1LYQA

Crystal structure of pcoc, a methionine rich copper resistance protein from escherichia coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
101
Chain Sequence
b'AHPELKSSVPQADSAVAAPEKIQLNFSENLTVKFSGAKLTMTGMKSHSPMPVAAKVAPGADPKSMVIIPREPLPAGTYRVDWRAVSSDTHPITGNYTFTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcoC copper resistance protein
publication title Crystal structure and dimerization equilibria of PcoC, a methionine-rich copper resistance protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 18
structure length 101
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1lyqA00
4CC4C 1O6VA 2OMTA 2OMZA 3BCFA 2OMWA 1OT4A 1H6TA 1IX2A 3FAWA 2WQWA 2UZXA 3BC9A 2WQVA 2C9RA 2C9PA 1O6TA 5ICUA 4CC4A 1LYQA 1M42A 4AW4A 1H6UA 4AQ1A 1M9SA 3BCDA 2OMYA 2UZYA 1XEUA 2C9QA 2WQUA 3FAXA 2YA1A 2OMUA 1O6SA 2OMVA 2Y5QA 1NM4A 4CILA 2OMXA 3BZ5A 2WQXA 2RA1A
chains in the Genus database with same CATH superfamily
4UNIA 3U2IA 4A6YH 2O6CA 1R4XA 1JF1A 2HKFL 4Q6KA 4NQSA 4NXKA 4LLDB 1QUNA 4JFFB 5HDBE 4WW2A 5DD0H 2JB6B 3MOAL 5DK2B 1BA9A 2VXQH 5DUMH 3KYAA 2UY6A 4YHNB 1E5AA 1YC8A 2AABL 4DK6A 3F6LA 3OMAB 3OLDA 3F7RA 5LGKA 2BJML 2GSGB 1QFPA 3BZ4A 5IGXL 3P11H 4CSSA 4KFZC 1WUNT 4ORGA 2VQ4A 3DJTA 4WSJA 4YXKL 5EZIL 3UCRA 1GY2A 3UJIH 4EBQH 1EEYA 1FWXA 5BOZG 2J88L 4PCYA 2QBWA 2XU9A 1KTLA 3PREA 4H26B 2BFVH 5ADPH 5CEYB 3JWNH 3MNVB 5CLXA 4M4PA 1IO4C 5FAAA 1CBJA 2C26A 2J4WL 4C4KO 3HAEA 3VXSE 3OSVA 1R9FA 1AHKA 5ID1A 1OL0A 2DI9A 2B3IA 2CLRA 4XN4A 4GW4A 4GW1B 4YXHL 2GEQA 2OX5A 1JVKA 1N7ML 4I88A 4XXCA 4ZO7A 3MA7B 1MAJA 2W9EH 2E7HA 5F9OL 2GJJA 3DUUA 4PJHA 3NCEB 3ML8A 5TDOA 3B83A 3S3CB 3G5WA 3K2UL 2UWEA 4I48A 1KYDA 5KYWB 2NR6A 3ZT6A 3P2DA 3MRQB 1BQLH 1RIVH 1X5IA 3EBAA 5CFHA 2BNUB 4TL5A 1UGNA 1U3HC 3BDYH 1UASA 4HSCX 1QLRB 3OM3B 3QQNA 4X6CB 4AGOA 2ZKWA 5B4MC 4FE9A 2HB0A 1FNSH 3WYRA 2FB4L 3N85H 1TDQA 4TVPE 3DOSB 1UD3A 2X89A 4PVLA 5HHMD 3N42B 5IJVB 1ZTXL 4PJ5E 1WAAE 4MMZB 4MMZC 3M17B 4JEGB 4NI6A 3RU8L 1MDTA 1FCCA 2ENSA 3JYCA 5L6YH 2G4GA 3G9AB 4DO4A 3T4AB 5M7QA 3QZWB 5GGRY 3T4AC 1U4FA 2O6DA 4WEBH 4G8EB 2BSSA 5DUPL 5LKNA 3QPXL 1UUSA 1UA7A 5DRXA 3NK4A 1ZHNB 4BFOA 4ISVA 3ZLQC 3LHPH 4LDCA 1WK0A 2YEZA 3O45A 3MLWH 1NCBH 3CMOL 1U8LA 1LE9B 3CDFA 3FULA 3TCXA 3NP4A 2K9UA 1R3JA 4MQ7B 3QXUA 4QLWA 5IB5A 1Z9SB 2FO4B 3UTZA 5I8CB 3DSNA 3QJHB 1YEWA 3DROA 2J7LA 3CPLA 3G6JF 2H1XA 2OSLA 3QDMD 4GMTH 2ICEB 2ICEC 3DXAE 1F3JB 4HIJA 4Z6AT 2AJSH 5F89B 3UTTB 1DBML 5EV7A 2EE6A 4PJBF 1LDSA 2QR0A 3NSXA 1P7HL 4XB3A 4P5KA 3KLLA 3CC5B 4UIKL 3ESMA 1JMZA 3Q3GA 3HCVB 5DD3H 3L3GA 3FQRB 4MA1B 4MA1C 3R8BB 4QTFA 3TBCA 1E0OB 4GKLA 2Y1AA 1MQ8A 3F12A 4GKSB 4DPCX 4H8PA 4QRAA 4PJCE 3IFLL 8FABB 1BFOB 4NIKB 3O2WH 1SQ2N 1MFBL 2AF2A 4KUZL 4YR6B 2OMYB 2AXGA 4UQ9A 3U0WL 4UI2A 1TSHA 3DJSA 1AFVL 1AXSA 3BC9A 4NUJA 5I0XA 1BLNA 1WJ3A 2E7BA 1D5MB 2ARJA 5EU3B 2DQEH 1U6AH 3FTYA 2XPGB 3HBZA 2DKMA 3EO9L 4N0RA 3BGFB 1MFDH 4I0PA 4KK9C 1TETH 2MPAH 1XXDC 5E00B 1OF0A 2VLRA 4U49A 1BLIA 2JIXA 3DBXB 3OLEA 3EZ8A 5DQJA 4DGIL 1C7TA 1WHOA 4XAWL 5DYOB 4NO5A 1P7BA 3AGVA 2XG4A 3DURA 3L9EA 4Z7AA 4BDVA 1IC4L 2WO2B 3O4LE 3RKDD 2QZ5A 2X53A 4E2OA 2X4PB 1UYWL 1SLWA 5DD5H 1MOEA 1NAKL 2NT1A 2AJYH 1MF2H 2HT3D 5MEPB 2UV3A 1SYVB 4KXAA 2G2RA 3D25A 5I24A 1YEFH 1FVDA 4RDBA 2G0KA 1U8MB 4K3EL 3W11C 1XGPB 4Y1AD 4HX1A 1ZHKA 2EIJB 3N5AA 3P3RA 4IU2A 2HLAA 2HG5B 3X17A 4HZLA 3LKOB 4RFEB 4TNWK 1OAYL 1WYJA 3JZ7A 3N1FC 5ABAA 5LGYA 4QRQB 4KZDH 3QDAA 3QGVA 1YMME 3DTDA 5JTWA 2HTLC 4MGXA 2OMNA 2ORBH 1KLUB 4RBPK 2P52A 2Y7MA 3MV9E 4OCLC 1QWUA 3GS7A 4KI1A 5I28A 1LWRA 3CPUA 3NFSL 1BAGA 1P5VA 1OB0A 2VR6A 4IYKA 4GBXA 3D39B 4QTHA 1EUTA 5GZNA 3K6IA 3HKFA 3HG4A 5DXWA 4WIQA 1WE5A 5K9JH 1KIQA 1QUPA 5KVGH 2R0LH 5KTEH 4GH7B 1S2EA 5PCYA 5J7CC 2Z7WA 4NC1E 2YAOA 2YD3A 2YD5A 4HFUL 2PYFB 2GAZB 4UF7C 4PG9B 3CCHB 3MZGB 5IB3B 2IMNA 2VIRA 3RIAK 3HE7B 5DJDB 3HE7C 4OF0A 4X42A 3WTWA 3QUXA 3FU8A 4ICWA 3WUZA 1PNDA 4IRJB 2YFNA 3B34A 4IRJC 2ZCZA 4ANWA 4GRMA 3OKOA 4OCRH 2E75C 4JGNA 4R5VA 4NWUL 2GIMA 1SJEB 4YE4L 2JKXA 4RDQF 3KPRD 2PWFA 3KLSA 2FYYA 4KMTL 5D7KE 5I23A 2EIZB 1XHHA 4D2NA 2EVFA 1UB5B 3ALPA 1R5WB 4IMLA 1BPLB 2D7OA 1GGCH 3KPSA 4M8VA 3VG9B 5CM1A 3VG9C 4MAYA 5A2CA 5HGHA 1GIGL 4JMNA 3QUGA 2X44D 1NCHA 4HJGB 3Q6GH 3CZNA 4ETQB 1V27A 4IKNA 3ZQXA 4LDEB 4AENA 4KOBA 4OD3L 5I8KH 2CRMA 2WLLB 1TVHB 5JLZB 1PYWB 2GTQA 4Y19A 1QRNE 4K5PA 4IQHA 4UIMB 3T0EE 5KBPA 2WWKT 3TVMD 5LGJB 1LK3H 1KTCA 3KPLA 4XBGA 2X0VA 4I4WB 1WFUA 5K59F 1OP9A 4XTRC 2F58L 2FQGA 5DS2A 1R17A 2CLVB 4JQIH 4JKMA 3VGHA 5C8JB 1UM6H 4HPHA 3MLYL 3KH3A 4XO3A 1ZKAA 1U8OB 4AMXA 3C2AH 2D7PA 5JXAH 4LSUH 4K8RD 4N8UA 4KTDL 1HYRC 4YO0A 1RXLA 3SO3B 1L7TH 4HWEH 2R0ZH 3SO3C 1BD2E 35C8H 1OO2A 4XCFL 4YSOA 2NUTB 4I3RL 5IFHL 5KSBA 5EF0A 2P24B 4PI0A 3OG6B 2OL3L 3RFZB 2BDNH 1FZKA 3RFZC 1ODUA 1MFAH 4KAQL 5DURB 2QQNL 1XIWD 4A6YA 2FJFA 1QHQA 5M95B 4XB8A 5C7XH 5L9DH 2X3AA 1MJ8H 3SDYH 2G5UA 4G6MH 5MERB 4UQEA 2X4SB 1OW0C 1AG6A 4BCZA 2VXQA 4Z1PA 3RDTB 4JL1A 2UYLB 4H25B 5FKPB 3TN0D 5J13B 4MVBC 3ULSA 3GIVA 1UB6B 4GG8B 3US9A 5EIIA 2FL5A 2A74A 2NCEA 2QLYA 1VENA 1E4JA 4JPIB 1GZHA 1MQKH 4DVRL 4FYQA 4UDUA 2C9QA 3FZUD 3X14A 4OGXH 2JNZA 5J1TC 2H3XC 4ZUUA 3BEWA 5EA0H 2G5BA 4MXQC 3T2PA 3RY6A 4AQOA 1SXAA 3TTSA 4XN7A 4TRPL 3J27A 2ATPB 3AXHA 2ZOKA 3BVNB 5J1AA 4AV0A 5L0QB 5L0QC 3DJZA 4AE0A 1NIAA 2ZWKA 4H8QA 1X9RA 5T1MA 1ZVYA 3KPTA 1RHHB 4Q9CA 2AEPL 1VKXA 4UZUA 5C9JA 2NRDA 1RZQA 3ULAB 1ZSDB 2QVKA 1PVHA 1DJZA 1KCSL 4GEIA 2E9GA 3MN8A 5GSRB 1DVQA 4L29B 2EACA 2FSEB 3BN9D 2WWOA 4LSPH 4MRCA 2NZ9C 2K70A 2WN2A 4LBEA 3UEZA 2X1PA 1BVLB 2QFRA 2DIJA 5FUCE 3FONB 1YG9A 4G59C 4EN3A 2ZYIA 5ECJE 3MI6A 1C5CH 1OPGL 4KTYA 1JI1A 3AQYA 3EZJB 5E2WH 3NUKA 3SBQA 4JRYD 2NYKA 1J9QA 1QQDA 1QPXA 2XN9E 4DP6X 3B2PA 2PO6D 3AC0A 3VXME 2Z4QA 2BOLA 4RSYA 3NN8B 2YHGA 5F7WC 2DQGH 4A39A 3LQMA 5IFJB 1KNOB 2H1PH 1T3FA 3L3IB 3GIZL 5EZOL 3NIFE 2Y0SA 1HINH 2JKRM 3GC3A 5CZVH 4J6RL 1IGCH 2YPLD 2IDFA 4OZHE 4U1HA 2F74A 3UDWC 5DR5H 1A9EB 3CLEL 4G6KH 3BIKB 1BXVA 1FG2A 1N26A 1CLCA 5D1ZB 3RWDA 2KUTA 4U6XB 1S5HB 3RWFA 1D5IH 3JTTB 3VXPB 5AAWA 3NZUA 2JLPA 4S1RH 1E9PA 4IIZA 5BRPA 3WI9A 1MCEA 3LN5A 4EEEA 2BP0A 4QOKD 4F9PC 1KGUA 1H15B 3Q8FA 15C8H 2Y25A 3D0VA 3NCMA 1DSWA 4RMRA 1J8RA 3VXUE 5HYQB 5I1EH 2Z7ZA 3WAKA 5KUKA 4DPAX 3WIFA 3IPEA 3ULUE 4ZPTB 3C60D 1D5ZA 4P23A 2VXVH 4BYHA 2MTPA 1M53A 1SF3A 4OZIA 4AQ1A 3ASOB 2E56A 1F0LA 2YIHA 4MNGE 1T5WA 3HRZB 3AXLA 2NY6C 3HRZC 1INQB 1A9BA 1NINA 3D9AL 5DJZA 3WLWD 4YDJB 1NCWL 3PP3K 3NIGF 3VH8G 5JMRA 1GZPA 1L7IH 1U0QA 1CFTA 2LT9A 2Q86A 3BPCB 4Y2DB 4Y2DC 3RVTD 3QIWA 1KJMB 3L4ZA 4NSKA 1Q0XL 2PPFA 5E1GA 5IJKC 4URKA 1HQ4B 2UXGA 1PSKL 3V0WH 1G1CA 3S4SG 3INUL 4FQLH 3TO2B 2XWJA 4NQEB 4LHUA 5HHNA 3LZFH 4G8GE 4APXB 5CJOH 5BRZE 3MUGB 3VSQA 2YSTA 1C5DA 2XX1A 2Q6WA 2XWZA 3FAXA 4JFHD 3QDGB 4Z23A 5EF1A 1NGXB 5K9OA 1G9ML 3V4UH 4HLEA 4WFED 2OYPA 2Q3AA 4ZTOH 2RCSL 2IAMA 4R90H 2K8QA 3QXAB 5T3XL 4WK2B 1L5GB 2IH1B 1QSFB 3ZK0A 3PV6B 1H9VA 3SE6A 1NKOA 4UTCA 3DMMA 2H41A 1QFWI 4QNPF 4M6OH 4GFTB 1YEHH 4G43A 3CU7A 3NA9L 4U1KB 4AQAA 4APQD 2NYYD 4IKJA 2H6PA 3FO9A 3ZW3A 2WKOA 3LJ3A 4QI3A 2EABA 1VRSA 5DZ9A 3ARZA 3S36H 4HT1H 4BQ8A 5EO0B 1CU4H 3WIIL 2R0KL 3IJSB 2X7LA 2F5AH 5CCGE 3D85A 1FGNL 2R15A 4FNSA 1BV8A 1RZGA 2L7QA 3GSUA 3IK2A 4NWTL 5IB4B 2JK5B 4PB0H 1EHXA 5B21A 1ILSA 2MIZA 5ISZE 3GZOA 3GBMH 1JG9A 1IFHH 1O75A 1IKFL 2IVFC 3NCWA 3QNYB 1YC7A 1I9IL 3VVVA 2WUBH 3VI3B 5AOKA 4Z0BH 1T7ZA 2BLFA 3O8XB 1F11B 4JFDD 3O8XC 4OU3A 4Z3GA 4AJWA 5KANG 4BZ1H 2ICWJ 1A5FH 4JG0L 2YA1A 4P9HL 4XCCL 4PU2A 5DJ2B 4JM2F 2DRUA 5LNDA 2AQRA 5L2KD 2NSQA 4EOWH 1GYWA 4IHOB 4TUJA 3D51A 5AKSA 2YPVL 4ZUVA 3A6OA 3RILA 3DO7A 2J8OA 3IS0X 5JORA 2FSDA 1BCIA 5EDXA 1XF3B 2H4EA 2WZPD 3HHMA 1AP2A 2VDNL 2VL5A 3TNMB 2N4IA 1T89A 1OD7A 3ARBD 4XGZB 3NSDA 1TQWA 4CU8A 3D2UA 4XWOD 1LO3L 4X80L 1TCRB 7CGTA 3AWEA 2WAHA 1SDDB 1HIMH 1PJ9A 3O41A 1TYRA 4ZYKB 2OMTA 5JR1H 2HJFB 3VFUA 4YHLL 1TFHA 2N59A 1T7WA 3MUZ1 3HE6D 2QFPA 4MQTB 4Z95L 1AIFB 5SWZA 2ADFH 3SQOL 4V1DE 3SJVB 4HXBH 4GAFB 1X3DA 4FQXA 3FQWB 5EC2B 5IROC 4E5XA 2VSCA 3FXIC 1ZLVK 4HWZB 4GI8A 1OAQH 3FT4B 5TTRA 4AM0Q 1K3ZA 2HUEA 4HBQA 4HD9A 3GXDA 1VFBB 3IDNB 2P5WB 5EU6E 1EWHA 1SOQA 3HFML 1WO2A 5FW8A 3VA2C 1YY9D 4MHHI 4B7LA 1TQCB 2BSCA 3L4CA 1TQCC 4ODWB 5IESL 4KKBD 2ESVA 2WBJA 4JMXA 3NH7L 4ZTPH 4OIBA 1SMDA 2GG1A 4JQIA 2WVUA 5GGTH 2OJZH 3TBWB 3S37H 1TQTA 3I6KA 5GISL 2W95A 4HEPA 3W2DL 1AH1A 3TJHC 5JYMA 1VA9A 4O2EB 2WBKA 3QFJD 5J4MA 1ZSHA 1FGVH 3ESVF 4FXKA 4MA7L 2AJXL 3Q1SH 4I89A 3PWPA 4O2FA 43CAB 2IOMA 3LEYH 4L4VD 3MJ7B 4OSUH 3KW8A 1JGLH 4LLDA 4JFFA 2IBZY 3P69A 4HMEA 4TQPA 3P77B 2XXMB 5DK2A 3FCBA 4YHNA 2AP2A 4HWBL 3RWGB 3MOAH 4XRCB 5FW7A 4HJJL 3LIZL 3EBGA 2DQMA 1N64L 2ICCA 3Q5YA 5DZAA 5T1LD 2BJMH 4OFPA 3IMSA 4P2RE 5IG7B 3QUZD 3K46A 3L54A 3QULB 5IGXH 4HHWA 3GTVA 4RGOL 4R4ND 2PPCA 4MJ4A 5E1QA 3DXAB 3PFUA 4H26A 4YXKH 2AS5M 4KKAD 1RUML 5CEYA 3L48A 2J88H 3MNVA 3RB7A 4AYID 4YHPB 1JMXA 1R5VB 4PRBB 4G7YL 3JTBA 1G0YR 1FLRL 2J4WH 3MODL 4GW1A 2COQA 1I7RB 3HN5A 4JHZA 3LKRB 4O4YL 3VTTA 4YVUA 1YEKL 2XZAL 1DL7L 1U2CA 3MA7A 4JRXE 1CDYA 5TFSH 3VI4F 4KRLB 4PY8I 4YXHH 1N7MH 5F9OH 4L4TD 1T6WA 3MRQA 2HA1A 3BWSA 2LU4A 4P4KD 3K2UH 5DI8B 4WUUE 2BNUA 3B6SB 2XACC 2GW5A 3ARDB 1MCOL 3ARDC 3DI2B 4WV1B 1CFNB 4WV1C 1QLRA 1YQ2A 4X6CA 1F4WL 3O0LA 2HRGA 1K4DB 4F2FA 3SDXE 4Z5RB 1GMEA 3DOSA 1FZOB 2J71A 5IJVA 4MMZA 4NZUL 2FB4H 3M17A 3BT2L 3WY1A 3PL6C 2P80A 3WGVB 4MMXC 4L0PB 3JV4B 1BIIB 5D55A 1YUKB 3CSBA 3RU8H 3T4AA 3QZWA 3FOMB 3WKMH 3X11B 4G8EA 3HMXL 3MRIB 1ET7A 3MO1B 4OB5L 4F2ME 3F6IA 1ZHBB 4DQOL 4WHCA 1TZGL 3LDBB 1ZHNA 5DUPH 3LDBC 1A02N 3RVUD 4FFZH 3QPXH 2VC2L 2Z8VC 3K72B 5SWSB 4ZMVA 4G11A 4ZW3A 2DMCA 1LE9A 1NSNL 5D1ZI 4F37F 1FI8C 2XKNB 5T1KB 4MQ7A 3CMOH 1DQJB 1Z9SA 4N6QA 2FO4A 4KDWA 5LWYH 1SJMA 1A6WL 2YD1A 3QC5X 4NQDD 3FSAA 2R0WL 5I8CA 1JPGB 4NPJA 4Y9BA 3WJMB 3QJHA 1IZJA 4HPYH 4HA1A 4C47A 4DEPB 4OY9A 4BZ2A 5TDPB 4EI6B 3B7SA 3R1GL 4XMZA 2ICEA 3KPRE 4JHWH 1F3JA 4QRPB 1RFDL 5F89A 5TDNB 4OZ4B 1K6QH 3T9WA 3UTTA 2XVLA 1SUHA 1SF5A 2LAAA 2B1AL 3D34A 1VCAA 2BSRB 3RGBA 1JZDC 3U0TB 1J5OL 3MMEB 4KK8D 5SX5K 1DBMH 4P8QA 1UEYA 3CC5A 1UT9A 3N41B 3QZMA 4WW2F 3A21A 4XAKE 5K5YA 5K9QI 3BYTA 4BWTA 1U95B 3HCVA 4XNDA 3FQRA 4DP4X 1DQLL 4PTTB 3MJ9L 1OT2A 4UIKH 3C5ZD 3T09A 5F2FA 2Y06L 4GKSA 5E95B 2I7SA 8FABA 1BFOA 1UA3A 4YR6A 1XZWA 3EYFB 2OMYA 4JDZB 3IFLH 5CLTA 3VQLA 3VMOA 1AMXA 3FKUS 4ACTA 1O7DE 1J5DA 1ETA1 1D5MA 2E9WA 4LCCC 4LMQI 5EU3A 2A3TA 3C8DA 4MCYB 3U0WH 1NANH 2XPGA 1AFVH 4N8VB 3P4OB 3GMPB 4PB9L 1DQDL 3C8KB 4ZPVB 2GJ6B 3DVGB 1MW0A 3TH4T 5E00A 4U6YB 1FYHB 1RJYB 1JPSH 5LHDA 2IWFA 3CXFA 3DBXA 4X7FC 5K1VA 5HXMA 4X5PA 5BVPL 5DYOA 1XTMA 2JI1A 4Z7UB 4PJHF 5ANHA 4AXWB 3V8OA 4DGIH 2X4PA 4ENZA 2R1WB 4XN2A 2IGLA 4PD4J 1IC4H 2EDBA 2XQYK 4ENED 1PMYA 3BUPA 5MEPA 2ADIB 4KKLD 1KBBA 1SYVA 3ZE0B 1I8IB 1TZHB 1UYWH 3DIVA 1G9MC 1G87A 1ZRUA 5FHAL 1URIA 3VU1A 1CGSL 1U8MA 1XGPA 5C0CE 1G7LB 4WWOA 3FC8A 1M9WA 2ED9A 4TF4A 2MEJB 2HG5A 2YUVA 2E6QA 3LKOA 4RFEA 1J8HB 4QRQA 2VE6B 5T8IA 3IETB 1CR9L 2FWOB 5DJXB 2AK4D 2OMWB 1XH0A 1KLUA 1OAYH 4GO8A 1CFQB 1YJDC 2VERN 5JHDD 3WE6B 3VCLA 2ATKB 3GTNA 1NC4B 4M02A 1RKRA 3U4BL 4TUOB 3MCLL 3AMLA 3U30C 4LCWD 2PW1B 3OV6A 1IKNC 3D39A 3NFSH 3D48R 2AMUA 3EIFA 3ZDZB 5AFAA 2FECL 3AQZA 4LSDA 4PJIE 3DTUB 2V5RA 4Q58C 2NT0A 1VF5C 3EBHA 1EAJA 4ZFOL 2F1AA 3BIAX 1LWHA 3GBEA 3QJUB 2PYFA 2GAZA 1SUJA 1VFOA 2YXFA 4PG9A 2UZIL 3CCHA 5AVZB 5IB3A 2CDEB 3I2CL 3HE7A 5DJDA 3NZHH 4HFUH 1O7SA 3WTYA 4IRJA 3QAZB 1BXAA 3A4DA 3QAZC 4QO1B 1E2ZA 4P9HC 5F7AA 5C0AB 1SJEA 3U7YH 4IBUA 3CN0A 3DTXB 1HL4A 4MJIE 3BUQA 4NWUH 2EIZA 3OAZK 4YE4H 2DQIH 2C1OB 5ACLA 1GPOL 3V4PL 1UB5A 3AG2B 3OWRA 1R5WA 3K6OA 3O3AB 2VDNB 4LOEA 1DTUA 1TTAA 2EDXA 2R51A 1Z0NA 2VGLM 3NAAL 2DKUA 4HJGA 4ETQA 3I6GB 1GIGH 4N2MA 4H1LG 2WP3O 2WLLA 1TVHA 5JLZA 2XBDA 1PYWA 2OW6A 1SLVA 2ZF8A 4X4XB 4OD3H 4UIMA 4V2BA 1QTSA 4OFDA 4PGEB 3RGHA 3QIBB 5LGJA 3QIBC 3W56A 1PKQB 2N0MA 4ZW5A 3FAWA 4DKAA 1P1VA 1TEYA 3CD4A 4I4WA 5J9PB 1BYOA 3GSOB 4E9QA 1MW1A 4OF5A 1EA9C 1NICA 4LRNL 2VITB 5B8CB 1RMFL 3EJPA 5B8CC 2CLVA 3VD4A 2X38A 4LE8A 5C8JA 5E4AA 4NM8H 1U8PB 3E9TA 2CBTA 2F58H 1UT1A 1U8OA 4XBPB 2N7BA 3T3PF 3O11B 2IPKB 3MLYH 2DBLL 2EDHA 1LO2L 4WFGD 4RMTA 1E2WA 5AAPA 3T8VA 2NUTA 4WHTB 3RRQA 5I76B 1TR7A 2P24A 3L4XA 3RFZA 5FLUA 2JJUA 5IFHH 4YSTA 3UBGA 4EZKA 1E65A 2OXGB 3A67L 1N9PA 4FKEA 3LXAA 2BNQD 1F1AA 2B14A 1KG0B 4KAQH 4KI5E 3MXWL 2QQNH 3OKNB 4WUKL 5DJAB 3ZMEA 4AEHL 5B39B 5D4HA 3O6ML 5MERA 1F8TL 1OW0A 1QFWM 1ZT4B 2NNCA 2X4SA 3FHEA 3J2PA 6PAZA 5TF0A 3RDTA 4GYBA 1YLBB 2UYLA 1QACA 1BVNT 4EI0A 4H25A 5FKPA 3Q0HA 1UB6A 4GG8A 2COVD 4Y8DC 3LRMA 4JPIA 3OJDB 1GHFL 3LV3B 4FLQA 4YLBA 1CF8L 2J1YA 4YWGL 2R69L 2LU5A 1G0DA 3TNNB 2JKJA 5E8PB 3DVIA 4KKCD 4DVRH 2C9PA 2HLFD 1Q1PA 5DFTA 3QDJB 4AMWA 2EE3A 5BQ7B 1WA2X 2ATPA 3BVNA 5JXEC 4LIQE 1RQ5A 4OF6A 5H94B 3T0AA 1BG9A 4TRPH 1WF5A 1EAQA 1Z9NA 3LCYA 1RHHA 2X4UB 3OWEA 2QVFB 2XJLA 4PUBL 3CHOA 5F96L 1MVFA 1ZSDA 2IWEA 5BO1L 1MW2A 4JY6B 1PPIA 2AEPH 5IBTL 3ZYIA 3QZBA 3HC2A 5BO0D 5GSRA 4L29A 4AX3A 5FLVA 2FSEA 3H3KA 2Q3ZA 3ZYZA 3LPWA 1M57B 3FT0A 3MDJA 4WNJA 1UH4A 5AWNL 3UPRB 4K8RL 2NXZB 5EOCL 1BVLA 2NXZC 3HC4L 4GP8B 4LSQL 4MNQD 3T2OA 3APNA 1YAIA 1RZJC 5FUOH 3FONA 3HS9A 3BPNB 4GXVL 3ZOAA 2ZNXA 3BPNC 2GBTA 1PG7L 1PY4A 4LZKA 3V0IA 3FO2B 5FHBL 3ARFD 2ZAHA 1OPGH 4EPSA 4YDKL 4W93A 5CP7B 3NJKA 1RPQA 1X5LA 4B9IA 3NN8A 5EN2A 3AADB 3OZ9L 3G6AB 3N04A 2MNWA 5IFJA 1KNOA 3BAXA 3L3IA 4OCYH 1JYNA 4ICXA 5E4OA 3T8XB 2Y7NA 4FFZA 3GIZH 5EZOH 1TZIB 1MRFH 4HGKC 4H7VA 4H0IA 2DWXA 2VC2B 2YD2A 1GSMA 3MRCB 1A9EA 4J4PD 2WNXA 3ECQA 3BIKA 3TBYB 4HEMA 4B50A 5D1ZA 2CXGA 4HWUA 2RAMA 4U6XA 1S5HA 1GOFA 3JTTA 1U4EA 3CLEH 3VXPA 3KMDA 2BY2A 2F15A 1S78C 4BFGA 3OKKB 3D06A 4KVCL 1NEUA 4RAVB 1A47A 5KSBF 4XPHL 4YBQD 1H15A 4V11A 3EJYD 3ARQA 1CL7I 4X5XB 4MD4B 5HYQA 2X12A 2ZPKL 4AEIL 1S46A 4ZPTA 3MLXH 2QQLH 4YK4B 1LILA 2NX5B 2WPGA 4YK4C 3KHOA 4NBYB 4JY4B 1H6TA 2NLJB 5E6ID 3HRZA 4H88L 2QMJA 4IOSD 3GSRB 4AYMC 4DEWA 1INQA 4YDJA 1X9QA 3C5SB 3W1ZA 3BPCA 4Y2DA 4CGTA 4HBCL 1R3HB 3D9AH 3PY9A 3LPFA 1KJMA 1IT9L 2GEEA 4Y4FD 2XV6B 5EUKB 3ZDXE 4LKXB 1MAKA 2CGZA 3JV0A 1KMGA 4QHPA 1JVLA 1HQ4A 5CD3B 3VXRE 2M26A 5HHMB 1Q0XH 3ZT5A 3TO2A 3HI1B 1TJXA 4Z7WE 4NQEA 1KGYE 2VLJD 4APXA 4O5LL 1CLZL 1PSKH 1IJ9A 1FNEB 1IBHA 3MUGA 1KGCD 1KDJA 3GUFA 4J3TA 4WENB 3KBHE 1E28B 1NUGA 4KRNA 3AWGA 1J1XH 4U6VL 1IGFL 3QDGA 1NGXA 2PPEA 4PJFF 4PN6A 4YSEA 1LP9E 5DMKB 3JXAA 4ODUA 1T21B 2ZG2A 3QXAA 3ZQ9A 1L5GA 1G9MH 2IH1A 1QSFA 1KY7A 3L95B 3PV6A 2RCSH 1AI1H 4N0YH 2P8PB 5T3XH 4DKEH 3PAUA 5E9DE 3P2BA 5C3TA 1NM9A 2IIJA 4PD4K 4KQ0A 1ZV2A 1WFTA 4CAGA 4JPVL 4GEJA 4U1KA 5IK3B 3APFA 3LTVA 1RUAL 2FWSA 3NIDB 3D12B 3HPLB 4PJ7E 3QFDB 3NA9H 4K2UH 5CEXB 1RAMA 1YJDH 2O93L 4MD5B 5A2FA 5EO0A 4ELMB 3G5XB 3IJSA 4HGMA 2Y2WA 4L1HA 5AAMC 3LZRA 2JELL 1OY3B 1UD8A 2V7HB 2OCJA 2R0KH 3CQQA 3HR5B 4H5SB 1J0KA 5IB4A 4ELKB 2JK5A 2R23B 3QDMB 1WHPA 5HHPB 5EU5B 1U8HB 3RTLA 1IM9D 4NWTH 1E3XA 1J9CT 1OK8A 3ZPDA 3DUHA 5GRVL 3QNYA 4LFHD 3UGUA 5E1HB 6PCYA 4XOBA 3FT3B 4FJ6A 5FYKD 2IPTL 1Z1WA 3VI3A 4BFFA 1IKFH 1NBQA 3UGXA 2XT1B 3O8XA 1F11A 1WBYB 4UQBA 1I9IH 1QBML 1CBVL 5DJ2A 3DA0A 1ZGLP 1FPTL 1Q9KB 4JG0H 4IHOA 4P9HH 2EP6A 4XCCH 4ZFOB 1F42A 1CS6A 2XWBB 2JQMA 4F33B 4P46D 4HJIA 1PZ3A 4P5SA 5D6CB 4YQXL 1XF3A 3GT6A 5BCAA 4AUJA 4N4YB 4HSAC 2YJQA 4M48L 1R3KB 1ANUA 3BDBA 3L9BA 3Q48A 3TNMA 1LWJA 4M1DL 5T5NG 2F7PA 2VDNH 1GS6X 4XGZA 3ESOA 4GRWE 1REIA 4P04A 2ZXAA 1YEIL 2CAKA 1TCRA 4Z7NB 1JI2A 2Y24A 1SDDA 5IF0B 1AYRA 3HNTH 2XDHA 4X80H 2XA8L 2ZG3A 4ZYKA 3MOBL 3Q01A 4OZIF 3V4PB 5GHWL 4L37B 2F19H 2HJFA 1AOHA 2VUKA 3H0TB 5F7BA 5C0DB 5CKGA 2NNAB 1AIFA 5F7EL 4NQCD 3SJVA 3BH4A 2LAGB 1T0PB 4YHLH 3FQWA 3OC5A 5EC2A 5IROA 4Z95H 3W9DB 1CWVA 1BZ8A 1KB5L 4HWZA 3FT4A 1PD0A 2CUIA 4Y1AB 2J3SA 5KG9B 1H3WM 3BVDB 3IGFA 5AW0B 3GBDA 3IDNA 1Q0YH 1VFBA 3WKPA 4IBVA 2P5WA 1SGKA 4PP1D 4GSRA 3UIZA 3SE8L 2NXYD 5C08D 3MRRB 4ODWA 5FFOA 7FABL 4BRJA 3N43B 3SE3C 3HFMH 2P5ED 3E80A 3DPBB 1L0XA 2RQ8A 4XO8A 5IESH 4GAJL 3S37X 4FULA 3TBWA 2YQ3A 1RLWA 2GJPA 3OQRA 5F7LB 3NH7H 5B7MA 3V4VL 2N3JA 4O2EA 1G4RA 1I1CA 3ARYA 4P5MB 5GISH 3AU1B 3ABLB 4RWHA 3T6XA 3W2DH 5KZCD 3EDKA 1H3UA 5I71B 5I71C 2DB8A 4JN1L 1T6BX 2V6HA 3QQ3B 4XNQB 1M3IA 43CAA 3MJ7A 4MA7H 3SODB 4F3FB 1IGYB 2VZ3A 3NJVA 3P77A 4GY4A 2WKOF 3RWGA 4R26L 4XRCA 4I1RA 3GXPA 4JUTA 4NZ8A 2XFXB 4HWBH 2H8PB 2WTRB 3WKNA 4DP1X 4HJJH 4XN9A 1BHGA 1PLAA 2V3DA 4ZUWB 3LIZH 5LAPA 3FH8A 5IG7A 2W1NA 3QULA 2J5LB 2J5LC 2WZ5A 4OGQC 4F15B 4F15C 3TEUA 4EIGB 4DGYL 5LNGA 4RGOH 5B38G 4YHPA 1R5VA 1ULVA 1Q72L 2K6ZA 4PRBA 4BHUA 4FQJH 1J8KA 4N1CA 3V55A 4TQ8A 2WANA 3WDIA 1I7RA 3LKRA 4G7YH 3R4DA 3CZEA 5D7LE 2BFGA 1I8LC 3MODH 3ELQA 5IVOA 1Q94B 4DP8X 1SXNA 4O4YH 3K0WA 5EN3A 2XZAH 1DL7H 2DEXX 2EZ0D 5AB2A 1E4WL 3VXNB 1L4IA 3F6JA 3A4FA 2NNRA 1LXMA 3VWJC 5DI8A 2A77L 2CO4A 3B6SA 4PJ9C 3UYRL 1A14L 2D7MA 3TVMB 2NY0D 1ZLWK 3ARDA 4PLJD 3TVMC 4WV1A 1CFNA 1JYXA 1RZJH 3ETBJ 1K4DA 3GF8A 4Z5RA 3V10A 1F4WH 1FZOA 3QG7L 2EVIA 4HMDA 3EOYG 4DH2A 2IPUG 4LL1A 1RUQL 1KULA 3JV4A 1BIIA 1V3LA 2AKRB 4A55A 4NZUH 2X05A 4K8RC 3BT2H 4PJBE 4ZBJA 1NMAL 3Q5TA 1AR1D 1BAFL 3FOMA 4JVWA 2KZBA 3MRBB 2ZQKA 3X11A 3MRIA 3MO1A 3OBAA 1QYGL 1PL3A 4JHVA 1ZHBA 4KROD 3AABA 4Z76B 3LHAA 3HMXH 4OB5H 2H0PA 4U4IA 1M7XA 1XIWB 1G7HB 4QAMB 4I0KA 4XNYL 2DQFB 3K72A 5SWSA 4KJYB 3TU6A 1NGZB 2QHRL 1BZQK 1TZGH 1W15A 3QS3A 3ZGIA 4PV8B 5CLWA 1JFQL 2BVQB 2VC2H 4RX4A 4WGVB 2XKNA 5T1KA 2H26B 4QJ3B 1DQJA 3BLBA 5BS0D 4N9OB 2BHYA 2QJDA 3QZLA 3LVEA 5EF2A 1PZDA 1G6VK 1NSNH 3AS0A 1XQ4A 3TN0B 2VLKD 3TN0C 1JPGA 3WJMA 3RUGB 3FTWA 1A6WH 1SJHB 1CE6B 2R0WH 1Z3RA 5TDPA 4EI6A 3U6XA 1X6NA 4JBSA 3UTSE 4QRRE 3APDA 3V9EA 4YMPA 1ET8A 4J3OD 4QRPA 2O72A 1XF5B 3R1GH 5DC0A 5TDNA 4OZ4A 5IVXB 2RGSA 3ET9F 3U0TA 2BSRA 4LLWB 4RMUA 3MMEA 2CM5A 4N90D 1U8NB 2B1AH 3DO3A 3K5RA 5AL0A 2KYIA 1K2DB 1INDL 1J5OH 1PCSA 1U95A 4WU7B 3HR6A 4PTTA 1MXGA 3RPBA 5HGGS 3W5MA 1QSEE 1DQLH 4NM4H 5A2BA 5I74B 3MJ9H 1KN2L 1T0OA 3B9VA 1QA9B 2EUWA 2Y06H 3EYFA 4JDZA 4KHXL 1VIWA 3L4WA 5ESVB 3TPKA 2Y3NA 2ZIDA 4NRXB 3BN9C 4OZFB 1OKEA 4G6JH 4MCYA 4ZRGA 2E4FA 1P84J 1UD4A 4N3UA 3P4OA 4N8VA 5IUCA 3GMPA 3C8KA 4ZPVA 2GJ6A 3DVGA 1J1OL 4K3JL 2IBZX 3MV01 1RJYA 2VMFA 4U6YA 1FE8L 1DQDH 4PB9H 1RZ7L 2DIEA 1HK6A 2FT7A 3MCG1 4BINA 2XWTB 1VZGA 1P4IL 4ZO9A 3HW7A 4JRYB 4XP4L 4Z7UA 4AXWA 4XNBA 3AS1A 5HHOD 1P53A 2PO6B 2R9HC 4BV1A 5BVPH 2Z8WC 2R1WA 5ETUB 4AV5A 1OT1A 2YEVB 2ADIA 1I8IA 5GRUL 1TZHA 2GPZA 2EICA 1MCWM 1ZMYA 3TYFB 1JGDB 2GI0A 1MI5D 3SHSA 5J6GA 2FR4B 4PBDA 4YDZA 3HVDA 1KGJA 4KDTC 3VYOA 1G7LA 2YPLB 5FHAH 1CGSH 1FFOB 3LZNA 3T3MB 3N42F 1J8HA 1OXYA 3D5OF 5E8NB 5JW3L 2VE6A 3D87B 4FDWA 3ALXA 3IETA 3LS4L 2FWOA 3WFZA 5DJXA 2OMWA 3NJLA 5LXVA 1CFQA 4XE5B 3WE6A 3MACL 4KY2A 2ATKA 5KVEL 1CR9H 1NC4A 4E68A 1UH3A 5FO7B 3N40P 4I0CC 3W82A 4TUOA 5CSGA 2BNRE 1E4XI 4QOKB 2PW1A 4JS7A 1IKNA 1A1OB 1SEBB 4OM0L 2LU7A 4O00A 3H85A 4KHTH 3GEFA 3C60B 1GS8A 3C60C 3C6EA 5HYSB 1AKJD 2YZ8A 3FUHA 7PAZA 2VL4A 4BFEA 3NFNB 4W9IC 4YUEH 2JQAA 2N7SA 2CJTA 2W0FA 4PCKA 3ABZA 5K59E 2MH4A 3QEGH 3WLWC 2UZIH 4JFQB 2BSDA 1JZFA 3I2CH 3RVTC 4X7EC 3RWHB 3QHFL 3KAAA 2D31B 4QO1A 4OKVB 4F24A 5C0AA 1E42A 3DTXA 1OM3L 1DQTA 4I1NB 5GGUB 3B4NA 2YPVA 1FH2A 5E70A 5D5ME 2H3NB 1VHPA 5ID0B 2C1OA 5TE6L 4YDLB 4YDLC 3LRGA 3O3AA 5J6SA 3PNWB 1GPOH 5ALBL 3V4PH 2CQVA 1HAUA 4JFED 3MRKB 5CLZA 5FKAB 3I6GA 2OMVB 3CVDA 3ELAT 2B59B 3NAAH 3PWNB 1YYLL 5HDLA 3PU7A 4LLVA 5KJ4A 4A63A 1BVKB 1NFDB 3QIUD 4X4XA 1AGBB 2YZ1A 4PGEA 3QIBA 4X7CC 2FLBT 1PKQA 3Q8BA 2MNJB 2A4EA 4UTBH 4APQB 3FFOA 5J9PA 4APQC 3GSOA 1T20B 2NYYC 4WAFA 1F4AA 1XB3A 3A6BL 2VITA 3ARRA 5E2TL 3P3UA 3VVWA 1UURA 4JHBA 5B8CA 3BCFA 4R0LB 4R0LC 1U8PA 4LRNH 4X8JB 1RMFH 1NBCA 3IDJB 4XBPA 3PIQB 5IBUB 1NCGA 3O11A 1JBJA 4Q97A 3CVBA 2IPKA 3QISA 2HP4A 3PS6A 3T0DA 4S0HA 1U42A 2DBLH 4WHTA 5I76A 3VW3L 1GGYA 4JO2L 1LO2H 1ZV5A 2CO3A 3V4VB 2OXGA 1CGYA 1DUYB 4UV4L 1TQSA 3VFSB 4JFDB 1QR1B 2NY2D 1KG0A 1MY5A 2GI7A 3BAWA 1MCDA 3OKNA 4IRSD 4LLAA 3KLKA 3A67H 5DJAA 5B39A 1UFGA 4LCYB 3ZTNL 3MXWH 1ZT4A 4KX8A 4AEHH 5L2KB 3NP3A 4YSRA 1DCLA 4G9FE 2HWZH 4GLRI 3N1GC 3LD8B 3LD8C 2HJKB 2VO5A 4GLRH 3D4CA 4HWBA 4OIAA 2H1LM 3OJDA 1INEL 1EJOL 2JTDA 3LV3A 3CFMA 5T3ZE 2EEBA 4DN3L 3LIZA 3TNNA 4TNFA 2Q8BH 5E8PA 3GHPA 1GHFH 4YWGH 4UOJA 2R69H 3HG0A 3ARBB 3ARBC 3CQPA 3MBEC 3QDJA 4RH4A 4XWOC 1EJFA 5BQ7A 1F6AB 1SJXA 2X6BA 4HZAA 4N2NA 5FGBC 1AE6H 3QYMA 5JXEA 4PBXA 2OV0A 5H94A 1I75A 4X8XA 2FT8A 3FK3A 5HHXL 4PRPD 3T4YB 3S3BB 1JD7A 4Q9BA 1H3TA 2X4UA 3F58L 2P46B 3DX0A 4C56D 3HE6B 3HE6C 3WXWL 4CC0A 1JXGA 1H9DA 2DWTA 1FFNB 2ADGB 4HALA 4JY6A 1BG1A 4KOCA 4PUBH 5F96H 5DQ9B 4POYA 5BO1H 3DGDA 1USQA 2ZOLB 1H0DB 5IBTH 5CBAB 2JIXD 4JFOB 3MLUL 3UPRA 3VFWB 4HUNB 4B7IA 4DKDC 5GS0D 2V2TB 1R3LB 3MV7E 5AWNH 1YY9C 2VW7A 4HK3N 4K8RH 2A6KB 1J8SA 3HC4H 4KKBC 4LSQH 5EOCH 4MSWB 3FO2A 4OKDA 3EBIA 4GXVH 3D69B 5ICUA 4F8PA 3BI9X 4N20A 3RLSA 1EK3A 1VADB 1PG7H 5TJWK 1C12B 1NEPA 2YS4A 4N2EA 5CP7A 3QFJB 3BSGA 3TFKD 3ATFA 4YDKH 2X0UA 4TVSa 2QPSA 2ZZUT 3G6AA 4L4VB 4Y7OC 3DGGA 3CX2A 1GGUA 2OW7A 1XH3B 3OZ9H 1RIUL 3HMXA 5FCUL 5K33A 3T8XA 3NIGE 3W9EB 1KWKA 5EORH 3BKJL 1TZIA 3ZRFC 2KERA 2NPLX 1YEEH 3MRCA 3TBYA 5B3NA 5D1QE 5T1LB 3EYQD 3KLAB 4NKIL 3LH2L 3QUZB 3QUZC 1FNFA 4DOHE 3JUYA 3MRDB 3U1SL 2XIBA 3REVB 4LAQH 1L6XA 4R4NC 4F80A 3OKKA 4LLMB 4RAVA 3RZCD 2BZDA 3QPKA 1Y18B 4JGJA 3EJSA 4Y4KD 3IAQA 3AY2A 4BGLA 4X5XA 4HKBB 4KVCH 4MD4A 4Y1TA 4XPHH 3UG3A 5DK3A 5DU7A 1ITBB 3ABKB 3G08B 3AROA 3SKOB 1S7SB 2NX5A 3D4GA 2ZXBA 2PYEE 2NTFB 2ZPKH 4MKMA 4AEIH 5F7YC 4YFLF 2WWKO 1MWOA 3AACA 4JY4A 4UT6L 5I16B 3O6FD 1WFOA 2NLJA 3H7BB 4B27A 3NJJA 4PEEA 4QDGA 3FRPB 4L4TB 4K5MA 3GSRA 3NYKA 4P4KB 2DTML 5C09E 4P4KC 3VUAA 2YAMA 2ZOOA 3C5SA 4MYPA 4RA3A 3HVNA 3QP3A 3MJ9A 1IC1A 1R3HA 4L8SB 3QXVA 4L8SC 2CGRL 4L5FE 4JG1L 5EUKA 2R56L 4LKXA 2IJ0C 2WWNA 4HBCH 3TT1L 5FM5O 1FFRA 4E41E 3H9SD 5CD3A 1Z9MA 1FC1A 5GJSL 4MHHG 3HI1A 2OSYA 5FUZH 1P84K 5KEZA 1FNEA 4UB0H 5F1KC 1E28A 2DBJA 5CU5A 3IGAB 4O5LH 1CLZH 1XEUA 4FA7B 2QGCA 4N2LA 4HC1L 5DMKA 2Y7LA 4U6VH 1IGFH 1T21A 4XMXA 3L95A 5CBEB 1OGAE 4YPJA 3WN5B 2P8PA 3WN5C 1C5BL 3RVUC 4RRPA 3P0VL 2KT6A 3GSNL 3WMPA 5DS1A 1IE5A 5FYJE 5IK3A 4RESB 3RBSA 3DJRA 4Y16D 2YO3A 3DX6B 3HPLA 4JPVH 4NQDB 5CEXA 1RUAH 4MD5A 3FUIA 4L2LA 4ELMA 3IDXL 3G5XA 5AAMA 2XKUA 3W38A 4PV9B 2V7HA 3REWB 4PHZA 4H5SA 1QW8A 2R23A 2JELH 2KS0A 1N68A 1DQKA 1JNHB 1U8HA 3QDMA 4FL4B 4FL4C 5EU5A 5HHPA 5I1DB 4LLUB 2WXIA 3OMIB 2F54E 2X28A 4PRID 2VLLB 3S5LB 1UWGL 4KK8C 1QRKA 1SXSA 3AG4B 5E8EB 1EV2E 1N6VA 1WBYA 1WZMA 2K3TA 3LKNB 1OGTB 4B9KC 1S8DB 3C5ZB 3K6FA 3C5ZC 3STLB 1KTRL 2XQBH 1QBMH 1Q9KA 1R1CA 1OIOA 3K8MA 1CBVH 3PGCB 3B37A 3POCA 1KXHA 4ZFOA 1FPTH 1GYAA 1T66D 2XWBA 4C4UA 4F33A 3I74A 5D6CA 3S3SA 5J06A 3MKGA 4OVVA 3LPPA 2ZKHL 4CN4A 4NRYB 3O3EB 4YQXH 4KTGA 3QT2A 1R3KA 1CG9B 3PWJB 4ZI8A 4Y2LA 2WTOA 5DFVD 3CH1B 5IHWA 4OLVL 3FU6A 1UWEL 1TTFA 4Z0XB 1G84A 1W16A 3PGFH 4M1DH 2WNKA 4N2DA 1MDAA 2XPYA 4P59L 2EIBA 3X1BA 3NPZB 1QFOA 5IF0A 1MCPL 3QJSB 3P4LA 4G1MA 1YEIH 1YNLH 3BVXA 4R97B 4R97C 3V4PA 1AANA 1U8QB 4L37A 3H0TA 2EE2A 3FU0A 2ISDA 5C0DA 3MOBH 1GC1L 2NNAA 5AOIA 3HS0C 1E50A 4JREB 4JREC 1X5ZA 2WWMD 3W9DA 4YXLL 4M93B 1OWWA 3CBRA 4JHUA 4EN3D 5L4IA 5KG9A 4Y1AA 4D7PA 2W65A 2E7LC 2AQNA 4MCZB 4DERA 4N26A 1ILUA 3MRRA 1A7NL 3SE3A 5C07E 2V3EA 4D0DB 2AK4B 3SE8H 3UBXI 2VYRE 1A7OL 2VXTL 3DPBA 1IBDA 4O58L 5JHDB 1MCIA 3D52A 7FABH 5FYKL 1KGIA 1AYOA 3CSGA 3IN2A 4DTGL 1PAMA 3L6FB 4NUPA 4MZRA 4ABUA 2P26A 4FFTA 4LCWB 4P5MA 3AU1A 3QYNA 3SPIA 1I4FB 1DQMH 1HX0A 3V4VH 2YOAA 3QQ3A 4XNQA 3VI4E 1WICA 4P2QE 4P5RA 4GW5B 3VG0L 1MZYA 2NQCA 4XP5L 3L4YA 4F3FA 1IGYA 3DK2A 4JN1H 2H47C 2EDMA 1DJGA 5IEHB 5HDOA 1Q9OB 3RWCB 3LNFA 3ZSTA 1SMAA 2EO7A 4CJ0A 1A66A 2D0HA 1OZTG 3FW6A 2H2SD 4FLOA 2XFXA 4KUCD 4UQ3B 4R26H 2WTRA 2WLYA 4ZUWA 5FO9B 4KK5D 4KH2A 3HC3L 3V6OE 1I31A 1BQUA 4MRBA 3HZYB 4PTUA 1PX3A 4GAAA 1PD1A 1UWYA 4F93B 1FCGA 1CD0A 3GPSA 3ZZ1A 3DX4A 3MXVL 4GSDL 4QWWC 2R69A 1OAZL 3VI3F 1DZBA 4DN4H 2FE0A 3UMTA 4B0MB 2EIDA 3BZDA 1I8LA 3G5YB 2F61A 1Q94A 2FIRT 4G8FB 5FM5M 4RBPH 3MUY1 3L7FB 1XBRA 1B4JL 1DJHA 4OFYD 5IR1B 4QRUB 3VXNA 1QNZL 1F86A 4S10A 4W68A 2OMXB 1J1PL 2N1KA 1CZ8H 3NCYS 1E4WH 1FUNA 3TVMA 1HHHB 3KNBB 3KWVA 4F5CA 1ZTMA 3AG1B 4LDOB 1YSOA 5E2VH 3SCMD 1X6LA 2A77H 5HJ3B 1A14H 4AM0B 3IU3B 4AI7A 2QGDA 2M83A 5EEWA 2QPUA 1LO5B 2W60B 4JGUA 4PJAE 1TEFA 3IN0A 1UOLA 1FNLA 3T08A 1G4MA 4Z3EA 2ID5A 1ZLDA 5T33L 4HCFA 2AKRA 1IGTB 2ZCHL 5JDJA 1II4E 4DO6A 2QT6A 1IUZA 1RUQH 5F1SA 2VUOA 3T71A 3BZEB 3WS6C 4GQQA 1BAFH 4U0QB 2EDDA 2QSTA 4AUUA 4Z76A 4A37A 3MBXH 2LABA 3VQ1C 4YN3A 1QYGH 4KJWD 3H6AA 1XIWA 1G7HA 5CR1A 2UXTA 2DQFA 2BNQB 4KJYA 1NGZA 4NCC1 5DEZA 2P8LB 4XNYH 4PV8A 1W91A 2BVQA 3TTYA 2IDSA 2QHRH 3SSGA 2H26A 5I1GL 1TG8A 1WAAF 1JFQH 2CR3A 3TN0A 4Z3IA 3RUGA 1SJHA 5F7NC 1CE6A 2NMSA 3KWTA 2DQTL 3EG9B 2E5EA 3QJQB 2DD8L 4FMFA 2Z0UA 5IQNA 1UHVA 1XF5A 3IXTB 3EDFA 2EXTA 3IWVA 4KKCC 5IVXA 1DVZA 3O9WD 5HDQL 4PJHE 3U2JA 4LLWA 5KVFL 2Z65C 2UWEE 3BD5A 1ZDSA 4Q74A 5HGDB 3KW7A 3QRFM 2BH0A 4X8CA 3ZT7A 1K2DA 1W8NA 1SEQL 1WIUA 2NYZA 2V8LA 4WU7A 1W0WB 3TA4D 2B77A 4UQDA 3QQ4B 1SLUA 3ENEA 4YSDA 3HMWL 3WEXB 1INDH 2IG2L 4W9HC 1OGSA 4JB9L 4RGNE 4N2AA 1MFCH 1FQ9C 2WXRA 1QA9A 2WXNA 3CG8A 1P4LB 5ESVA 1E27B 2D9CA 2E3VA 5AB0A 3PHQB 4JRFA 3S6CA 4KHXH 4NRXA 3CFUA 2CHDA 2IWKA 2P49B 1HOCA 2G30A 4RZKA 1YN6B 2GHWB 4L3CB 4MNQB 4NLHA 3B9AA 4WWID 4HH9B 3V95A 2O5XH 4AK1A 2RTTA 1J1OH 4K3JH 4YOKA 3ARFB 3WIIH 2XWTA 3ARFC 4FI7A 3K3QA 4JRYA 1RZ7H 3SKMB 5DMGD 1HWHB 2PO6A 1Q9LB 3BN3B 3HBPA 5EMYA 1P4IH 2E8YA 3KD4A 3OKDB 5A7EA 3NT0A 4XP4H 1GW0A 5ETUA 2VJXA 1SDAB 5IVNA 1V7MH 3SE9L 4U1JB 4L1SA 4YSAA 3L2NA 3SGJC 3FCSB 3TYFA 5DK0B 3UG5A 1NCDL 1KB9J 1ORQB 1JGDA 1L9PA 2QGBA 2YMOA 3SYOA 3QYCA 1R33A 3L1GA 3BP7B 5GRUH 3GBNL 3GXTA 5G55A 2FR4A 5A6LA 4NGHL 4KDTA 3L5XL 5JYLA 2YPLA 3K1KC 2PR4H 1FFOA 2ZAGA 4DNLA 5GRXG 4PMFA 1YNTB 3UAJD 4BE6A 4FG6C 4N0UB 3PJLA 5E8NA 4J4PC 2X3BA 4J3BA 3GSNB 3TWYA 4YLCA 2ITCB 4XNXL 4E9XA 4N5ED 3HN8A 3UZEC 4B5EA 5JW3H 3TC9A 5JOPD 5D1XD 2XZCH 5F97E 3LS4H 2PUQT 1KF9B 1NPNA 3JUZA 3NQIA 5FO7A 3FOLB 3AM8C 3OB0H 4FN0A 4QOKA 4ZO8A 5EG6C 3IBEA 4MWFB 3UADA 3S35H 5KVEH 4YBQC 1A1OA 1IFGA 1SEBA 4WHYH 3CVHL 1CXIA 4S11A 1WGVA 4IJ3B 3CFDB 3PLYA 4IJ3C 3S8FB 3C60A 1NIBA 3V9FA 5HYSA 4WY7L 3ZKND 2R2EB 2X41A 2C9RA 1MFNA 1Y6MR 3NEEA 1WPCA 3NFNA 4IOIB 4XT1C 5E6IB 5E6IC 4AIEA 3FTVA 4YX2L 5EF3A 3INOA 3AMKA 4GQ9L 3VGEA 1NGWB 3U4KA 5L2JB 4BSJA 4Q8BA 4JFQA 3NG5A 3RWHA 1J0YA 2AMGA 2D31A 2X9ZA 2DJMA 4S0SD 4OKVA 4Y4FB 3F00A 4Y4FC 2VLRE 5JQHC 2Y07L 3QHFH 2R8SL 3T3PE 3ISWA 5GGUA 3BUIA 5SWQB 3B2UC 4WTZG 1OK0A 3HNSL 1DEDA 2H3NA 4M6ML 5ID0A 1OM3H 5MEOB 1ES0B 2VLJB 1SYSB 2OJ1A 3I3EA 3D18B 1IARB 4M56A 5C3IA 1H8NA 3EJCA 3RTQD 4EMZA 3N41F 3PNWA 5TE6H 1YN7B 1KBVA 2XOTA 1TYEB 1J11A 1U3HD 3MRKA 5ALBH 5FKAA 3UJTL 2OMVA 3ZU8A 1FO0H 2B59A 3PWNA 3I6SA 2FX8L 3BRFA 2RJMA 1BVKA 1NFDA 2X6MA 1AGBA 3C09B 3C09C 5AVVB 1YYLH 4NZJA 1MCFA 1QPPA 2K3HA 2VZSA 4M7LT 3RYMA 2PCPB 4APQA 2VZOA 1T20A 5DF0A 2X6VA 3SYAA 4WI6A 1IIIA 4R0LA 3F84A 2YWZA 3I02B 4X8JA 3A6BH 5E2TH 4D94A 4H20L 4PG2C 3IDJA 3PIQA 2Y9RT 1NOFA 1QWNA 1YYML 2BVYA 3FUKA 3PP3H 4JVPA 4Z7UF 1OCRB 4ZT1A 4A2HA 5KN5B 2DQDL 1AZNA 4JPKL 5ILTL 1IM9B 5D2NB 5D2NC 4DGUA 5IHLB 1YECL 4JK0D 1YDPB 3FQTB 3ZE0F 3I3DA 3VW3H 3V4VA 1CI3M 4JO2H 3VFSA 1DUYA 3HKZA 4JFDA 1QR1A 4HV8B 4N2FA 4XX5A 4UV4H 3UCQA 3T5WA 3P9WB 4LCYA 1Q9WB 4CBZA 3CZGA 3GRGA 1M1SA 4QHLB 5L2KA 1AO7D 4ZUSB 3LN4B 3GJFK 4ADJA 3Q8CA 5HJGA 1KBKA 4GQRA 4LASH 1SFHA 1XO8A 4P46B 2HJKA 4P46C 1MJ7L 4GOSA 1RVFL 3EOAB 3P4MB 4NHUB 5GIRB 3T77B 3HLKA 4RLDA 3L3OB 2WZPA 4HLZG 5C71A 2IGFL 3KPSE 1INEH 1EJOH 4DN3H 3ARBA 5I9QB 3HZVB 5I9QC 5AZ2L 3S48A 2YPKB 4U2ZA 1TOXA 3L81A 1F6AA 5FGBA 1NGQL 4ADIA 3NCYP 5AZEL 1G9EA 1IC5L 2BOCB 5EH1A 4CSTA 4YHYB 4YHYC 4Y19E 1R3IL 4ZMNA 1JZEA 3T4YA 1MFMA 1XB8A 2G75B 4YEEA 4XVOA 1H8OA 4NQVB 4F91B 5HHXH 3HE6A 4U3XA 4UNTA 4P48A 5C0RL 4NQCB 3V5KB 1FFNA 2ADGA 3EO1B 1S5IL 1F4HA 1FN4B 2LR4A 4B6ZA 3WXWH 1PEWA 3LMJH 5DQ9A 2ZOLA 4X9BA 1H0DA 5CBAA 1NMBL 2GK2A 3FNKA 1Z5LB 5BOPA 4G42B 1X5JA 4JFOA 5MHSD 3ISRA 3VFWA 2V2TA 1FV1B 4PP1C 3TO4D 1R3LA 2NXYB 1IBZA 2NXYC 5C08B 3MLUH 1NFKA 2A6KA 4NUGH 2P5EB 4IBLT 4MSWA 5KSBE 4QMEA 2H9GB 3D69A 1TITA 1PG7X 1VADA 3I84A 1C12A 4DGVL 5FGCE 2NCMA 5KBDA 3QFJA 1CK0L 3UTPE 3TURA 1N19A 1WTGT 4D9QD 2ODHA 2WNGA 1WLHA 2DM2A 3CZJA 4AQZA 2EH8L 4UV7L 5KZCB 3CDYA 3EADA 1DBAL 2YK1L 4L4VA 4AUYA 4F37K 3IFPB 5BUPA 4U31A 4L48A 2YOCA 4PIBA 5LAXB 1XH3A 4OCSL 4TXVB 4P07A 5GQBA 5JIKA 3GSQB 3W9EA 4LCVA 4XHJD 1ZEAL 1QPKA 2WN3A 1T1XB 1RIUH 1MNNA 2A2QT 1UXLA 3DKHA 4FFYL 1S9VB 5KOVC 1DE4B 5T1LA 3KLAA 5EDSA 4U1NB 2O6FA 3QUZA 5FYKU 1E9QB 2GY5A 3FQ4A 2VDOL 2WLIB 3MRDA 3FQ2A 1UXMA 3REVA 4LHQB 3JWNE 3A4EA 2YMXL 3LH2H 2DTSA 4NKIH 3S3DB 4UBDC 5E7BA 4LLMA 4LPTA 5CJQH 3P30L 1NFAA 1GYVA 1Y18A 3GRWL 2WGXA 1NBZB 3QO0B 2PP8A 1HN1A 3QRBA 5A6IA 4AKPA 1CTMA 4HKBA 1U92B 2NY3D 3G08A 4IKIA 1PD6A 1S7SA 3SKOA 2DJUA 1UWXH 4HLZH 2NTFA 2A9DA 3BZ5A 1AD0B 2BS8A 5I1AB 5I16A 3LZQA 3H7BA 2OYLA 3RG1C 3FRPA 4L4TA 1I7TB 2EZ0C 2WLJA 4P4KA 4UT6H 4UWQB 3LZPA 5FDWB 1A6PA 2CG9X 4NKQB 2B1HL 5FOJA 4N85A 1UZ6F 5GS0L 3RI5F 1XL6A 4I9WE 3VSUA 2NY0B 3FYIB 2NY0C 4L8SA 1NEZG 4LF3B 4PLJC 2RIKA 3K71B 3ZO0A 2LLGA 4HU8A 4J3XA 1OOWA 4G1EB 4JG1H 1X7TA 4FEMA 3QB7C 3TT1H 2EJ1A 4G2AA 4FQ2L 3CK0L 3DSFL 5GJSH 5B1BB 2BX5A 1RZPA 2JB5H 5F3HB 3NCCB 4G6FD 2FEEL 3IGAA 1AR1B 5TPWH 1AR1C 4MB3A 1HS6A 1JGUL 1MCWW 3KEDA 1WBXB 3L5JA 4KROB 3ABGA 3C6LD 2QVTA 2OR8A 4HC1H 4NN6B 4OW6A 4NN6C 5CBEA 5KVMC 3WN5A 1NUFA 5IP4A 3DYMA 4JKPL 2QSCH 5DEGB 2Y7OA 4UMSA 5DWUL 3RX5A 1C5BH 2WTPA 3P0VH 1KB9K 5E4IA 3GSNH 5BS0B 3DX6A 3FO0L 4NQDA 2LGNA 2P45B 3ILEA 3OKYA 3W39B 2ZUYA 3WXVL 3ZY7A 2N7AA 3MNWB 1V54B 2VLKB 1NMCB 1NMCC 2Z8RA 4XPGL 1OAUH 4UQAA 4PV9A 1B3JA 4LU5L 5SX4H 3GMRB 4ZQTA 3REWA 3IDXH 1MCNA 3EH2A 4ODSH 1SHMA 2ZKYA 4UOQA 1TNMA 4HIPA 4M4RB 1I1RA 2DM7A 3ZTCC 5I1DA 1F02I 4CMMB 2YD6A 4KO6A 4LLUA 4CL7A 1T0MB 2A9ML 3ZHFA 4OZIE 2VLLA 3S5LA 2CO7B 2HH0L 3CXDL 4DP9X 4UNUA 3F85A 4JO8A 5D96B 3PHAA 2PWGA 5E8EA 1DUZB 1OCZB 1URLA 3MHZA 2CIKB 1UWGH 2D3VA 2DWYA 1OGTA 3LKNA 1UACL 2OCFD 2XQYG 4F8NA 1S8DA 3CVHB 3M88A 4HXAL 3TEWA 3C5ZA 4PLOB 3STLA 2CKNA 1GZQB 2X2HA 2Q0ZX 1GAFL 4G9DB 4LGSB 4MJJA 4F8OA 3WJLC 3PGCA 3SZ6A 4F7CB 2UY7B 1JZGA 2Q7YB 2AERT 2JJVA 4XPFL 5HVGB 1XCXA 1LVEA 4PJXB 4Y5XB 4H8VA 4Y5XC 4W70A 4NRYA 3O3EA 3C08L 3WDHA 1CG9A 3PWJA 2P42B 4ZOAA 4XMPL 4Q0XL 3CH1A 3VTMA 1ZVHA 4FMKA 4ZS7L 3R8QA 1MG2C 4Z0XA 4QRTB 4HIQA 4OLVH 1MIEH 1EHLL 1UOVA 3CMGA 3GXIA 1UGKA 1WEJL 5JIIA 4X7SL 5EEUA 5HHOB 1U8QA 1MCPH 3OXRB 2OZ4L 3ES6B 1WFIA 4KKNA 3BCDA 5CD5C 4L18A 5J6HB 5K93A 4WNSA 4RISL 3DECA 2DLGA 2EC9U 3TBSB 1MI5B 4ZQKB 3DHUA 4QHMB 1E2VA 4B9FA 4YXLH 2HFEB 5SX5H 2E7LA 4U7SA 2ZCLL 1MCCA 4QHNB 3WNKA 5DA0B 1N6QL 2LVCA 4MCZA 5CILL 1I8UA 3VQMA 3SBRA 1TYJA 3ECUA 4PJAB 1LDPL 5AOMA 4OCMC 3SBWC 5HHQB 4D0DA 5AVRB 2AK4A 4DP5X 4XP9L 2YXVA 5JHDA 2GTWB 3UZQB 5MEND 1VPOL 1J5CA 5FR3A 2WV3A 1BAWA 1A7OH 4O58H 2VXTH 4QRSB 4RSVA 1A6AB 1DQIA 2VXQL 3L6FA 3LQZB 5DUML 3T8MA 4LCWA 2HRHA 5FYKH 5LBVA 5MI0B 5MI0C 3WE1A 1I4FA 2B4CL 4PGDB 3DX3A 3DRQB 2Q9OA 5KVGE 2Z93B 4GW5A 2FRGP 2D0GA 1AKJB 1FL5A 5IEHA 3VG0H 4XP5H 3UJIL 2VUYA 1Q9OA 2ZWZA 2V37A 3RWCA 1HXYB 3OAYK 1KLFB 3NIDF 2FBJL 3FN9A 5ADPL 5JHMA 3VA6A 1YY8B 4GKZB 1HH9B 3M7FB 5GS2D 4UQ3A 4ELMF 1GW6A 5FFGA 4YHKL 2ZOTA 5DJYB 3CLWA 3P3SA 4TLUA 1I8AA 3NCJL 3CFBB 3RWIB 3WEAA 2ZKMX 3ZRCC 4D0BB 1AOZA 2ARJQ 2W9EL 4OF3A 3BD4A 4PJEB 5E94B 3B9KD 4ESKA 3WKYA 3HZYA 3SDAD 1X5KA 5JZ7D 2EDEA 4R7VA 3RX9A 5J57B 1RIVL 2WXPA 5KVDL 5IMKB 2MKLC 2NY6D 2VSKB 1EHAA 1VB9A 5SWZE 3MXVH 3APCA 3QXTA 3G5YA 4JFEB 3I75B 4G8FA 1TTGA 1N10A 3I9IA 3L7FA 5IR1A 3R4RA 4QRUA 2C1PB 4F8TA 4D9RD 1MY7A 3WFCL 3QIUB 1B4JH 2OMXA 3QIUC 4HW6A 5KYNA 4UT7L 1HHHA 1QNZH 3KNBA 4FTVD 4X0KB 1R6VA 2V3FA 3WSQL 1B2WL 1NJ9B 2ESVE 1J1PH 5HJ3A 2CHWA 4AM0A 3IU3A 2HUHA 2ZCKL 3H9YA 3PXLA 4QT5B 1LO5A 2W60A 2YD8A 4DZ8B 4F58L 1I7ZB 3X1FA 4J5VA 1M56B 4I3GA 1IGJB 4DSYA 2VDQL 3F04A 1XMWA 4Z7NF 1IGTA 4JPSA 1JXJA 3PWPE 3MLWL 1IAIM 1JNLL 2GKIA 3BZEA 2ZCHH 1JDDA 2EEAA 3WS6A 3DX9B 2YEZB 4I18B 4I18C 4JFFE 4N9GB 1CO1A 5BQDA 1JN6B 3QPQD 1P0SE 2H32B 4FOMA 4MBRA 4NNYB 1EANA 2CCWA 4PVBA 4EE2A 2Z8SA 2BNQA 1GJUA 2NY2B 2D4DA 3VMPA 1BX2B 4IRSB 4PBWD 4IRSC 5CGMA 5IHBA 1NOLA 1JZHA 3MBWB 1MKFA 3Q7JA 4Z18A 2A83A 1MVYA 1OHQA 1R0AL 3U9PH 1ZE3C 3N43F 5I1GH 4JFZL 1YAZA 2EUZA 2MMXA 1GOHA 3O2VH 2XNAB 1CD1B 1EMTL 3EG9A 2MQGA 4L4JA 2GJZB 2J6EL 5JIDA 3VFOB 1X5GA 1QNIA 2DQTH 2OQJB 3IXTA 5IQ9B 1AZUA 4FZEL 3WIHL 2VDOB 3DK0A 4H4NA 3QWNA 2EECA 2GHZA 5HGDA 4GUCA 1XXFC 2HN7B 3E3QC 1LYQA 1XCQB 3IRPX 5HDQH 5KVFH 4UT9L 3MUHL 5B1AB 2ZXWB 2BW5A 1W0WA 4F7PB 3WO3B 2CR6A 2VCOA 4JM0A 3QQ4A 4PRPB 1SEQH 3F7KA 2YFOA 2ZWLT 4JANB 1MFDL 4X6CE 4C56B 3SE4C 2J1ZA 3HMWH 1TETL 2KQNA 3RPKA 4G7RB 4OFVA 1CXFA 1P4LA 3VM5A 1CFVL 3K6DA 2ITEA 1E27A 4UT6A 5IOPB 4C4BA 3PHQA 1CDJA 4LKCB 3GSXB 4PQXA 4FG0A 5KUMA 1WFNA 1YN6A 3II1A 4L3CA 5DMJB 4MNQA 4XMVA 5GS0C 2AEQL 4AEFA 3BAYA 1SDYA 4HH9A 3CHQA 1LGVA 3ESNA 1AQMA 3FF7A 3GMMB 3ARFA 2MNUA 4YZFF 2XFGB 1EBPA 5D7JD 1KCUL 3SKMA 4K9EC 4LLYB 4POZD 1Q9LA 5F71A 1J0ZA 3OKDA 4P05A 4LBAA 1AZVA 3CBKB 2HKAA 4U0RB 2AEOA 4U0RC 4U1JA 4A2GA 3SGJA 4HS8L 3FCSA 3O2DL 1KB3A 2UX7A 3FUMA 5DK0A 4YDVB 1ORQA 3C75A 5ENWB 4HC1A 3SE9H 1OLLA 1HHGB 3V6FB 3BP7A 4C59B 3GXUB 1NCDH 1A2YB 4IGBC 3UFIA 5HYIA 3GBNH 2A7BA 4NGHH 1YNTA 3L5XH 5AUMB 4J4PA 4N0UA 3GSNA 4HUKB 3EYQC 1JCKA 5AW9B 3V0DA 2B0SL 4M7LL 3UZEA 1SY6H 3UTTE 1R34A 3S3JA 2F7RA 4XMKL 4XNXH 1CGTA 3FOLA 4C58B 1QHOA 3AM8A 4WFHD 3RZCB 5KS9B 3RZCC 1YEDB 3S35X 2KC0A 5I0VA 3ZKSD 4Y4KB 4Y4KC 2Q8AL 3BPLB 3BPLC 3THML 3B7TA 3CFDA 2PKDA 5IWLC 1JPST 2EDLA 4JM4L 3T1WA 3ILDA 4NI3A 2YBRB 2R2EA 1MELA 2UVFA 4RMBA 4L3ED 2AEWA 1KXTB 3O6FB 4WY7H 3HG1D 2Y7SA 3O6FC 4IOIA 5E6IA 3UPCA 3RIFF 3ZBMA 4IOSA 1NGWA 4V2CB 5L2JA 3WO4B 4R5XA 3RUGF 3SGEH 1PLCA 4YX2H 1DQVA 4DT2A 5IOKA 4GQ9H 1TLKA 2IBBA 3NBNA 3AT0A 3E8VA 3I3BA 4Y4FA 3ARED 2YQBA 4I2XB 3ZSSA 3UC2A 1HZLA 2GQHA 3H9SB 3O6KL 5DMIL 4AW4A 1G9NL 2BIOA 5SWQA 3Q6GL 1LTXA 3LNEA 5B1KA 3IMRA 2I9TB 3ZL4L 1RJCA 2Y07H 5IVXF 4PI2A 3BKMH 2R8SH 5MEOA 1W0YT 1ES0A 1YA5A 2VLJA 1SYSA 4OLXH 3HNSH 1F90L 3D18A 2O5YH 3EJUA 4M6MH 5BRQA 5DT1L 2V17L 3IU4L 1LK3L 1YN7A 3HZKA 4JRWA 2OR9L 5LCVL 3U82B 1A22B 4X4KA 2XY2A 1JZ4A 3H1ZA 1G6RL 1JPFB 2ZTBA 4LARL 2V7NB 3BT0A 3UJTH 3VYNA 1UXWB 5DZNA 5DLLA 4M9OA 3IDIB 4IRZH 5AD0B 3FSWA 2X2IA 2ODIA 3UP1A 3FT9A 3WFDL 2PTUA 4J1UB 4LSUL 2FX8H 3PL6D 2PCPA 4GSQA 1A25A 4XNUL 4Y16B 2X09A 4Y16C 1JZJA 1NIEA 2BZCA 2DV6A 2O4EA 4A67A 2XTLA 3V0VB 1B0RB 3OMZA 3I02A 4PG2A 4E0RB 1R75A 2XZQL 3D39E 3EJQA 1WGOA 4MJ5B 3K2MC 5KYYB 5C6PB 5I2IB 5KN5A 1AQ8A 4YSPA 4HK0B 3QRLA 1IM9A 1TNNA 1YYMH 3R7RA 3ZIMA 4EUPB 5D2NA 2GITB 2ILLA 3IYLW 2PABA 4Q9RH 1JK9B 2DQDH 3KPMB 4JPKH 1YDPA 2K1MA 2XRAL 5ILTH 1V7NH 4LSRL 4PRIB 5F3FA 3FQTA 4MLSA 3NQKA 3A4AA 3MCYA 4PWFA 2AJ3B 1YECH 1WFJA 4PJ8D 1AHWB 1AHWC 5D7SH 4JAMA 4TTGA 4HV8A 2XV3A 1MQKL 1A7RL 2B4CC 1CLYL 3GS4A 4K73A 1JDAA 3FU7B 1EUUA 2WIIB 1Q9WA 3HUJB 1I1YB 5LO7A 3EYOB 3CN3A 4FXTA 3ORJA 4LEBA 2JLLA 4QHLA 3T3MF 5DVMA 3VGGA 2AQSA 3VDAA 1SXBA 3LN4A 4ZUSA 5D72L 3G5VB 4PH8A 1Q90A 4OUUB 1WDAA 4C55A 5HYFA 1T66C 3DV4B 4P46A 5C2BL 4CVXB 3EOAA 3P4MA 3D3VD 4NHUA 5GIRA 3S97C 5HI3D 3T77A 1MJ7H 2K0RA 3LPGA 4CJ1A 3NRPA 4Y7MA 4M8QB 5F0LB 3DRTB 2IGFH 4H2AA 3HZVA 2NSMA 2YPKA 3DPDA 5T1MB 2RA1A 3VXOB 3BISA 3UEQA 3K1DA 4KI5F 1LM8V 4B9GA 2BOCA 1NGQH 1HQRB 3DHJA 3X3FL 2G75A 5B7FA 3KLDA 5AZEH 1IKOP 1IC5H 4NQVA 5IY5B 5SV3A 1SVBA 4N6RB 4NQCA 3V5KA 3EO1A 4AYEC 2WWMC 3GFUA 4AGMA 1J18A 4HAKA 5C0RH 1S7TB 4EN3B 3B2VL 4W9KC 4DFIA 3L17A 1Z5LA 1BWMA 1J9TA 4G42A 4X9GA 2D73A 5IW3A 4P9ML 4CU6A 5I18L 1FV1A 1IE4A 4PW4A 1NMBH 5CZRA 3ZTJH 2QEJA 1TZOA 3FH7A 5C08A 3VFRB 1V5JA 4GS7C 1PKOA 2P5EA 2H1PL 4JGMA 2H9GA 1O5DT 1ESOA 4XE0A 1CGVA 4EZJA 3BKYL 1P6FA 2FZ3B 3FSVA 1VLXA 3OX8B 2D2OA 4FYTA 5CGTA 4A2DA 2H32H 5CJ5A 1IGCL 3WLBB 2ZUWA 4R7NB 5FYLD 4B60A 2VDQB 5G4OA 2WOYA 1BZ7B 4FHKA 3WNIA 4AH2B 2QV2A 1CK0H 1AACA 3IFPA 1NFDF 4U1HB 2EH8H 1RLBA 5LAXA 4I1PA 1DBAH 2YK1H 3IKCB 3GSQA 3ASWA 4OCXL 5F6HI 1QSZA 1HCFX 4ZAKD 3UOAB 1T1XA 1E4KC 1MN4A 1ZE3H 3O4OB 2C7UB 3KM2A 3O4OC 4N22A 1HC1A 4XPAH 1S9VA 4R7XA 15C8L 1KJVA 2H2SC 1DE4A 2JH2A 2BP3A 4WKZB 3L3JB 1I1FB 4U1NA 4XVJL 4FFYH 1E9QA 2JJWA 3IT8D 2FD6L 2WLIA 4KK5C 2VXVL 4K9JA 3GDCA 4RETB 5CCJA 2VDOH 2VM9A 1YHPA 1EO8L 1NBZA 2YMXH 3H2QA 3QO0A 2XVBA 3P30H 3GRWH 5ABZA 1U92A 3NCFB 1L7IL 4ZXBC 2EDRA 3QZOA 1RUPL 5EULV 1HFUA 1U3ZA 3L9RB 1AD0A 5I1AA 2O61B 3U4EB 4C4KT 4IOFD 3AVEA 3GDBA 3ATAA 4BK4A 3G7TA 3MU3A 1I7TA 5AVXB 5FDWA 4Q14A 3IXAB 5GPRA 4KXZI 1WZ1H 2VDLL 3MV8D 3OLIA 4XMTA 1JZ6A 4LF3A 5FM8A 3SCMB 3K71A 3SCMC 5GS0H 2AGJH 4HFWB 5GS1C 4G1EA 3DX8B 4L1LA 4UZSA 1JPEA 1DBKL 5KBLA 1UTDA 2KLTA 1BYPA 2WY3B 1VSCA 1R46A 2VJ8A 1IC0A 3H2PA 3GD1C 4PY8J 1BYNA 1N6UA 3L13A 4K9EH 2ZUTA 5F3HA 3V7MA 3O3UN 3B43A 4FQ2H 3RVXD 4JE0A 5AEAA 4M9PA 3DSFH 3OB8A 2FDBP 4XVTH 4ZSOB 4M03A 4A7QA 2I5YH 1MSPA 3H4HA 1WBXA 4BK8A 3D0LB 3NSJA 2AAVA 3VGAB 3VGAC 4GQPH 5C0EB 3SYQA 4KJWC 1OP3H 2DWDB 2K78A 4CBPA 2DL2A 5ACMA 5DEGA 4ZMPA 4K5LA 1VFMA 3B56A 4ABVA 4HEME 3STBA 2L0DA 4JKPH 4LAJH 4PB0L 2VN7A 2JKLA 4AE1A 5BS0A 1QLFB 2L8AA 2IAND 2V5TA 3W39A 4JCMA 3E6FB 3MNWA 4FXGB 2VLKA 5A3ID 4NZDA 1CF1A 2ZP9A 1HCYA 3FB8B 1M2OA 4P3DB 4JZNB 3WXVH 5CEZD 3EFOB 2DQHL 3GMRA 4X9IA 3NK3A 4XPGH 1MCBA 1XVSA 3QDHA 4BZ1L 5F9DC 1ZLWH 4M4RA 4OM1L 4PJGB 4CMMA 2DH3A 2AXWA 5F9WB 3O9WB 5F9WC 1T0MA 3HC0B 3IDYB 3SKUD 2CO7A 3IDYC 5F6IB 4TSBL 5F6IC 4DQAA 1DUZA 1GJWA 2XWDA 2VR5A 2CIKA 2J56A 4NJAL 1QLEH 2HH0H 2MPVA 3CXDH 3N6YA 3CVHA 1D2OA 4WF7A 1GZQA 1JK8B 5A2AA 1UACH 2FQDA 3QR1A 4G9DA 5GGRB 4HXAH 3WJLA 3KGUA 4ZNEA 2MTAA 4F7CA 2UY7A 2Q7YA 3QJZA 4ZDHB 4AYSA 4L23A 1GAFH 3S0PA 2BP8B 2WYTA 3K8KA 3K6SB 2A6DB 4NO0D 4NQEE 1N5YL 1H3XA 1HIML 1FNAA 1NOAA 4LXFA 1DDHB 3II3A 4PJXA 4Y5XA 4UANA 4MQSB 5D9SB 1U3JA 4XPFH 2IH3B 3K81A 5AW4B 3EOTL 5HI5D 4OFKA 2W9LA 2OM5A 1PZAA 3QDGE 3C08H 4WDIB 1XGQB 1E5UI 3LYRA 4WRLA 4HXBL 4QRTA 2L04A 3HOGA 4ZS7H 4GSUA 3JBG7 1FAIH 3VXTB 3DO4A 1QSFE 1FH5L 1G9NC 5C70A 4AQ8A 3G6JB 3PV7A 5HHOA 1EHLH 1L3NA 2JJSC 2R39A 3OXRA 1WEJH 3LH8A 4LQFL 3ES6A 4KRPD 5G5DB 3RQ3A 5J6HA 1M1XB 2OZ4H 1PZUB 1MVUB 2OR7A 1TTUA 1OE1A 3TBSA 1RURL 1MI5A 4ZQKA 5GGTL 4QHMA 4RISH 1G6RB 3S37L 2HFEA 3C5JB 4EZLA 2UUDK 4QHNA 5DFWH 1FGVL 1W9XA 5D6DC 4H0LC 4X6DB 1WCBB 2E7MA 2ZCLH 3ISYA 5CO1A 5C0IB 2ZWYA 3UAJC 1N6QH 3D1MC 3LEYL 3SBWA 3VFPB 4N5EC 5HHQA 1MHPL 3Q8EA 4OSUL 2FIKB 3BDXA 2GTWA 5D1XB 3UZQA 5D1XC 4EUPH 1X5MA 2YA0A 4KJPD 2F7OA 1B6DA 4XP9H 4QRSA 3VI3E 1A6AA 4NP9A 2JJTC 3LQZA 1VPOH 3TF7C 1U8IB 2DIAA 4PGDA 4X6BB 4CN6A 3DRQA 3F65A 2Z93A 2B4CH 4GG6B 3POHA 1AKJA 2YN3A 3EGXB 3ZKNC 1E6JL 2EO9A 3CZLA 1HXYA 3NPSB 1NC2D 2A9AA 1KLFA 2W88A 3NPSC 4N2GA 2DH2A 2OSXA 1S78D 3ZTEA 1YY8A 1XR9B 4GKZA 1EZUA 1HH9A 3GRBA 5I1LB 5LLIC 3NFPB 2FBJH 2LV4A 3TJEL 1J5HA 1U2YA 5DJYA 4QHKJ 1JYVA 2I9LB 3RWIA 3CFBA 1YYCA 4D0BA 4AJYV 5E94A 4YHKH 4PJEA 5TFSL 1NQBA 3NCJH 2NX5D 4Q2ZB 3VD3A 3Q2VA 3BESR 5JA8B 1KENH 1KJ2H 5IMKA 4PAZA 4Z3TA 2EDTA 1N2RB 1T2QL 4N8CL 5J0BA 3RTQB 3ECVA 3RTQC 5DD6B 1E40A 3LNIA 4EIZC 1FFQA 3GYRA 5KVDH 1MFUA 4NZRL 4I87A 3SJVE 2CRIA 2EXYD 3SOBL 4JFEA 1CGWA 3I75A 1U3HB 2ED6A 5D7IB 5INDB 1WA0X 5DO8A 1BP3B 2C1PA 2G9KA 4XH2B 4WLCA 3QIUA 1C08B 2P5WE 1ZS2A 2CRZA 4AVKA 4NCDA 4P2OD 4X0KA 3H42L 3WFCH 1NJ9A 5AYTA 5C6WH 4Z8FH 1WV7T 4JO1L 4UT7H 2IDCA 3VSVA 3WKML 1P6WA 3WSQH 3WS3B 1B2WH 5FDYA 4BGDA 4MAUL 1CMOA 4QT5A 5E9NA 5I6NA 4DZ8A 4FQCL 3SBPA 1I7ZA 3BWAB 2WZ6A 3HFFA 4FKKA 1IGJA 2ZCKH 1HXKA 4PJ6A 5DWPA 3R7QA 3K4ZA 1WD8A 1JZ5A 5F1IB 2V0AA 4F58H 5I5RA 4FFZL 2VLME 4UDTB 1EBAA 3G9VA 2VDQH 4LEXL 2B1OA 3PAZA 5IB1B 3DX9A 4I18A 1UUNA 4N9GA 1DSFL 3OAWA 1JNLH 1JN6A 5LWYL 2H32A 4NNYA 4YBLB 4YBLC 1K5WA 4WQOA 3P1VA 4OD2B 1T6VN 2XHNA 3I50H 3ZDYB 4UM8B 1A4BA 1JV5B 4R7LA 4HPYL 3Q8AA 2R2HB 3M1CA 3MRGB 2G3XA 1BX2A 4IRSA 1MPAL 2UX6A 3IMVA 2WBXA 4ZJ9A 1WG3A 4POUB 1DLHB 1H19A 4ZX3A 4JHWL 4DIXA 3ZN6A 3MBWA 1AO7B 1K6QL 2CH8A 2YQGA 3GXNA 2KDYA 5A6MA 2X1OA 4QUOA 2BIPA 1KT2B 1R0AH 2XNAA 1CD1A 1S7QB 2VN3A 4FFYA 4JFZH 2GJZA 3L3KB 3QI9D 2GABA 1LO0H 3VFOA 3FHAA 1BVZA 2OQJA 1EMTH 1E8XA 1E5ZA 4GT7A 2FWLB 5IQ9A 3VU2A 3MRNB 4GXFA 2J6EH 3M1BB 4ALAC 1AGFB 4FZEH 2HN7A 4LOVA 3WIHH 1XCQA 3CZFB 3H7LA 2VKXA 3GRWA 3MTXA 3PHOB 2MFNA 4F7PA 3IFNL 4PRPA 3PUCA 5HYJD 4UT9H 1L9MA 3TIDB 2WLKA 5DHVB 5DMYA 4PVMA 1EEZB 4JANA 1T1YB 5D71L 3SE4A 1A8JH 3AT9A 3SIKA 4C56A 1T04B 4O2CB 4PLKD 1EAOA 2P47B 2Y5EA 4GAGL 5BPPA 1JPSL 4FA8A 2OSWA 3SDDD 5AOJA 3F05A 4JDTL 4R4FL 5IOPA 2FQFA 4ZS6C 4LKCA 3GSXA 1MCLA 1CFVH 2ZXGA 4NJ9H 1TMQA 3T6VA 1B3IA 3UX9B 2HPTA 5JW4Q 1MREL 4J3WA 3TYGL 1O0VA 3TO4B 1HTYA 2VDLB 1LNUB 1IILE 3DC0A 3TO4C 3FUNA 2XVGA 2AZUA 2AEQH 2JV6A 5EFIB 3GMMA 3OPUA 3D50A 4LLYA 2LTQB 2LTQC 2YRZA 5SWSE 1KCUH 4NQUA 1C8QA 3LSOB 2CDFB 3CJJA 4BWWA 1WZLA 2XTJD 1UKQA 4PJDB 4YDVA 5ENWA 2IFGA 1