1GCUA 2BEKA 3WMGA 1X7ZB 2VQDA 2XECA 1WXEA 2AFVA 1NIPA 1ORVA 3W79A 2WU4A 3GV0A 3EXEB 5JJCA 4YJKA 4W5JA 3LO8A 4OUKX 1LXCA 1VE3A 2DFPA 2FP4A 4IHJA 1KYQA 2W11A 3OSZA 5I51A 4LF9B 4ZCSA 4DV2B 4XXHA 2VH5R 4YTEA 3WGLA 3CEAA 4UPVA 3AU8A 3DO8A 1BS2A 4YUZA 5CIYA 1TJ5A 2FPXA 4GEGA 4CM4A 1GZ7A 1NX6A 3ZWNA 3L4JA 2LUOA 4N7MA 1IK4A 2WSSD 1TPZA 2YKGA 5E4JA 1W46A 4AY4A 2IXAA 2VUSA 3P9YA 1OH5A 1QZUA 3VZPA 2HHAA 1BC5A 3AQIA 4RZIA 1RI4A 4YQEA 4AMYA 2FA9A 4ZTZB 2C7OA 3IUMA 2AN5A 2FGKA 2HN9A 4CL8A 2R8RA 5AJVB 1WNTA 1GGNA 1PV4A 3C6YA 5MDHA 4F6CA 3A3OA 1U7HA 2DLNA 3JPWA 2KM1A 4JX8A 2JHGA 2BFOA 1P2FA 1ISHA 2X8WA 2JVIA 4LXQA 4BQEA 1KAMA 1I1OA 1T9BA 1L4UA 3ISVA 3F0TA 4FJ1A 5EXXA 3V8PA 4C4OA 3NIFB 4AS3A 4C3UA 4BRZA 2IYLD 2C5SA 4NBWA 4GECA 4QD3A 3MAJA 5A1JA 1L5MA 1PK8A 5JS8A 1Y8QB 3C70A 3DXYA 3PC2A 4WLFA 1XJ0A 2DPLA 5L3SA 2H1LA 2N1MA 5ARCA 5SZHB 4GKKB 4K0KB 4WESA 2GYWA 5EE1A 1EWRA 3DZIA 6AT1A 3CLKA 1USUA 2Z43A 3DQPA 1NJ8A 4RVNA 2IXEA 3H9GA 1L7AA 5D01A 4NY1A 4D3FA 3WIDA 4Z3KA 1GILA 1L4MA 2WM2A 3K0FA 4WINA 2E6KA 3W3ZB 1CR6A 1W94A 1FF9A 4AYWA 2WSYB 2F8LA 1RC1A 1LW6E 1VGRA 1LBQA 2R86A 1L7MA 1ZA2A 3LZ6A 4GXTA 4IICA 1C0LA 3LCJA 5GONB 3WRYC 1E0JA 4CUKA 2V6BA 1ENOA 1KDRA 1EX9A 2YY7A 1U4OA 1BN6A 3TVTA 1M74A 3GPDG 4LZLA 2QLBA 4GRDA 1G0OA 1WZEA 4PO1A 5C4MA 2QENA 1UZAA 3V6MA 5TRTA 2A5FA 4WOPA 1KK1A 3GNSA 3WMXA 1OYOA 1X2BA 1Z4OA 1P61B 1ZQ9A 4FONA 1EIZA 4LFCB 3A32A 1R9MA 1QX3A 2ZSJA 4LHVA 4CKCB 5IS2A 4RD4A 1MPXA 1IATA 1G3MA 2GZHA 4P4LA 4U8GA 1ODSA 1WMEA 2BFBB 1L8LA 2OCKA 2UVPB 3B6KA 4MV3A 3TKYA 5BOSB 3CVWA 1MXHA 2CLIB 3D7LA 3U1VA 1X1DA 3EHEA 2ZETA 3I58A 4IIJF 3PFFA 1UBSB 4ZAWA 1POWA 3DDHA 4BNKA 1XC7A 4KW7A 1FFEA 4L22A 4RNDB 5G4KA 3HUEA 1OAOC 4G0OA 4HRYA 5FJIA 3H8SA 4X8HA 2QD1A 3JWGA 4BPBA 4X6UA 2VS1A 4QBIA 1FFGA 2CKDA 3JU3A 4QYXA 4JVMA 1S2GA 4DPLA 4WY2A 4F3NA 3IAM6 5JAZA 4M8KA 2AVDA 1U3CA 3E0QA 3MC1A 1PJ3A 1XTVA 2H1CA 3CZRA 3NT2A 4G37A 3OM8A 1U2DC 3GEDA 4NATA 4Y1GA 5DHRA 1E2LA 1NFRA 4DABA 1BA3A 3R0ZA 1ATZA 4OQMA 5LQNA 2EW1A 5CM2Z 5IF9A 1YA6A 1H0SA 4A6DA 2LD4A 2HT1A 5H9WA 2A5JA 2PEYA 5AKZA 2ECOA 5F7OA 1EFAA 1LFDB 4FZRA 3RT1A 3DCYA 9MHTA 4IFEA 1PEDA 4QUBA 3UXHA 4LYFA 4Q6WA 3TLAA 4QPJC 4NC9A 3RH0A 2GA9A 2DUUA 2WHXA 3T1VA 3OEED 1YVDA 3OBBA 4QO8A 1T9KA 4ZVQA 3GAMA 2H8GA 3F3KA 4Q1BA 3HEBA 3LFTA 2QZZA 3PRYA 1OILA 5CD1A 1UBLS 1YB6A 4G97A 5ALKA 1UZLA 1PSDA 4CF5A 4JI2B 3DYBA 4AWBA 4PZCA 3I83A 2HMSA 3IEKA 5AQEA 4MRRA 3RSOA 1UAAA 4HYEA 4NMXB 1C4WA 3FZGA 1OTHA 1E61A 2PZAA 5IBQA 2Q28A 3PGMA 2NTYC 3EA4A 2CEAA 1JQJC 2WOOA 1LPPA 2OZVA 4AWAA 3HBFA 3LQKA 4O2BA 4TWZA 1P4JA 1SKAA 4Q5IA 5EMJA 1AXEA 3X1JA 2I7TA 4MVJA 4EFMA 1K88A 2AMJA 1F8UA 1H42A 1NN5A 1NUUA 2D2EA 1ULTA 1LRJA 2HHCA 3MWDB 3NVMB 1DJQA 4BNYA 1J2TA 4NBVA 2D74A 3H42B 4Q93A 2QMYA 1F12A 4J3NA 2JHCA 4Q7EA 3LHFA 4QUKA 3JAKB 3S8YA 3D7KA 3ZU2A 2OBFA 4XSGA 4MV5A 1DIAA 3CZAA 3N70A 1BMFD 2AMYA 4G09A 3AR4A 3WWOA 3H8JA 1SCBA 1HT0A 4J0GA 3TB6A 1JAHA 3OHPA 2VPPA 3O1LA 5LOVB 4DZTA 1OFHA 5KNDD 2VYND 3LQYA 3TOXA 3VPAA 5KYNA 1F2TB 3NU1A 2NXCA 3JQ9C 4Y6PA 3VVLA 2SKEA 2X3UA 5K3DA 1J5EB 2QX4A 1JIQA 4C5CA 2FMUA 3M4JA 1L4LA 5EERA 2DWUA 2ZUWA 3G1TA 4HH1A 4PF1A 3KAJA 3QF4B 3QVUA 1VLZA 4U6QA 2ZKIA 4DMUB 2KHZA 3W6PA 1KYIA 3K1AA 4ERXA 1GL7A 3H2ZA 1ACLA 1NVWQ 4BQFA 3M4YA 3ZTTA 1Y5MA 2H08A 1PEYA 4DQKA 4F06A 3CF2A 5M2QA 4EY5A 2F62A 4FFRA 1FDWA 3SBDA 3X1DA 2V98A 3LXXA 4UMFA 4AS1A 1EQAA 1CY4A 1NBIA 1NT4A 3GVIA 4ND2A 3W78A 5M04A 1MW9X 3H2JA 2Q3JA 4Y1RA 4JQOA 3ADBA 3B60A 4KDEA 5GADl 2IITA 4ZV7A 5KKNB 5U9CA 2HRQA 1LLUA 4YXWD 5T4HA 1HTBA 4DIUA 4QEDA 3N76A 2Q8QA 3CM0A 1XP8A 2CXTA 1TT5A 3A6DA 1FDRA 3AHCA 3FMFA 2HQRA 3QLJA 1MLDA 2O57A 2YUTA 2OFOA 3G8CA 3GJRA 3IP1A 4W8OA 4BE7B 2FQXA 3CGWA 2CFCA 2A0KA 4CM5A 2P3LA 3COJA 2D8AA 3EOAI 3HP1A 1O4WA 4DUGA 4FNAA 1CUUA 3K53A 3FSJX 1RHJA 1Y9AA 2FN4A 3JQBA 4TWAA 1GN9A 2WKQA 3D8BA 4MINA 3WWCA 2BGUA 4OYRA 1UQUA 4REOA 3VR6H 3QWHA 4L76A 3QEBZ 3CT4A 3TFQA 3W2FA 4DIMA 3KVRA 2IYYA 4TWJA 3QPDA 1MO5A 4Y0VA 5CXXA 4B8ZA 2VDQB 4KEAA 1OU0A 2WWTA 1CR2A 2R8YA 4QL3A 5ENVA 3ZHZA 3QSYA 2V8BA 4O0LA 3K94A 2O2GA 2CEKA 2R5WA 3KKKA 5AUPB 4CF6A 5LFAA 3G8AA 1RMTA 1N32B 4PYJA 4N6GA 1N5LA 1U5AA 3DR3A 4RVGA 2F6RA 3ZDZB 4BHTA 5JPCA 2FE4A 3NBUA 1VBKA 2X23A 3PE3A 4YMIA 4A8JB 5FYQA 4GPEA 4E2ZA 2QRGA 3KOMA 5AXCA 3MQFA 1P31A 3RE1A 1PR1A 1YNOA 3FXAA 3L04A 4ON9A 5GZ6A 4UHKA 2B4QA 3SZUA 1XTJA 3F5DA 1ILEA 2FKNA 7MDHA 3OQ6A 5FBHA 3N05A 5TLSA 3CRW1 3E18A 1JZQA 1A4RA 2W5UA 3R5FA 4QUDA 4YWHA 4C29A 3K6KA 5C7LO 3Q5GA 3H9BA 4DTCA 3F5MA 1A27A 1JU9A 1AQLA 4LY6A 4MPJA 5CVUA 1WXDA 5ALTA 1YHNA 3PLRA 3HR8A 1HQKA 1Q7CA 4G8DA 4C4XA 5CD9A 1EDOA 1SZPA 2H5LA 2PZJA 1QIDA 3DMDA 3UMCA 4AF6A 1GCIA 3U1TA 3UHFA 4RLFA 4BLRA 3MIIA 4LDZA 2DR0A 2Q7OE 3UVEA 1NN3A 2CV0A 4N41A 3IVXA 3AETB 2WAYA 2PAFA 4WUTA 1YB5A 1YWGO 3FCOA 1LSUA 5JS7A 2AQKA 2RGCA 2P78A 2R97A 1TVKB 3EK2A 2I3GA 3R20A 5AR1A 5AVOA 5THXA 4BLVA 4NZPA 3L8CA 1FSZA 3GOHA 2JS7A 3ILSA 4W5QA 4GVLA 2BHSA 1SBIA 1ZRHA 3OA0A 3SEFA 3TR0A 4M38A 5FH9A 4YAOA 3RIGA 5K3OA 2YN2A 3FLBA 1RRPA 4QOFA 3ESBA 4E46A 1DEAA 4HNSA 2ZUDA 3NRJA 1WD7A 1T6XA 4FBMA 3UWPA 1NJGA 4J0EA 1O6GA 4R69A 4D0RA 4GZLA 4DA4A 2R6FA 3EXIB 2EJBA 1UOPA 2WIFA 3O92A 4GLFA 4M99A 5EJEA 4ZT3A 3U3DA 5BNFA 2RHWA 2EFEB 3EG9B 4HN2A 4LZZA 1ARZA 5CK4A 5IHXA 4OPMA 5JARA 3TH5A 4EHJA 2XE4A 2Z8XA 4H2DA 1YB1A 1WUHS 1I9CA 2C77A 3U7RA 4BNGA 1CDDA 2PLRA 3FSGD 3HJUA 2MR6A 1EUYA 4JJIA 1RADA 3H5IA 4NCJA 3ZLJA 3HBAA 1W5AA 5I4CA 3W1WA 2O7RA 5TQ2B 1P3DA 4RESA 2FOXA 1V96A 2WVJA 2XADA 4REQA 3ELUA 1R8QA 3A3NA 4HQNA 4O4JB 2TYSB 1VE9A 4KCGA 2WHRA 3LC7O 2MJLA 4I50A 4M6WA 3WK9A 1ESCA 1C9YA 1UBTS 2ZLBA 3LD9A 1JPNA 1VYHA 1ZVKA 1YGPA 3NX4A 4MW5A 5JASA 3FDXA 2VC2B 4KXWA 4Q9NA 5AI8A 5EE5B 5ITWA 4FS8A 3CWZA 3TZQA 2FW0A 3WLTA 2P5SA 3SQLA 4HEA6 3RRXA 2QWXA 1O94C 2QJTA 1FP7A 2ZJ2A 1W59A 3MAGA 2ZSIA 3QX7A 2VUHB 4Q9KA 4C4SA 2O8BA 2Q99A 2Y8EA 5BSWA 4CBVA 3MK31 3UKJA 4ER3A 4B09A 5I01A 4W99A 2OD7A 2PLAA 2WFMA 3CNBA 3U7IA 3QELB 1MA0A 1EGHA 4WECA 1RFLA 2C7PA 3PITA 1RLTA 4LS3A 3RVLA 4RZ2A 3TTSA 3MWLA 6PFKA 3A1SA 3DMTA 3DFFA 3BTVA 4H1TA 2OV2A 2FF5A 2OZKA 1O5OA 1DO2A 2VT6A 3PGKA 4IAOA 1USGA 2JARA 1XZIA 2VQFB 1UXJA 1K5DA 3W77A 2Z2ZA 1SKBA 3AHHA 3C41J 4N01A 5HBGA 4KB5A 3NATA 3R0QA 4NE7A 4B6JA 2XCQA 1LPNA 4CQLB 4HDCA 5LLDA 3RRNA 1YZLA 2IUYA 1GKKA 4YDSA 2PY6A 2Z9BA 3L43A 1ZI8A 1P29A 2Q50A 3PCTA 5G02A 4IQ4A 3HKCA 2JCSA 1KI9A 3GCXA 4DYHA 4O4LA 3DOUA 1R10A 1JHAA 1KP9A 3DP7A 3FKJA 3LOPA 5DHQA 3D6NB 3HV0A 4G4SO 2RIPA 3FPBA 3O1JC 4P92A 4ALKA 1A9SA 4E08A 4AD8A 2WLTA 1Z07A 4L9AA 4NJMB 2L17A 3R7FA 3DTTA 2ZWMA 2ID9A 4V1CB 5JNWA 4OF4A 2DULA 2Q4EA 4OSEA 1TM1E 4DM4A 4EG8A 5P8WA 1SPXA 4INJA 2A30A 4EO7A 5F4ZA 1RCUA 1KI8A 4BKMA 4DR7B 4J4BA 2P67A 3I9FA 4F5YA 3FZYA 3Q3IA 4JR0A 3IP6A 3KE9A 3CSUA 4ZKEA 3A2KA 4K28A 5CVEA 3U3OA 2FPLA 1PG0A 2P7IA 4F3YA 2DH6A 2Q8PA 4Z3OA 2DKNA 4Q3DA 4LF6B 2V65A 1Z8FA 3O0DA 4TLDA 2OV8A 4LGYA 1YD7A 3GUYA 4XD7D 3R76A 4MCHA 2AHRA 2PUEA 1NI4B 1DAKA 1X9HA 5HQJA 2BEWA 1M6HA 2C9DA 4B6RA 1OSNA 1QCCA 4EX7A 1GJRA 5CEJA 1ORDA 3OY2A 4BNDB 2F1KA 1F1BA 2XGOA 3AY0A 4AF8A 621PA 1VTKA 3KU4A 4Q3KA 1CJMA 3K9GA 2CHGA 2XMRA 4GPBA 4LTNA 2WBLC 1ZFNA 4N7RA 5AHRA 2XY4A 3S8MA 1BH2A 1I5RA 4EYGA 1ADGA 1Q1ZA 3BXZA 3P4XA 3C7TA 3WWYA 4L72A 2G67A 5EEGA 5FUXA 3B1VA 2PX5A 5JZBA 3NBYC 1DKPA 3PFKA 4ZO9A 1Z8NA 5TMEA 3VGPA 3EZ2A 3HP4A 3D0KA 1ADBA 1KO8A 4NICA 2GEBA 4UBKA 3ZBPA 1BDIA 1T8YA 1LV7A 2P6MA 4E2FA 3THWA 2AFRA 1W0JA 2G1JA 3MUEA 1NOIA 1J8DA 2BM1A 3P9NA 4K81B 4BEJA 1KMCA 3ZWBA 4Y6OA 5IM4A 2DVMA 4KIUA 2X58A 2CVFA 3E61A 4GSLA 4X54A 3W6NA 1U0GA 2IXDA 5HUQA 3R3WA 3BDAA 4J6FA 3IUPA 2VYQA 1R0BA 2JFXA 3O8BA 3IHTA 3Q10A 1EINA 1ORWA 1XYGA 1ODJA 4YRTA 1JLMA 4YPOA 3QVVA 4YI5A 2X9VA 2Q0QA 4ARAA 3N2LA 3QVJA 5CLJA 2HLHA 4CM8A 4OFWA 1KPIA 4KQMA 1H1TA 1JNYA 1TCVA 2FPIA 2QTVB 3ZCSA 4CXMA 5BN4A 1HXHA 1S2NA 4OQEA 4CKEB 2PX6A 2NO6A 2ZR8A 3G2PA 4BVAA 2O3QA 4RC9A 4JVNA 3RGWS 3RAEC 3CRVA 3LJKA 4G81A 4CKXA 5H4GA 2HO4A 2QT1A 4MW4A 1FQOA 1U0EA 1OROA 1U7OA 1YBFA 2HSEA 2PL5A 2GD1O 3BXGA 3F49S 3BE5A 2IHZA 3DVSX 4QGFA 5K0GA 5IKXA 2GD6A 1QH8A 1RYZA 2P75A 1GKUB 3ANSA 4HUQA 4M1TA 4TYQA 3MRVA 4E13A 3W06A 2QB5A 2XUQA 3M6VA 3BXEA 4PSUA 2UYYA 2X0IA 4W7IA 2NUPB 1N7JA 3AESA 4MUBA 4IWNA 1GKLA 3OFNA 2R1TA 4PCLA 4KV7A 5LP1A 1EJBA 1DAIA 2C5HA 2XQFA 4AMGA 4GHWA 5GOZA 4KDCA 4PIVA 2I62A 3LWDA 2FTKE 3ZI4A 4YCNA 1ZINA 4HQOA 4DSZA 4R31A 4HV4A 1SZDA 2C54A 4EHIA 3GZNA 4ALIA 5CA1A 1J25A 4W6QA 3LSYA 1JE1A 2PX2A 3P2KA 5TPZA 4EDFA 4D6YA 3H18A 4FQ7A 3RVOA 1S2OA 3I4FA 4YY3B 3I4CA 1PL8A 4F3CA 3L7MA 2BGRA 1KRXA 4UCQA 4P7KA 2BGKA 4RSRA 1ZHFA 3EDRA 4U2KA 1YCHA 3W4IA 3PTLA 3E05A 5BPHA 1OASA 1YI0A 4KR3A 1LW7A 2IZ5A 4JVSB 4JVOA 2AR9A 4KTVE 1MDFA 2EU8A 4NZZA 4N0EA 2WIGA 1FNBA 3GGSA 4N54A 3GG9A 3IKMB 3WI7A 4YYEA 3IMKA 1E2UA 5K0ZA 2PWPA 3A1WA 5E6SB 2YXEA 3KSAC 3EEBA 3OE5A 5EPOA 4X97A 3ZKWB 1BAPA 3E3MA 1H6AA 3JD0A 3ITDA 4KZPA 4MW7A 4NFYA 1XVTA 2Y99A 4XSVA 3K9WA 5AW2A 5LYJB 3CH5A 2H0AA 4U02A 1VI6A 1W88A 4MS1B 1A8UA 2YN0A 4LZWA 3UHOA 1LI5A 4WT7A 1L3CA 2JPDA 2CBZA 4UDNA 2FEWB 3ZJUA 3R9WA 4L1KA 2NUAB 2ZIAA 2GBFA 3U7HB 3E8SA 3IXMA 5CLFA 1TTPB 3Q11A 1O77A 2EKLA 1RWNA 1AD2A 1Y3CE 2NZJA 3I05A 2FSSA 3IEUA 1WCIB 4Q1DA 4XQ9A 2IEAA 3L4SO 3ZHVA 2EOAA 4BQNA 4BECA 2H7YA 1BG6A 3QVMA 1RQLA 2QZ4A 3ERCA 3KUKA 2J07A 5CT8A 2GBLA 1WLYA 4JUAA 3FAZA 1ESEA 3KUXA 2ZOSA 1Z33A 4XGIA 1QF6A 3KYDA 3IE2A 3MGCA 5TPWB