1LYQA

Crystal structure of pcoc, a methionine rich copper resistance protein from escherichia coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
101
Chain Sequence
AHPELKSSVPQADSAVAAPEKIQLNFSENLTVKFSGAKLTMTGMKSHSPMPVAAKVAPGADPKSMVIIPREPLPAGTYRVDWRAVSSDTHPITGNYTFTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and dimerization equilibria of PcoC, a methionine-rich copper resistance protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords PcoC copper resistance protein
total genus 18
structure length 101
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1lyqA00
1M42A 2UZYA 3BZ5A 2YA1A 3FAWA 4CC4C 5ICUA 1H6TA 1OT4A 4CILA 2OMXA 1IX2A 1LYQA 2OMTA 3BCFA 3BC9A 1O6VA 2WQVA 2WQWA 2OMWA 1H6UA 4AQ1A 4CC4A 2C9QA 2OMYA 3BCDA 2UZXA 1XEUA 2RA1A 2WQXA 3FAXA 4AW4A 1O6TA 2Y5QA 2C9RA 2OMZA 1O6SA 1NM4A 2WQUA 2OMVA 2OMUA 2C9PA 1M9SA
chains in the Genus database with same CATH superfamily
3SCMB 2AK1L 3GI8L 2IXQB 1QSFB 1BAFL 1XH0A 1MIEH 4P9ML 2NNAB 3IBOA 4OH2A 3D3VD 1XFPA 2OMYB 3MREB 4HXBL 5JQHC 1CXEA 5HJ3A 5KVEE 2VR8A 4JHVA 1CE6A 1P6FA 2A73B 2J4WH 4WEEA 4XHJC 4E41D 2B4CL 3PV7A 3GSWB 3C60B 3OXRB 1J1PL 5H37A 1D7FA 3V4VL 2ATAA 2QQNH 5CBAB 1KTKE 3OJDB 1UM4L 5E8EA 5LAXA 3G5YB 1H5BB 4OGZA 1BF5A 3P2TA 3A6BL 3FHAA 4JW3A 3NIGE 5DJ0A 1KTJA 1Y1DA 3F8UB 2MNJB 3WJMA 1F3RB 4WUKL 2QSCL 3W81A 3CGTA 1WCBA 2EIDA 2QGCA 1FVCA 5C0RL 1XH3B 1S9XB 1G9NH 1BZDA 1JDDA 2AK4D 4PJFA 3TOPA 1U33A 3BN9D 5F21B 2PCXA 2OMBA 3QG6A 4PMEA 3ZE1B 4EIZC 4Z7WF 3UX9B 1AD9A 1S7WB 1O7DE 2YAOA 5GGTL 2W9DL 3LIZH 3VG9B 1YG9A 2O72A 1JN6B 2VLRA 4R96A 1N5AA 1HS6A 2OMUA 4P49A 1QMUA 4LRNL 3QJHB 6CGTA 1S7XB 2XXCB 3OJMB 2ZWZA 3GZPA 4IGBB 3BDYH 2DLTA 4G8GB 5EBGA 2ICES 3HIZA 5DO2C 3M8OL 4YDLB 4WFHD 2OKMA 4C83A 1W72B 4LSQL 5DC4B 2AZAA 4UQ3A 4HKZA 4JB9H 1S3KH 3HZKA 1CBVL 3TO4B 5E94B 2R0KL 4J7RA 3AMKA 4NLAA 4G5AA 4N8PA 1I7RA 1W9XA 1B9ZA 1AACA 3HEIB 4K7PX 2HFFA 4WCYL 2NY0B 5H94A 1KXTB 5D2NC 2Y0SA 4H7VA 3T3MF 1BD2B 2YLHA 4KBPA 4L1SA 5FXCH 4OSUH 1ES0A 1YPZF 5IJBC 5A2CA 3NJMA 4N2NA 5DVLA 3Q5YA 4JPKL 2VDPH 3EG9A 4KKBD 4DGVL 3BPNC 4HWNA 1WTLA 4Z95H 3D9AL 1QLEL 3T3PF 1JNJA 2JKIS 3BC9A 2E7DA 2DBLH 2K4AA 3MNVA 5GGTH 4H4NA 2VXQA 5FYJD 1CBJA 5F89B 1T03L 2B0SL 2AITA 5C8JA 1SXCA 4OCWH 4ONHB 3GBLA 3RJQB 3KH3A 1R17A 4GP4B 5DFVC 3BRDA 1E9OA 3DJ9A 5AVUB 4PBWD 2OA9A 2R56H 4GUPA 4H8QA 4ENEC 3WIAA 1F2XK 2CA3A 5D1XC 4TRPL 3FB8A 4BZ2H 3QH3B 1NQBA 3L5JA 2CDEB 3IF1A 3G6DL 1U92A 4FC3E 3KLHC 1INEH 5EOTA 2I32A 2CIIB 3QISA 4UIMA 1UGNA 2Y5EA 12E8L 1TG8A 2XRAH 1LO5A 4LLAA 2X88A 1UM5L 3OLDA 4J28A 2GHZA 2A6KB 1CFSA 2AQSA 4FTVB 1BD2D 1G5AA 3N55A 5CSBA 1X5LA 1UM4H 3D18B 1T4KB 2XKSA 3IFNH 1V3JA 1VFBB 5GGVH 2P5EB 5IR1A 1PZSA 4H26B 4PUBL 5T1DH 3ZIYA 1MCOH 3Q6FB 4YHMH 3OX8B 3ZT7A 4BUQA 1F4HA 2YJQA 4Y2OB 4UTBL 2FT8A 2TSAA 1NOAA 1UFGA 3OVUB 4RWHA 4FABH 5ADOL 5ITBH 1A9BA 1RZPA 2ZCZA 1ZTXL 2G3NA 3AC0A 4Z7UF 2DQHL 1AD0B 5FGSA 3S36H 1RUPH 4YDJB 3N44F 1XWVA 1UXLA 4AKQA 5T3ZE 3WV0A 1HINL 4OM1L 3FT2A 1ZE3H 1HHHB 2K4WA 4XVSH 3D50A 3VRLE 1ZT4B 2A74C 2R1XA 3KPSA 1OXYA 2UXTA 5T5FA 1FJ1B 5ITFA 1RZQA 4BWTA 2XTJB 1MI5E 3PLYA 5ERWB 3HLAB 3DUUB 2OP4L 1IJNA 1TVBA 5HHVH 4N1CA 1HC1A 3W37A 1CQYA 1KPRB 2QTEA 3O4LA 4N20A 3LY6A 5E2VL 5EA0L 3FSZA 1M2VB 3GTTA 4QO1A 1UT1A 1B4JH 1FF5A 4FERA 4L8CA 1YO4A 1AVAA 1K8IA 3KBHE 4PRPA 2A4ZA 5GGVL 4ZFGH 1I8IA 3CFEA 2CO6A 5EMYA 2WBJD 4J4PA 1RFDH 3MJ8B 4QRPB 4JAMB 4R90L 2ZSVB 4LEXL 4BDVA 1EFQA 4RRPM 1JZ6A 4FABL 4HIXH 3WXWH 2DQFB 4FX5A 3BMVA 2VDNH 2QQQA 4L5FH 1WFIA 1YEJH 5GJSH 1N12A 4RFEB 2XA8H 5F0MB 3NCJH 5DMKA 2Y3NA 2WXIA 1H8LA 4WW2A 3DX0A 2MCPL 3KLKA 3I50L 1RH8A 3BEWA 3X3FL 1IL1A 4NDMB 4WU5B 3FFCA 1ZSHA 4LKCB 5CP3A 1J8HE 3GINA 3PWNB 3HN3A 3AVEA 3NIDB 5B7MA 1KJMB 1HWWA 2EIEA 3QQ4A 4X80H 3Q2WA 3NPZB 5GPRA 4HOZA 5FYJE 5I1LA 5CEXB 3S7GA 1P84K 1J0JA 1RU9L 4AGQA 4Y5XC 4BV1A 1BWWA 5DK3A 1IM9D 1QFWL 3JV6A 4AG4H 4ZMVA 2DL9A 1UB5B 3R06A 2ZWKA 3FT0A 1YJDC 1UYWL 4KHTL 5DMGD 1SBBA 4LCIH 5C9JB 4RX4D 3FYEB 4I5BA 4XX1G 5ANMA 4LAQL 1QUPA 3HA0A 1CK0H 5EZOL 3ZKQD 3FONA 3QIWB 5KVFH 4POUB 1OAKL 1T7XA 1MWAH 3F5WA 4IK6A 3IWUA 2YJLA 4ILDA 4PY7A 2QPEB 3QFJA 4L4TE 4LDOB 2Z8VC 4KK8D 3NCBB 1JPTH 4LSRL 5MENE 1LEIA 1HYSC 1ECYA 4PU2A 5D6DC 1H3XA 2IADA 3UDWA 1N7ML 2Z35B 5CAYB 3V5DA 5CGBA 4QHKJ 4RQQB 4KFMA 4NGHH 4U1KB 5IQNA 4A7GA 4ES9A 4NQVB 4UTBA 3WKNA 4YHYB 3ZJAA 1J8RA 2Y06L 4I3GA 4S1QL 3D0AA 3C6SA 2V9TA 1OAUH 1JGDB 3O9WB 3BIAX 3MRBA 1IGML 4LQ1A 3WLWC 5EU4B 4G6MH 4NSKB 1T5WB 3KLAB 1A7PH 2CALA 1LMKA 5F97E 2FT6A 4X4KA 2BOCB 5SWSD 1IGFH 1TIUA 1O7VA 3R8QA 3TBTB 3UC0H 3KDMA 5EU5A 2ZUUA 3ARRA 4K94L 3UEQA 4DZ8B 3QZNA 3ZDZF 3GMNA 3LDBB 4OFIA 3SY0B 1W91A 1N8OE 1PPIA 4MNGA 3G5XA 1C5CL 2RTTA 3JYBA 3NCYS 1ZD6A 4P3DA 4J3OG 3WDHA 3CBJB 3T8VA 5DUPL 4UT7L 2IWKA 1DEDA 1XGPB 1AS7A 4KX9A 4PB9L 5A6IA 1LE9A 4Q9QH 1KN4L 1WBZA 3MGOB 1LGVA 3LHPL 2NNXA 4NRYB 4NQCD 2DI7A 1U3HD 2YD0A 1AQMA 4N0CC 4HIPA 1FZMB 4V33A 2YMTA 3UBXI 2MEJB 1P53A 2P8LB 5IHBA 4LL4A 2R23B 1BZ8A 1N19A 3NCWA 4UT9H 1WBYA 1AG6A 4ZQKA 4MJ2A 1KN2H 2HWZH 4QHLB 2VR7A 4NJAH 3TGXA 2EKJA 4LGSB 3BWZA 4MKMA 1UZ6F 3CZFA 1NCIA 4NBXB 3ARDA 1KEML 3HB3D 1A25A 4XBMA 3V8OA 1IEHA 1TZOA 3RL2B 2ITDB 1M05B 3C9NA 2V7HB 3K71B 5AKRA 4N4YB 1C5DB 2F19H 3IDXL 4HKXB 4UAOB 1PFCA 2BWDA 35C8L 3BSZA 32C2B 5CN3A 4DN4H 1KDIA 4NO3A 1QSED 3CLFL 4OM0L 3UGEA 3VJ6B 4PGJA 1IAMA 3GEWB 2YOCA 3QNXB 2X0UA 2EXWD 3DXAA 1X6NA 3ZT6A 1DR9A 3AWGA 3PHSA 1VACB 4LOFA 4OV6F 3HFML 1ZPUA 2NDGA 1RY7B 4ZTOH 5E24E 3MV9B 5C9KA 4UOJA 3QIBC 1U8JA 2H5UA 2CPCA 4ZFFB 1L3WA 3C6LC 3QI9A 1BBDL 3FB7A 4DCQA 1BAWA 4LP5A 4ZFOB 3EOBA 4APQA 2DYRB 4NJAL 3VSUA 3LPWA 4X5XB 3MRHA 5HGBB 2FGZA 3QULB 2WIIA 1UD4A 4H8VA 4IIQA 4KKLD 4XP9L 4XPGH 4AYGA 3LJ3A 4KXDA 1F41A 3A21A 3ZHKA 4X6DB 5DHVB 3F05A 1G9MC 5BCAA 4X6CF 1WFTA 1QOKA 3MV7A 5CFHA 4D8PA 1C16A 1NLDL 1QFUH 1RCYA 1T6WA 2E7MA 5JPNC 1RAMA 4YIQA 1TENA 3KLDA 2R7EA 3VFOA 3NCCB 3QYMA 3MLXL 4DFHA 2ZNWA 3LS4L 3LKOB 4OSUL 4MAUL 4X6CB 5JPMC 4X9IA 4MJ5B 5CMAB 3F7QA 4ONFH 3T2LA 1FNEA 4P2QA 1Q9KA 4CADA 4F7EB 4TKWA 4Z7WE 1SVBA 4PTUA 4IOIB 4YXHH 5FEBA 1WFOA 4EKXA 4DP4X 1EANA 4OD1H 3BPCA 5GGRB 2FYVA 3ARTA 3CU1A 2EEFA 4UCFA 5BZZA 1KJ3H 1AHWC 4XO8A 3PWJB 2F53D 2V2TB 4PSPA 4FYQA 1SUHA 2XZZA 1MFNA 2EDTA 3W0WB 2H9GA 3PWLB 5I9QB 2P46B 3G6AA 3U1QA 2JKNA 3H9SA 4NQDE 3RZCD 2FATH 1YMHB 1QBAA 2XKUA 1JCKA 3M1BA 3K4ZA 2V2WA 3W82A 3MRRA 4R0LA 4JRWA 2HJLB 2R1YA 2SODB 1NLDH 3DTXB 3NIDE 1RJCA 1MRCL 2W65B 3CC5A 4HLJA 3QDMA 5J6HA 2X5PA 3ERXA 2A6DB 1M7DA 4PS4L 3HE6C 2JNZA 2RCSL 4DGIH 3QJTB 3KWWA 5A2LH 3QEUB 1F3DH 2VQTA 3TN0D 2EYTA 3FPXA 2AJSH 3RL1A 1ZGLB 5K33A 2D7QA 5E4AA 3IGLA 4NJ9L 1GRWA 4JFOB 1A3QA 2OMTB 1OZTG 3LQAH 5DCCA 1CCZA 1CT8B 2WM0A 2LU4A 2V33A 3IMTA 3P4MB 3TNNA 3RE0A 1XXDC 3RPIB 1GZPA 4NKOA 4J2QA 4M7KH 3WE1A 3ZE2F 4JFWA 1CFTB 1BVOA 4Y4HA 3RG1C 3UYRH 2IQAB 1FLRL 2YN3A 4XXCA 4UAHA 5CWSB 1KLGA 3LTVA 4C4UA 2PP8A 2LLNA 4P2OD 3BZEA 2A83A 2DY2A 3FFOA 5HD8C 4LLUB 1TCRA 2DBLL 3KG5A 2CA4A 1MXDA 1DVFC 3KPLA 3LZQA 2BP8B 4POZD 5JW5A 2Z64C 1A0QH 2FUTA 2JELH 5GSRB 1HXYB 4U31A 4P2OA 1P5UC 1YYML 3VQ2C 1FC2D 1PMYA 3NA4A 2P8PB 4M7LL 3MXVL 3LX9A 1PYWA 1FAKT 1MUJB 1KFGA 5C0BE 3LNIA 4GI9A 2OMVB 1H9VA 3UTQB 1EFXD 3EUUA 4JDZB 2R1WA 3TNNB 3BUTA 4FKKA 1Q94B 3DK2A 5AKSA 3EFOB 5DMYA 1UA7A 4N87A 5HTSA 1MAJA 3BAYA 4KRMB 1GC1H 4JFUA 1WH0A 5I8OL 5T3ZD 1T1WA 3AG4B 2E7LA 5EIVA 1KNOA 3GQFA 4L18A 4Y2DA 1IBHA 1SEBB 3K1KC 1V3LA 3ZU8A 3TESA 3WTVA 1Q0EA 3KHOA 4PP2A 3JUZA 4LCCA 4EIGB 3AQXA 1FL6A 5J6HB 2A77H 2MCMA 3DTXA 2WKOF 4HULB 1OKEA 3M86A 4OZHF 3FFCD 2B14A 4P0DA 5CEYB 4NP4H 2YSSA 4X9BA 1J9SA 5E5RB 2PPEA 1YEDA 5KAQF 1CTOA 3F7VA 3BAEH 2V9UA 2X4RA 5CILH 5EBWB 5AW8B 2IQ9H 2Y72A 2NXZC 3P0YL 2CLZA 4R7DB 1NCOA 1KXQE 4KC3B 4YLCA 3IDYB 3LEYH 3FDWA 3VWJB 1HNFA 4PRDA 4FQQB 2FEDC 1HILB 5DF0A 4P9MH 4P57A 4KY2A 5GS1C 1PLAA 4S1RL 3JWOL 3LKQB 4V2CB 1NKRA 5ESAB 4F7EA 2C5DC 1FNGA 1FNEB 1SHWA 5EN2B 2ORBL 3ASWA 3C8DA 1X9QA 2CKBH 1OSZA 1LNUB 3IAQA 1YN7B 4B7LA 3F84A 2YWZA 4O58H 1IGIH 3M1OA 3DURB 5H35A 4JGNA 2AXFA 2ED9A 3HW7A 3FB6A 3NGBC 3UJJL 3UBGA 2W07A 3G9VA 2CLVA 3QCUH 4QRRE 3SPVB 5IG7A 1I9IL 1K5WA 3MJ7B 2J72A 3DIFB 4JRYE 4NQUA 1G7QB 1I1YA 3P1VA 4FDWA 5CLXA 5B22A 1DCLA 4N2MA 4DK6A 5JHLH 5B1JC 1FH5H 1OAJA 3TCLA 4WNSA 4FNUA 4ZMYA 3II1A 3ISWA 4DK3A 4F15B 3V6FA 3U0TA 2HRGA 1MEXL 2EVHA 2ZYIA 3I3EA 2R8SH 2NY3C 4EI5A 5C07E 4DGYL 1ILSA 3U6XA 4F5CE 5GS2D 2Z7UA 4M93C 4XO9A 3PRZA 5I73B 4UINH 5E6YA 1F1AA 3VFMB 4UTAL 2HMIC 5D7IE 4HJGA 5HJDA 5DZJA 3SDAB 3OR7A 4MAZA 2XZCL 3PV6B 5DSCA 1S7UB 1QUNA 2Y7SA 1JHTB 2VDNB 3O4OC 4ZOBA 2CR6A 5F9OL 4B9CA 3QG7H 3BHBA 4KDWA 4IOIA 2IAMA 3FSAA 2NYYC 1XH2A 1F2QA 1W16A 4Q97A 4OB5L 2F53B 3TEUA 3AY4C 5EF3A 4CADB 5I5JA 1QLRB 1CLYH 3QP3A 5DRZA 2UZYB 3EGSA 3PJSA 4RAUA 4FFVD 4HWZA 5EZJA 1FH5L 2H32H 4JL2A 1EX0A 2F7OA 3DX3A 5D1ZC 1MCWM 4BH7A 3OLEA 4I18C 4JN1H 5DHEA 3VFSA 4JHAH 2HWZL 4MMZA 4PJEB 2WHVA 5KTEL 4I0PA 4DKAA 2AJXH 3E6HA 4Q0XL 5EOQH 2V9QA 4GKSB 1WRFA 2Y2YA 1CDJA 4I9XA 2BP0B 1KV3A 1X5MA 5KBDA 4AYBA 1QBML 5AW9B 3M1CA 4NYLB 4KUZL 2NTFB 1SBSL 1HHKB 4OCLC 4KMQA 4BK5C 4PBXA 2P8LA 4GSQA 3QO0B 1ASOA 3L4CA 3DHPA 1GOGA 5CD5D 2OMXB 1S8DA 5D71H 4APQB 3EOBB 1MQKH 2WJ7A 3K46A 4O2FA 3ZQXA 1T1XB 2LR4A 2NZ9C 5T3ZH 4UNIA 4HHWA 3KLQA 4O2CB 3TCTA 3C8KB 1U8JB 4P3DB 2Z8SA 1C7SA 1QKZH 1SMDA 1Q8MA 1NAKH 3D33A 3MV9A 2B59A 3SE8H 1JIBA 2OSYA 5D1QC 1VENA 4A67A 3TU6A 5K1JA 3E0GA 5L9DL 1E5YA 1E7VA 3O41B 1M7IB 2YD7A 3MV9D 4O2EB 5GISL 4HPYL 3IFNL 4Z7VB 2UUDK 1BBJB 4QRFA 4HKXA 4OUOA 5DZPA 1DP0A 4QRQB 3T0BA 3DX6B 3UO1H 3VFVB 4WK2B 1GCFA 4PRHB 3HHRB 2E27L 4HCRH 4XO3A 4YN3A 2BFGA 5C09A 2VN4A 4NO0D 4EOWL 4DP1X 5LWYL 4YHLL 3WNOA 4OFYA 3DVGB 4TUOA 3MLVH 1LEIB 3VXOB 5EFIA 2FNBA 2AQRA 2ZKXA 4DGYH 2D0HA 4LT7A 5JQ6H 4FJYA 3PP4H 5IVXA 5CO1A 1IGTB 2UWEA 2H26A 3COOA 4QXTB 3BCFA 4DKEL 4Z3GA 1CF1A 4LZKA 2XU9A 3T6ZA 1V54B 3MRCA 3B7RL 3MGAA 5EC1B 3CSPA 2XN9A 4MGXA 5DXWA 4QXGL 1NEZA 1OE2A 1Z3GH 4KITB 2X7LA 3O81A 3LNDA 3SE9L 1GTFA 2XWJA 5J1AA 3G9AB 5GGSA 2J56A 1UH2A 4GAYA 1ZA6B 4RMTA 2OR9L 4QR7A 2DQEL 3WKPA 3H9SD 3LYRA 2E86A 2F08A 4DJMA 2VC2L 5CKGA 4Z7WB 4K3JH 3OKKA 3C5ZD 2CK0H 3QQ9C 4KRPC 4OLZL 5A16B 1T5KA 4UZUA 2HUHA 1TZGH 2W1NA 3FFCB 1G7MA 4PAZA 2Y06H 1IL1B 1U8KB 2WTPA 4N2EA 4S1QH 2H0EA 1LO2H 4L5FL 2C4XA 2N56A 3VGAC 4ZS6D 4LB8A 3RY5A 1F6LL 3MRBB 4Y9FA 4KVPA 3RP1A 1MLCB 2O5ZH 4GKZB 5DMKB 1WITA 3C5ZA 3C6SB 3NJFA 3DIVA 3MRNA 3RVWD 2PMZA 2J55A 3MRPA 4HUXA 4MDIB 5DJAB 3RUGF 3V4UL 4Y5YA 4U1KA 2J8HA 4NEHB 1NPJA 3RLSA 2NXZD 1KCUH 4JAMA 2P43B 5BQ7A 1AI1L 2EZ0D 2LQRA 1E4HA 1HHJA 4JNXA 1KIQA 2BVPB 3IJSB 7CGTA 4GG6B 2QKIB 2WKGA 1I7ZB 3HN8A 1K8IB 3D2UA 3AMLA 1J0ZA 4PJ5E 1CE1H 2APWA 4LBAA 5BV7L 4P4KA 4MJID 4NKDA 2H41A 4HIHB 4QYAA 3O4LB 4AMKH 5HHOB 2WGXA 5D7LB 4D9QD 3D2UD 1ET7A 4YHPB 3CX2A 2Y9RT 2V7NB 4YGAB 4RSVA 4B9ZA 4M9OA 5F6HJ 2X70B 4DESA 1RZJC 4UOZA 4Z7QF 3L3OB 2BOBB 3FUDA 2VW6A 1YEGH 3GIVB 4LKXA 2P80D 5DTFB 1J9RA 4R5TA 1O0VA 4NUQA 5GGUB 2BSRA 2ZXEB 3VXMB 3E8UH 4MZ3A 2AJYL 4JQIH 4AQ8C 1XTLA 2ZOKB 1WHOA 3DMMB 1EZVY 2PYEE 1EEZB 1I85A 5I8EB 1P7BA 1XH1A 3QQ4B 4DUWA 4AW4A 4PJXB 4CVZA 4Y5XA 1PCSA 4IOFD 5D8JH 4XB3A 5A7EA 3KYKH 4WKZB 5F0PB 1A6UH 5FIEA 5D2NA 5INDB 3VXUA 3ZT5A 5EO0B 1MAML 4GQZA 3MXVH 5DZOA 5BXFA 4UB0H 1X44A 3MODH 2KZWA 3EOAA 4Y2OA 3OX8A 3GJEB 4JG5A 3TEXA 2GUOB 5G5DA 1DN0A 1GCYA 1OSEA 4FULA 1DQLH 4F7MB 3IJYB 4GSUA 4ZDHB 2JJTC 4RFEA 3BH8B 3Q06A 1LEKB 4PBVC 3WIIL 5FCUL 5GS3A 3D18A 3H3PL 1IKOP 1HDMA 3PHAA 1INDL 3APMA 4MWFA 2QLVB 5CZVL 3ZL1A 5EHFA 3V6BR 5GS0D 5L4FA 4IU2A 1NEPA 2VLKD 2HT4D 2W0KA 4MD4A 1BWMA 4IRZH 2J8UA 3IDIB 4U3SB 2DM3A 2Y3AA 4FLSA 5FK9A 1F3JB 1CG9B 2ICWB 3R18A 1P6AB 3MLUL 1EXUA 4JY5L 5KVGH 3QUXA 1I1FA 2GI0A 3BMWA 4N25A 4P5MA 5BUPA 1TDQA 1TTRA 1KN4H 3IT8D 4PIRF 3MJ9L 4F37K 1PY4A 4QRTB 4TULL 1OAZL 4B9FA 2HA1A 1W0YT 2MTAA 3KPOB 3T6VA 4IS6A 3OC8A 4BD4A 1S7VB 1OEZW 3L3JA 4AW7A 1R5WA 3DJTA 2EVJA 1HAUA 1QABA 3WJJC 1HYSD 3MV11 4HIEA 2YZ8A 4HSCX 1AXTH 5IEHB 3HZMB 4ZODA 4RGNC 2ZG3A 6PAZA 3ZUCA 1DCEA 3RIFK 5AFAA 5C6PB 4PN6A 4YNYA 3ZDXB 2NYKA 1CDIA 3VW3H 3MCLH 3S35X 1VZIA 5B39A 1N4XH 4WUUE 4GLRH 3G6JE 3EH1A 2BIPA 2FH8A 2BNRE 4NERA 3T09A 4XP5H 3FRUB 3K72A 2G9HB 4D9LL 4JO4H 4N2IA 4PG9B 5B3SB 4R7XA 3MRKB 4KMTH 4H5SA 3Q8AA 2ZCKL 4MVBC 1BZQK 2ZX8A 4Y4KD 1KELL 3O0LA 2CM5A 4PD4K 4GKNA 4Q89A 3U4EA 2RH0A 4M1GL 2JQAA 4F33A 5LXVA 3L5WB 2DM7A 2JKTM 4KTEH 3O3DB 3CN2A 5EBMB 2FBOJ 4GRWB 4J6RL 4MNQD 1UJ3C 3S8WA 3SPHA 2QL1A 2DEWX 3NZUA 1YPZA 2VERN 4K7FA 5MEQB 1B4TA 1TQBC 2ADIB 3T0WA 2OCCB 3MJWA 5DEGA 1Y0LB 5T1LB 4LVHB 4OZGE 4NQEE 5DRNB 4DVRL 4TSBH 1AGBB 4L4VD 1FIGH 4WV1C 2HLAA 3BVDB 2ENYA 1QD0A 5J11B 1IO4C 1SLWA 2IWGA 2E9BA 2VO5A 4JQVA 4WKXA 2OPCA 1ZLVK 1UCBL 3BN3B 3M17B 1NCDH 2K8QA 4U1JA 1HZKA 3STLB 3BAWA 4A37A 5EBLB 5C07B 3JZYA 1NCAH 4NPYA 2YUWA 2AXGA 5ETUA 3OGCB 4G43B 1ITCA 3V4VH 5EEYA 3CPLB 3K6IA 1DJZA 2WB1A 3S34L 2DJSA 4S1RH 3ME0A 3VRJA 4B53A 4YVNA 4GRMB 1JNLL 4G9DB 2QJDA 2ZKYA 3EHBB 4LGPB 1ZIAA 2DQIL 4P3CL 4RNRB 5ICYA 5G4NA 4LE8A 3V0HA 1N5YH 3BUQA 1TQTA 1IGIL 4XOCA 1TETL 2WTRA 3HB3B 2C7UA 1EGJA 1I7RB 4HWEH 2G3XA 3MREA 4F80A 4WI6A 5F72S 4HMCA 3Q8EA 4J39A 1IM3D 3L9RB 2FHCA 1DVFD 3H0TB 2PTTB 3EUDA 3C5JB 4HPOL 1ZS2A 2WYZA 4GY4A 1MDAA 4CBZA 1NFDF 1KJ3L 3LIZL 1CXKA 4ODWB 3SDCC 2XWDA 4L0YA 4HJJL 1G9MH 3AG1B 3CZNA 1QBBA 1DQJA 4WI8A 5E7FA 5I0ZA 1OP5H 1JN6A 5L2KB 4DP6X 5FV1L 5TPWH 4ABWA 3TBBA 4G2AA 3HMWL 1F56A 3T65B 1MFAH 1N0LA 4NQXB 4OZFB 1HINH 2JTDA 4YBLC 4C56A 4I8DA 2VUYA 4GSDH 4MAYB 4XP6H 1JYWA 2TRYA 1BQ5A 1LYQA 5SWZA 1FVCB 1UD8A 2J57A 4UU9A 5IBTL 1MNNA 4YWGL 1EJFA 3V0FA 4FOMA 5LVEA 3N40P 5HYJD 2Y5QA 2VB5A 3RNKA 2ICEC 1UADC 4U1GC 3X11A 4E41A 1JNNH 4ENED 3BD5A 1SJHB 1KDJA 3HI5L 2FX8L 3KXFD 1UWFA 4MTMA 2Q8AH 2AGJH 4OKVA 3NBNA 4JO1L 1JK9A 1QATA 3C2AH 4XPTH 3UFIA 1ZANL 2ARWA 2ATPB 2QR0B 2Y7MA 4YDZA 3S2CA 1QG3A 2JB6B 3LS5H 1UEMA 2YAQA 2AW2A 1S7RA 1WF5A 1JTTA 2O5XL 1JMXA 1H6UA 4R7NB 4AY0A 5MHSD 3TV8A 3HZVB 4WTXA 1RK7A 4J2XA 2VDNL 4XMLL 4LSVH 4F7TB 4XNMA 4TPRL 3X12B 2HFTA 2KZ1B 4JFYB 1A2YB 3AXHA 3Q05A 5DFWH 2OTUB 4I88A 2WANA 3IRCA 4WK4B 3ECVA 4X9YA 2GPZA 4UU9B 1INEL 1HQ4B 2ZWNA 4DPRA 5SWZB 1F97A 4L4VE 5DT1L 1AP2B 4MBRA 5KOVC 1E4XL 2C3XA 5KW9L 4NQXA 3T4YB 4GXVL 3U7WL 3DETC 2CUAA 4FXGC 3UAAA 1KZQA 4NUMA 1BFVH 1IGYB 3ARBB 3B5TA 4HS8L 5JZ7C 4WI5A 1QWUA 3LHPH 1M1XB 4I3SH 4L8SC 1OF2B 4G70B 4PV9B 4Y1TA 4KOBA 4LPUA 4DAGL 1AR2A 5FUOH 3LKNB 1NCBH 3K1DA 1PZ3A 4M6NH 2PO6B 2XSKA 2ZOLB 3LD8B 5HGDA 3L6FA 4DIXA 2P1YA 4AVJA 4GP8B 4DPBX 5L9DH 3F04A 4OU3A 4CSTA 4NNXB 1KCRH 3TXAA 4PGCB 1URLA 5TQ2L 1BYPA 5I8CB 1OTUC 3ARWA 3WDJA 3QXVA 5SV3A 2KLRA 2AEOA 4H8WC 4OFPA 5ENWB 5FYLL 3V4PH 1U3NA 2VXSH 4JGMA 2BNQE 3DA0A 4HCIA 4KKCD 4WI4A 1OP4A 1E4JA 1ULVA 4W4NA 3EYOB 4J3OF 2QADB 2WTOA 3CPLA 2R29A 1N59B 2XCMC 3H6JA 1MHPH 5TF1H 4LASH 3Q3GB 1NFIA 1EHKB 3Q6GH 3VXRE 4ZAKA 2HVJA 3K2UH 2PCPA 4KJPD 3IB4A 1E5AA 3RJDA 3HAEB 2CBPA 3KM1A 1UOLA 4YK4B 1EO5A 2FWOB 3IETB 3S5LB 3RUGB 5CCKH 4GW5A 4R4NC 2ZSWA 4KROC 2IDUA 4J8QA 3DGDA 2F15A 4XVUC 5ACLA 4DVBB 4RMSA 3DYMA 3ULVH 1AXSA 1T2QH 4AZ8B 3IXAA 4WV1A 1RUMH 3SJVB 3UC2A 2P5PA 5I1HL 5F9DC 1LWJA 3VTAA 2D73A 3GDCA 5CSGA 1RIUH 5T1DL 4Z7NB 4G8IA 4YGVB 3V4PL 4FLQA 4HUUB 5EF2A 3O3DA 5EF0A 3L5WA 3RGBA 4K3HA 2NY1C 5JPMA 4JY6B 4AITA 4F7CA 1DQLL 5AG9A 3GK8L 3CFBA 3HPLA 3Q0HA 4LSVL 4PVMA 1CURA 5GRVL 5IW1B 2PXYB 5KSBA 1RV6X 1RQ5A 1SOQA 3MRFA 4P4RA 2DD8L 2MTPA 2CZNA 4LFHD 4GRMA 4WWID 2NUTA 3FRUA 4YE4L 1HKLL 2X1QA 3LVEA 5K9JL 4ZUTA 5B39B 5L4IA 1Z66A 2E7CA 3QFGA 3ZHFA 2OZ4H 1IV8A 1MI5B 2G75A 3DTUB 3GJFA 5FUZH 4DP9X 4GG8B 5B39G 4CNIA 2FR4A 1WAAA 4YXHL 4GKOA 4RESB 1ADQL 1EA9C 2F1EA 4IS6B 4ZXBC 1TO4A 2FWLB 4YSPA 3CSGA 5BV7C 4KTGA 3W9DA 4L4JA 1F02I 2GVYA 2WXJA 2E6PA 2YO3A 4YSUA 4ANUA 2DF3A 4AIZA 4CBPA 3WS6C 2ED6A 5D7KD 1MJJA 1U8MA 2K70A 4GUCA 4RMRA 4Z7VF 3BVNB 4HIIB 3LV3B 5DJZA 3H7BA 4EO5A 1ND0A 5ID0B 1DLFL 2HRPH 4F9LA 1N3NA 5FK9B 3UBXA 1TJGL 5F1OB 3NJHA 5T1LD 2EDKA 1JPST 3VCLA 4YDIL 5HDQH 1QRNA 3HKZA 2MWCA 1DL7H 4QT5B 3QZPA 3U4EB 1J48A 2EEDA 4K94H 3BUYB 1IQWL 2PXYD 2YEZA 1WAAE 3D39D 3AAZA 3MBWA 4BFFA 4IM8A 15C8L 4HZ1A 5CXPA 1OQOA 4JM2A 2BSSB 3RZCC 2XUWA 4RGOH 4MXQC 3ROOA 2BHUA 4X98B 1E5ZA 3NCFB 4Q2ZA 4WEBL 3TO4D 1TTGA 2MKWA 5ALBL 4PG9A 3EJCA 3OKMB 4QRUA 5B3NA 5KYXA 5HHME 5I1KH 3S37H 3FCTB 1IT9H 4TLTA 3LZRA 1OP9A 5D9SA 1IM9A 4PJ9D 5FLVA 5J57B 4PJXA 4CVZB 4HHAA 2EDLA 5HVGB 4YFDB 4M62L 1KT2B 2OCJA 4Y1SA 1TYEB 1TQVA 4HUNB 3OC5A 1FL3B 2IG2H 2EE2A 5CLZA 4ZFZB 3GSUB 4BM7A 5LDSA 3HC0B 4FFZA 1UB6B 3KPOA 2X70A 1CLZH 3UPAA 1L6PA 3GS7A 3S35H 1CYXA 1A4KA 3X1BA 2F5AL 2BOLA 2FX9H 2WO4A 1HI6A 1Z9SA 4P5MB 1DQML 1LHZA 1SOSA 2W9EH 1E6OL 3UTSD 2EYRB 2WOYA 3WY3A 4R26H 2IH8A 2D31B 2DTML 5I0XA 3ESPA 5L2KE 3F7RA 4OVUA 4UWQB 4MD4B 3TLRA 1I1RA 3BXNB 1KIQB 5BV7H 4P4KC 2WLIB 5TK2A 1E4WH 2YPLB 3UJTH 2YK1H 1Y07A 3VNZA 1EH9A 1NM9A 2B1AL 3OG4B 1LEKA 4B3VA 3GPEA 3BH8A 3BUPA 3DHUA 4GKZA 1MLCA 3A24A 1IM3A 1JWUB 4N5EC 4X5LA 4N68A 1QSFD 2X1PA 5C0AA 2Y7QA 1X9UA 4G1MB 1EERB 5E2TL 3E8UL 3VMNA 1UHVA 4DUVA 4OIIL 2V5YA 4OJAA 3QEQB 4HKBB 2O26U 4HJIA 3WHXB 4C56E 3SQBB 3ARBD 4X7TA 5I15L 3TZVC 3H2QA 2IBBA 5F9JA 5DTFA 5E6IB 3F85A 4G9FE 4OLUH 1NFDB 2X7LB 5IVXF 5SWZD 3KJ4C 3TA3C 2UWEF 2X05A 2V7NA 1AR1C 2NY2D 2WP3T 4RH4A 1TJGH 3CHXA 4OZHE 5CZXC 1VFAA 4LCUB 3WY2A 1H0DB 1S9VA 3LB6C 1E4WL 3ARDD 1DVSA 3F6JA 1LO0H 3ILPA 1DE4B 3NK4A 4XN7A 2GJZA 5IVXB 2JQZA 4RAVB 1AI1H 3DROB 4J5VA 3MAWA 4G8AC 3EJJX 1A4AA 4M7JL 4PBDA 4OCRL 3RTLA 1I7ZA 4MXQD 3D3VA 2EABA 1BZ7A 1T6VN 4KKRA 3NCYP 4UILH 1LDPH 3UYPA 2EDJA 4A38A 1VGKA 3NFSH 5AB0A 3QCTL 4P3CH 1VESA 3ZHLA 4QF1B 3GUFA 1A4JA 2NY4C 2CJSA 3DXAD 3MRQA 2LLLA 4U0RB 1AJ7L 3WIHH 3JT2A 3DSFH 4NNPL 1W80A 1BBDH 4NX0A 2Q2LA 2AV1B 4OR1A 5C0CD 3ULUF 4XNQB 1QP1A 3FMGH 4K3DL 4TNVK 4ZFQA 4NFDA 1NCHA 3QNYA 5HVHC 4RA3A 3QS2A 4WI3A 2QFPA 5JOFB 2ZYRA 4N9GB 2P28B 1B4LA 3W2DH 2EDWA 2AK4A 3D12B 2JF1A 3AT9A 1EIBA 4U6VH 3SDDC 2F6AA 1M1SA 1HN1A 2KMWA 4RFNB 4MVBD 4O5LH 1JWMB 3RIKA 4AWJC 4JO4L 4ZMQA 4OD2B 4PW3A 4QF1A 1NEZB 4EN3C 2XIIA 4IJ3C 5EC2B 2R56L 2AJZA 3PPSA 1SQ2N 3WCYA 2ZD0A 5DYOB 5LCVH 2DLHA 3QO0A 4PPTA 2MMXA 1E2WA 4P48A 4ZSOB 4X9GA 4RMWA 4AZUA 2DAVA 4QMEA 3K6SA 1OGAA 2Q0ZX 5IQMA 3LRGA 2E5EA 2GJZB 1SGKA 1RFDL 4MA1B 1GJWA 1S5HB 3QQNA 2ZICA 4XWOD 1KTLB 4O00A 2OSLA 4RZCA 5HI5C 1IB5A 3BW9A 2BH0A 4JPIB 5C08A 3EYFB 5IFHL 2AEQL 5E9NA 1IX2A 3B9EA 2C1PB 3NIDF 3NJVA 4NI6A 3BGAA 3FUFA 3DX6A 1RZGB 3BI9X 1MCIA 2XG5B 4XH2B 5LBGA 4OZIA 3GSRA 2DI8A 4X7TB 1YYMH 3B3BA 2O6PA 3ARGB 43CAA 5ITBL 3MJ6A 2X40A 5FHBL 3AXLA 4KO9A 5DI8B 2F9BT 2FEJA 4XCFH 4M1DH 1SJXA 5DFTA 4OZ4A 5AEAA 1UD5A 1QHQA 4JR9L 3KJ6L 2QELA 3RZCA 5C0IB 1A7OH 1MHEB 2XWTB 3VW3L 4IBZA 1TR7A 3U25A 1D9KC 4DHLA 1XL4A 4A04A 1ZS8B 3II3A 1IM3B 1JWUA 4N1EA 5E8OB 3MV7E 1LWRA 2OXHA 3IGAB 3FT9A 4F3FA 2NNRA 3ABMB 4LNVA 3VD3A 3DNKA 3HPJA 3II2A 2CCVA 3B8YA 5B1AB 2BVOA 4XAKE 3QUYD 4JRXA 3BYYA 5H37H 2YAMA 1S7QB 3CCHB 1ZLWH 5J12C 1HH9A 1WWBX 7PCYA 1F1GA 5DR5H 3SGDH 3UG5A 4OGQC 2G4EA 5A2KH 4NYLA 3B34A 4HWBA 4LHUA 1GS7A 1PL3A 5HI3D 4X99A 3QVAA 5SV4A 1NBVL 5D1QA 4YUEH 3B9AA 2WBXA 2X42A 4YC2B 4FADA 4JRXD 4ODBD 1PBYA 1K85A 4OCNC 5CNHA 4NQEB 4Y5VC 4PJEA 3D3VE 4EN2A 2WZ6A 5GRZA 1IKFH 5D1QD 2HRLA 1RJLB 4JFHD 5BZXA 5LO7A 2NPLX 1KFAL 4MMYB 2GSMB 2R0ZH 4JDEB 5DMGC 1K2DB 5KVGE 1PJ9A 1S2EA 3PYCA 5I6OA 4FQXC 3B1UA 1FL3A 2MH4A 4PRID 1RZ8A 4WI0B 5HY9A 4D7PA 3JWDH 3B37A 1CGSL 5C0CE 2AHIA 5E56A 4IRSD 1AS6A 4N8CL 3ZLQC 2APTA 3KPNA 4B5EA 2D2OA 4RMUA 3BO8A 1NCDL 2CKBL 2NYYD 2OFQA 1THAA 4YBHA 2FJGB 5CLTA 4I48B 4L2LA 1JHTA 1A3LH 3GMRA 3STZA 4LASL 1D3CA 3TJPA 1T22A 3CG8A 4X2UA 4G7VH 1JOIA 3CZJA 3S6CA 5FOBB 4WU7B 1BJ1H 3C5SB 3QZWB 4OIAA 4U2YA 3X3GH 4B96A 2X4RB 4X6BB 3TIDB 3L1OH 5DVNA 3A3YB 2JKRM 5CBEA 1A6ZA 2HUEA 2WCGA 1HX0A 1PZ5B 1R3JA 3PAVA 4G7RB 5KS9A 2G60L 1U0QA 4G6FD 1KYDA 2Y1AA 4ZMLA 3V0AC 4R4BA 4ETQB 3ISYA 3CVHL 1D5IH 5KBPA 2Y1ZA 2BZ7A 2QVKA 3OMZA 1R3KA 4RDBA 1N3NB 3GB7B 3VFTA 1RZKL 4ZS7H 5L8JB 1MEXH 5ID0A 4UQBA 1MN4A 1A1MA 1T6BX 1J1XL 3FULA 5I75B 3CLEL 4DZBA 4Y2DB 2WXPA 4OF7A 4D7BA 5D2LE 3RRQA 3CFKA 3D85B 1QBLH 1MF2H 1WIPA 2IFFL 3CUPA 4TQHA 5LG1A 2ZUQB 4AEHH 2HZHA 3GJFK 4X7DC 3VDAA 4WF7A 2H0FA 1NL0L 3GMQB 3QNZB 4LVOC 4EI5C 2HN7B 2V3EA 4JDZA 4YSEA 4CNIB 2WC7A 4GG8A 3AT8A 1WUNT 4M6MH 3P30L 1R5IA 4HAKA 1I8KA 3LKQA 1QR4A 4YHKH 3HTLX 4KX8A 1HILA 4AYID 2ED7A 1HL5A 2HFGL 1HXYA 1C5CH 1W6WA 3VXMD 2G60H 3LZNA 3HMXA 1UKSA 3RWIA 2EUVA 1OGTA 4BSVA 2C9UA 4IGBC 3REVB 4DUXA 3QYCA 3AACA 4LLUA 3OZ9H 4K0OA 3I9PA 2EC9T 5F9WB 3MRGA 3IDNB 2G0LA 3NGBB 1WZ1L 1DBKL 4RX4A 5JOEA 2NY1B 3RY6A 3H4FA 4F7CB 2YLKA 3H54A 2OMWA 3BT0A 3QPXH 3GSNA 5HHXL 3QNZA 3P4MA 4ZAKC 1T66D 1EHLH 1SVCP 2F7QA 3NP3A 4HT1L 3TBSB 3X14A 4BGLA 2DN7A 3ZDXF 1E4XI 3H9YA 4F2ME 5ADPH 4JFOA 4WO4A 1M3JA 4TQ8A 1DFBL 5E0FA 2H1PL 5DFAA 3Q2CA 1F1DA 2JH2A 4DZBB 2WLMA 4PV8A 4JFEB 9CGTA 3GLEA 4N85A 1NUGA 1ZE3C 3MXWL 1JBJA 2ZXBA 4ZMTA 3QJUB 4GS7B 4PRHE 3GB7A 4E42B 3V79C 3CC5B 2Z0UA 3LRKA 5DFVD 5C0AD 3RHWK 3TH4T 3MYJA 5KYWA 5EU6E 3ZYIA 5T3XL 4LPCA 1PY9A 2EIJB 1U8LB 3UTQA 5KW9H 1A14H 5D55A 5F9OH 3Q3GA 3M1BB 5HDBB 3FC8A 1KYOK 1FDLL 5IMKB 2N0KA 3MZGB 4L4TB 4QIRA 4B97A 3TIDA 4BEIA 5J56B 2ZNXA 4JPVH 4UQAA 3WO3B 4KI1A 2ED8A 4NRZB 2VQ4A 4YHNA 5AWNH 3O6FD 4Q6KA 5H4YA 3KWVA 4XMXA 3STZB 5L0QB 5I0VA 3E80A 5SWQA 1KBBA 3V0JA 4BWWA 2NXZB 1SF5A 2XIBA 2IGFL 3AW5A 4M03A 1A6AA 2DQDL 5DRXB 2PPDA 1MFCL 1ZWIB 2IQAA 2ICEA 4UTCA 2E74C 2V5SA 5DWUH 5CMAA 2WQRA 4ODUA 3EDDA 4FQ1H 4GAJL 5AZ2L 3V9FA 4YPGA 1LQSR 1GS6X 1EAPA 3BZ5A 4JDEA 4HC1A 3NJXA 3CFUA 3NRPA 3VFOB 4N0UA 4D9LH 3MODL 5HDBE 4ANVA 4LVNC 1P1VA 3NEOA 3L7EB 2IV8A 2EAEA 3O2DH 4KQ3L 3A47A 3IM1A 3RL1B 3ZE0E 4X6FA 2WYTA 1FYTA 3QUMB 2B2XL 2YAHA 2DEYX 1OCCB 4HWBH 3BRFA 1HCZA 3AREC 3VWKA 1UYWH 2ODIA 3KEDA 3GBML 1EHAA 4FQXA 3TFKD 1CU4H 3FO9B 5DQDL 3MV8E 1WICA 3M46A 4QRRB 2NX5E 3VD9A 3W9EA 4TV3A 3PDDA 5DMIH 2EUWA 1MPAH 1UKTA 2P3YA 5DHXB 2XWEA 4GG6F 4GQRA 2ADGB 3JV4A 2V2XA 4L29B 1MG3C 1OSPL 5K1VA 5H37G 2XJKA 4D9QE 4HZLA 3DSNB 3NA9L 5SX4H 2VDOL 5HHNB 4APQD 4OZ4B 1TPXC 1OTTD 2Q8BH 2JB6A 4GMSL 3L3DB 1TYJA 1OCRB 1AXTL 3P9MB 2VXQL 1QI3A 3O2VL 4OCYL 1TJXA 1OAUL 4GLRI 4R0LC 3ARGA 1Q9OA 43CAB 1ROWA 3I6KB 1C5DA 1E7UA 1YNTB 4WCYH 3L54A 2YPLE 3MA9L 3SQOL 2K9FB 4AQEB 1QYGL 3WEXB 2H0PA 4RZKA 5BUAA 4ELMF 4ZFOL 1HEHC 2LW3A 3FB5A 3BE1H 5KAQG 4BJLA 1GYAA 3TO2A 1INQB 3BW9B 2DOCA 4TTDC 1LO4H 3IPFA 4NJ9H 3SBWC 3BSZH 3CZGA 1FV1B 4WWKD 1KGCD 2PABA 2GTWB 3NFSL 4H0LC 3ZVVA 4AQ8A 3CBKB 3KPRD 1N0LB 4XC1L 3T65A 3TYGH 3WNKA 3WFZA 5BPPA 4X6EA 4ABVA 3UZVA 3FQYA 4AQAB 5F6IB 4JG0H 3OZKA 3PIQA 5E6IC 4OF6A 2WXMA 5F88A 1DVYA 3QULA 5AD0B 5DYOA 2OJEA 1SY6L 3QDGB 1AFVH 2KT6A 2NZ1A 4Z23A 1YA5A 4Z77B 4DCQB 1WZLA 2GT9A 3KW7A 3D87B 3D8MA 1BQHG 3ZR5A 2KC0A 4OCYH 5IREA 5BMFL 1KB9K 2AVGA 3U46A 4F93B 1FNSH 1I9JH 1YNKH 2DB8A 3FTWA 3QXUA 4FNLH 4ETYA 2PWEA 5LN4A 1R3LA 2V5RA 2YMXH 2APBA 5C0NC 4M6OH 3QNYB 1OD9A 2B4CC 3ES6B 5FWRA 2L4OA 5CU9A 4KDVA 1KB5L 4IIQC 3TZVD 5EDXA 4Z3IA 3DDFA 3VRJB 4AL8H 3EBAA 3NG5A 3CVDA 3QRGL 4L48A 1ZTXE 4MA3A 2FX8H 3QZMA 4B7IA 4X8XA 4NPYB 4J3TA 5AZUA 4NWUL 3INUH 1DEEA 4N1HB 4FLOA 2A9CA 3ZQWA 2DMBA 4TQIA 4M1CC 5E1IA 4BA0A 4K8RD 3SYCA 4TSCL 1N2RA 5HVHB 4LSUH 3UYPB 1AFVL 1B0WA 3ARYA 3RQ3A 2PP9A 3G5VA 5DQDH 4JCWA 3LPPA 4RBPK 3U2SA 2A9ML 2I9LB 2ZCHL 3C12A 5I19H 2RBLA 2CJUL 3RAJL 1BVLA 3T2NH 5JIDA 3OAYK 1U8IA 3LH2L 3L5IA 2R0ZL 5DRNA 1PKQE 3QJXA 2X4OA 3IJEA 4NNYA 3U1PA 5BOJA 4BCYA 5KVMC 4LF3B 1KCKA 1NC4B 4E9YA 1EMTH 2VJ8A 4TQEL 5MEQA 4XP4H 4GRWE 1YPZB 1CGXA 2BMKB 4TF4A 3VFUB 5IOPA 4TVPL 5G4MA 3LKRA 2VDLB 3ZTCC 2GJPA 3E8VA 3SPCA 2IFGA 5KYYB 1U6AH 2BVQA 2EYSB 2B1HH 4NAJA 1AOHA 3QIUC 5E6IA 1KXVC 1EZSA 2DIJA 3I9GL 1QLFA 4L3CA 4LRIA 4BQ6A 2DKMA 4S0SD 4ZI8A 1AGDB 4HH9A 3KYOA 3WHXA 2P8MB 3P3UA 4MNGB 3DV4B 4K5NA 3VGHA 3FU8A 1OP3K 4UOW0 4X83A 1KJMA 1KXHA 3EYSH 1CLYL 5CP7B 3U0PA 4XVJH 2OS7A 1J05B 2B15A 2G9HA 2B1AH 3P69A 4KXZH 4MCYB 5DUJA 2QVFB 5EU3A 3VE0A 2HB0A 5DJYA 3UYRL 4HMEA 3UGUA 4W6XB 5DO8A 3VB8A 3R8BB 3WIHL 4WEMB 4IBVA 2X89D 4F9PC 2XHNA 2J21A 1A8ZA 2ZXGA 3F2LA 3BIKB 1CMOA 1C5BL 5FYLD 4AE0A 3FW6A 4PH8A 5BNXD 4PJCA 1IQDB 2UY6A 3V5DB 4BDVB 5C08E 4UTAA 1GMIA 4DW2L 3BJ91 5JDSA 7FABL 2CCWA 3KPQA 3FRPG 4XNAA 4XP4L 4AIOA 3KLHD 1S7VA 2FECI 1IGCL 3IMSA 1UCBH 4K7PY 3MCG1 4YO0B 5C0AE 1U91B 3BKCH 4ZRGA 2HXAA 4Q6IB 2FATL 3IE9A 3GFUA 5JIMA 1KPRA 2D9CA 4ODSH 1L9OA 4ELKA 5CLYA 2UWEE 5E4EC 4RGNB 4U1IA 2P7TA 5BRZB 3D4YA 4F2MB 5D7JA 4A2FA 3P30H 4DP7X 4PJ8D 1O9ZA 3PE9A 1WBXA 4KK6D 1F3JA 2APFA 4ZX6A 2A0LD 3B2UC 4XNXL 4LCIL 3PGCB 1DANT 2G3ZA 4U2ZA 5IHUL 5I6KA 3SE3C 1IQDA 2UY6B 5CD5C 1W8OA 5IT2L 3DKHA 3OZ9L 5FYJU 1ODUA 4G7VL 5IW6A 2FT7A 4BQCA 2A74A 1IM9B 4HUCA 5DD6B 2CBMA 5FYKD 2KI6A 3O6KL 3VGGA 1A9BB 3KWTA 5CJ5A 4WWPA 2Q6WA 2VZOA 3P77B 1OP5K 4MCYA 2EJ1A 1MSPA 2EIBA 4F2FA 4K5LA 5IQOA 3U0PB 4XZ4A 2QPUA 4OY9A 3O6LH 2BCKB 5FHAL 5AVXB 2WV3A 1DBBL 4FJZA 1A3RL 1V3KA 3VXME 4CU8A 1M7UA 4NQQA 2YWYA 3TCXA 1YEJL 4JZOA 4NKMA 4QRPA 4QT5A 1F42A 5GGUA 3WNMA 2YUZA 3N9GL 2YPKA 3PDOB 3SSGA 2A9NL 3WHE0 4PY8I 3ILDA 3FTVA 4QNPF 1OQXA 2VN7A 3CXDH 4MLSA 3LKRB 1SBSH 4AM0Q 4QRPD 1M2VA 4D3CL 2YQ2A 4G6FB 2GTQA 5DRWA 2EZ0C 2A1WH 4QAMB 3AWEA 2YBRA 4LBEB 4A63A 4AIZB 5C0GB 5HHPA 3BKML 2ZPKH 2XTJE 1LO3L 3MUJA 4GUPB 1E8WA 4NKDB 4UT7H 2B20A 5HDRA 1AE6H 3DHJA 3LXUX 4PWEA 3OKOB 2PR9A 5ITFB 3GYRA 3G5VB 3BQUC 1AQKL 1GOHA 5F89A 3VXSA 2GBAA 3QWOA 2A9BA 3T0VA 2FR4B 1L5GB 3V0VA 3OF6D 2XN9E 4BZ2A 1L0XA 1AD0A 3EYQC 1XB3A 3W39A 3EZ8A 3VXPB 3NYKA 3NH7H 3TPUB 4RMVA 3JT0A 5HD8D 1MFCH 3G04B 3BSHA 5C0DB 3OF6A 2Z31A 3MKKA 4BH8B 1G7MB 4H26A 4WFFE 5CP7A 4NP4L 3ES6A 5TD4A 3IXTB 5CP3H 1MHCB 1QAWA 2QPSA 4CW1B 3DV4A 2BINA 1JPGB 5IKCB 4KK9D 3BGFB 5CILL 3FZUC 3Q7JA 1NBCA 1ZLDA 1ZA6A 3O8XC 3L2NA 4WJKB 1R3IH 3CLFH 4PJBB 4IRJA 2VRQA 4UIMB 1RZIB 1I85C 4CJ1A 2A0LC 3B2UD 4C56D 1I3GH 3QDGA 4KK5D 5HSFA 2H2PD 5FM5O 3I3BA 3MLRH 1CDGA 3UACA 1DUZA 4EJ1C 1JWSB 3MROB 4HCFA 1U8IB 1IGTA 4I0PC 1A14L 4LL1A 1R24A 1TVDA 1FFRA 5F1IA 5C8JB 2WXHA 1HXMA 2OYPA 4JFPA 1FC1A 4K8RC 2XBDA 2HVKA 4HJSA 1DBAL 5BZWA 1F8TL 3RBSA 3CAFA 5JHLL 3WEXA 1GYUA 2F5AH 3AZUA 1LP9F 4TNVF 2LABA 3ARGD 4NOFA 3NPSC 4PG2C 4J12A 4W9ZA 3GWJA 1DQKA 2F61A 1OK8A 1PJWA 2FK9A 3FT1A 3VGEA 3DC0A 4M5ZH 3DRTB 1DJGA 2V8MA 3I6KA 1N0XL 3D25B 4L1LA 1HAWA 1NAML 1BD2E 2H8PA 4GAAA 4AK2A 2XLLA 2M1KA 5FUCC 2VH5H 2F18A 2XIDA 1KTBA 4FFYL 4JRYD 2OYKA 2HFGH 4UOQA 2EH7L 3QDJD 4XO4A 3JV0A 5AAMA 5LKNA 2FGWL 1XF2B 1DJYA 3IE4A 1OGPA 4I77L 5EZOH 4PLNC 1TQUA 1JPSL 2HP4A 1DJSA 1F4WH 3LKPB 3G08A 2OJ1A 4QRPE 4F57L 3QDJA 3O8XB 4OD1L 4W9CC 3MPCA 4P2AA 3EJUA 2LT9A 2XZAH 4FQXB 4LOUD 1B4JL 5GRJL 5AD0A 3AUVA 3FTZA 1U3HB 3SBPA 4CGUB 1HHKA 1WISA 5IBLC 5IJKA 1F58L 4PJ7E 1WS7A 1UXSB 2Y1YA 2J1XA 1VJSA 1KLUB 2GSGA 1CS6A 1VLXA 4L3EA 3DX9B 3OHXC 3IKKA 4J1UA 1JJUA 3ZHDA 3KMDA 1NUDA 2X4SA 4KI5D 1KC5H 4G42B 3L7EA 2J5WA 2IC2A 4QYOB 1QLEB 2CNZA 3RWDB 4A7UA 2PYFB 3GI9H 4AQEA 1ZHNB 1JPFA 4DKDC 4Z7UB 3FF8A 2VXSL 4N8VA 3RWFB 4W4OA 2VH5L 3FN3A 2VMCA 5FO7B 4MJ6B 4EQ2A 4J27A 1KPUB 1D7DA 2WXLA 2SEBB 3WEOA 2VDML 4ODUB 3VFNB 1QLRA 3GLAA 1IU1A 1K8DA 1JMZA 2ICEB 2YS4A 1FZOA 1J7VR 2DIBA 3DX2A 5TGBB 1U93B 3BP6B 5C0JB 2IAAC 3L3DA 3JUYA 3SD2A 3BHBB 1GHFH 4TLUA 1CE6B 2C9VA 4Z0BH 5IGXH 2HT3D 4M7LT 2I85A 2D7TH 2Z34A 1O6SA 2Z7ZA 5IBUB 2CXGA 3O6FC 4CDHA 2PETA 5CF3A 4N90E 4GAGL 5DA0B 4ZAKD 4LSPH 4NRZA 2IXQA 1UEYA 1T1YB 5F7BA 1BM7A 3K4AA 3BN9C 3TNMA 3WS6A 5IROA 1HE7A 4MB4A 4AJWA 1JK8B 1GVIA 3L1EA 2X9WA 3RWCB 3SE6A 4KKAD 3DHMA 4EI5B 2PNDA 1O6VA 1BEYL 2WQSA 5SWSB 4H8PA 4WIQA 1E42A 1RHHA 1KGWA 1EMTL 1NCWL 4MAYA 3V6FB 3HG3A 5LNEA 2DLIA 1NSNH 2CDGA 1DL7L 4WVRA 4ABQA 1ASQA 1BMZA 5BZDA 3WS3B 3MLSH 1HIML 1BW8A 4UM9D 4XVTL 5K9KB 3HUJB 3HRZB 3VXUD 2ZOUA 2OM5A 4X5WA 3OKEB 2FX7L 3JTTB 1KPVB 5AYQA 1Q0XH 3LMJL 1P4LA 5I8OH 1ODAA 1LILA 3LVTA 3WNIA 4MMZC 3IKCA 5K9JH 1XF3A 3B9DA 2EDOA 2VDQH 2AQNA 5DRXA 4AL8L 4JPKH 4WUUA 5DO2D 5IMMB 4I1PA 3ZO0A 2FO8A 4X6DF 2R69H 3T3MB 1OAYH 1I7UB 1NGXA 1SXNA 1X5FA 4LEBA 4ORZC 4PRIE 5DURD 1W0VB 2VLKA 4B9JA 4FTVE 2DIEA 3RDTA 3KYMB 5K59E 2EUXA 4UDTA 2OR9H 3UTSB 1EDYA 5C7XL 1VF5C 2OW7A 1G6RB 3S35L 3P9LA 4M6AA 2XPYA 4S10A 1F4XL 4HK0B 4ZXBB 5BV7B 3GUTB 3SDYL 4G11A 3Q5TA 3PWPB 2QSVA 4JMNA 4TTDD 1GL4B 4M1DL 1DJWA 2H6PB 4CKVX 3IFPA 1MCQA 2HN7A 3HMWH 2XTJD 5I6NA 4FYSA 3QPQC 3TBYB 1KC5L 5KANG 1XAUA 3WY4A 1FL6B 5JIHA 4E42A 2WCSA 1G6VK 1T3FA 3EO0A 4PP2B 4PV1C 4Z8FL 1U8NB 2XV2A 5HI4D 1FBIL 2G2RB 3RKDD 3EDFA 1K6QL 1QA9B 3LMJH 4FQCH 5IFAL 3F58H 5T1LA 2FUQA 4FZ8L 1X7SA 4I1RA 1JZ8A 2AJUL 5L0QC 4AM0B 3F12A 3CHOA 5EN3A 2WBJB 4HIQA 4RBPH 3APDA 5LCVL 3ZZQA 1U95B 5LGJA 5F7AA 3MLWH 4AH2B 5D96B 3VFWB 1RVFH 1IJ9A 4JLRA 1N5YL 1FIEA 4AYDC 1AHWA 1CGUA 2A9DA 4HSQA 2L7JA 1WZAA 3MCYA 1RZFH 2VABA 3FCSB 1UTDA 2ICCA 4XMVA 5B21A 4X7CC 3UAFA 2DWYA 1C08A 3LN5B 4WWOA 1FZKB 1LXMA 4IRSB 4ZOEA 4EZLA 1JZJA 4EPSA 3BH9A 5J4MA 1UH3A 3CDCA 1MVFA 1ZTMA 4UZSA 3QIUB 4FNLL 3MMEA 4LPYA 2ERJC 4PJ5D 5FB8B 3K3QA 5CWSA 1OSPH 1PEWA 1KCVL 3MR9A 5AOJA 3E9TA 2GIMA 2I9TB 2CGZA 2YEQA 5ECGA 1KBGL 5EULV 2J4WL 1B9KA 1HHIB 1NGZB 2VUKA 5IEHA 5KN5A 1ROCA 4NQED 2OW6A 5JHDE 3OAZH 2F5BH 2AJSL 3U36A 1ZIBA 2BSEA 1KG0A 4D9RE 1NGQL 3VX1A 1ZY9A 1URZA 4M7ZC 4U6HB 3HC4L 2HX8A 3SPJA 3BQUA 5L2JA 2FL5B 1TZHB 4QWWC 4N0YL 1UQSB 4HYTB 2RGSA 3KWWB 5E9AA 3QUXB 5CJXA 4J8RA 4LFHG 4TSCH 2X6UA 4R90H 3MLPA 1QI4A 1X5AA 3HVDA 4Y5YC 3WTUA 2ICWA 5FWQA 1Y6MR 5TE7H 4ETQA 2YAEA 2ZJSL 3MNZB 4I85A 4BA8A 3VNYA 3SHSA 1AZUA 2AMUA 3C2AL 4WGVB 5I5IA 2WWKO 4MWFB 3GXNA 2XWXA 1U8HB 3BGMA 4E41E 3DGGB 4K55A 4X6BA 2RQ8A 1NJ9A 2JIXA 3SD5A 3U48A 4ZDHA 4AE1A 1FAIL 3C5SA 3QZWA 2ZWYA 1D5ZA 3S5ZA 5JXAH 4JVWA 4M7LH 2O1AA 1NKGA 4NT6A 4PJEF 3TVMD 3UP6A 3WNLA 5I6LA 5I24A 4GI8A 1OVZA 2KPNA 3GMRB 2J1ZA 4J3SA 5AW7B 4TPRH 2E75C 3UEZA 3MOBH 2WZ0A 4BRVA 4IRJC 3ARXA 3UTPE 4POYA 1Q9KB 4YQXL 4PJ5B 5IIEA 1H8NA 4JKWA 3MDJA 4Y88A 3LRMA 3HR5A 1L0QA 4H1LH 3ZSTA 5BUGA 4XCYA 4XCNB 2Z0BA 1PZ2A 3MLZH 3DGCR 4A68A 1DZBA 4EDXB 3LKOA 3IJ8A 2ERJB 4LKXB 3NCEB 4BFGA 3Q43A 5IUCA 4YEEA 2CM6A 4NRXB 3QUHA 1HVXA 4D8PB 2JCWA 5I23A 4DT2A 4XXDA 1SNRA 1DQTA 5E70A 2AV7B 2VL5B 4X6DE 5HYJA 4BBWA 3VM5A 3QCTH 5HVWA 1RVFL 2O61B 4DW2H 1ED3B 3LH9A 4X6DA 5FW6A 3WL9A 5HYJE 1T04A 5DUMH 4GRLD 5HDBF 2CHXA 3GHBL 4FCAA 1AGCB 3AS0A 3KXFA 5AYUL 3IJSA 4HLZG 2EILB 4XVUD 2V6HA 4IIQB 2WIIB 3GMPB 1CFMA 3KPSD 2OTWB 1RZKH 4ZD3L 4F9LC 2BDNH 1OANA 4KJYB 1UZ6E 3HI1B 4I1NB 2BP3A 2GC4C 2Y2TA 4Y5YB 2AC0A 4MCNA 1YEIL 4Z76A 3VQ1C 1A7OL 3V0IA 1ZXKA 4LLQB 3FBQA 4JRXE 4PS8A 1C1EL 1RD6A 3GEFA 1JYNA 3ZTDC 1G7PB 3JWOH 1H3TA 1USQA 3VMOA 2YN5A 5MEOB 1ESOA 3BDYL 1MZYA 3QUGA 4JN2A 3FT4B 4BK8A 5DQJB 4Z7QE 3N2JA 2VYRE 4Y4FD 1MFDH 1SF3A 5EIIA 4JQVC 4EIBA 4U6YA 1RJYB 4EN3B 3SE9H 3DK0A 3OJ2C 2YRPA 4JZJC 4Q9RH 4N8VG 4BKLB 3T77A 3GSRB 4YVUA 5GGSB 4JANB 4HQQL 2XETA 2VDLL 4GSRA 1IUZA 3KYNA 5AOZA 3K74B 1OPGL 2Q86A 3NFPB 1NTDA 1XD0A 5JHDA 3CDZB 3MBEA 5F3HA 5FDWA 1S5IL 3B2VH 2YQGA 2R2BB 4PYGA 4F8QA 4KK5C 1JZIA 3BZ4A 3KJ4B 3DLQR 3FQNA 3TT1L 2PN5A 3QWRA 4OM1H 1XZWA 4Z7QB 4PW9A 1T80A 1NDMB 2VMJA 3L3KB 1GSMA 4CKQA 1AIFB 3BZ4B 2CO1A 3OQRA 4MXVE 1FZMA 3RUGE 2VSKB 43C9A 1R33A 1N0XH 2MCG1 3FYIB 3AU1B 4M8QA 1T20A 3HE7A 3MSPA 5HHVL 2BFVL 2OBGA 3VFVA 1XGPA 4FG4A 3HG1A 4PG2A 5TH2B 2B5IC 4AJVA 4CGTA 3GMOB 4XMKH 4BKSC 4BE5A 3PABA 4UQDA 5J11C 5LQBH 3A6CL 5I1EH 2FJFB 3QEQA 4OIBA 3L13A 3T71A 1H3GA 2C7FA 5IHUH 4WFHE 3NJJA 5IHZA 5EU5B 2VDQB 1L9QA 4R4FH 4XNQA 4G1MA 2F2HA 4PR5A 1AGFB 2BOCA 3QFJE 1F4WL 3NH7L 1RULH 3LEVH 3NN8B 2BNQB 4MAYD 3PL6D 3C8KA 3MRQB 4W9FC 4O2CA 5SX4I 3ATBA 1JRHI 5TQ2H 3CJJA 4PWFA 1Z2KA 1JGDA 2NQDA 3O9WA 5AAPA 4OJEH 2WZAA 5FF6A 1X5GA 3QJZA 3WBDA 2YD3A 1FO0L 2YPLA 4QTFA 3AG2B 4JG1L 5LGKA 3PL6A 2BVTA 2DWDA 2JJUA 3TBVA 2VDKB 2UUDH 1IBBA 2N01B 3FQWA 3KXFB 1RMFL 2NY5H 4MB1A 1NMCC 1ZGLP 2JV6A 1LD9A 3FUKA 2R8SL 2B3IA 4IK7A 2XV3A 2ZX5A 2BP0A 1M6OB 1INDH 1Q0XL 1OT4A 2GKIA 1HI6B 1Z9SB 2D7OA 5E6UB 3WGVB 4X8JA 4CU7A 3VMPA 5F7UA 2CRZA 4PRIA 2ZX6A 2AANA 1T66C 3QSKB 4NZUL 3IN0A 3HS0B 4IBYA 3RNQB 3S96B 5LXGL 4NZDA 3V6ZA 2WQUA 1BIIA 4I0CC 1H19A 4MZRA 5E2TH 3X3GL 4EAEA 4J4PC 4HKBA 3ILEA 4UMSA 5KVEH 4GAGH 4C59B 5EV7A 5CN2A 5D72L 5DQJA 4CC0A 2LAGB 2K6ZA 4NDMA 1V3MA 3V55A 5EEXA 5ESVB 1CICB 3APCA 2UZXA 3FAXA 3TH2T 3H9ZA 3L4ZA 1NJ9B 2JIXB 3VFMA 5D70H 4HG4J 4XPFL 2YKLH 4PB0L 2DWEB 4KRLB 1MIEL 3MRLA 2P26A 3OJVC 3GKWL 1KYOJ 3WTTA 5FYLH 2ZSVA 3RI5F 3WFEL 3K91A 5K5YA 4XBPB 3HG4A 4UANA 4S0TD 3EHBD 3HCVA 1BYNA 2AJUH 1UCTA 5J6GA 4KRNA 3CIQA 4HJUA 4L8CB 3FO1A 4V1DE 4M43H 5IJVB 1YEHH 1NL0H 1CXLA 2IOIA 1NDTA 2X4QB 2J2ZA 5K9OB 5JUEH 1UQSA 4Y9BA 1JPSH 2XI9A 1I1YB 2JKJA 2LHAA 5C07D 1TVBB 2AK4E 4GRWH 1WZKA 1FG9C 4JM2D 1LK2A 3ASOB 5D4HA 3TIEA 2IPUG 4ZW8A 1TUPA 1MFEH 3LEXA 3FO0H 1MI5D 3IDMB 1XZ0A 4YBQC 4AV5A 3ULVE 4G5ZL 4P2OC 1ZSDA 5H35B 2CKBA 3MLUH 5KN5B 3IMUA 3GM0A 3EO9L 4ZMXA 1BZ9B 3B1TA 4GMTH 3F00A 5DJ6A 25C8L 2O6DA 5SWSE 3JV5A 2VLRD 3KPMA 4C55A 3KL3A 4CVUA 5FO9B 1L0YA 4HHAB 3MR9B 2HRHA 4JM4L 4K5MA 4HPYH 3FCGA 1A47A 4YXKH 3V4PA 3QR1A 2VRAA 3ABLB 1OB1B 2NW2A 3OBAA 3A6OA 3AY4A 4CC1A 1JVLA 1L7IH 5BRZE 5F2FA 1UATA 4O4YH 3SE4A 15C8H 3BAJA 5E5MA 4Q8BA 2GQHA 4S2SB 5K39A 4WDIB 5AOLA 4M5ZL 5LG6A 4NQCE 1FL5B 3PNWA 1VKXB 2WNWA 1BAFH 3WTWA 1K5NB 1IFRA 1N4XL 3B2XA 3FQ1A 4KUCD 4IEFB 4HWBL 3FOLA 1DUYA 4AH2A 4HUUA 2DM2A 1HJCA 2WVVB 5DHYA 5FO2A 2P5WD 1MREL 4BFIB 4UILL 2F7RA 1HZHL 1S7SA 4U6XA 3B5HA 3BAXA 3S3CB 4K4KA 1Z3GL 1KNOB 4DVBA 2IWFA 1T1WB 3UZQA 1MQ8A 1IBFA 4G72B 1E9OB 1H6TA 4KTEL 2W5PA 4PJGE 2YBGA 1LP9A 5CSZA 2HLFC 3KDPB 3DX7B 3U36B 2IGLA 2CJTA 2WSDA 3CFNA 4WUKH 2WQWA 1G9ML 2BXYA 5J13C 4DP0X 5DJXA 5T3XE 2VDRH 1KJVB 4GP5B 4UNVA 5E2JA 1BAGA 4S1SL 1MCNA 2OXGA 3MNVB 4APXA 3SYAA 1ZEAH 5MI0C 2X2JA 4XCEA 1LO2L 2EH8L 3ROLB 3ARFA 3NAAL 3QIUA 5D93C 4W9DC 4P2RD 2B1OA 3TURA 5FCUH 3B8SA 2CLRB 2KZBA 4G6KH 4M4PA 3V4UH 1QPPA 2HJKB 3MA9H 3EZJB 5DQ9A 1W0VA 2VLKB 2C1OB 1FZJA 1CJYA 1NC2B 3QJQB 4NWTH 4Z9KB 2XXFA 3TF4A 2YGVA 2MOGA 1BD2A 3WUWB 4UV7L 1PKQB 3FTXA 4MAUH 5FYKL 2QVIA 1YUHB 1TJHL 4Y9GA 1Z5HA 4JY6A 4Y4HB 1V05A 4NNXA 1BVNT 3ETTA 1PD6A 2ISDA 1FNHA 2VLJB 5IESL 1Z9NA 1JFQH 1P4LB 5CU5A 3KVQA 5GSVB 3MJ9H 2H6UA 1E28A 4Y2NA 2ADFL 4JFZH 5F70A 4AMKL 2YA2A 1Q1JL 1I3VA 2PW1A 2NLJA 2BRRH 3CBRA 1OF2A 5TE7L 4NBYB 2YXMA 1E6JH 1TJMA 2OMUB 1M1XA 3BPLB 3TM6A 4MAYC 1IAIM 5IFHH 3PGFH 3D39E 3ZZLA 5KG9B 2E9WA 3ARFC 1QWNA 2DQJL 4GW5B 3L3IA 1O5PA 1MCRA 4HJ0D 1AD9B 1ZLSH 3BPOB 3ZRCC 3A4AA 5I6MA 4WJ5B 3GSVA 2OSWA 2GK0A 1XH3A 1FNFA 4KZCA 4PJ8B 1DSYA 1JV5B 4IOSA 3LNEA 5JOPE 4M9PA 1YMME 2J3SA 3QIBA 5FECB 3RWCA 3QO1B 2V4LA 1PEZA 4GRWF 3H9SB 3ZN6A 2V17L 1A2YA 1QACA 4C4KT 1PDKA 4QTIL 4JR9H 4UDTB 4UQEA 2PW2A 5DJCA 5F3BA 4RA0C 3QZLA 4XNYL 1MRDL 5CS7A 5CBAA 3JYCA 3VFPA 1NGXB 4YLBA 2JKWA 1FFNB 3WD5H 1BA9A 3WFBL 4YZFF 2DWSA 5D93B 4XB8A 1UOKA 2FH6A 1H3UA 3FQTB 4FXLA 3IKCB 3WNJA 5A2AA 2VUOA 2XT1B 1JG9A 1XCTB 1GGYA 3DECA 5GS1B 5C2BH 3AUWB 4AV4A 2QPDB 2MKLC 5F7EL 4PLJC 2AJXL 4Q0XH 4Z7UA 4P9HL 5EOQL 1TSHA 4GINA 1ZHNA 5EU7E 3RA7L 1QFOA 4PJIB 3BH4A 4XBGA 4H25B 4CUCA 3SDXF 2ZE0A 3VXQB 5DUML 3KNBB 3MV7B 2X4SB 3NSXA 1N6QH 1BFTA 4PJFF 4K3GA 5JLZA 5E8PB 2PYEA 1U41A 5DHVA 4LPTA 1UXSA 3ZKMD 2M83A 4DO6A 1PG7X 4LEEA 4PGZA 4NO2B 5GIRB 1MCWW 1U8OB 1D7BA 5MEND 3O0RL 1UURA 1X7QB 1HOCA 1QSFE 1MCPH 2YC1A 3PJLA 1CD1A 1MWAB 2ZXDA 3GSXA 3S5YA 5CEZD 2J8UF 2PYED 2J5LB 4OFDA 2R4SL 5E0QA 1NAKL 4G9FB 3WEMA 5CGYD 2W9LA 5FYJH 2O6CA 4F7PB 1KB5H 3HE6D 1T4WA 3D48R 3RGVA 1QFWM 3FUNA 1OAQH 4N6RA 1NFAA 2YGPA 2EDXA 4LCVA 3OPZH 3SN6N 4KI5E 5GZOC 2DWTA 3B5GA 4X4YB 2C7UB 2YOAA 2GG1A 2VR9A 1IC7L 3ALPA 3QNXA 1ITBB 3RGVD 3AM8A 2QR0A 3SKOB 1TTUA 4X6CE 4HFWA 1A7RH 4J23A 2QSQA 3V52L 1I82A 2E59A 1WFJA 3CN1A 3VH8A 2BC4A 3WXWL 4KAQL 3EGXA 4LLDA 2FQFA 5I1JH 4OT1H 3WEAA 5KTEH 3QI9C 3E3QC 4ONGL 3S4SG 3MCKB 1CGYA 4WHTA 4YFLF 2BSBA 1ZHKB 4J3UA 3NK3A 4URTB 2L0DA 4N2DA 1EJ8A 1HXMB 3MXWH 2MHAA 4DPCX 5IVNA 3QR0A 5F1IB 4NM4H 3OKLA 4KVNL 4QHLA 4XMTA 4CILA 2WXRA 3GRWL 1JGUH 3QGVA 3NACH 4U3HA 4K15A 3DWTA 1S6NA 4HAFA 5FKPA 4X0KB 5E9DA 3FZUD 4IU3B 5A2IH 3QQDA 4U7SA 5EUKB 1MCLA 2D9QB 4ZT1A 3ZRSA 4GG6E 4Z7NF 1QFWH 4HJ1A 4WTQA 1ADQH 2QMJA 5F71A 1RZ7L 2JKSA 4JG9A 4NHUB 1T7VA 3Q44A 1VPOL 3HMXH 1Y6NR 2XX0A 4JREC 2FO4A 2VQUA 3P4OB 2X9XA 3D69B 1P5UB 4LEOA 2WZPD 2X6AA 4P23A 5CD3B 1OM3H 2DDQH 4D0CA 3VI3A 4YDKH 1PIGA 4CAGA 3G5XB 3UTOA 3ZL4H 5IKCA 2A7BA 1Q90A 4CW1A 1B4RA 4GBXD 2XBZA 2MIZA 5GISH 4H8WL 2H8PB 4OD3L 3TBTA 2FBJH 3GKWH 4KKAC 5ICYB 2MRYA 1TVHA 5L8LB 3SOBL 3PL6C 3MRDB 1V7ML 5F1NA 3G04A 3APFA 3J8F7 1VA9A 4OZHB 4TYUA 2G5RA 2K45A 3WFDH 4JHUA 5TDNB 1T0MA 1XCQB 1IGMH 5J9PA 5DEFB 1FFOB 1A6WL 3UERA 1GAFH 4KQ4L 2VMDA 4JFDB 2ZUVA 3B7TA 3ARZA 2R2HB 2OYLA 3T04D 5E4EB 2J8OA 4ENZA 1OCWL 4HUMB 3RILA 3RPKA 1GYWA 5FC9A 1ZJAA 2ITEA 4NZJA 4WO0A 4LOVA 1PG7H 2CE6A 4FQIL 3MROA 2XVBA 3CH8A 4PGBA 5HHPB 5F0JB 3WJLC 1YEGL 2YUVA 1Y0LA 2YBRB 1J5OH 3GO1H 4Q6YA 4KKQA 2VLME 1Z0MA 1FP5A 1W2KT 1A7QL 1CG9A 2M26A 5TTRA 5I30L 3RFZA 3B43A 3WMSA 3Q9PA 1QBMH 4W6YB 5IWLA 3UTTE 3ETBJ 4OLXL 2VDMB 4LLWB 1PU0A 4W68A 1N67A 5IBLD 3K2KA 4G59C 3MV7D 2FE0A 4BFEA 4E9TA 2K6YA 5D7IA 4NI3A 4HC1L 3W5MA 4ZMPA 2DICA 2DQHH 3S36L 2BK8A 1YY9D 2GJ6B 4FG2A 5KSAA 3BEWB 4G7QB 2WLNA 2VZSA 3K72B 1MQKL 2HAZA 3ZE2B 4BKTC 1F6AA 4KDTC 4KRPB 3MACH 4OUUA 3VA6A 1JS4A 1QFWI 2P5WA 1S78D 4K5OA 1CGSH 1PZDA 2YPVL 1FYHB 1BVKB 4IOFC 4XMKL 5DZNA 5DD6A 2DMCA 4K94C 4CMMA 3WJJA 2A74B 2DQFA 2F19L 1YDPA 1WD8A 1DBMH 2ODHA 5KSAD 4LHJB 2E6QA 4M43L 1L5GA 3P2DA 3HZMA 5BRZD 4PJIE 1MCFA 3L3GB 2IAMC 4AYFA 2EP6A 1I8IB 5HHOD 3BFQG 4TNFA 3WIFB 1M9SA 1OWRM 3L9BA 4JFHE 1WBXB 2PP7A 4L0PB 5B4MD 2DLEA 3MA7A 4MJIB 3NFNA 3WE6A 3ZSSA 1T1ZB 1A7NL 1AZVA 1M71B 2VOTA 1XGYL 2BJMH 1EWHA 1RK0A 4MCZB 1BFSA 2DW5A 4HIHA 4NC1E 2VR4A 1KJ2L 2AEPL 1KYFA 3TEWA 4JE4B 4QKTA 25C8H 1WVZA 3MA7B 4PJGB 4PJGA 5T5FH 4JVPA 2Z92B 3INOA 2BVPA 3FFDA 4GG6A 2WVSA 2W95A 1UA6L 4Z8FH 2BIOA 1RK0B 3GMLB 4MCZA 1QX1A 6PCYA 1HZLA 5DHMC 3TJHC 1OPOA 1KBPA 1F90H 4YDJA 5IM7A 2VZTA 1J8KA 4PI2A 1G9NC 4W70A 2R27A 4FTDA 1OT2A 4KJWD 1L6ZA 2LFGA 4M02A 1SN0A 1TJHH 5AZEL 1G0YR 2V5MA 4AENB 4FEMA 2WUBH 4QHNB 2VWEE 2AP2A 3S2AA 1AH1A 2X9YA 5BXFB 3QORA 1MFUA 1W6LA 2JVUA 1U42A 5EO0A 2GITB 1CL7I 2ITCB 3IMRA 4F1SA 4E9RA 3ORJA 2L04A 3OB0K 4CMMB 5D7IB 4XWGL 2QQLH 5GQBA 4XCCH 3TN0B 2P8MA 5I8EA 4EE2A 1FYTD 1YNTF 3K8MA 1P6WA 4AQ1C 3GMLA 1NGWB 5KSAB 1AR1B 1LO5B 4UBDD 5CR8A 5IHLB 1YEKL 5BQDA 3IMWA 3V0GA 1X3DA 5J3HC 3MV8A 5EH1A 5J8OA 1HXKA 2EDYA 4GQPH 5E1GA 3V4LA 1BP3B 5CCGE 2CDEA 3IF1B 4KROD 2HSIA 3RX7A 4N3UA 5IF0A 2Y6TE 1NC4A 1SHMA 2H47C 5KSUA 1QVOB 3ZZSA 3QAZC 5AB9A 3GI9L 4TVPH 1M3IA 2F54D 3I9IA 2CAKA 3IDJB 3SGDI 2XTLA 4G1EB 4HOXA 4A2GA 3VRLF 4FFWD 3KYAA 4HWUA 3WKML 3KVDD 1MVUB 1N2RB 1XVSA 2GJ6E 2YGQA 2NY3D 2IH1A 1LWHA 4X5QA 1MRCH 4ADGA 2HT4C 4PJCB 2O5YL 3UC0L 3BIKA 4Y2DD 1RZJL 2B77A 3EADA 3ESUF 1P84J 3F58L 1EO8L 3FUMA 3PWVA 2P5WB 2PLTA 3KR3H 5F1NB 3EOYG 1E65A 1BBJA 1KCSL 2GFBA 2QDWA 4JHWH 3TV3L 5KYNA 5I74C 5J7CC 2GBTA 4JKLA 4LNRA 5I76A 4ICWA 5I1DB 3QRGH 4JKNA 3W11D 4ZOAA 5IESH 4GBXC 1BQSA 4PCYA 3QEHB 1UWGL 4Z7WA 3S98A 1P0SE 2WXQA 8FABA 1N68A 1UWYA 1AO7E 3U4KA 3VI3B 4D0CB 1BF8A 4OCSL 5G2NA 4FGMA 2RIKA 3U46B 2ZOWA 4TS6A 1P5UA 2VDOH 2EYSA 3DUSB 2FO4B 5KYYA 1BX2A 2EDQA 2GT9B 2XOTA 1ZVSB 1SFHA 1UFUA 3HBPA 4TNGA 4S11A 1JGIA 1S7TB 3KPRB 3U2IA 1A9EB 1YSOA 1FSKC 3NIFE 2OJEB 3LIZA 4LF3A 4RISL 5F9WC 1FIGL 1D5BB 5AENA 1PQZB 1KWGA 3C09C 5HDLA 2NY6B 4BCZA 4IBSA 2O5YH 2AERT 4AVIA 2RAMA 2IH3A 5I1IL 5AW1B 2G2PA 4LPWA 2X2HA 3WIHA 4KMLB 4QOKB 2HT2C 3BE1L 3ZKXB 5HGAB 4WTWA 2R2HA 3BUIA 3KS0H 5I5MA 1MREH 3BDBA 2COQA 4P07A 1MFBL 4IW4C 5EUKA 4G6AD 3FUEA 3CHPA 4UAOC 3T0EB 5FKPB 1E3ZA 3D0LB 2VN5A 5KBLA 3S37L 2VKXA 1NCNA 3A22A 1KIRA 2I26N 2D7TL 3VG0H 4B5ZA 2YR3A 5D7SL 2QQLL 4ZUSA 2MHAB 2NT1A 3LS5L 1YPZE 3VH8B 2F7IA 3A4FA 1TETH 2NYZA 3CVIL 1TTBA 4EI0A 3NPSB 2A5UA 1JDAA 4ODXB 4OGXH 2J73A 2CHWA 5IUSA 1QPXA 3JWNE 1VERA 2ZJSH 2L7QA 1P2CB 1RUPL 3E6FA 3NAAH 4Y1AE 5E5LA 1UKQA 1BGXL 2WQ8A 3OR6B 1YECL 3FSVA 1TLKA 4W9EC 4LIQE 2JK5B 4HXBH 5DU7A 4JM2F 5EU7C 1N64L 2EDDA 3AS2A 3VWKC 1S8DB 3K7UA 3BP7B 2CRYA 4P23C 1RUQL 5I0WA 1CD1B 1MWAA 3GSXB 1UWEH 1KXVA 3B56A 3VYPA 5I18L 1KSRA 3U0TB 3CHSA 4OJCA 4YSQA 1CFVH 5E8PA 1FV1A 3I6GA 2X3BA 2AJVH 2TAAA 1E3XA 2BM3A 4GW1B 4WW1A 4ODHL 1MRFL 4XAWL 2NY6C 2XQ0A 4YBLB 1D6VL 2FJHA 5A1AA 2YD1A 1MFMA 3K2IA 4I0PD 2YFNA 5DUBA 3QHFH 1ZHBB 5JPNA 1WEJL 4WFEE 3ISRA 3RWJA 1Z5YD 2HLFD 1XL6A 4MASA 2PYEB 3PAZA 3CSFA 1I8LA 5KSVA 1YNTA 2AXFB 4PJXE 4ZMNA 3VSTA 3F7KA 1WGVA 1WQVT 2ZKMX 5HHMD 3KBPA 1T0OA 2BW4A 4RRPA 1A6TB 2JLPA 3BCDA 4PYHA 4ODVH 2NT0A 2H0JA 3VXQA 2Z8RA 3EKCA 4U1GB 5EZIL 1ZWIA 1VADB 2VM9A 1E2VA 4A7QA 4ZMWA 4P57B 3APNA 4FQQA 4L23A 5FGBC 3D08A 4NQCB 3ZMEA 2BO0A 3RI5K 4X80L 2Y36L 3LOWA 3PWUA 4MQXD 1S7UA 5JNYA 1HTYA 1VZGA 1CWVA 2CUMA 4XNUL 2ILLA 3TBWB 5JW4Q 1DDHA 5GS0L 2JCCB 3H1ZA 1CZ8L 4UT6A 4N6RB 2V2XB 4JJ5B 5F3BB 4HJGB 2E7LC 3AM8C 3L95B 2F1AA 1G84A 1BLNA 5M95B 5B3JF 2QT6A 2ETWA 1GA2A 3N3EA 3P54A 3LHAA 3MOQA 3FTUA 2ZP8A 2WW8A 4JFFA 1E4XH 1HOCB