1LXCA

Crystal structure of e. coli enoyl reductase-nad+ with a bound acrylamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
251
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of aminopyridine-based inhibitors of bacterial enoyl-ACP reductase (FabI).
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
total genus 89
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lxcA00
2WE7A 1Q1NA 4Z3DA 3INGA 3WBBA 2OHXA 4MP6A 3DTTA 4CM4B 5BNIA 1LDBA 5COAA 3PYXA 4YAKA 5EQFA 1K6IA 1ENYA 1PZEA 4DXHA 2AQKA 5C7OO 2C59A 1UDCA 1PGQA 3JQ9C 4L75A 3GLQA 4Y6SA 4DQUA 1WNTA 3PJDA 4J4TA 4CM8B 1ZSYA 4FOSA 3ETEA 3VPFA 3WWYA 1T1RA 3RUHA 1H9AA 4DLAA 1OC4A 3C24A 3QRWA 3TWOA 1TXGA 4DPMA 1DIGA 3OJ0A 5TJ9A 3ZWXA 1P3DA 3MOGA 3RUEA 3K2BA 4C7KA 5KIAA 3AFMA 2AXQA 2IDZA 3PHHA 4CM1A 4IZIA 1ISHA 4XJTA 1CQJA 4QT0A 5DBFA 4BB5A 3IKVA 3VZPA 2VYND 3D5QA 4RVUA 1XEAA 4OOFA 1U2GA 3NT4A 1PJ2A 1HT0A 4ZQEA 3BHMA 4DVJA 1R6DA 1VPDA 4GSKA 5BNTA 3GHHA 4FFMA 4XYLA 1YBMA 3RUFA 3LT4A 2GGSA 2X23A 2FR8A 4OM8A 5DNAA 3JQ8A 3DOOA 4DIFA 2TMGA 2OBNA 3ASVA 3PWKA 5JW6A 2GZ2A 4Z0TA 1AGNA 2R2GA 4GGPA 3TPCA 4IQGA 1DXYA 1FF9A 1UXIA 3INRA 4N7RA 5JC1A 3CIFA 4LISA 5AXCA 1IY8A 1M75A 4GLOA 5JSFA 1DAPA 3GFGA 1UXKA 4LCJA 3U4HA 1DRVA 1IPEA 3GK3A 5H82A 3TZHA 2C20A 2VWQA 3E9NA 2IEDA 4E5PA 1CJCA 3UXYA 4IS2A 2IODA 1IZ9A 2NQTA 3NDRA 1EDOA 3WYBA 3O8QA 4KWIA 4ID9A 3ZW8A 1BVRA 1Z7EA 1OMOA 1HZZA 4UEKA 1LQTA 2VUTA 3F5SA 2EP7A 3CTMA 1B16A 3BA1A 3VZSA 1WDKA 1KEVA 2DFVA 3PQEA 1LSOA 4G5HA 1OOEA 2EV9A 4WEOA 5F21A 3PLNA 1GZ3A 5AXDA 4MKRA 1BXKA 4E32A 2X22A 4EJMA 3UF0A 3ASUA 4P4LA 4BNNA 2P9EA 4BB6A 1HDYA 4Y8VA 5ITVA 2VOEA 5T8KC 3GT0A 1E6WA 3L4SO 1HE3A 5TF4A 4XZ3A 4XWYA 3RSHA 4A26A 4CUKA 1T2DA 3K96A 2UVDA 2O4CA 2RAFA 4LRTB 1R37A 2IEBA 1H6CA 1EDZA 1FDTA 1OBFO 2UUPA 5A5FA 4Q3DA 4EEZA 4U6QA 1NWHA 2VTDA 3BMNB 4YBZA 1A7AA 3A4VA 3OQ6A 4R5HA 5KVVA 1Y1PA 3NT2A 3VH2A 2AQ8A 3IMFA 5DZSA 1ZK2A 3O4RA 1VL0A 1K3TA 2RHRA 3QVTA 3H7AA 3AUUA 3TZQA 4ZRMA 3RC7A 4BL5A 1GZ6A 1X15A 1Y8RB 1TVEA 4UEOA 2J3JA 3G0OA 3QQPA 2Y0EA 4DREA 1I8TA 3H9UA 4IDAA 3SBOA 2OBYA 4PG8A 1M76A 5CP8A 3QWFA 4AJOA 4GWGA 3VPSA 1U2DA 3UUWA 1D4FA 2P2SA 3E03A 3C3XA 4CQMB 5KVCA 1EUCA 4J1TA 4OOEA 4PGFA 3QVXA 4YVFA 8ADHA 1MFPA 2Z1MA 3LU1A 1YRLA 4XX0A 3W6UA 2NTVA 4K9DA 4MDHA 2CY0A 3GN2A 4ONEA 2NADA 2NU6A 3SLKA 4CV0A 3AM4A 3OICA 3PZBA 1PQWA 2J3HA 1T4DA 3L9XA 4OL9A 3DAPA 4E4YA 1VI2A 1JAXA 1RJWA 4BMNA 4EUEA 4FC7A 4ZVVA 4E6PA 2PLAA 4B3IA 1LC3A 2B36A 2PY6A 3RUAA 2D4AA 1ZMOA 3WTCA 2RH8A 3S2GA 4TKLA 3WIEA 4XR9A 4MVJH 1YS4A 1LSUA 4CV1A 3E9QA 1U1IA 4JX8A 5K9ZA 1HSZA 3I9NA 2AE1A 4Q3BA 1LX6A 2HMTA 4XQCA 4EUFA 4XQGA 1C0IA 2EKPA 5ICSA 5F3RA 3EUWA 5T8KA 4B3JA 2QHXA 1BW9A 3JQDA 3GGOA 5CDYA 3WX0A 4R9RA 2POQX 2YFHA 1K5HA 3RFXA 5L7WA 4R54A 2HLPA 3OSUA 1ISFA 4FSHA 5TJHA 2CDBA 4XQ9A 5I7SA 2B0JA 4IS3A 2YUTA 4CMEA 4GBJA 2JD0A 1NR7A 3DB2A 3IUSA 4XGIA 2EJVA 4M86A 3GVXA 3WB9A 1I2ZA 4IJWA 5THQA 2FR1A 1ONOA 2CFCA 2CF5A 3NAQA 4DIOA 1YH3A 2I76A 4UULA 4MO2A 1HDZA 3JQFC 4UVHA 5CFZA 1U5AA 1JN0A 4R3WA 4BNIA 4E21A 3LC1O 3KBOA 3FPLA 3NT5A 4Y9DA 2JJYA 3MTGA 1HDOA 1NAIA 4DPLA 4H16A 1DIAA 1I3MA 1UZMA 4D3FA 3DBVO 1DB3A 1E1KA 4BQRA 5DCYA 3O03A 2JL1A 1O9BA 3JQGA 2FN7A 4O6VA 2ZQZA 5AXBA 4NFHA 2ZIZA 2EWMA 3FNGA 4A7PA 3V1UA 2ET6A 4BOYA 2O23A 1DBVO 2AW5A 3AI1A 2Y1EA 2DPGA 5FI5A 3JQ8B 4CL8A 1GPJA 2X58A 3PVZA 4XCVA 3T7EA 4CPDA 3LK7A 1KEPA 1V9LA 2DQ4A 4CLDA 3D4NA 1QV7A 2X5OA 4WK6A 5IJZA 1H93A 2CUKA 2YHUA 2X5JO 1Q0HA 3H5NA 1X1TA 3JSAA 1MG0A 5I8WA 4EBFA 4QSMA 2GUGA 1W6UA 1EVIA 4OMUA 1CETA 1RPNA 4GKBA 2RIRA 4Z0HO 5IZCC 4CQLA 3MJ4A 2X9GA 2BD0A 3ICPA 4I1IA 4P38A 3WMXA 3OBBA 4E2ZA 1I2BA 1R4MB 3FTNA 4WKGA 5ILOA 4GPD1 5DOVA 2D0IA 2HRZA 5IZ4A 3DAFA 1U7TA 4BGIA 1TT5B 3DHYA 3GPIA 3ZZNA 2CVZA 3NTOA 4XR4A 4XRGA 3JYNA 4CMGA 1YDWA 3L77A 4RQUA 5K0ZA 1XU9A 1LLUA 4NK4A 4ZJUA 2HK9A 3DFUA 3EZYA 4MPDA 3C7DB 2PR2A 4E5YA 4D7AA 1KY4A 4GSLA 1O94A 5U9CA 3VHRA 2XXJA 4M89A 1B8VA 1BTOA 4AJHA 4DMLA 1VJ0A 1H2HA 3VH3A 2O7QA 1U3TA 2PD3A 4RPJA 3AU9A 3DBHB 3ENNA 2W2LD 1C14A 3H2SA 2DPHA 4CLEA 5GZ3A 3E1KA 5A5EA 3OF2A 4IMPA 1MC4A 3HG7A 4E2WA 5A03A 4IXWA 3SJUA 1JWAB 1ZJZA 4J6FA 2X7HA 3A1NA 3SXPA 3GVIA 3FWZA 3OJEA 2VWGA 4BKQA 2X0RA 2YV2A 2Y93A 1DOHA 2X0NA 3JCZA 4LK3A 3BMNA 4BKRA 1WAMA 3L0DA 4J9UE 4R41A 4L76A 1TLTA 1GDHA 2QIOA 4TRMA 3AOEC 4O63O 1B3BA 2WD7B 3IJPA 4FJ2A 1XGKA 3EC7A 5JYDA 2P4HX 3RC1A 3ZWCA 1F14A 4CM9D 2WTBA 2VZ0A 4YQZA 4CV3A 1NVGA 3H65A 2VHVA 4FFLA 4TZKA 3QSGA 3GGGA 2VHWA 4QQRA 4K26A 5JDCA 5KVSA 2FHSA 3G49A 4ZU3A 1A4IA 4B4OA 2EP5A 2V65A 4J0FA 2CMDA 1F0YA 3CSDA 3ZN2A 1YB4A 4RPKA 4W7IA 1YONA 1SC6A 3ZNNA 2X1HA 2AE2A 1QV6A 3NGXA 5CEJA 1ZK1A 4I5FA 1VLLA 2Y05A 2GLXA 3GAFA 4ZQGA 1Z45A 4QO8A 4IPTA 4BIIA 2OUIA 3VH4A 4QX6A 2Q2QA 1KY5A 2C54A 1R15A 4IIVA 1PZFA 3MEQA 3UKOA 3DFZA 1GCUA 3DBRA 3PQFA 3DOJA 2D5CA 3WFIA 4W82A 1JQBA 3KV3O 3NJ8A 3K92A 1QSGA 1LTHR 3P2OA 5DDIP 4CM5A 1E7WA 1NM5A 4IY1A 1ZK4A 4GX5A 4GX2A 1SOVA 4JN6B 4RV9A 3VAZA 1ZW1A 2GASA 5C37A 4DYVA 3GVPA 4YTEA 3I5MA 3WICA 4CMCA 5TSDA 3HFGA 2YQ5A 5ADHA 4IQ0A 4CM3A 2WE8A 4CQLB 1JVBA 2VN8A 5JCJD 4XIJA 2YHIB 3H9GA 3ITDA 1ZK0A 3WGOA 1O0SA 1BDMA 2GO1A 4O0LA 5TGDA 1VKOA 2WDZA 3N58A 4YCAA 2AA3A 4NBUA 5KJ1A 2DTDA 3EZLA 2G17A 3WQQA 3PHLA 4ZGWA 2YQ4A 4UVIA 2VUUA 3PYLA 1LUAA 2VNSA 1MG5A 2ZYDA 4XKJA 2VHZA 4DIBA 1BXGB 4Z6KA 4E0BA 4DBVO 1LRLA 4B7XA 3RQSA 5BR7A 1VRWA 1GTMA 2OOSA 4RDIA 3W1VA 5CG2A 3TFOA 3G79A 2DTXA 1KIFA 3MJVA 3DQPA 4PLHA 2VRCD 3BMQB 1ORRA 3ICCA 1KVTA 3C8MA 3W6ZA 3NX4A 1PZHA 1ZXLA 2IYOA 3PLRA 4PLYA 5ENVA 1CEQA 4EYEA 2H1SA 3TL2A 4M49A 1KEUA 1QRRA 1V8BA 3NJ4A 1UH5A 4KWHA 4BO1A 3LLSA 1H0KA 4N54A 4AJEA 2VQ3A 1NFRA 3WGZA 2HJSA 1ZCJA 2ZQYA 2OP0A 1ULSA 4WNCA 4LRSB 3LVFO 3PWZA 4EZBA 1P44A 1PU2A 1RWBA 2JAHA 3HZZA 1H6AA 1SMKA 4F6LA 4CV2A 2G1UA 4DGSA 1LJ8A 4YJGB 1ENPA 2NNLD 5EINA 5AQ1A 5IN5A 2PD4A 4PG7A 4W9NC 4B4UA 3GUCA 5B4VA 3WSWA 4UUMA 1UAYA 2IXBA 5I8ZA 3N74A 4J2OA 2DC1A 3VPHA 3BMQA 3GFBA 3AUSA 3F1KA 1P0CA 3FNFA 1PZGA 2NVBA 4NR0A 4JLWA 4RF5A 1R12A 1PJBA 1MGOA 3MTJA 4L73A 3SX2A 5DCUA 1P77A 2QZ9A 3WOHA 1DHRA 3JQFA 3KRTA 1I36A 3VZQA 3WGGA 2IE0A 3TL3A 4FJ0A 2WSBA 4BO6A 4EJ6A 2Q1UA 1LSSA 2R00C 1HDCA 2OFPA 4BVAA 1J0XO 3QIVA 4OQYA 1LDEA 1Y9AA 4GLLA 5TC4A 4DLLA 4MVJI 5KKCA 2DKNA 1PX0A 1A71A 3LC2O 2X8LA 3HHPA 3Q2IA 5HS4A 3GEGA 5CPBA 2Q3EA 3V8BA 4IINA 1HZJA 1P45A 1EEHA 3X2EA 1PL7A 5LDHA 3U09A 4J7CA 3FTPA 1X13A 4MINA 1KC1A 3W4IA 5CDSA 3AY3A 4JBHA 2D1YA 3VPXA 1LLQA 4NFYA 5KNLA 3JYLA 1ZO8A 4BV8A 1YL7A 3QY9A 3CZRA 3V5NA 2ZYAA 4B4VA 2Q45A 3GDGA 1U4SA 3ZU4A 3PHJA 2OP1A 3OETA 1EE2A 1A7KA 1MV8A 2B4QA 3B1KA 2I3GA 1QR6A 5I9MA 2LDBA 1YGYA 4AJKA 2VRCA 2QG4A 3QE3A 3K8ZA 1UXGA 4BNZA 5JO0A 4IDBA 4EEXA 3OA2A 4JGBA 2V7PA 5GY7A 2V6FA 1GQQA 3A14A 1UDAA 4ALJA 2RH4A 1YKFA 1XQ1A 3KYCB 3HADA 1U5CA 4TKMA 2BF7A 3Q1LA 4IUYA 2AG5A 1XR3A 1VC2A 2IYPA 2HK8A 2WMDA 3KEOA 4H3VA 3I83A 4R9SA 4B4WA 1DIBA 2DFDA 4YT8A 1Q0QA 4URFA 4R1UA 5JFOA 1CYDA 1ADBA 2WYVA 4A10A 3P19A 3LT0A 3HQ4O 3O9ZA 6ADHA 3EVTA 3GN1A 4WE3A 5AOVA 1I3KA 2QYTA 3WJAA 3OP4A 2B5VA 1CRWG 1VJ1A 1C0LA 1OC2A 2GYYA 1ZEMA 2GERA 4BNUA 4D0RA 1Q7CA 3JYPA 1GUFA 1C1XB 1X0XA 3UCEA 4CLRA 3IUPA 3MJSA 3DZJA 2B37A 4D0SA 4HV4A 4ALNA 2FPGA 1XQ6A 3B1FA 5DBGA 5LDGA 4GI2A 1SBYA 2VHXA 1O89A 3RC9A 4YT4A 3L9WA 2C7VA 3IDSA 2FZWA 5I7EA 1T25A 4IJVA 1G6KA 1E1LA 5JS6A 5JLAA 3GNSA 5GZ6A 2X9NA 3DO5A 4A73A 4MOWA 4ALKA 3ZW9A 2X0JA 3Q3CA 3U3XA 3GRPA 4BO5A 5ER9A 4ROSA 3OJLA 4U0JA 3V1TC 1N8KA 3Q9UA 1BDBA 1GY8A 2BI8A 2FY8A 4PN3A 3VZRA 2DTEA 1VL8A 4N18A 4BNJA 3KM0A 3G17A 2E4AA 3GG9A 4Z3KA 3PTZA 1DLIA 3GDFA 2EHDA 5DN9A 1EFKA 1LLCA 1E92A 2C5AA 2B35A 2P5UA 4DMMA 3CPSA 1SAYA 1RKXA 2Q4EA 3BTOA 3V2UA 2P91A 4PZCA 3BXXA 2BGMA 4RF2A 3H5AA 7ADHA 2VYVD 2JD2A 2JCYA 1GZ4A 2Q46A 3S55A 1D1TA 4RO0A 4YRAA 1UUFA 3PRJA 4CR8A 4NIMA 1RYDA 1LI4A 2FPIA 4UVGA 5KJCA 3FSRA 4XGKA 2I9PA 2HQ1A 1B2LA 4JXKA 3JD0A 4JROA 3S1LA 5B4TA 1R4NB 1B7GO 2FP4A 4WLOA 3HN2A 3EDMA 5A4DA 1MX3A 1S6YA 1CERA 1E7YA 3TSCA 2QQ5A 5L7YA 4IDDA 4Q3EA 4CM8A 3BMCA 4L8VA 4J3FA 3CMCO 3TZCA 1U8XX 2ZTUA 3N7UA 4DTIA 3WYEA 4KUHA 3CMMA 1ZJYA 4Q3CA 4D3SA 3PXXA 1LRKA 3M2TA 4TSKA 2ZTVA 4KTVE 3QVOA 3KSUA 3RBVA 5IDQA 4DBZA 1ZSNA 1SNYA 4YJHB 4HXYA 3HN7A 2D8AA 2NACA 2EGHA 1C1DA 1ZUD1 1BGVA 4WECA 3G3EA 1QYCA 2Z5LA 4I9HA 1ADGA 5FF9A 5JXWA 4FPXA 1NNUA 4IDEA 4BMVA 4MIEA 4CLOA 3HB5X 2J3IA 4I9UA 2YDYA 4OHUA 5L45A 5ES3A 4UUNA 3ZU2A 1UP4A 1H6DA 4FQ8A 4NI5A 4I08A 2QZZA 3GDOA 1QKIA 3LT1A 3W8DA 1DDOA 1L1FA 4BS9A 3KYDB 1DO8A 1VL6A 1PSDA 3ADOA 2ZTLA 4XEHA 1EBUA 5JAZA 1AN9A 3I6IA 1Q2XA 4DWVA 4A5OA 1AE1A 3AOGA 2HO5A 2YHIA 1M66A 3Q9NA 4N5NA 1R0KA 4WLFA 2GPTA 2ILTA 1QMGA 2PZMA 2I99A 2GDZA 2EEZA 1VKNA 1X7GA 5FYDA 3AUTA 3PIDA 1H5QA 4JCOA 4FGSA 5DF1A 5L95A 1E77A 4RL6A 3KO8A 3S8MA 3FBGA 2PH3A 2RBEA 4RZIA 1ZFNA 1D8AA 2Z1NA 3K73O 4PG5A 2B83A 4GL4A 1JKFA 2BI7A 3QLJA 1LA2A 1YB1A 3ZU5A 3IAHA 2BHLA 4D3DA 4UUPA 2XXBA 1BW9B 3WSVA 1R4MA 3FF4A 4ND5A 2EF1A 2C7GA 2Q50A 5JAIA 1MUUA 2VZ8A 2F00A 2LDXA 5IDXA 1XCBA 3UW3A 4WASA 1A9ZA 3PIIA 4L9RA 4WLUA 5G0UA 2Q4BA 3PFFA 4EDFA 2IRWA 3FI9A 4I5GA 3UHAA 2FZEA 1Q7GA 3MJCA 5B4UA 1OI7A 1A72A 1KYQA 3NV9A 4E3ZA 3EMKA 3RWBA 3QW2A 3P2YA 4UEJA 3RUIA 3QWIA 3P7MA 1LU9A 1IB6A 4RVGA 4P22A 3IL2A 4HNHA 4AJNA 5GZ1A 1GCOA 1E5QA 2NVWA 2RCYA 2H63A 4DL9A 4ZN6A 4ZA2A 4IIUA 1AHHA 1BG6A 1Y5RA 4NBTA 2ZB3A 3ENKA 4J90A 5K6AC 3RAJA 4MVJF 4UVEA 3JQGB 1Y6JA 3JQEA 4MP8A 3DMTA 1E7SA 1HDXA 1Y8QA 3GZNB 5ICMA 1BRMA 1CWUA 1O8CA 3GOHA 5EJ2A 5A9TA 5B12A 4GMFA 4NH4A 5BQFA 4IGFA 4PCVA 1GUZA 1ISJA 4ZQFA 4INAA 1I3NA 2CNBA 3ANMA 1P1IA 3O26A 1K2WA 1HE2A 3GMSA 4GX1A 4RF3A 1ZK3A 3WQRA 1XSEA 4ILKA 5DP2A 6LDHA 4GGOA 4KUGA 4YT5A 5L40A 5KTKA 2UUOA 4U0KA 4DQVA 4QFDA 4DPKA 4MKXA 1WDLA 1YBVA 3JD4A 4DQXA 1YL6A 1RM5A 1HWYA 2EKLA 2HDHA 4CR7A 3DHNA 3ONDA 4M54A 5KVQA 3ZWWA 2DT5A 2V6BA 3TFQA 5TT0A 2QRKA 1HL3A 4J91A 1V3VA 3D0OA 4XYBA 4M1QA 1DRWA 2J5QA 2QRLA 5B37A 4LGVA 1ZZEA 3SJ7A 1J4AA 1UAGA 3JQBA 3MOIA 4OXYA 3F6YA 3U49A 3SC6A 4Y6RA 4IM7A 1ZNQO 2O3UA 2FR0A 4TRNA 4PFJA 3RFTA 1DAOA 1VJTA 3CEAA 3IQDB 5H83A 5CDTA 2I65A 4EITA 4DC1A 5HS6A 1BWSA 1Y8RA 2DM6A 1O5IA 4PLCA 4LMPA 3C1TA 1TA4A 4GMGA 4RPHA 4E30A 5EIOA 4W6ZA 2DLDA 2X9VA 3E9MA 4UREA 4JP3A 5G4LA 1P1FA 4BNMA 3VH1A 2R6JA 5K6AA 3WTBA 5BSGA 3H3JA 1Y81A 3F9IA 3K9QO 4AG3A 1OAAA 3DWFA 5U4QA 4CR6A 7MDHA 2AEJA 3L4BC 5JPIA 3I4CA 1P1KA 2TMDA 4A03A 5T64A 3TF5A 3SEFA 2QX7A 3NTQA 4IDFA 4RCVA 4F45A 5IG2A 3KYBA 4FB5A 1V3TA 1AXEA 1PJ4A 2WWRA 3DZIA 4WPGA 4D41A 4W9NA 1Z82A 2G76A 3DZKA 3DMYA 4YACA 2BELA 1MC5A 3RD5A 1DFGA 3V2GA 4IDCA 4Q9NA 1X1EA 3WQSB 4ZHSA 2PV7A 1CF2O 3IP1A 5L4SA 3DHEA 2P9CA 1K6XA 1N7HA 2GR9A 5EN4A 4HUJA 3AM5A 1GUYA 1FDUA 1PJTA 4PZEA 2J6IA 4YA6A 1ENZA 5AYVA 3E6AA 2E82A 3WMWA 3PFWO 4BNLA 3B6ZA 3MJTA 1YXMA 1PS0A 4E13A 3EVNA 4DA9A 4RF4A 1QORA 1WWKA 1NHWA 4J1NA 4FW8A 3RROA 4CJXA 1WXDA 4E12A 3JYQA 3RASA 1MB4A 3DBRB 1WP4A 4J1SA 1CDOA 3B70A 2HMVA 3AK4A 4FN4A 2B69A 1PGOA 2W98A 2Q2VA 1DLJA 1Y8QB 3GZNA 4RPLA 5IAAA 4CMBA 5DCWA 3GNQA 4U8GA 1JA9A 2ZK7A 2Y1CA 1YL5A 4ALLA 3GH3A 1BXZA 2WEKA 4YJFA 3CXRA 2X6TA 2Q99A 4XDZA 2W4QA 5TT1A 2WYUA 4BNVA 3HB4X 2DBVO 3W4JA 2AG8A 3OIFA 5FWNA 3KUXA 2AQHA 1XA0A 2Y1FA 2B5WA 4BNXA 3ZH2A 5DT9A 1OZAA 1I10A 3INTA 1X14A 2PK3A 3ZWNA 4QEDA 2E48A 3DBHA 5FEUA 1J49A 1GFSA 2X4GA 3RKUA 4BHTA 3C1OA 4D46A 3WGQA 4NPCA 2BGLA 3KETA 4TROA 4G81A 1HTBA 1V35A 4JJIA 1KBZA 1Z6ZA 2JD1A 1EVZA 4PLPA 2GZ1A 5I9NA 3U4DA 1XDWA 1B8UA 3U5TA 3NDIA 1YBAA 3ZHBA 1W73A 1T4BA 1N9GA 4XQEA 1K6JA 1KS9A 2JFGA 5G4KA 1GEEA 2CDCA 3CZMA 4BNKA 3EGOA 4WJZA 3ZV3A 2NM0A 4TWRA 1PIWA 1PJLA 1SO8A 3I23A 2AHRA 1IHYA 5IF3A 4ZD6A 3HDYA 2UDPA 4PLFA 4R4JA 5I9LA 1I33A 1UXHA 4BQPA 1MLDA 3LSYA 1IYZA 3NEPX 2WJPA 8LDHA 1DFIA 4S3MA 3M1LA 2AEMA 3PK0A 3E5RA 2YYYA 3H4VA 4R1SA 1EK6A 2H6EA 4NQZA 1Z75A 4B7UA 3JQ7A 3I52A 5G4KB 5T67A 4HFMA 3C1AA 3UICA 4D45A 4HNGA 3AI3A 5KJEA 3IP3A 4O59O 3C7AA 3DTYA 3I4FA 1LBEA 3I9JA 3JD2A 1PGJA 3CINA 4NDNE 4HKTA 1SB9A 1F17A 3R3JA 2O2YA 3KYDA 2YFQA 3L6EA 2ZB7A 4KZPA 4LVUA 4J0EA 1M6WA 1EUDA 5F1OA 4ND2A 2X0IA 3GAZA 1JU9A 1U9JA 1UDBA 2O3JA 1E7QA 1HDRA 4NHEA 2GF2A 4FFPA 3AI2A 1UJMA 4PVCA 3PJGA 3F3SA 2YY7A 1IUKA 1T24A 3ZWOA 5CPFA 4U6SA 1NASA 3PGXA 1YJQA 1W4ZA 1KVUA 3ETDA 1IZ0A 3RIHA 3WG9A 1ZSVA 3IS3A 4XIYA 5BSFA 4AJIA 4YEDA 3ZNQA 3BIOA 5CHEA 3KLMX 4TRJA 5FI3A 3Q11A 1ISMA 4ZQBA 2FPPA 4HFNA 2C82A 1WPQA 3A9WA 2D3TA 1B15A 3OH8A 3P5SA 3UCXA 1L7EA 1J6UA 1LC0A 3DZHA 4JJGA 3AFNA 1H9BA 3FRJA 4J49A 4Y67A 2D2IA 3UH1A 3VKVA 5F1KA 2A92A 2HUNA 5JO9A 2E37A 4Z9FA 1BSVA 1FDVA 3ROPA 3TN7A 4F46A 1LDGA 2JFHA 2O48X 3SVTA 2DBQA 4CMIB 1E3LA 1TI7A 3D3WB 2GNAA 3ZHXA 1E3EA 5TS3A 3D1LA 2HMUA 4FIZA 1QYXA 1P1RA 1T1SA 3RUDA 3MCVA 2B4TO 3LC7O 3FNEA 5EQDA 4B8WA 4N5LA 1BXGA 1RYEA 2W2KA 1WMAA 1P74A 3I9OA 1ENOA 4MP3A 3UOGA 4Q3NA 1E3JA 2VYVA 4AL4A 1XG5A 3F4LA 3VPGA 3RC2A 1F8FA 3FWNA 3E82A 4LSWA 4M8SA 2FWMX 1Z7BA 3D3WA 3OECA 2JHFA 3OIGA 3ANNA 2O3RA 4J7UA 4CL3A 1SOWA 3FCOA 3GEDA 4RORA 3U0BA 3AM3A 4E2XA 2JCXA 2I67A 3C85A 4XYMA 5C7LO 2FSVA 3DAGA 1P31A 4L74A 3HDJA 4CMJA 4HFRA 4IJKA 1N9GB 4J2HA 2PZLA 2BRUA 1DC5A 4KTTE 3AW9A 4YWJA 3NUGA 1ADFA 5CAEA 1MXHA 4NBWA 3WYCA 4J9VA 2CD9A 1G0NA 3PEFA 4L4RA 4S1VA 3RJ5A 1ZVMA 5ER6A 3FR7A 2DBRA 2CVOA 2YJZA 4PLWA 1R16A 3V1YA 3ONEA 3U4CA 4BKPA 1HEUA 2E49A 4AJJA 1GV1A 2CDAA 5H81A 3UVEA 2PTGA 3M1AA 4TVBA 2AEFA 2PZKA 2O2SA 4PZDA 3RBXA 5IXYA 2BFOA 2NTNA 3K5PA 4D44A 4NMHA 1E3SA 3JD1A 1NQOA 4NJMB 5JY1A 1FDSA 4JJFA 2YZ7A 4EI2A 3NYWA 3HDHA 3KSZO 1BHSA 2BGKA 1E7MA 4FOOA 2NU8A 2GD1O 2G82A 3ZV6A 4YR9A 1GPDG 4F3YA 4LCEA 3I9KA 2W90A 3DZBA 4AJ2A 4D79A 1F06A 1LRJA 2OGUA 2UYYA 3E48A 4FR5A 4WNIA 4WGGA 3OFSA 1I32A 2HJRA 1J5PA 1GYQA 3KEQA 1FXSA 5BT9A 3PP8A 4Q39A 2EGGA 3PQDA 4OIMA 4XYGA 2CSUA 1PR3A 4IJUA 4RVHA 1DHTA 1LDNA 3H2ZA 3Q2KA 3VVBA 1EMDA 2VOJA 4PLTA 1N7GA 1A9YA 1VSUA 1E1NA 2ZCUA 3AY7A 2D5AA 4FJ1A 4XGNA 4MKZA 1KEWA 2HK7A 3F46A 4OJNA 3KLPX 5FFFA 5U1PA 2ZCVA 4FS3A 3OIDA 1JLLA 1T2EA 1YVEI 2P9GA 3GF4A 3ROKA 9LDBA 1Q0LA 1E1MA 4K28A 4NNJA 4TRRA 5CDUA 2ZKLA 4QFCA 1GU7A 1KVRA 4BNYA 4E2YA 4YQYA 3UAGA 1VM6A 3BTUA 4KQXA 3ZI0A 4CM7A 5B1YA 1SPXA 2GN8A 2HAEA 1UP6A 4WOJA 2JFFA 5JNLA 5HWSA 5T6BA 1P0FA 1DPGA 1EVYA 2VWHA 4GQAA 4RLSA 1SZJG 3ZWPA 2PD6A 3LQFA 1H2BA 3UCFA 1EZ4A 4KOAA 3GNTA 2HRBA 5G2OA 1PR9A 1E3WB 1E7RA 3PDJA 3R3SA 1KC3A 2I3AA 1Q7BA 5L7TA 3GR6A 1W8DA 2BFMA 5JDCC 1IE3A 3B20A 5BNFA 2EKQA 1PJSA 1NQ5A 3MJEA 1JTVA 4YXFA 2PZJA 4Z0PA 4EUHA 3DC2A 1N2SA 1HLPA 1PS8A 3DMTC 4NJOA 4ZICA 1MA0A 1LSJA 4GKVA 5COBA 1MXFA 5A04A 3ZWYA 3QWAA 5KJ6A 4NG5A 4MVJP 1UR5A 2IZ0A 3GPDG 3JQCA 4CMHA 3QJ5A 3LT2A 3D4OA 1C3VA 4OKIA 3TQHA 4E31A 2C2YA 1D3AA 4FD3A 2BFAA 3WXBA 4R68A 2PGLA 1ISIA 3KSDO 1NVTA 4J1QA 1YB5A 4CMEC 1B14A 1GV0A 3U62A 3PYMA 2PNFA 4CUZA 4J4HA 1XLTA 2O50A 4MVJG 4WCFB 4DC0A 3I6QA 2O4UX 3VC7A 5JBIA 3RBZA 4XDYA 5JYEA 3WJ7A 1B8PA 1NTOA 4ALMA 5IXSA 2OZPA 1FK8A 3AU8A 4OKNA 3OA0A 4BGUA 4CQMA 4PLZA 5BSEA 1I30A 5JAMA 1UZNA 4N5MA 1WDMA 3GZ4A 5A02A 3WGTA 1I5RA 1T2AA 2A4KA 3L07A 3AUAA 4U5QA 1N5DA 3MWDB 3ONFA 1CIVA 4CLXA 2O3QA 2G5CA 3QWHA 2V6GA 2GRAA 1BMDA 4BMSA 2BH9A 1ZBQA 3EY4A 3G1UA 3NDJA 1C0PA 2I66A 4ITUA 4IBOA 5KWEA 4QECA 1IPFA 5T57A 2X86A 3VTFA 4PIVA 3EHEA 4II2A 4MJLA 1WZIA 3ZHZA 4MVJA 1ZKMA 1WW8A 4DYDA 3HNPA 1P1HA 4ZRNA 4HY3A 5EESA 3VOSA 3ON5A 2NU9A 3E8XA 3KZVA 3C7CB 3M6IA 3FNHA 3OM9A 2HKIA 3F1LA 3H9EO 1ID1A 3K30A 1RM0A 2UAGA 2C29D 4BGEA 1HRDA 4FFNA 5HA5A 3UN1A 3WGIA 4TZTA 4RVSA 2ZB4A 3IKTA 1AHIA 2PA3A 4XB2A 3TJRA 2NWQA 4GWKA 1PL8A 3ZWAA 5CEFA 1GR0A 1P9LA 2C0CA 3W8FA 1HETA 1R0LA 2Y66A 1I2CA 5L4NA 3ZCXA 4B7CA 4E5KA 4M87A 2RHCA 3QHAA 1EK5A 3OQ1A 4YT2A 3F47A 2NVUA 3KB6A 3T4XA 2O7SA 1IL0A 2OO5A 3GRKA 5TRTA 3ANLA 1NQAO 3BZUA 1HE5A 1UP7A 3LLVA 4CM4A 3CH6A 4CQMD 5I7VA 2QW8A 1ONPA 5DP1A 2ZJ1A 5L53A 1NVMB 4CLHA 2NV6A 3LZ6A 1P1JA 1EUZA 3NTRA 3DR3A 1LDYA 2PGJA 5AVOA 4YAGA 1B0AA 4P8RA 2GCGA 2J8ZA 4K6FA 1PWZA 4YYZA 4NFSA 5IDYA 3WNQA 3PGJA 3EYWA 4MVJD 4RZHA 1C1DB 4I5EA 3S2IA 4XRRA 4IXTA 2PGDA 1DJQA 1GQ2A 3COSA 3H9JA 1ULUA 4AJ1A 9LDTA 2PKQP 4XJSA 2JAPA 4HWKA 1CQIA 1U7HA 4CLOB 1I24A 2DVMA 3DZFA 4R3NA 4W4TA 3H9QA 1U28A 3H5RA 2GN6A 3GA0A 1PQPA 1C0KA 1WZEA 2HMSA 3D7LA 4QO7A 3VVCA 4AVYA 3JQAA 4NZ9A 3FN4A 3WGYA 3X2FA 4ALIA 3KTDA 1HLDA 2EW8A 3KYCA 2J5KA 4YJDA 1T26A 5JE8A 2NUAA 1R4NA 5JAQA 4QUKA 4EGFA 3T7CA 5C7IO 5MDHA 4E33A 4ESOA 3U4IA 4I8XA 2P68A 1NPYA 2Y68A 2Q1TA 3CE6A 3ITKA 5A05A 2J5RA 1DJNA 1XELA 1HE4A 3JQ6A 3OJOA 3ROQA 3H3FA 4WCFA 5COQA 2XAAA 1ZH8A 1TEHA 1U3VA 2W2KB 2ZYGA 2Y1DA 3EK2A 5LCXA 2BMAA 5IZCA 4DRYA 4YRDA 3ZV5A 1AXGA 2GN4A 2Z95A 4JP2A 3VDQA 1DC6A 2WD8A 2DBZA 3HDQA 1FMCA 1IHXA 1JW9B 3A06A 3JQAB 1ZEJA 2IXAA 3ZWMA 3RCBA 3NKLA 1ONNA 4WOKA 2YW9A 4OQZA 2C07A 4AJLA 3AJRA 3HUDA 4JBGA 3WLEA 5TNXA 4O5OA 1OFGA 4K1LA 1GQYA 3BHJA 4LW8A 1LEHA 4TMFA 4HBGA 5G0WA 4Q3AA 3TNLA 4QTZA 1Y5MA 2H9IA 4EJ0A 4RGBA 3AY6A 1Z74A 4BNFA 4RVFA 2QRJA 4J43A 5L3ZA 3K6JA 1UZLA 1ADCA 3IIEA 4C4OA 1NX6A 2SCUA 1KERA 4I5DA 3WDSA 5A1TA 4UUOA 2C2XA 1O95A 1VE9A 3MWEB 1EFLA 4NBRA 4PVDA 3JQAD 5TLSA 1Y7TA 3D5TA 4O1MA 2VT2A 1KETA 4JQCA 4BO9A 4UAGA 2YV1A 3PJFA 1LXCA 3TOZA 1PJ3A 3B1JA 4BNGA 4CMIA 1PTJA 3ZNPA 3BMOA 1EQ2A 4II3A 3H6KA 3PDUA 4R01A 4LSMA 5EL0A 4BO0A 5THKA 3GMDA 1DEHA 2DU8A 4RDHA 3ZNOA 2HU2A 5DULA 4YJGA 2NSDA 5G0VA 5JMPA 3OQBA 3DBLB 4KQWA 3WNVA 5JDIC 3LDHA 3VKUA 3STHA 3R6DA 5EMHA 3WWZA 5AXAA 2A35A 3K2EA 1XHLA 4KDFA 4OAQA 1JWBB 1NXQA 3O38A 1WMBA 3BMOB 3DL2A 3JTMA 4GH5A 4L0QA 4WCFC 1N92A 2VTEA 3HE3A 4NU5A 3S2FA 2VWPA 5EPOA 2YV3A 1LNQA 4OH1A 4FFOA 3ADPA 3U9LA 1QLHA 2WM3A 4L4XA 4LMRA 4A0SA 2Y99A 3CUKA 4FC6A 4YAIA 1X7DA 4YDRA 2P4QA 5TX7A 1PWXA 3LYLA 4YPOA 1LDMA 1JDJA 1E6EA 1QYWA 2V6MA 3R1IA 4OXKA 2W2LA 4KUEA 4RVDA 5IFLA 3ETGA 3NRCA 5CDGA 1M6HA 2WD7A 4OO3A 4R51A 1NPDA 3GHYA 2NVUB 2H5LA 3UFXA 4BNWA 4PLGA 4UVDA 2HMWA 4XB1A 3PHIA 3PJEA 2DUWA 2VNAA 4XD2A 2XOXA 3ZGYA 1E3WA 2I5PO 4I9NA 2JCVA 4Z9YA 1B26A 3IOYA 3RVDA 1DSSG 1RM3A 1DC3A 4WLNA 4AJPA 1SB8A 3IC5A 1D7OA 2EJWA 5HRUA 2QYSA 2VUSA 2GN9A 1FDWA 1QYVA 2A9FA 4ND4A 1A27A 3D64A 2EG9A 3W4KA 4JIGA 3DONA 4OGWA 2Q49A 3V2HA 2G0TA 5ENDA 1SEPA 2O3SA 1I3LA 4PLVA 5BSHA 4B79A 5MGBA 3D3EA 4DUPA 4WEQA 1HSOA 4WCDA 1S7CA 4W99A 4TQGA 4PRKA 5DOZA 2PH5A 4TVOA 4BGVA 1Z73A 4GVXA 1K0UA 4KP7A 4JK3A 1GYRA 5F1PA 1XIVA 5LC1A 5J23A 2VT3A 4J7XA 5JDIA 2FRDA 1SEVA 3ZWVA 1PGNA 4R1NA 1R0SA 4B8ZA 1YOVB 3GVHA 4J4BA 5ITWA 4OYRA 1HF3A 2XF8A 2Q1WA 4RQTA 2EERA 5IN4A 3QWBA 1T2CA 1HXHA 4H15A 5HTOA 1GADO 3T4EA 3LF2A 4BV9A 1N1GA 4WUVA 1W0CA 1LLDA 5KCZA 1E0DA 4MIYA 1PJCA 1F8GA 5A3VA 4IMRA 2PWZA 2CVQA 2Q2WA 3ROMA 5A06A 2O3TA 4F6CA 3M2PA 5CEEA 2ZB8A 1PJQA 4NU6A 4IQ8A 5KOIA 3KXDA 3WBFA 2BLLA 4P4GA 4BO7A 2I6TA 1KVSA 3OHSX 4R16A 3FHLA 1TB4A 1M67A 4DLBA 4WLVA 1NWCA 3WLFA 5IDWA 3WGHA 1NBOA 1DIRA 4PG4A 3JV7A 4QXMA 2FSSA 3Q0EA 2CZCA 3ZWBA 2HSDA 5T5QA 3ULKA 3ZHYA 4NJMA 4BO3A 1U4OA 3GEMA 1RM4A 1M2WA 5L51A 2AMFA 4EW6A 1A5ZA 1WVGA 5JC8A 5JY6A 2WYWA 4M55A 1ML3A 5G0SA 1DFHA 3HJAA 3WIDA 4FFRA 4MIOA 3DZGA 1ZIDA 4JBIA 1JVSA 4BO2A 1NYTA 2GSDA 3GVCA 3L6OO 3QP9A 4GAEA 3DXFA 2JHGA 2GZ3A 1O6ZA 1YQDA 1AUPA 1E3IA 1PEDA 1D1SA 4CUJA 2BFPA 2CF6A 2OXIA 1TT7A 1VSVA 3VDRA 3ZV4A 4P4NA 3PPIA 3DOCA 1K89A 3ORFA 1HYHA 2PKQO 4KMSA 4BO8A 1A4UA 1P33A 1GAEO 3QV1A 4ND3A 4RLHA 5F5LA 1KVQA 4FBGA 4FCCA 4CMAA 4J16A 4CMKA 4YAJA 3BTSA 2P5YA 2D59A 5ILGA 1R66A 1LQUA 1NR1A 4LN1A 3OMLA 4YAEA 3GUYA 3FPCA 3SLGA 4W7HA 5HBRA 1X0VA 4C7JA 4H7PA 4BNTA 5L9AA 4PG6A 5C5IA 2OMEA 4WLEA 4Y98A 3PWSA 4XYEA 2BKAA 3TZKA 3ZDFA 3A28A 4NK5A 3RJ9A 4RJTA 4IZHA 4NBVA 1EBFA 1XWFA 3JYOA 4R69A 3E5MA 2F1KA 3BAZA 4K6CA 3IJRA 1XU7A 4D43A 3HFSA 1H94A 2VRBA 2NLOA 3BHIA 4OSOA 1DIHA 2JKVA 1ARZA 3F4BA 4X54A 1JKIA 1NFQA 3GQVA 4RPGA 2DAPA 5KJFA 3UGKA 2Y0CA 1YJ8A 2UV8A 5GMOA 1XKQA 3HWRA 4BNHA 1NFFA 1N1EA 3FD8A 4D42A 4CLRB 3DDNA 4GX0A 1MFZA 1U3UA 3OJFA 1GYPA 3TDKA 3W8EA 1UXJA 4YB8A 1NAHA 3JD3A 3CKYA 4A27A 4AICA 2R00A 1H6BA 4OSPA 2EW2A 3PHGA 4BO4A 1GD1O 3TZ6A 3OEWA 5A9RA 3RU7A 1IOLA 3AWDA 2YDXA 3E18A 4E5MA 4FGWA 4AJ4A 1U3WA 3JQBC 3FR8A 4HP8A 1NQTA 1JAYA 2HCTA 3RUCA 4B3HA 1XYGA 2FMUA 1NPTO 3PI7A 2IZZA 4GVLA 1GEGA 4JNKA 4BUCA 1YE3A 2XPCA 2A94A 4OXNA 5CG1A 3TRIA 4CODB 3D4PA 1L7DA 3FBTA 3RU9A 4CM9A 2OL4A 4AFNA 5A3JA 1E6UA 1YQGA 3I1JA 3JQ7B 3ZU3A 4U7WA 3ABIA 3GY0A 3DEYX 3MZ0A 2Y1OA 4CM6A 1KOLA 2NU7A 3RKRA 3SC4A 3F5QA 5JCXA 5EERA 3WS7A 1F12A 4MVJM 3Q6IA 4R5MA 5L4LA 3OEYA 1JKJA 3AOEA 2DUUA 3QVSA 1IULA 1PGPA 3JQ9A 2OORA 3KHUA 3L4BA 1Y9EA 2EIHA 2VHYA 3QA9A 3RI3A 2ZTMA 4IDGA 3WR5A 1GL3A 1C1XA 3ST7A 2C5EA 1QP8A 1V0JA 2EXXA 1ISGA 3PZRA 2B4RO 4FDAA 4PRLA 4MVJE 5TQVA 4R1TA 4BKUA 2AQIA 2E6UX 1V6AA 1YWGO 1HYGA 3O8QB 1YO6A 1NP3A 1QG6A 3VTZA 4G2NA 1DC4A 2ZJ0A 5TIIA 5DBIA 4Z9XA 2PFGA 3GG2A 3I9LA 4XA8A 1G1AA 2Y0DA 5F5NA 2NTJA 3G1TA 5A9SA 3I9MA 1X7HA 1YOVA 3LF1A 1FJHA 3RFVA 1I01A 3BTVA 3EW7A 2VZ9A 3R0IA 1EVJA 3BMCB 4ND1A 5JCJA 5C3MA 5JMWA 1PQUA 3QVWA 2IZ1A 3GC6A 1E5LA 4G65A 1ZXBA 1PS9A 1U8FO 4A2CA 2ZATA 4YJFB 3TOXA 5G0TA 2Y67A 1G0OA 1BVUA 3DBLA 1T2FA 1ZMTA 4KDEA 2Q1SA 3I3OA 4LVCA 1YDEA 4BKOA 3KOUA 2FOIA 4HADA 4YJHA 1QLJA 1EQUA 5A9SB 3HSKA 1SCUA 2X5KO 1EE9A 1HDGO 2VYNA 4L4SA 1MP0A 1V3UA 2Y1GA 2W8ZA 1I0ZA 4HX5A 4ZQHA 5HM8A 2PKRA 3K31A 5I7FA 1TT5A 4HFJA 3WFJA 3GGPA 3L6DA 5KKAA 1B3RA 4Y6PA 2NQ8A 1QXSA 3EAGA 1NHGA 4IGEA 2J3KA 2VCYA 4YRBA 3KVOA 1QYDA 1WLYA 4E5NA 3NGLA 3H8VA 1HKUA 3S2EA 3BYZA 1HYEA 1DRUA 1YQXA 1PL6A
chains in the Genus database with same CATH superfamily
1Q1NA 4PYMA 2Z6UA 2OHXA 2JIZD 2YCLA 1J5XA 3OFJA 2I55A 3R9IA 4AROA 5JNTA 4JB2A 1F6WA 5BNIA 2BHRA 4YAKA 4ZCMA 1XTPA 5AKJA 4FDLA 1A9RA 3BK1A 1RWQA 2CJYA 2ZRIA 4REQA 2G77B 4JLJA 5CFPA 2FI1A 1PZEA 1YK1A 4PX5A 2H7YA 1ECPA 2DHEA 3A9SA 1L4UA 5YASA 4TKVA 4BPBA 1RRPA 2ABWA 3JQ9C 1POWA 3RVJA 5LZ2A 4B33A 2R9VA 2ENUA 3KT8A 1WNTA 3QKRA 2XE6A 1ZSYA 1L4YA 1UT5A 4TQAA 1D4AA 3ISJA 2XNDD 4RMNA 2QN7A 3BF8A 3VPFA 1JI3A 1GQRA 1U3FA 2SHKA 3O1HB 1KJ9A 3AVOA 4RMHA 3WLMA 5FWXB 5JQWA 4KNWA 4O2BA 2XD9A 3PFNA 4D9HA 4HUQB 4CEJB 2H5IA 4P7JA 1JSRA 3PF9A 1GCGA 1QE5A 4O2AB 1NJ6A 4AN4A 3FDFA 4Q7KA 1J1ZA 1CR2A 1QZUA 3OJ0A 4JB0A 1UFKA 4X3PA 5TJ9A 4KLCA 3ZWXA 1BNCA 1TZMA 3K0BA 2PTHA 2RAPA 2IVZA 3AFMA 5BR8B 2C4HA 2IDZA 3PHHA 1JR2A 1K9VF 1Y7HA 3GT4A 3HXTA 4IFIA 4HGQA 4JC4A 2ZSUA 3BL8A 4XJTA 4C2BA 4YMHA 3I6ZA 3KQVA 5DBFA 4ZOQI 3IKVA 4NYIQ 1AMUA 4IG4A 4EK9A 1UKCA 2RBKA 3L0BA 2BEUB 4QFMA 1HT0A 3BHMA 1F7VA 3HGTA 3CLHA 4INPA 4NABA 3E9CA 1LI5A 1L5RA 1R6DA 4B3XA 4EZIA 2QAJA 3BULA 4RGYA 3OY7A 4WFQA 4XYLA 1YBMA 1XN4A 3LWBA 3MWLA 1IPHA 3EUFA 2GGSA 1K4KA 2FR8A 1G7RA 3PUYA 4DKXA 3HFJA 4RHUA 1XDDA 1S5PA 5DLEA 2TMGA 4ID3A 3PWKA 5EMMA 5H3HA 2DPYA 2GZ2A 2FEKA 2BMFA 2R2GA 4FWBA 4IOMA 3L4KA 1ZGHA 1ZN7A 2R79A 4WKOA 3TPCA 1FF9A 2PL5A 1CLEA 2JIQA 4LISA 2AF3C 5G3YA 1A69A 3OFVA 4X1YA 5DXFA 3AHEA 3HLTA 5JSFA 2VQSA 2WUFA 2R2AA 3LKBA 2P1RA 1UXKA 3BSYA 4NWIA 4YFVA 4LCJA 3D9QX 3HXQA 3D6VA 1NATA 4MV8A 1ZGJA 1DRVA 1C3OB 3PF8A 3QTBA 3O91A 4N3NA 5F2EA 4AN1A 4D82A 2IEDA 5MFPA 2F9FA 1IUPA 4MMYB 2GA8A 3NDRA 1IZ9A 1EDOA 2LUOA 4CCYB 3IKLA 4KWIA 3I9V6 3JZMA 1P3Y1 1IB0A 1Z7EA 2Z3WA 1GPLA 1Z06A 1MQ8B 3HACA 3ZW8A 1RRMA 1HZZA 2ZAMA 2HFJA 2ZUDA 4HDMB 4NZYA 4Z86A 3ZTYA 5KHOC 2JEZA 3F5SA 2EP7A 5KTOA 3M6LA 1SXJD 4GXTA 4NSNA 5F76A 2ZI7A 4ZKEA 4BX0A 4BE7B 2C77A 3BA1A 3R3WA 5IC5A 2HU7A 2PNJA 3C3AA 5JPCA 2UU9B 1WDKA 3PNYA 2H57A 2DFVA 3PQEA 3ABZA 2MJLA 3P2MA 4X8MA 3TD9A 4MUBA 1OOEA 3S28A 1AKWA 3R41A 4WEOA 5F21A 3BD9A 4H4EA 4TV9A 2X22A 2M6RA 2G1KA 4G36A 4K6HA 1QHYA 1XF9A 2VT7A 2I62A 3BIXA 4BVHA 4EJMA 3UPTA 5HQ3A 2QX6A 4QXAA 4BNNA 3PUKA 3X1DA 3IAS1 3ND6A 1HDYA 2KW5A 4Y8VA 4DT1B 1RXEA 4Z2AA 4L27A 1UKYA 1PDVA 1Y8ZA 4FGJA 4P53A 4B2LA 4J0KA 5KWSA 2PFSA 3L4SO 1NJGA 1HE3A 2E9SA 1YZTA 4XWYA 2YYSA 5CLLA 5TF4A 1H23A 4LHXA 4M98A 2OBFA 2ZUWA 4AO7A 2XNDA 1T2DA 4FILA 4RD0A 1WB5A 4MQ6A 3WGVA 2RAFA 2MSKA 3AJ9A 2A5JA 1D4OA 3QUAA 1R64A 2UUPA 5A5FA 4EEZA 1QIGA 3F6EX 4GSYA 1SWVA 4JYCA 2VTDA 4FE7A 4GXRA 3VOTA 1CZOA 1E18A 3IALA 3MTAA 3CO5A 3A4VA 4FBLA 4LVOA 1WHTA 4R5HA 4XJXA 3NT2A 4IUDS 4KGDA 3TUIC 4GOJA 2AQ8A 1ZOOA 1G66A 1OX4B 4FSDA 3VH2A 4ND8B 1BDHA 5EKSA 2OV1A 3FZEA 5HP4A 3FOZA 1QGUA 5ISMA 1VL0A 2RHRA 1B0UA 1EWYA 1N25A 3G8YA 4ZRMA 3RC7A 1DAEA 1GZ6A 4F2GA 1KQPA 5HKKA 1GM5A 4WHMA 1CU1A 2NPIA 2R25B 4LJAA 4Q19A 3STXA 2J3JA 3G0OA 1N32B 4HN2A 4X84A 1XHFA 2IIQA 1SRQA 1REQA 2C1XA 1WCYA 3SBOA 4WK0B 3T41A 3NBKA 4F5EA 1JFRA 2C42A 4WERA 2H52A 2VIIA 1BRTA 4HXGA 3QPAA 4AJOA 4ZV9A 4GWGA 5KNCA 3VPSA 5LZ5A 1PO7A 3JZIA 1U2DA 2FYTA 1BYUA 3PXCX 4H18A 4XCXA 3EXAA 3UUWA 4AS1A 2IOFA 2PANA 5IMBA 2D74A 4BFZA 5KVCA 3REOA 4J1TA 3PQ4A 4OOEA 521PA 2GEFA 3T1HB 4A36A 4ZU1X 3ZY3A 4GO1A 3GMTA 1G8HA 3REQB 4MMZB 2GCEA 2AXPA 1CXZA 4G1FA 4A1OA 1KI3A 1VGRA 1WQ1R 2LRHA 3NBMA 5E6RA 4MDHA 2WJ6A 2CY0A 3GN2A 2SICE 3PDHA 2NU6A 2IV2X 3ELWA 4BUJA 4EFNA 2XBMA 3NH6A 5AJTA 1F8UA 3JWJA 3UUFA 2BM0A 2J3HA 1HGXA 1T4DA 1Z6TA 4NBKA 4PY2A 3BRWD 3MLBA 4OL9A 3DAPA 3OLQA 3LECA 4E4YA 2FA9A 3MPUA 4BMNA 1FMFA 1MPTA 1PDWA 3JARB 2H16A 4WA8A 3RYHA 2PLAA 3NG1A 2ZUCA 4B3IA 1LC3A 2B36A 2PY6A 4E1AA 3GLRA 4I50B 3LO8A 3Q7EA 1X6VA 1JEYA 2W2QA 1TEZA 4LJ6A 1WXIA 2AFIE 2ECPA 2QVCA 4IQFA 1IDN1 4MVJH 3A0RB 5A2GA 3IOCA 5HR5A 2KHZA 2OCBA 5EIXA 1QCDA 3R7BA 3FUWA 4FFBB 4NMLA 1A5TA 1HSZA 1MR3F 3R7LA 1Z07A 2Q6KA 5LPNA 1QZ3A 4ZYTA 3GLFE 4O4IA 4YQFA 1COWD 3GYGA 1W87A 1N6PA 1H05A 3H83A 5D5QA 5F3RA 5ICSA 1ELOA 1IEQA 6CHYA 4NOMA 2FW6A 5F33A 3WX0A 2BFNA 2GUWA 3K8QA 2POQX 4NECA 1MO5A 3ZI7A 1XA3A 3DDHA 3AF0A 2HLPA 2P2CA 3BKXA 4QYTA 3BE8A 4IS3A 3M49A 4S24A 4QU8A 2FUCA 4YH1A 1OH6A 4GBJA 2IVFA 1NR7A 3DB2A 3IUSA 3MQ4A 4PZYA 4XGIA 4ZAGA 1JDUA 1NUTA 4IJWA 4XSGA 1DBQA 3C97A 3HM2A 4MDEA 3NAQA 4TSRA 2XCIA 5H7XA 1VLZA 4GOMD 4KLAA 3UMYA 1WHSA 1T5TA 2BGRA 1K08A 1PK9A 3HKCB 3AUJB 2QDXA 1Q1BA 3PI6A 2IZ7A 1JN0A 3IGFA 1ZRNA 3GJ0A 3H17A 1ZS9A 4OGGA 3IP8A 4R3WA 1FYDA 5BOSB 5EE5B 1CR6A 3KBOA 4R8MA 1CUJA 4AO6A 3AFGA 3I1YA 5CBPA 3BC1A 3U4QB 1UZMA 1HH4A 4D74A 1RZ3A 2QN6A 3I1IA 5LOVA 3LL7A 2PE5A 2JL1A 1D6SA 2BFEB 4O6VA 3BJEA 1TCAA 4NFHA 4EMTA 4A7PA 2PVCA 2AJCA 1T1JA 2O23A 3A36A 3ER6A 1DBVO 3HA2A 4U2EA 3AF5A 5FI5A 5EJ7A 3HKCA 4JJ4A 4V0MA 1RHQA 2MSDB 2PRIA 4GC5A 1M5UA 4CPDA 4HJRA 1BJKA 2J07A 1KEPA 1KYTA 5E7IA 3ZHTA 4F1JA 5BR4A 1KWGA 1NNLA 4J75A 1QV7A 4X20B 3UC9A 3WL3A 1C1HA 5FRDA 1CF9A 4AF7A 3UH0A 5IJZA 1H93A 1LJLA 4AUKA 3PNPA 2YHUA 4FS8A 1Q0HA 3GD7A 3UG6A 3H2KA 4JI2B 2P62A 5AKHA 4EBFA 4DSOA 1CETA 1FFXA 1MH1A 1RPNA 5EUCA 2IW3A 2RIRA 1PSWA 4J0GA 2OYSA 4U7PB 3V46A 5K51A 1T3GA 3OQVA 2HN9A 1E4OA 1WKBA 5FAKA 2A0UA 5KTYA 3O84A 2GLTA 4CTKA 3FTNA 5AHXA 1SUDA 4GPD1 5DOVA 4WZBB 1IVYA 4W5TA 1FS4A 4ETWA 4CG1A 4XFJA 3NBFA 3B9PA 4C7VA 2XBUA 1U7TA 1TQ6A 4IVPA 2E4ZA 2OC9A 1IH8A 1AKNA 2HBZA 3CNBA 3HS3A 3MBKA 4UEQA 5HCUA 2DT8A 3GPIA 4MS1B 5TEWA 2Q27A 2HWYA 2RARA 1ZWKA 3IDOA 5GV7A 4DAOA 4Z49A 3O7WA 3JYNA 1Z12A 5I4BA 4OM7A 2WIAA 4RA9B 3SS8A 2PS0A 3HRIA 3ECCA 3L77A 1FFXB 2ZJOA 4ZJUA 3DFUA 3DVAB 2G6TA 1XEFA 2H1VA 1S2LA 1NNSA 2PX2A 2V98A 4EF5A 1ZQ1A 2AL7A 3O73A 1COWA 2PYZA 1UKZA 4D7AA 3AEKB 4GSLA 1LV8A 5FA5A 4M7WA 4LWOA 2XADA 4XE5A 5U9CA 2C83A 2AOVA 1MJ5A 3RADC 2X13A 1H2HA 1NVKA 2IPMA 3F8WA 3EZ6A 4CEIA 5LLDA 2UYOA 4AKEA 1C14A 1I14A 1VHQA 2ZVPX 3THXA 3AHHA 3EEBA 1DUSA 2DPHA 4CLEA 5GZ3A 3E1KA 1PWHA 3OF2A 1D7AA 4YI3A 3G2NA 2FG7C 3LQ1A 4YP5A 1FS6A 4E2WA 5A03A 4KQCA 4D9CA 1G8JA 2K2QB 2VJMA 1ZJZA 4PWZA 3W9UA 1Z37A 4MV0A 3A1NA 5J3JA 1J8DA 3SXPA 3ABOB 5EP1A 3UWKA 1Y6QA 4BKQA 3VJKA 1DOZA 1E9BA 1FPQA 2X0RA 2E1PA 3KWFA 1K68A 1GNPA 2G80A 4MWGA 2QRNA 2Y93A 4OVKA 5K7SA 4OLHA 1VSQA 2DULA 5EKXA 2BGGA 4LK3A 4YREA 2FX2A 1UJ4A 4G1VA 1FFEA 1VPEA 3BMNA 4H6PA 4P2GA 1U28C 1WAMA 4BKRA 4J9UE 3T3DA 2QGZA 3F67A 4LY6A 2H54A 5JYBA 3IAEA 1WZCA 4Y6QA 1VI6A 1AGRA 1E0AA 3AB3A 4TRMA 1WBJB 4O63O 3H87A 1B3BA 3JS5A 3KOMA 3V3KA 2B7CA 3C14C 1UPUA 4ZCSA 5FBVB 1OZ0A 2OZLA 3ZWCA 2QUAA 2WTBA 1GPMA 1NJFA 2VYQA 3H65A 3ZHUA 3F9RA 3GGGA 3ECAA 5IBRA 1H2AS 4F71A 2A9KA 2GWRA 7GPBA 2GN0A 2EP5A 3O31A 2V65A 2FUG1 3CSDA 2WSLA 4FE4A 4QFBA 5CVEA 4TTPA 3VR2A 2R47A 2FN3A 4JU9A 1MVLA 4RPKA 2HQOA 4B3RB 5AVQA 3B51X 3GU3A 1SC6A 1Z83A 4N5DA 3I28A 1K8ZB 1Q21A 3T5GA 3AVPA 3NGXA 5CT6A 1ZK1A 4BFWA 4GMKA 4YHBA 5DFAA 4Q4LA 3ZWQA 3VV2A 4PZUA 1XKLA 4YFYA 5D2CA 1MKYA 4IPTA 5LSAA 2OUIA 3R23A 3MNFA 3VH4A 4A3SA 1R15A 4CG2A 4OL0A 2VP4A 3GI1A 3MEQA 4RCYA 4ECEA 4IIFA 1H0SA 3N28A 2OVFA 4PPYA 4OLJA 3PGKA 1X7XB 1X87A 2D5CA 4MKHA 1RWMA 2P4UA 1FY2A 3IDZA 3KV3O 3NJ8A 4MRNA 2XUZA 4PZZA 3RVQA 4LZLA 3U7QB 3UT0A 4GI1A 1OTXA 3ZW7A 1LTHR 3L1JA 1AC5A 4AJ9A 2KJQA 1E7WA 3STUA 4CT5A 1SOVA 2EZTA 4BP8A 3S27A 1QH1A 1IWBB 1QO0D 3D4IA 3GVPA 3IQXA 4ZO7A 5C37A 2UXDB 2P6OA 5C5EA 5EFZA 5IS2A 4US2R 3L0CA 3D4BA 4BP9A 1U0RA 1HK7A 2PH1A 2YQ5A 4JQZA 4WY5A 2QR2A 1YDMA 4E07A 1JVBA 2ZZKA 5BUCA 4DNQA 4JI1B 5JCJD 1DOAA 1R9GA 3EEFA 2WF5A 1EGAA 4WCVA 2P7IA 4B80A 1SCBA 1RACA 3ITDA 1ZK0A 4NESA 1B0ZA 2W71A 3NAGA 1O0SA 2IHBA 4QM7A 1V9SA 2WDZA 4MV1A 3CZ4A 5AW8A 2AA3A 5KYUA 2FFAA 2P65A 4K9SA 2DTDA 2XCUA 2FDCA 1N5LA 2RH5A 2I6UA 3GFSA 3LOPA 3C3DA 2DP4E 4P3NA 4Y3UA 3Q0TA 3WLKX 4V0OA 5JV5A 5LWQA 4RIHA 2YQ4A 3ZY4A 4ZGWA 1BFDA 2VUUA 1MIOB 2DQSA 5LUBA 1MG5A 2DWPA 4DIBA 1Y1KE 3DOEA 1XPOA 2ZSJA 4DBVO 2F8SA 3NEYA 5DN6A 2Q3CA 2FCAA 3VSDA 1YR1A 1GTMA 3G79A 3OKPA 3DWEX 4ZJPA 2DTXA 3R0VA 3O3NB 4N0EA 3JWPA 2DZDA 2WQ6A 2X3FA 3G59A 2IWHA 3C8MA 1DZIA 1H2XA 4OXIA 4P4SA 1Z39A 3PLRA 1CF4A 3FLBA 1NDHA 2G5GX 4PLYA 4EYEA 2H1SA 3WDLA 4M49A 1E79D 5CM9C 3VX3A 2QRZA 2FW7A 4BO1A 1UBNA 4TZ0A 2IXFA 4KHPB 2X40A 3KJZA 4IX1A 3S2UA 1K7YA 4D80A 3Q8KA 1NFRA 3RFFA 4JJKA 2C5FA 3DOFA 1CUVA 2A9RA 2ZQYA 5GADl 1QWOA 2QLFA 4ARCA 1E32A 3SYNA 5BN3A 2LKDA 3KUDA 2JEOA 3LVFO 2WFMA 1QGUB 1YHYA 3MFYA 2C2OA 1LFDB 1PU2A 4L50A 5IW8A 3GJ4A 5BVHB 1P7PA 2LTAA 3HZZA 5JTTA 4PNZA 4EY8A 1EUYA 1M2VB 4OB6A 2G1UA 5AVUA 1ULTA 2NNLD 3LZDA 1K8XB 5IN5A 2PD4A 2ZPUA 3PUZA 2YYZA 5DTIA 3S68A 4HLCA 3WWEA 1VLHA 4B2YA 4L8LA 1OU0A 5ECYA 1WMFA 2DC1A 3BMQA 4H4DA 3GFBA 1TJ3A 1CFJA 3USZA 1C9YA 2XBLA 1NKTA 4N3CA 2AN9A 2QD1A 1R12A 1M74A 3SQNA 1CEEA 3HWSA 3CUEF 5J1SB 2GJSA 2JC3A 3F6PA 4DCTA 1YQUA 4Q03A 2JLRA 1P77A 2QZ9A 1YKSA 4GEGA 1EE1A 4U39A 2GAFA 4JKYA 2CHFA 5E6RB 2XTJA 1M8JA 2C3OA 3DYVA 3GZJA 4BVBA 1GUAA 5IM4F 4FJ0A 4FT4A 4I8IA 1NZJA 2ERCA 3VPAA 4NCNA 2ZR8A 4X5OA 2R00C 3TKAA 1VHJA 3U19A 2FEXA 4WDRA 1UCFA 4DLLA 4GLLA 3FIUA 1PT9A 1KU0A 1YJBA 1TF5A 1PX0A 1UM9A 1A71A 2O2XA 3HHPA 3OP1A 3GO4A 4CHGA 3DV0A 1RVV1 3HCAA 4G63A 3KD3A 2ZWMA 1FP1D 5ESXA 1YAJA 2KB0A 2QS9A 3A37A 1PL7A 2REXB 4P4TA 2V7TA 4C76A 4EG6A 1C7RA 4GI7A 1L5LA 2XUJA 3N2YA 4MINA 1KC1A 2WOJA 1W7AA 3AY3A 4JBHA 1UOOA 3VPXA 5HX7A 1LLQA 4HQ6A 2JKYA 4FHGA 1LB1B 2CVFA 1P2BA 5B58C 4BV8A 1YL7A 1CYEA 3OCCA 4G0YA 5EWMB 1L7VC 4CXMA 5IABA 3GDGA 1TQ4A 2XZPA 2WT9A 1N5MA 3ZU4A 2RMKA 4LXTA 4P82A 2QMEA 3WK5A 4TQ9A 2WTEA 5AKLA 3ZQUA 4GUAA 2GX6A 5B57C 1TGYA 3ILXA 3KQYA 3BG5A 4PINA 3G9ZA 2GKSA 1T1EA 5JFGA 3GLIA 3CXUA 4M1TA 3B1KA 1BMFA 5FKJA 1QR6A 2VDUE 3CZ9A 3LMKA 3K8ZA 1UXGA 5CH8A 3T3NA 3T7RA 1CHNA 1RADA 1SHLA 2PRJA 3ZJVA 5IAKA 1K7CA 2CCJA 3PKIA 4W5QA 2H1LA 1EG2A 2YN4A 3TG2A 5AJVB 3CRZA 5L6LB 7REQB 1P7ZA 3A27A 2XVYA 8AT1A 1UWVA 1MBZA 4ALJA 1E1RA 2O0LA 2R60A 2VH1A 3GCDA 4ER0A 5ESDA 3FY4A 3OZGA 3HSSA 4OFZA 4ETIA 4DB4A 2BF7A 4RANA 5M7EA 1ZHOA 2C9ZA 2OV3A 5TF0A 2J33A 2ZM5A 1A50B 3KEOA 3I83A 4R9SA 4RXMA 5SY9A 5I3ZA 2V3VA 1DIBA 3O3MB 1CQZA 3ND8A 4UU0A 1E2DA 1BOFA 1BDJA 1B6SA 2D1SA 1WXWA 2RJNA 3RT7A 1IAQA 2WYVA 3G2MA 4Z4FA 2CHQA 4M8LA 4UBOA 3LT0A 3RSQA 4HEA1 4AQ7A 2QN1A 1FCJA 1QG4A 4CDMA 4JR0A 3EVTA 4NCHA 2HWXA 1TYCA 3OQIA 4L6IA 3WJAA 3OP4A 1CRWG 4IFEA 1VJ1A 3G13A 3OD1A 2YVAA 1U5BB 1U7PA 4BNUA 1ZEMA 1F38A 2GERA 4G5FA 3JYPA 1GUFA 1X0XA 1QAQA 5KDOA 4DR5B 1N4AA 1KMHB 1AQ6A 1VE7A 2ZZMA 4ENSA 1DQNA 1XQ6A 4LF7B 4C4SA 5TPZA 3NP9A 3KL4A 4YMSA 1II8B 2MSLA 3EQ9A 3PC6A 2IUUA 2J0UB 1DE0A 2HV8A 3O90A 1U8TA 2I8CA 2FZWA 2YVLA 1JDNA 1H4VB 1ZXXA 1NOKA 1E1LA 4IJVA 1W5EA 3B78A 3GNSA 5FBZA 1JHZA 4OHVA 4MOWA 3THYA 3ZW9A 4RDXA 3W5BA 3U3XA 1UQUA 5D8DA 1CZUA 3S2YA 4BO5A 2QGFA 5SYMA 2PMFA 4C4XA 4N3BA 4D6YA 3DMNA 3MQFA 3Q9UA 4GOOD 4HB4A 1U0TA 5ALEA 2YVQA 1GY8A 2FFRA 3UNXA 3W5IA 3QE4A 2HF2A 2WZBA 3LO5A 1UKEA 4OY3A 3QOXA 2J3QA 5KNDD 1KFCB 4LYYA 5F4ZA 3CZAA 2Z9BA 1ZQ9A 2H3EA 3G2IA 2E4AA 3AG6A 1PT6A 4FEEA 3B5EA 1W2GA 4M1YA 4C3VA 3URMA 5JZ9A 4DMMA 4AQYB 2P5UA 3CPSA 1GG9A 1SAYA 2XSZD 4GBGA 4GYKA 1MX5A 3MTQA 3BXXA 5B30A 3H5AA 1T9DA 1SA0A 1T4CB 2JCYA 3A7EA 3SMQA 1GZ4A 4FD2A 1V16A 4G26A 3UJ6A 1SXPA 5DPMA 4CCWA 5KKNB 4GKKB 3G8AA 4RO0A 4DNXA 3G85A 4C2UA 4Y1RB 1DBRA 2VHCA 2FSGA 3N1UA 2FZLA 2W22A 1NF2A 1OJLA 3WRYA 4RY8A 5MFZA 2PPVA 2CL5A 3Q3JB 1DV1A 4UVGA 1XNHA 4KWCA 4MQFB 4XGKA 2I9PA 2XRMA 3OC0A 5FR1A 3B9QA 1RRKA 1TZBA 1B2LA 4PC3A 5C1IA 4I1YA 2QDKA 4ER6A 1YR7A 1F4LA 4BDSA 1HT2E 1WZNA 5KWJA 2AMJA 1MAUA 3VR3D 3RVRA 1ESEA 3LGSA 3TSYA 2ZYWX 5IK2A 2H51A 3C4QA 3MF4A 4UM8B 3K20A 3B2NA 4MIKA 1URPA 3IEXA 3C87A 1CERA 1J2EA 3H84A 4XSHA 1V1RB 4MXDA 5E2AA 4RS4A 3ZPXA 2XCRB 2IPNA 4LFCB 1GNTA 3CTPA 4QGSA 1BS1A 3KOWA 4L8VA 3K9FC 2UYHA 5AVJA 1Z2EA 3SEZA 2ZTUA 3AINA 2I34A 3N7UA 3WYEA 5HF5A 1ZJYA 4REOA 1N6NA 1O7JA 4G67A 4TS4A 3PXXA 3JRXA 5DIZA 2WF7A 3I01A 1QKJA 3N07A 2HGSA 3MM4A 1Q83A 5AW5A 2C9OA 1UXOA 5DMXA 4EYOA 5IDQA 4URXR 3UK1A 4OYHA 1M2EA 4HNAB 3ZCQA 2P9BA 1RAHA 1U1EA 2WIBA 4I2VA 2IX3A 1XLWA 1I5EA 2NACA 1FMJA 2O0HA 3V8MA 1KF0A 4K5QA 3UV3A 1LS1A 3LPLA 4H08A 4QOHA 4WRRA 3NJRA 3GP8A 5JXWA 1EU1A 4NYMR 1LVUA 1RQLA 4ZZIA 4EMBA 4G1UC 5K0TA 2GAIA 1I2DA 1MRSA 3HB5X 4AS2A 3UEOA 3UQYS 2WZDA 2QM0A 4QPZA 3TXXA 3FG9A 2V8OA 2WABA 4D9BA 4YIHA 4TMYA 3ZE7A 2ID4A 3PSAA 4NV1A 4YLYA 3OWOA 4U7FA 2I2XB 3ADCA 3O2SB 1OY1A 1NJ8A 3OZXA 2AOXA 4KDRA 1TLFA 4FQ8A 4LIPD 2XUFA 4UUNA 4ZVPA 4NI5A 1QH1B 3VJMA 4X71A 1QKIA 3W8DA 1X42A 1Z5ZA 1N2CE 2R5WA 4Z3OA 3T4PA 4NCXA 1KI1A 2GA9A 2ZTLA 2DR0A 3HY3A 4RXUA 1PNRA 1E0KA 3UJ3X 1V8ZA 5CD9A 3ZIAD 1YA8A 2HO5A 2OBMA 3KYJB 1UMKA 1M66A 2FUKA 4N5NA 3LFUA 4MJXA 2PZ8A 4EFMA 1T0IA 2GPTA 3R7WA 3X1JA 1QMGA 4QELA 3QUCA 2VLBA 3T94A 1FZQA 3NVDA 4GVPA 4NYMQ 3HB0A 2FXIA 1U9ZA 1X19A 4W1QA 5FYDA 3UZUA 2XEXA 1RP1A 2IEIA 3IMGA 4JCOA 4FGSA 2IIPA 4ND7A 3PNBA 5FB3A 2H2HA 3UGTA 4BLWA 3HVKA 1WMDA 2Q3JA 2RBEA 4RZIA 1QZXA 2OA0A 3TUJC 5CB4B 1Z0KA 2WFLB 5JH7F 3ICEA 1F0PA 2XT6A 3L7NA 4IEFB 4DRXA 1F5SA 3QBVA 1YB1A 4RTKA 4RTOA 2J7PD 3IAHA 2BHLA 3VHXA 3FGZA 4MS3B 5JALA 2QPLA 4ZC8A 1GGJA 3PVSA 7ABPA 2YHBA 1NGSA 3Q3VA 2VZ8A 1SBIA 1BWPA 3A1VA 5GONA 1ZISA 4L9RA 2V6IA 3FOAA 2HJGA 5IVIA 2Q4BA 1XALA 2WM9B 3LBNA 1YJ5A 4MLPA 3N8GA 3FI9A 1QPBA 2HF9A 4UNQA 5HJEA 5LQCA 2EAUA 2ZAIA 2RHGB 2YXPX 2RGEA 3B82A 2MTBA 3GGJA 3UJDA 2K5UA 1ZX1A 2BEKA 4UEJA 1XQ9A 4JKIA 3P7MA 4GZLA 4M22A 1LU9A 5BURA 1AVTA 1JFFB 1KMNA 3USES 4AJNA 5GZ1A 2QTNA 5IT0A 4CI9A 2C00A 3T0IA 2NVWA 2RCYA 2GKGA 2H63A 2VXCA 5EE1A 4DL9A 5EIHA 3B52X 4ZN6A 3OQMA 2ZBGA 3BK2A 2RHOA 3I6BA 4ZEXA 5AW0A 1E3MA 1VIVA 2IA5A 4KMMA 4NZOA 4NBTA 5AK5A 5KYXB 2ZB3A 2XUHA 3ANSA 4J90A 3RAJA 3U1TA 1M83A 3R74A 4D1YA 4F1KA 4MVJF 2ANCA 1WHTB 2GBLC 4MP8A 3JQEA 5AM5A 4B34A 1UBCA 4P5DA 1YR2A 3GFFA 3M8KA 3OOHA 4F86A 1FLAA 4M9QA 5LQJA 4GR5A 3GZNB 3EUEA 2GWHA 1BRMA 1O8CA 3NIBA 3RE1A 3B3AA 3K9LA 1B0PA 4N40A 5TE9A 3GOHA 4K9RA 1A77A 1JHPA 1M6YA 1WMSA 3CR7A 3KQWA 2KLHA 1A96A 2GNPA 4NH4A 4JUDX 3TSWA 1JFSA 1QP4A 4M83A 5F7OA 2O6LA 3PE4A 4WVLA 2M32A 1HV8A 1MO3A 5HJ2A 4UBKA 3OM0A 2OHVA 2PMKA 2M6LA 4BXOB 1ZD9A 4INAA 2VXBA 2SNIE 2XMCA 4XXHA 1MNAA 2AFHA 1HE2A 4HD8A 5THXA 3T9DA 4W9MC 5LL6P 2LZ0A 4XW2A 3SYTA 2PWPA 1XSEA 3BOSA 3G82C 4ILKA 5DP2A 2WWTA 5LP6B 2ODQA 5IM5A 1P17A 3OLVA 2X8JA 4YT5A 1QB8A 5L40A 3OURA 1TRHA 1M34E 2Z2YA 2GB4A 3IV7A 3M81A 4QFDA 4FYMA 4Y2UA 5HM6A 4DADA 2C95A 2GZDA 2LNDA 5CUQA 1VXRA 2DOKA 3MD0A 4OQDA 3QNMA 4DQXA 2GXQA 5ELXA 5EUBA 1VIAA 1GTJ1 1UBLS 2HDHA 2VXYA 4K2AA 3FE2A 3KB2A 4FHFA 4CR7A 3U7FB 4C7OA 2V6BA 5K6TA 3PEEA 5DEOA 2BZ1A 1E9VA 1V5FA 1DZ3A 4QWWA 4JZYA 3P9IA 5KMGA 1U0SY 1IXZA 1T34A 4R83A 2PCJA 3BXHA 2J5QA 2COEA 3GLHA 3IDAA 4XYBA 3SJ7A 1DTWB 3V1MA 1J4AA 5JRJA 1CR1A 1UAGA 2C2KA 1UWCA 2DFTA 4OXYA 4ZP1A 1BQ3A 1C2TA 3U49A 1BYIA 4L5JA 1Q95A 2FSPA 1R0BA 2JASA 3OI7A 1PR6A 4G01B 4IM7A 3UXHA 2I6XA 1QF7A 3RJMA 4HAYA 5JD5A 1NF3A 3GLFB 5B1YA 1Y48E 1R00A 1A9XA 1VJTA 4L0MA 4CEHA 2J4FA 1BOOA 1KORA 3EXIB 5GONF 1HL7A 3U3ZA 1DWOA 1WW3A 3HMKA 5CX1A 3VFDA 3T12A 1BWSA 2DM6A 4JWTA 1O5IA 2Y1LA 4W8GA 4CNBA 5BUSA 5JARA 1ICEA 5IAEA 1XMPA 1IM8A 4RPHA 4D0LB 3KU1A 5BN5A 721PA 3DL0A 4IVRA 4GS5A 2X9VA 1BEUB 1C5KA 1P1FA 2R6JA 4RV5A 3WB1A 5K6AA 1DI0A 1IY9A 1SHTX 3CA8A 4YJ3A 5BSGA 2HA6A 1YZUA 1AV6A 2IBMA 1EQAA 2OGZA 3H19A 3HXKA 3L8YA 3M1IA 4EJ2A 3ONVA 4W8HA 3LQYA 5U4QA 3WK4A 4AX4A 5LQUA 4CDGA 1E66A 2AT1A 3SEFA 2QX7A 4MUFA 3R8FA 4EKNB 1OXUA 3IILA 1JHMA 4HNSA 3ZE8A 2WAAA 2Z1DA 3QF7A 3QU9A 4FB5A 5BPHA 1DQPA 2CZGA 1WY7A 2IQ5A 2JGAA 1FSSA 1M6NA 2V8BA 2VPTA 2ZI3A 3A1EA 1XAGA 3FUXA 4M8KA 5CBPB 4H0CA 2G76A 5AUQA 4C1BA 4R05A 1L3BA 5LN1A 3RAPR 2CFSA 3N8DA 5CNMA 2BELA 4YDQA 4RS3A 4YJ3B 3V2GA 3QJGA 3VDNB 3EDRA 1W0JA 4ZODA 1X1EA 3WQSB 1G1MA 1Z4KA 2PV7A 3BJZA 2QTFA 5BSVA 4EY3A 2QSJA 3MIIA 4IQ4A 4XLTA 2QMQA 4YRJA 5TR9A 1F4PA 5UKDA 3VI3B 5BP7A 2ZWIA 1P0IA 4NV0A 1XWWA 2J5XA 2OGTA 1M2NA 2Y1KA 4XPIA 1FDUA 1PJTA 3P1JA 1N34B 4M0UA 1UJ6A 3E6AA 4I9GA 4CNQA 1B73A 1Z0SA 5E2IA 1N2OA 4BNLA 1VPWA 2F90A 3E3AA 4LOAA 2H07A 1PHRA 1YXMA 1PS0A 3EXHA 1QK3A 3G2OA 2QF7A 3EVNA 4E51A 2PH7A 4RF4A 1QORA 4PNHA 4J1NA 4O2LA 1OHHA 5HUHA 3RROA 1J0BA 4EX7A 2PAFA 5BWNA 2MHCA 1MB4A 2GTHA 4Q6BA 2X0KA 1ANKA 3KKQA 4J1SA 4HJXA 3AK4A 1SVNA 5IT4A 4FUQA 4KE8A 4NONA 3LA8A 2OT3B 1R27A 2Q2VA 4OQLA 1QHHB 1QQ5A 1Y8QB 3V8PA 1K8QA 3G0DA 4E22A 3TLGB 2WR8A 1T5HX 1U90A 4L22A 2ODWA 5CW1A 1ZD2P 2BKLA 4MUEA 5E38A 2WYUA 4XI9A 2RGUA 3VO1A 1A1SA 1X9IA 3LUPA 3BWBA 5G02A 3W4JA 1TK3A 1BMTA 2CN1A 4DNPA 4CIBA 4B3TB 1TPYA 3T9BA 2AQHA 4UCWA 4BWYA 3E1SA 3WSTA 4B85A 1WUKS 1I4EB 1KL7A 4KR0A 1FQWA 2R84A 4C08A 5J4VA 2CV1A 1X14A 1XMIA 3ZWNA 1MAWA 3DQZA 1J49A 1GFSA 3N2NA 4BHTA 4D46A 5ITSA 5JNVA 4C14A 2WU0A 4JJIA 1EVZA 4TM7A 2ZAGA 1XDWA 3U5TA 1WL8A 1E63A 1P3JA 3AB8A 1JB9A 1YBAA 3EOAI 4G0MA 4TGLA 1N9GA 4NCIA 4XQEA 3OT4A 4A2WA 1P0MA 1K6JA 5F1YA 1KS9A 5G4KA 2C3UA 3GRFA 3VYWA 1WCIA 1YIAA 1T9BA 2XWSA 4B73A 4X8LA 2VQ6A 3NCTA 3EGOA 4V3BA 1YRBA 1PJLA 2AHRA 4HDAA 1IHYA 2IHUA 4MROA 2UDPA 3H7IA 3CWQA 3SSMA 3SDZA 4RK5A 3T7DA 1FXUA 1UXHA 2ZR0A 1KI8A 4LHWA 2ZBUA 4DIDA 4JI0B 5KYXA 1IYZA 2C8LA 2ORVA 3UUEA 3W2TA 1SKMA 1DFIA 3CLUD 2C2BA 3M1LA 4UOZA 4MRAA 5C4IA 1K5GA 1Z75A 3AWIA 4FHZA 2XUQA 3I52A 4V0RA 2A0WA 2BZ0A 5T67A 4D45A 4ZVTA 4I4LA 1V8OA 4HNGA 3GLSA 3IPLA 4E3WA 1JMVA 2Z08A 2FJPA 2OZLB 4ZYUA 2I80A 2XTAA 1SQGA 4YLGA 5A6SA 1N3YA 2TMYA 3DEHA 3I4FA 1JG1A 5ENZA 5T4FA 4WUTA 2W6PA 3I9JA 3JD2A 3MBOA 2I54A 1OGYA 1ORWA 1SB9A 4D81A 4GW3A 4ZMBA 2DMRA 2OYRA 1U04A 1ZN9A 3L6EA 1ZGZA 2QEQA 2ZB7A 1ZPDA 4LVUA 1GSOA 4J0EA 2FSVC 2OYCA 2ZPTX 3NW9A 3P0IA 4DY4A 5CD1A 2MINA 3S1AA 1LPNA 4DR4B 2IYQA 5HDBB 1QR2A 4L5IA 3TAXA 121PA 2X0IA 1G5RA 1E1CA 1JU9A 1U9JA 4KPFC 1UDBA 2C04A 3DUFA 1E7QA 1HDRA 4NHEA 5IAGA 2XT0A 4DR2B 3M6MD 4FFPA 3I5AA 3O8RA 1E61A 4KK4A 2IE8A 2YY7A 2P79A 1I6MA 2W43A 3W6PA 2X2PA 2R0QC 2HJHA 3HV0A 3F98A 1EX6A 2BTQA 1QDLB 2VDQB 3OHMA 3PGXA 4UHCA 1W4ZA 4MPRA 3IERA 1IZ0A 2YZMA 3WG9A 4PYNA 1ZSVA 1EEXB 1RJEA 2BIFA 2HC9A 3ZNQA 5KC8A 2O1WA 5CHEA 2KS6A 5J1TB 3IUEA 4ZQBA 2IUEA 3IA7A 1U99A 5C8XA 3GIWA 3OPYA 2C03A 2IHNA 1Q92A 2YINC 5HZKA 4LJYA 1OYYA 1EIZA 4EM6A 3K0AA 1J6UA 3BUSA 4UHJA 3DZHA 1YV9A 3HUFA 3IIIA 1RHKA 1TM4E 2HZBA 3JVDA 3VKVA 2J0EA 2D2IA 3UH1A 1SM4A 4R71A 3FSGD 4DWWA 2WP0A 2H4FA 4YHHB 1OAOC 2VBCA 4ZT6A 3TN7A 1H3FA 5EJ6A 1LDGA 3C43A 3SZUA 4UZFA 2O48X 3E1GA 2XGSA 4CMIB 3KVVA 2DQYA 5AR1A 4DUGA 4XIIA 1QH0A 1NI4A 3AUXA 2HMUA 3M5WA 3S7ZA 3PEYA 3HA7A 4DGQA 1EVEA 2BZGA 1J90A 4CKBA 1T1SA 1RIIA 1XF1A 2DX7A 3JR3A 3LC7O 5EHIA 3ZY5A 6YASA 4HAWA 1CUFA 5ESWA 4EG8A 3I9OA 3D0KA 1T13A 1FE8A 3FCYA 3IURA 2R44A 1FRNA 2Z8YA 4HDMA 3UOGA 1E3JA 1HURA 2PXCA 5BYAA 3J81A 3F4LA 3L7CA 4FKBA 3FWNA 2PX5A 2O59A 4N7BA 1GGEA 3E82A 3G9TA 1DPFA 3TCKA 3FKSD 1ZUIA 4KW7A 2TS1A 2PG3A 3OZVA 3OIGA 4II7A 1NI4B 2QLBA 2RHTA 1SGWA 1E2FA 4HB3A 3ND9A 3HJBA 1EFPB 3M6AA 1OXTA 3EW9A 1DQYA 4XYMA 3C5CA 4RKRA 1U7UA 3CKLA 4QGHA 1QHSA 4NVRA 3IAS6 5K99A 2EKBA 4RZ3A 1V71A 5A0VA 3F7OA 2Q8QA 1N9GB 1SCQA 4JLSA 2ZQ5A 4KTTE 2P2ZA 3AW9A 3QZUA 4HC4A 2IDMA 3EMVA 4OHKA 4ODIA 5K3CA 3SBDA 2V7UA 4TMVA 3WLLA 3EQ2A 4F06A 2FQ1A 4QDZA 1V95A 4WOCA 1PKEA 1U2DC 4BMDA 1J7JA 1JQDA 3D6JA 4D97A 3NIDB 1G0NA 3PEFA 1CB7A 3O74A 1D0VA 2ZI4A 1PQ4A 4S1VA 3M5DA 5ER6A 3RK0A 3U7IA 4ZAVA 2WVAA 4BCBA 1APBA 4RH1A 2ISCA 3W34A 1WBDA 1D6NA 2O8CB 1HEUA 3CCCA 1CVRA 2PAAA 3NXKA 3QBTA 1ADJA 2CDAA 4HEJA 3VZCA 2H7VA 1YR8A 2ADFA 2PTGA 3ET5A 1NLFA 3RBXA 5IXYA 3MAAC 4LGMA 2QOEA 4D8YA 4D44A 2E7ZA 3C48A 1E3SA 2QJOA 1G4AE 3JD1A 2IFTA 2QU8A 2ECOA 4M60A 4NJMB 4O4LF 4QUBA 4RMJA 5JPDA 2YIJA 3CGGA 2YWJA