1LYQA

Crystal structure of pcoc, a methionine rich copper resistance protein from escherichia coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
101
Chain Sequence
AHPELKSSVPQADSAVAAPEKIQLNFSENLTVKFSGAKLTMTGMKSHSPMPVAAKVAPGADPKSMVIIPREPLPAGTYRVDWRAVSSDTHPITGNYTFTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcoC copper resistance protein
publication title Crystal structure and dimerization equilibria of PcoC, a methionine-rich copper resistance protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 18
structure length 101
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1lyqA00
1O6TA 1H6TA 3FAXA 4CILA 3BCFA 1OT4A 4CC4A 3BCDA 2C9RA 2RA1A 3BZ5A 2OMZA 2UZXA 1O6SA 2OMXA 2OMUA 2WQWA 4CC4C 2OMWA 2YA1A 4AW4A 5ICUA 1H6UA 4AQ1A 2OMYA 2WQXA 2OMVA 2C9QA 2WQVA 1NM4A 3FAWA 3BC9A 1LYQA 1XEUA 2OMTA 1M42A 2WQUA 1IX2A 2UZYA 1M9SA 2C9PA 1O6VA 2Y5QA
chains in the Genus database with same CATH superfamily
2CLZB 4YPGB 2X12A 3KL5A 5FYJU 4EN3A 5KSAC 3EH1A 1KB5H 2NY0D 4K3DL 1FPTH 4KBPA 3DRQA 4GAGL 5AVYB 5AZEH 1U8JB 4XCNB 3ILPA 4JDEB 3GMPB 4ZMTA 5F0MB 5JO5A 3IXTB 3L2NA 1J8HE 3LNGA 1INQB 4LOVA 5JPMA 3FHQA 2WWOA 1NGZB 1PZ3A 2LTQC 3NIFF 4WWKD 1IC5L 1SY6L 1BAGA 1WEJL 3OB8A 5CJ5A 5ACMA 1N4XL 3WJLA 1WWBX 2FHCA 4J1UB 2H9GB 2WTPA 1E5ZA 4YFEA 4I2XA 4EVNB 2VW4A 4XMWA 3U7AA 1DQDH 2YBRA 1LP9E 4F33B 3OKNB 4HC1L 3B5HA 3W37A 1D5MA 2XZZA 2G75A 3R18A 3S3BB 1U92B 4PTTA 4U3CA 4Y19B 2Z65C 1NFKA 1ZT1B 3X3FH 3MZTA 5AL0A 1S8DA 4X4ZA 4FADA 3H6AA 4KRMB 1IAII 5M95B 2ZYHA 4X9YA 1O75A 3FU0A 5FECB 5SWQA 3BIBX 5KVGE 5D9SA 1CTOA 1DSWA 1TYEB 2VDPL 4MD0A 1V55B 4IBUA 4MXVE 5FHBH 2D0GA 1JZ5A 1WAEA 2DYPA 3FCSA 2F5BL 2X38A 5DD3L 3E9TA 4F8NA 1LMKA 4WO4D 2H1LM 4KTDL 2WYHA 5D4HA 3CQPA 3IPFA 5DK2B 1R17A 1MUJA 4ODUA 4RNRA 3NCFB 1XSOA 2YIHA 3KDPB 3DIFB 1KJ2L 3ESVF 1N59A 4PRPB 5CUSH 3GSXA 4JKMA 1E6OH 3LNHA 1Z7JA 2E3VA 1ORQA 12E8L 1LP9F 1U6AH 2A77H 3RZCD 3BT2H 1S9WB 3EJUA 4HWUA 2CWRA 4YAQB 5KVFL 1UJ3B 1FE8L 1JGLL 2WAHA 2YJLA 4HJJL 4W93A 3B9AA 5ICYB 3WLBB 1T6BX 5AVZB 3BLBA 2IPKA 1FV1B 2YQ3A 1T5WA 3FCTA 3SYOA 5H94A 3WXWL 3KM1A 2V0AA 2CZNA 4OJDH 1DJZA 4N26A 1KLGA 4P59H 3N06B 1UB5A 1QSEA 3QEUB 4O2FA 3SDCA 5EORH 1M71B 2ICEB 5EU7C 2BRRH 1CFSA 3VXNA 3CFJA 5DI8B 2QSCL 3H6JA 2P80A 1N2RB 4I0PA 5TE7H 4IOIB 5I1DA 2PYFA 3P11H 2L7UA 2NNXA 3LXCA 1J1XH 2RIKA 3N1GC 5M94B 1RJLB 3UOAB 5F7YC 2FX9H 2IF7A 3TJEH 4S1RH 4G8GE 4TNGA 2VKWA 3X1FA 1UUSA 3QIUB 1UGNA 1YEFH 1S9VA 4YHKH 3VXUA 4GQRA 2I60H 4G5ZH 4WFGD 5KTEH 5CN3A 3Q2WA 3PHQB 3T5WA 1I3RB 2K4WA 1KACB 3MRKA 5JW3L 4LLVB 1SUJA 4H0IA 1L5GB 1X5FA 3TIDB 1JCVA 1PX3A 3RX8A 1JZ2A 5IVZB 1F3RB 4RX4D 3GKWL 3CZEA 4TL5A 1PJWA 3RL1B 1K5NA 2EDKA 3VMNA 3MJ9L 4N9GA 3BVTA 3GXMA 1F90L 1HZHH 4AEIH 1G7JA 2XT1B 3DO7A 4UNUA 2LHAA 4OI7A 1IIIA 3S3CB 4ELDA 4D9QE 1BEXA 1EGJA 3X11A 4OQ1A 1EANA 3MXVL 3MRLA 1GGCL 1QR4A 1B0GA 3LZQA 4NN5C 2VLJE 3AY4C 3PWPA 2JH2A 1DN0A 2ZP8A 5GS1C 1BMWA 4XRCA 4F7CB 4R2GD 4M3HA 1JZEA 2J6EA 4R0LB 2ICCA 1FZOA 5ECGA 4N0UA 3FT0A 1YDPA 2H2SC 1AP2A 2WXQA 3INUH 2YUZA 3TZVC 1UYWH 1OP5H 5C7XH 1NUNB 5A6MA 1KT2A 2P5EA 1RZ7H 4AYEC 1BJMA 3BESR 3D39B 4MKMA 3VFPA 4CBPA 1JHTB 5JPNA 4CN6A 3NZSA 4EQ2A 1E9QB 1X3DA 1T7WA 4HUKB 4OF8A 3U4AA 3BAWA 3WKPA 5FO7A 1U3JA 4JHAH 4LVOB 1DQLH 3ZMNA 4R7XA 2WQAA 3NABH 4C54A 4Q4IA 3MRNB 2X4QB 4TOYH 4J4PC 2OMYB 5D70L 5K9KA 5DGRA 3D6GA 1ZVHA 3MJ7B 5LN8A 2P49B 2C34A 4L29A 5EC2A 3QDJD 2IQ9L 4IKJA 1V27A 4NHCL 5J57B 5DJ8A 3OHXB 3N42F 4MWFA 2NY4C 1QWNA 3FO2B 4ZO9A 3H9SE 2YD6A 5ID0B 1GZQA 3RGBA 5SWZD 1SJMA 3JWNE 4ZAKC 3KPSD 3E80A 5E1HB 4HT1H 4EN3C 1G6RB 2FH8A 2EYTB 3T0AA 1BJ1J 5IMLB 4TV3A 3WTVA 2IADB 1PDKB 4FRWA 5FKAA 3P4NA 2P5WE 3EYQD 4E42A 5AVXB 5MENB 4JFXB 2YRLA 3MJWA 3QEQA 2EIJB 3RDJA 3KZ8A 4BIKA 2BVUA 5JPMC 4FKEA 1ZIAA 1JZ7A 3IS0X 3D0AA 4F58H 4FYQA 4YDKH 3UTSB 3GINA 4JDTL 4K9JA 2PETA 4JGNA 2VSMB 1Z5LB 4WU5A 1ZV2A 3TCTA 1NCJA 4TS6A 3CFBA 1TVHB 1PLGL 2G2NA 3OBAA 3LDBB 2IGFH 4S1QH 4MJ5A 2NXZD 1WIUA 2PTUA 5HHPA 2DM7A 3GMLB 1UXSA 2J1YA 1GS7A 4LNVA 1AAJA 1ND0B 5A2CA 3TBTB 2WO3B 2FSEA 1UZ8A 1GY1A 4UINH 4CW1B 3QAQA 3T9WA 3FU6A 1PD1A 3HAEG 3UAFA 1BYNA 3O6FB 5C1MB 2ZG2A 4PS8A 1NEZG 1MEXH 3TT3H 4QAWA 1U3YA 4WHYH 3V8OA 1YEJH 4M3KB 1TVBA 2WLMA 2XKUA 4ANVA 2Z91A 2D2CC 4KJPD 3EYOB 3D51A 5ESVA 3O2VL 4BGLA 3N55A 5I15L 1J5IA 3AWFA 4E9RA 1W0VA 3VFGL 1JJUA 2N7AA 4L8DB 1DQJB 2BZCA 1ED3A 1LO3H 4Z7UA 1P7HL 5G5DA 1LTXA 2YO3A 3NUKA 4F7PA 4MD4B 2DI7A 4B95C 4UT9H 3I6GA 3O6LH 5DMYA 2QADC 2BNUA 1UWEL 1PG7X 1KENH 3QJFB 1JS4A 3ELQA 2Z8SA 4AE1A 2EC9U 4Y2DC 4FKHA 3VO0A 2H0FA 2OR8A 4U1MB 4L4JA 1D5IH 2ESVA 4RMQA 2MWCA 2WLKA 2OCCB 4Z7QE 3SDCC 2CSPA 3ZR5A 2C9QA 5CCKL 5AWNL 3ARFD 5ABDE 2NW2B 4QOKE 1MH5B 2WP3O 4FXGC 4UBDC 1R33A 4RBPH 3OAUH 4L8CB 4I0PC 2QV2A 3NRQA 1PKOA 3CX5K 2OQJA 2ZG3A 4FMVA 5I1CH 2HT4C 5TDPA 3BKCH 1CT8A 4LL1A 4W9ZA 3F3HA 5ALCH 2B1OA 2VLKB 4NFCA 2PWDA 3MR9A 4U1GB 2BNQA 1YEKL 1Y7VA 1FORL 3OJDB 4ZFFA 4X6EA 5AOMA 4EEEA 4X4YA 5DD1H 1EJ8A 1IM9D 3FRPA 3VCLB 4G1MA 1NFDA 1QBML 5DYOA 3U25A 3KBHE 4G8FB 3I85A 5D7HA 1SF3A 5E9DA 1PZ5B 4AEHL 4M1GL 3HCVB 1E30A 3DUSB 1MDAA 4OVUA 1QO3B 3N43F 5E7BA 2BMKA 1HN1A 4OF0A 1ECYA 3EYVA 3NCJL 3ZVVA 1IGYA 2XVKA 3SZKC 3ZYOA 2F7RA 3MCKB 4OLZH 1Y6NR 4YPJA 3A67L 3MCG1 3FRPG 3JUYA 4NPYA 4XB8A 1I7ZB 3OAYH 4O51B 3ABKB 5BJTA 2UWEF 3DK0A 3EFDL 4U1KA 2WUCL 1KTDA 4NWTH 5C0BD 1FJ1B 1FYTA 1MW0A 5AW6B 2XWEA 3QDGA 1OAXL 1EFQA 5J6HA 4K0OA 3Q01A 3S96A 2QKIB 2EEFA 3DX3A 4FTVB 1DFBH 2HRLA 2H8PB 3EG9B 1U58B 3O11B 1FDLL 1ZWIB 5CLYA 3O41B 1QI3A 3GHBH 1ZLUK 4WEBH 1KC5L 1QFPA 4HIXL 4HPYL 1EVUA 2FJHA 1EUTA 2Y3NA 5JPNC 3QR2A 1IKFH 3IBEA 3JTTA 3O8XD 1KPRB 3DOHA 3LB6C 2YK1L 1ZK9A 4PP1C 5JR1H 4DN4L 4PI0A 3HZYA 4G7YH 3DBXA 4HALA 5I5IA 3ULVH 2WXFA 2P7TB 1IAIH 1HH9B 4JCWA 4TNEA 1FL5A 3T6WA 1MHPH 3ILQD 3P02A 1OGAB 3MLUL 5BRZD 3MQIA 1KTLA 2E9BA 3V55A 1Q38A 4X7FC 5DUMH 2M8XA 3WAJA 4MTMA 5I1GL 4NQDA 1NCWH 1NC4B 35C8L 3MV01 2GJPA 4IJ3B 4UILH 1PCXA 4YWGL 2XTLA 5TQ0H 5FFLA 4MJ4A 4AZUA 1C5BL 1RAMA 4CU8A 1PF3A 2NR6A 3QEHA 4NCC1 4AQ8A 2KBGA 1UATA 5C0JA 4P3DB 3IDJB 5HVFB 2X09A 2DBJA 3CDZA 1EXGA 5IB1B 2ZUXA 4TN9A 5EEVA 5DSCA 5LBSL 1FLTX 3I50L 3BSZA 1UKTA 2FYYA 4H8PA 5IB4A 4R4FL 3OPZL 3BX7C 5A2LH 5CO1A 1VADA 4H8UA 3C6LD 4NZ8A 5JOEA 3ULVD 1HZLA 2ARJA 3ARUA 4JM2B 2AVFA 3UBXA 4C4KT 4G2AA 4AW4A 4NSKA 1A22B 2A74C 2OP4H 4M4RB 4W81A 5FKPB 1KJ3H 1U8PB 2WNGA 3QO1A 4BQCA 1VGEH 2QSVA 5A3IC 4WI3A 3QUXA 3RURA 1VERA 3ZHNA 4E9SA 4HETA 3QJHB 4APQA 1FIGH 4NUPA 1MKFA 4OM1H 1QR1B 3UBXG 3MGOA 3IFLL 1H8LA 5KN5B 1M3JA 4YC2C 4AQOA 3FUHA 4TUJB 1W8OA 5HHXL 3N44F 3QIBD 5FLUA 1PYWA 2VSKB 3X2QB 4HISA 3NSJA 2F53B 2IC2A 3QDMB 3QQ4B 5LGJA 3NAAH 1T0MB 2MQCA 1F4YL 4HWEL 4L2LA 3OPUA 3PGDB 1E27A 1Y1DA 5AQ0A 1W2KT 3APDA 4XVJL 2I9TA 2NQDA 3A6OA 5I6XB 1A4KA 2V2TB 3ARPA 2YWZA 1SOSA 2JVUA 4NGHL 1HEHC 4EUPB 2HA1A 3KCWA 4ZQKB 2W9LA 2GB2A 5GISL 2NNAA 2Q8BL 4ODHH 4JRXB 1GSKA 1N6VA 2XX1A 5F9WC 1PJ9A 3CVIH 2QT6A 4Y4FD 3BRGC 1OALA 1REIA 2HKFH 4JG0L 3TN0A 1Y18B 1W6LA 2BOCA 2L7JA 4J12A 2YC1A 4QHKJ 2OTUA 2FJFA 1OLZA 4RA0C 1PPIA 3M45A 4TTDC 2ZD0A 2DL9A 1JNLH 4LAQH 4Y5XB 3Q5OA 2F9BT 4MHHI 1JZ4A 3SCMB 2P48B 3L08A 3B37A 3EJSA 1RLBA 1X44A 3VXPB 1BXUA 3KYNA 1HHKA 4HHAB 2X2IA 4JO1L 4ZUUA 2XG4B 2DPKA 4RMSA 4XNQB 3TWCL 4K3HA 3AREC 5BS0B 3WKYA 1BFSA 4GI6A 2Y2YA 5DUJA 4XCYA 1QEXA 1KJVB 1CLYL 3GPEA 1C9SA 2F7IA 3P54A 3RIFK 4XAKE 1SXCA 2X6UA 3L3KA 1J87A 4OFYD 2J4WH 4KU1A 3ZQ9A 3GB7B 5TE7L 1KNOB 5DRWA 3QZNA 5ISZD 2PCFB 5DMKB 2BIHA 2ENJA 4MDIA 3OKMA 2JIXB 2EVFA 5TFSH 1F02I 3EJYD 3SDAA 4LO9A 2J1XA 4ADIA 1FZJB 2V33A 4B7LA 2D7TL 3BAEH 3HS9A 4FYTA 2VZ1A 1D6VL 5DMGC 1GSMA 1U8CA 4QJ3B 1G9MC 4Y1AB 2J8OA 4I4WB 3GSQB 3RB7A 4XH2B 4QD2E 4V1DA 1JYWA 5GSRA 2K9UA 4OZHA 1QLFA 4HIQA 2W5PA 2XWXA 1RZ8B 1HJCA 3WY1A 2GTZA 2HG5B 3ATFA 1E8WA 5GS3A 1S7RB 3RKPA 1DBKL 3BP5A 3NJNA 5DYFA 4EZMA 1JXFA 4LSSL 1VAHA 4TQPA 3OKKA 3BCDA 3MRDA 5I18H 3LSOB 1F13A 2XUWA 4XHJC 2R2HA 3KD4A 3H0TB 3TPUB 4DPBX 2W92A 3K71A 2WXLA 1EWHA 5I0XA 4I18A 3AWEA 4U6VH 5EU6A 1T2QH 2MIZA 2Z1KA 4YDLC 1LQBC 5G55A 1VRSA 3QO0A 5L7XH 1NCUA 1YYML 1EGJL 2WTRA 4JO2L 3U83A 1AS8A 5I2IA 1KV7A 4XI5C 5DRNB 1X9LA 1Y0LA 3AS3A 4NFDA 1P6WA 1RUAL 3TU6A 2J6EL 3K8MA 4HS3A 2J5WA 3O2DA 1XGTB 2AQ1A 3U30B 3PFQA 4YO0A 2F1AA 3TIEA 3EUUA 4OIBA 4MS8D 1AHWB 3LKOA 2RAMA 1X7QB 3BN9C 4KRPC 3M8OH 3O45B 4ENZA 4H0HB 3FB6B 2YFOA 4PJHF 4AYDC 1OSPH 4NZTL 1CK0L 3N1PC 5FDWA 3V0GA 4AQ8C 3EOAB 2PWEA 4KTEL 1H3VA 2G60H 4C56E 5IB3A 3Q3GA 2CRMA 3MCLL 2HMID 2H6PB 4QF1B 4I13B 4J6IA 2QHLA 5FIEA 1HI6B 1P4IH 4IIQB 3Q13A 1H15B 1QEWB 5C09B 1UD8A 4ECNA 4NQEB 4QTHA 1AQKL 3US9A 1TZAA 2WWKT 5HGHB 2Y24A 5B38A 4M8QB 2ZX9A 5E0FA 4JR9H 2IO5A 2P9RA 4AVKA 1NJ9B 2QGBA 1N64L 3RB5A 4OD1H 2IDUA 3DJZA 4TVSa 4FYSA 1X5KA 3AW5A 4M7LL 4OCWL 4PSRA 2XWTA 3NZHL 2G2PA 4DGVH 2GBTA 4HF5H 4X4ME 1CC3A 1R3JB 3N04A 3BDYL 1PG7L 4OI9A 3UTSE 3QUXC 3EYSH 3NFNA 3P4OB 5B38G 3SO3C 5I6PA 1J8KA 3VWKA 5E5UB 4APQC 4J5VA 2LAAA 4UT7H 3PV7A 3MV9D 1DE4A 4PAZA 4WFED 1XB6A 3VFNA 3CHQA 4U1NA 3D69B 5E23A 3RLSA 5F89B 2YQBA 4OCRH 3TV3L 3DTXB 3UZEA 2GSIA 2QZ5A 4XODA 4TLSA 2ERJC 3VH8B 2WINA 4JRYD 3HHSB 4G9FA 1L9QA 5EOCL 1TTFA 4XPTL 1HHHA 2NDGA 4S1SH 4ZFGL 5KJRH 2CCVA 1CD8A 3FUFA 4I3RH 4B97A 1QSZA 4UTAH 3DO3A 2WBJA 3QEGL 4CDHA 5DRXA 1QUPA 5JW4Q 4P23B 1EFXD 4BELD 2D31B 4IIZA 5DURB 4XPBH 4A7TA 3EFOB 4YSDA 5HHMB 1A4CA 1TG8A 1YJDH 5BV7L 4MXWH 5IFAL 1OHQA 3VXOB 3FU7A 3ARYA 4X6DE 1F4HA 4QXTB 4L0PB 2P46B 4P5TB 1UC6A 5GIRB 3TN0C 2HVJA 3NYKA 3GS7A 2XQBH 4JM0A 2WTOA 5HSFA 5D7IF 1E5UI 4WFFD 2JQAA 2K9FB 2QVMA 5ALBL 1SZNA 3LJ3A 2ED6A 2O61B 1V8HA 1WAAF 4QYOB 4MNQE 2E6PA 1HILA 5IFJA 1Q0XL 4DH2A 1KCSH 4KXBA 4FQ2L 3QC6X 4TLTA 4F24A 4H88H 4Z76A 3RWGB 3LKNB 5KW9L 4YH6A 1E0OB 5C92A 2NT0A 25C8H 5EFIA 2BIPA 1KENL 2VW7A 2IWGA 3H3PL 3QS3A 3WN5B 1OTSC 4K5PA 3DVNB 4X6BB 3JQOB 3C2AH 3TA3B 1JZIA 2OCFD 3VJ6B 2M1KA 1MSPA 3MREA 2PW1A 2ITEA 1I1AB 5KYWB 2FJSA 4PJEB 3NSFA 4HJTA 4ODXB 4OGZA 2I07B 3BFQG 5IREA 2EC8A 1TSRA 4PY7B 4X6DF 1LK3H 1T83A 1USQA 2VQ1A 1RIVL 4G6KH 4DKFH 5C0RH 1U8LA 2VDKL 5GZOA 5C0DB 4TUOB 2CG9X 1I8MB 1UURA 5JW4M 3KLAB 2WUBL 5H37A 3SDAC 1CL7H 2CM6A 2DZEA 3ARDB 3GHEL 2UWEA 4DGUA 2EKSA 5C71A 3LPFA 4KHTH 3JSSA 3FU3A 4TQIA 5HBBA 4DOHB 3FW6A 3KWWA 3BZ4B 2CXKA 1CGUA 1PKQB 1XH3B 1IBGH 4GLRH 1QSFA 1GC1H 2BSSB 4UV7H 5E2UH 1J8RA 1RZQA 5BRPA 2E7BA 5CP3H 4NKDB 3IDXL 5H37G 1KUMA 1OPGL 1FAIL 1WS8A 3S3PA 4ZPVB 4OZIE 5TE6H 5I1KH 2RBLA 3C60C 3RIFF 3EF4A 2W91A 4LLMA 2APVA 2IV8A 4Y16D 3RWFA 5I26A 5I5RA 2D9CA 4DEUA 3HBQA 2NXYC 1JYNA 4RWHA 1G9ML 1B6UA 1BSIA 3D33A 3HHMA 5HPMA 2BIOA 4WUUB 4E9WA 3DPDA 4D0DB 2Q1EA 3MO1B 2MFNA 4FTVE 2X87A 4I1NB 3FTGB 4IRJA 1CGSH 1UD6A 2BP0B 4OCNC 4QTFA 4UQ9A 2EEBA 5IMKA 2NW3B 3CVBA 2CIKB 2G2RA 2PPEA 1OP3H 3BUDA 2R9HD 3F00A 3L3DA 5JW5A 5DHYA 2WXPA 4GO8A 4Z0BH 2Y5EA 3ABMB 4RQQB 3ZHDA 3KPMB 5T3XH 5L2KE 4OZIF 2C26A 1JUFB 1N67A 3FQRA 3OM3B 3C5JB 4I7ZC 4YBLB 1XH1A 1XR8B 3HN8A 1OGAE 4M6MH 1JGVL 4ZDHB 3Q1SH 4XGZA 4YX2H 4KO7A 2Y1YA 1BQKA 5C9JA 1NBVH 2J43A 4QRPB 4J3OH 3WEXA 3HR6A 1WZ1L 4NKOB 3UJIL 4ZFZA 3U36B 4ZW6A 2ATPB 2C9VA 2XXMB 1L0PA 4F2MA 4Y9GA 4ZFOB 3LV3A 1B2YA 4X5WB 3V4UL 2LGNA 3TO2A 5KS9A 1JPSL 4M48L 4PJ8A 4JHBA 5FFOA 4LSVH 2ICWA 2VDRB 3H7BA 3ZKSD 4YSSA 3V4VB 2EUXA 1BHGA 2WLLB 5FW6A 4XMVA 3PIQB 4R7NB 4K94H 3HG2A 5CBAA 2Q7YB 1FRGH 1WFMA 1ET8A 1P1ZB 5L2JA 5GZNA 2OR9L 4L48A 1RZJL 5T3XD 1OF0A 3RVUC 4PV9B 4NRXB 4PJDA 5LNEA 1JNHA 3WFCH 1DVFB 3MA7B 3BSZL 2GPZA 3RPIA 3ZTDC 4F7TA 3Q43A 4YXKL 4OT1L 2R2BA 3PJSA 2QDVA 4RWYH 3D07A 2VR5A 4OLVH 3UZEC 4Z7NB 1AY1L 4Y9CA 2R4SL 4YL9A 1OB0A 4J3OD 2JKJA 4MNHB 2XBDA 3V52H 2VDML 3OX8B 4ZMNA 5MEOB 4FABL 1SYVB 3GIVB 3UAAA 2W65B 5F6HI 3QUZB 4ENED 6FABH 2GW5A 2LFEA 1AGFA 1U8HA 3EJCA 2WJ7A 3BH8A 1MVUB 4ADJA 3DX6A 2X4TA 4Y4HD 2WBJC 3T0ED 2PNDA 7FABH 4HHGA 5EIIA 3FOLB 2IAMB 2WHVA 1XGQB 2ID5A 4Q58C 3QDME 3GUFA 2A0LD 4TUUA 3UBHA 2KZBA 4XMLL 3OKYA 1U9KA 2AJYH 5C0AB 1I7UB 4KZEL 2LU4A 1O6VA 2HFGH 2NY0B 2WD0A 4HDIA 4OQTH 1XF5B 2VMFA 1NQBA 3IFOA 3MACL 5I16B 4R4NC 1F6FB 4AK2A 3GMQB 2B1AH 3O4LA 5EIIG 5EF2A 1OT1A 2OX5A 3CBJB 1MW1A 2UXFA 1QRNE 1NGWA 2IQAB 5F7EH 3QORD 4JRXE 4WWKB 3RDTD 5KYYA 2OSYA 1IB5A 3RWJA 3L81A 1A6WL 5C7ZA 5C0FA 5AEAA 4FTDA 3NCBB 1BWMA 2FNWA 5IB2B 2CRZA 1AXSB 2QVTA 3TCLA 3ZZ1A 1ORSA 3HIZA 4KNUA 4LCUB 4NO5A 2A3TA 2BIMA 2X0VA 3QUYD 2K6WA 3MRCA 1WFOA 3L6FA 5IVOA 3QR1A 3HZ3A 3COOA 2PF6A 1RD6A 2ILLA 3KHOA 3KYOB 3QNYB 3SKOB 3UGXA 1MZYA 1MJJA 2E74C 2WC7A 2OMUA 4N87A 1M7DA 2K1MA 3JTSB 1JMZA 1I3GL 3W0WE 1W6WA 2VN6A 2UY6A 4LASH 4QHNB 5FA4B 2ZQKA 1T83C 5GGSB 1FVEA 3LVEA 1KB5B 3MFFA 2H0JA 3TF7C 1WZAA 3NPSB 4HJEA 4L5FH 4YK4B 2HX8A 3DI2B 4HK3N 3VRLE 4P99A 4K3JH 1NIFA 3C5SA 5BVJB 1JHLL 3KLDA 3P4MA 1AZUA 2QQLL 1WFUA 4MB3A 4OM0H 3ZGIA 3VD3A 2GITB 3KWVA 2ZWKA 4LGRB 2BX5A 2K3TA 3PWLA 4DVBA 4AUUA 4P4KA 4HJSA 3RZCB 2FHBA 4TSCL 1A7PH 4G43A 1MN4A 4Y1AE 4JFEA 1FFNA 3QULB 5L4MA 2B2XH 2AEPH 4R5XA 2YAPA 2BNRE 3EO1B 1GL4B 3FB7A 5C3TA 3S2AA 2JB6B 1YNTB 2BCKB 3MYJA 3VW3H 3VD2A 3QNZA 5LGYA 2ED7A 3F62A 2UY7B 5EF3A 3CZLA 3UZVB 3IGKA 4RMWA 3RTQD 2EDTA 1S7VA 4LNRB 4ORZC 4FL4B 2D7MA 4OV6F 5EH1A 5AAPA 3X1NA 2ZAIA 2AJUL 4QGYA 2C3GA 1BFOB 3KBEA 4RDQF 2ZSWB 1NOFA 3E0GA 1JK9B 4H20H 3VFSB 2AQRA 2PLTA 3VGGA 4KTYA 3DPBA 2X3BA 4U05A 2R0ZH 1DEEA 2IWEA 3S97C 1OAQH 2GK2A 1A6TA 5GGTH 4OUOA 2YSTA 3NSXA 5DUPL 2D7OA 3N5AA 4PJHA 1S5HA 2IDSA 1KMGA 2X4SA 1XBDA 2Y23A 5B1AB 4UWQB 2CKNA 3P9WB 3RWCA 1SBSL 3JV0A 3ALPA 5T5FA 4DWHA 4LSPL 4K3EL 5DF0A 1A6ZB 5CHNA 5KSAD 1XAUA 4ISVA 4MNGB 2ORBL 3O2DL 1VFAA 1XEUA 3D48R 4WI7A 4Y5VA 5I24A 3UTTD 4GP4B 1RIHH 3QUKB 3FQXB 4Y9FA 4TRPL 2X40A 4KXZH 4PJ8C 5HYQB 4XE0A 2I5YL 4L4VA 1AIFB 1E5AA 2UUDK 5B3NA 1LE5B 4JDVA 2CIIA 3NCCB 5CNHA 1VEOA 3ZMEA 1P84K 3KDMB 2Q6WB 1X5AA 4D9LH 4R2GB 2HVKA 2P45B 4HA1A 4MAUH 4MJ6A 3BEWA 4NQEE 4NO0A 2AJ3B 2ZAHA 1AZVA 5D1XA 3MRQA 5LXGH 4UOJA 2PXYC 2F08A 5TQ2L 5CEZL 4G80B 5GZNC 5ANMA 1O7DE 5KUKA 4ETYA 2IFFH 4YN3A 3W11D 2BY3A 3HG4A 2PCPA 4ODSL 1HYSC 1JVOA 3P30L 3L17A 1RLWA 1JPFA 2QPSA 3I2CH 2XWBB 3T0VA 4AIZB 1M57B 3AS2A 2QLVB 4BFNA 4F57H 4LPTA 2H41A 5GS0L 5D7SH 4HLZG 2BFVH 4R7LA 1TPXC 3CN3A 5H2BA 3RNKA 1A6AB 4M61B 1T7ZA 4JS7A 2EYSB 4G3YH 3LS5H 3D2UA 4FNTA 3QDJB 1S7TB 2DEYX 1H0DA 4JW3A 1GMEA 3Q44A 5CEYB 3AU0A 3PWVB 4Z6AT 3QCVH 2AC0A 1FCCA 2DL2A 2IAND 3LPOA 1BQUA 1ETZB 3WG7B 4G70B 1HNYA 1Z32X 4FXKA 1P4LB 2JKRM 1Y1UA 4XC1H 5D7LE 5CN1A 1O9VA 3RJDA 4ZW3A 4P5KA 4YSRA 1DHKA 1L6PA 1ZD6A 2DBLL 3BGMA 5SWZB 4I3SH 1XL6A 4HIIB 4BH7A 1EPFA 1WH0A 1TJGH 2KL6A 3KPSB 3ML9A 2FVNA 3BH4A 5HYSA 1XWVA 1QNIA 5D7IA 5KVDH 4FNUA 1HXYB 3REWB 3AADB 1WCBB 4WW2F 3WTYA 1WAAA 4OJFH 4U33A 1MFBL 1IZJA 4IM8A 4AQEB 4ZZFA 5JIHA 1HWHB 5DLML 4XP6L 2E56A 5FHAL 1IGIH 3KPOA 4WWID 1A1NA 3FTSA 1EEQA 1HHJB 1S7QB 3APNA 4NUMA 3CFEA 5FLVA 5HYSG 1FNSH 1F97A 4N5EC 3MJ6A 4AM0A 2L8AA 4KKCC 2FHFA 2VERA 3R4RA 4L1HA 4TVUA 1JSYA 5C08A 2ZUYA 4AQ1B 1OARH 2NXZB 3FFDA 1KN4L 4F7EB 2FD6H 2KPNA 2V5YA 3JWDC 2OJZH 4PJAF 1TJIH 3I9GH 1RZGB 4RZKA 4TTGA 1IEAA 3HLKA 4MZ3A 4Z7VB 2PYED 4UNVA 1RUQH 1M1SA 3RU8L 1ZPUA 1EBAA 5FYJH 1CXHA 5KSBA 2BCMA 2AAAA 4E9XA 4JPSA 3TFBA 1Q1PA 2R4RH 1KEML 3ECUA 4LLWB 4RZCB 2A9NL 2P8MA 3V6FA 3QE5A 1BQLH 2YN5A 4PJEE 2B59A 2Q86A 4QXVA 2ZOKB 3PG2A 1OGSA 1RJZA 3GSUA 3RUGB 2DWDA 5CR8A 1ZHKB 3F7YB 1T03L 3PF2A 2C8NA 1CLVA 4ELKB 4GUPA 2IH9A 3TEXA 4P4KC 3AROA 3HW7A 4CJ0A 1S7WB 4KROC 1UEYA 5EZIL 5EUKA 2H6OA 3SY0B 3M17B 2XN9D 4U0RC 4HKZA 4LRNH 5HHVH 4DSYA 4LPYA 4PGDB 1U93A 3N3EA 3MRGA 4KUCF 2NY6C 2WZAA 3ZDYB 1IGCL 4TULL 4ZMQA 3L1GA 2D3JA 2H2SD 4N1EA 2EH8H 3HPLB 5T33L 1FSKB 2VQ4A 3DMMA 1MFAH 1YAZA 1YMMA 1ZLEA 3CHPA 4UMGA 2OMWA 4X4XA 4IMKA 4AKQA 5FK9B 3RI5K 2ZF9A 3BP4B 2Z4TA 1A0QH 1HH6B 1ZGLA 1A4JA 4IS6A 4JG1H 3K5SA 1J05B 2VE6A 3ARFB 4OF3A 1OF2B 4FKKA 3C2SA 1DCEA 5E99H 1JNNL 1BZQK 1EDYA 3DV4B 5TE6L 3MRIA 1SEBA 3CFDB 1Z66A 3TEWA 2NT1A 3BDBA 4FFZA 2XN0A 4UIKH 1MRCL 1ZEAL 4WUUE 4J4PD 5EOQL 3HLAB 3K81A 3DDFA 4XVOA 1P5UB 1FF5A 2ZKHL 4GQ9L 2DWSA 5KYXA 3FQUA 5A2FA 1BQSA 1FZMB 1IM9B 1TEFA 3HKFA 4FZ8L 4MBRA 4Z9KB 3RY6C 2WQXA 4NQCE 4DQOH 2ITDA 3L1EA 2QPFA 2CPUA 4YFDB 3FZUC 4LBEA 1H3PL 2XA8L 1MCPL 1IL1A 3P73A 3I3BA 4ZAKD 3B8SA 3VG0H 2H3XC 5F6IB 1UOWA 2H32H 3HTLX 2A83A 4EN3D 4LOEA 4LCCC 1Q9WA 1HYRC 3PWUA 4MMZB 4P9HH 4PM1A 4ESKA 4FQXD 5JOFB 2C9RA 5CJQL 4L1LA 4PN6A 3DUHA 3Q8EA 3BD5A 1JPTL 4BFEA 4HWBH 4U3XA 4Z18A 5BZZA 1PQZB 4XB3A 1OAZL 5JW4N 4QRPE 1TQBC 1XCQB 5C0BB 3S8GB 2JJSA 3IPBA 1QBLH 1CU4H 1YY9D 2XG5B 3UYPA 1FFOB 2ED9A 5EDSA 3RZWA 4OJCA 5LN4A 4G1EB 4MCNA 4Z1PA 5D1XC 2PW2A 1F3DH 2TAAA 3HUJE 2NQ3A 4KY2A 3WFDH 3W2DL 1T20A 4Q2ZB 3P9LA 5TH2B 1WFTA 4M1DH 1X5MA 3ETBJ 5ESQB 5K69A 4CL7A 5I71B 5F6HJ 5B21A 3U4EA 4ZW7A 3UBXI 1KEGL 3I75B 2DW5A 3KGSA 3O8XB 1RMFL 3LQAH 1CD0A 2X1PA 1MWAA 1HL8A 2XV3A 1INDL 3HBPA 1KIUB 3K2UH 3MLXH 4ILDA 4L3CB 1AQ8A 5KYUB 1OAYL 5DGQA 4TLKA 2DD8L 3CCHB 1P9MA 5D6DA 2DB8A 2H6UA 5F7WC 1E9PA 5BRZB 2WLIB 2Z4QB 2H1PH 4HXAH 4R97C 3CFKA 4BINA 1Q1JH 5IBTL 5EBMB 3TJHC 3S34H 5IGXL 2OAAA 3FC8A 1JMXA 4BFIB 1T3FA 4XMPH 2E27H 1RURL 3HN5A 3MOBH 2B5IC 5D1ZC 1CGWA 2VDOL 5TK4A 3VMOA 4BZ1A 3HUJF 2EE2A 4MB5A 3TGXA 3V52L 4LKCA 5JOPD 4KZDL 4MCZB 2VDNH 3D18B 1DANU 1MJ8L 3ET9F 4X0KA 1FFRA 5IBUG 2FUTA 4BGDA 1IQWH 1ZT4B 3NRFA 5D2LA 3VFOA 2QADD 2P4AB 3P3YA 3OMIB 4GKZA 3Q8FA 4Y2DD 4AGQA 2ZCKH 4WGVB 1YY8B 4JG9A 5C0AE 2R0KH 3MYZA 5AOZA 1QSED 3SDCD 3OLIA 2VCOA 1OZUA 3C6LB 2D4FA 4JJHA 3QIWD 2VXSL 3G5XB 4Q9RL 1U3HB 1S46A 3UERA 2WBWB 4OVVA 2EDWA 4UM8A 1SVZA 4DFHA 1YN7A 4UBDD 5IMOB 4JFOA 4D8PA 5L9DL 2RB8A 5HVHC 3BSGA 2HT4D 2W9DL 4AGPA 4A39A 1XF3B 1FC2D 3L95A 1FNHA 3QAZC 1RZIA 4H1LG 3KH4A 3MRRA 3DHPA 1C1EH 2VR8A 5F7DB 2P8PA 3VXUD 1NSNL 4A04A 3WKML 1NA8A 3WO3B 1CFMA 3IGAB 4QRQA 4TUKL 5T1KA 4M93C 2V2XB 3IMUA 3UP1A 4BWTA 2ZX7A 4P2QD 3C08H 3QIBB 3T2NL 1I75A 1NH6A 2BS9A 4XNZB 2DMBA 3HBGA 1BW8A 2DQEH 3FO1A 2DQCL 2LR4A 2ITFA 1QBAA 2A9AA 4K2UL 3ZIMA 4PRDB 1TQVA 4JUSA 3AXLA 1XD0A 2KZ1B 3F7RA 3UZQA 4E41A 2X2HA 3VI4E 6PCYA 5G2NA 3QUHA 1Q90A 3JWDL 2AI0H 3M1OA 2VYRE 1T04B 5L0QB 1E8YA 4MJIE 4FQQB 2O6PA 4KXAA 2RCSL 4M1CC 3TWYA 5MERB 1GPOL 1NL0H 1FLRH 5DJXA 1GGIL 3F12B 4PG9B 1HINL 3OF6A 2X4OA 3TA4D 4Y4FB 3CFTA 1S7XA 4P2RA 5FO8B 5KBLA 3JWOC 2A6JA 2WM0A 2A6DB 4X9FA 3DMMC 2ADYA 1J0HA 4PRIE 5CEXB 4IMKC 1BZ9A 1PTZA 3ME0B 3IMSA 4MCYB 5E03A 2IVFC 3GC3A 2IPTL 4QRRA 2K78A 3SE8H 3QRGL 4P9ML 1J18A 1MCJA 4KQ3H 1RFDH 2QQNL 4PLOB 3GI8H 2ZKYA 1XR9A 2WB7A 2JCCB 3PGFL 2OXGA 4P3CL 4ORGA 1FL3A 3HI5H 4J2QA 4PP1D 3B56A 3FQNA 2EZ0C 1R3KB 1T1ZB 3VI4F 4ERSL 5B4MC 2GFBA 3OAZK 4K15A 1N0XH 3VFRA 2GBUA 2OXHB 2W0FB 4JY5H 3H4HA 4JKPL 3HAEH 4G6JH 5DT1H 1R47A 2WIMA 4LCIL 3RFZA 5HY9A 1S3KL 4XZ4A 2BOLA 4C4UA 1VFBB 3LOWA 2WN2A 5MP6H 2BHYA 2Y5TA 3PP3H 1AD9A 1BJ8A 4YDVA 4IJTA 1W16A 1G4RA 1NCGA 4MAZA 1IKNC 5ISZB 3CQFA 3MBWB 4WI0B 2J7LA 2W0KA 3QI9C 1KCRL 3RI5F 3QWOB 3RWDA 3U4BL 4HEMA 2FZ3B 5L88H 1FGVH 2NY1D 4MA1B 2X3AA 4LPCA 5AD0A 4XWOC 1RU9L 4OGYH 3S36H 2CLVA 2YEZB 3MUZ1 4GAAA 1N5YH 4GG8B 3S3SA 3U0WH 1FO0B 1PX4A 1X5JA 3AM8A 1EXUB 2JJSC 3V6OA 1NLBH 5HYJD 1FHGA 4BFJA 1AGEB 1BVKA 2F0CA 1TEGA 3M88A 3L3JB 5EOCJ 2Z8VC 4U49A 5E4AA 4V11A 1F3JA 1ET7A 1TIUA 2A6KA 3LZRA 1TMQA 5T5FL 3W9EB 2DJMA 2EDLA 4LPXA 4ZMWA 2EVIA 1SJEA 3RVVD 2YOAA 4NKMB 1SJVA 1H3TA 2O4EA 2JKLA 4XXDA 5A3ID 1R0AH 1AGDA 1BZ8A 5I8KL 4JZOA 3L1OH 4QXWA 1A7NH 2VDLH 2WXMA 1TJHH 3BJ91 1YEGL 3IETA 2CGRL 3IJSA 4JPVL 2F8VA 1M42A 5F70A 4HV8B 4RAHA 2P24A 3ILEA 3KPNB 4ES9A 4PFEA 2IDFA 2IH3A 3HHRB 1MFDH 3VYPA 2B9BA 1ANUA 1MNUH 4N2HA 4R90H 4Z7WA 5CWSA 4PV8B 2C3XA 4MA7H 3SKNB 3ZTCC 2CGZA 1URZA 4HUWB 4PD4J 4Q56A 1T21B 4D0CB 3IDGB 2H7WA 5T1DH 3CFNA 4TNVF 1BZOA 2O5ZH 2Q2EB 3BZFA 4LQFH 2K7QA 4UOW0 2YPLE 1BLNB 1AGBA 3NRPA 3QDJE 2HFFB 2J8UB 4WW2A 4WSGA 2VL5B 3BH9A 2ADFH 4NZRL 4X42A 3ES6A 4MYWB 4PJFB 5FYLL 3MLYH 5GPRA 2GT9B 4WHTB 1KBWA 1XL4A 2YJQA 4XAWH 3FT4A 4KI5F 3KS0J 1PD0A 1JRHH 3OJMB 4M3JA 3WUWB 1EEUA 1JV5A 2JKIS 4PB0L 2ESVD 1V7MH 2NSQA 4TTDD 1R9FA 1PAZA 1TQTA 4ABQA 4U0QB 5KSVA 3FHEA 3CUPA 4JO3H 5CZKA 4KHXH 4U3SB 3FQTB 1T0NB 5GGUA 1CGXA 3BEVB 3VXQB 3IF1B 1IX2A 2AAVA 1CFBA 4PJAA 3GK8L 2X2JA 1LWRA 4R8WH 2X3CA 5JDSA 2CJ3A 4M7KH 3G08A 1GW0A 5HD8C 3CXFA 4X7EC 4PWEA 1L4IA 4N25A 2DQ6A 3LEYH 3BHBA 4PGEB 4AEEA 1OWRM 3MLRL 2Y6SC 3ARED 2APWA 5CIPH 3ZSSA 1BEYL 3UX9B 3MV9B 4WV1C 2BVQA 4GJTB 4RISH 1R3LA 3U46B 4B50A 3V5KB 3OJ2C 3BAJA 3U2IA 1KB9J 4FG6C 2YRBA 1SVBA 4LGPB 1AOZA 1P7KA 3BPCA 3G5YA 3BXNB 1U4FA 1HXKA 4HH9B 4HUUB 4QGTA 4HOWA 3LXUX 2ADJB 1KPVA 4JRYB 4UTCA 4ZOEA 3FFCD 3P2TA 4KWUA 3FBKA 2X2YA 3QCUL 4NENA 2HRPH 4EO5A 1O6TA 3CDYA 5DMGD 3R1GL 3ZN6A 1VFOA 1QFWM 3PXLA 2DQUH 2HN7A 2J1KA 2OSLA 1MHHB 4L4TE 4UB0L 3NN8B 3O2WH 4NKQB 3BJLA 1EFXB 1HKLL 3V4PA 4QRSA 2DN7A 5HHNB 3RWEA 1E2VA 4JRFA 1BD2A 4I77H 4D94A 2FGZA 1CTMA 3ENEA 5LWYH 1ZVSB 5EZOL 1JYVA 5E08H 3QDGD 4QHMB 4LFHG 1TZIA 5EC1A 2KERA 3KPRD 4RSYA 5EWIH 2Z92B 2ZT9C 4GQZA 1WYJA 4GAYB 1U8KA 3CMOL 4XHJD 3CXDH 1BIIA 1YN6A 5IG7B 2EVJA 2AXFB 3F7VA 1RJCA 5IVXB 1QTSA 1XT5A 4HWZA 4H0GA 2FRGP 4ZS7H 3U9PH 4HPHA 3CN2A 3VG9C 1C7SA 3BIKA 5DR5L 3K0YA 4U1HB 4S0SD 2IMMA 3KPTA 1OOWA 3HZMB 3NT0A 4YHML 4CNIA 3CLFL 5E70A 2HJLA 1CFVL 2VC2H 4L1BA 2FO4A 3JV6A 2KC0A 1SM3H 1FFPA 2NY3C 2X0UA 3ZRFC 4DCQA 4YS4A 3LKSB 4WVRA 5GRJL 5JHLA 2NTFA 1FWXA 1T7YA 1TEYA 2RA1A 2AABL 5E99L 1HZKA 1PG7W 3BN9D 4KRPD 3TV8A 1YC8A 1ET5A 1WQVT 2F18A 4F2FA 2EC9T 4PJCB 3GMOA 5GRUL 2BSRB 4D2NA 2R27A 1MJ7L 2AJVL 4PP2A 1JF1A 3WIFA 1H5BA 4WTZG 4EI6A 4FFZL 2CMRL 4BH8B 5BVPH 1HHIB 4BFBD 1MPAL 2WMPA 3UGEA 1ZANH 4AMKH 5CKAA 4GSXA 1ICTA 5IMMB 4NC2B 4OLEA 1A66A 3LIZH 5ENWB 5IBLD 3KPQA 3GNMH 4UMSA 1HL9A 4OZFA 1DQKA 2GIMA 4YHIB 5JNYB 3C6SB 1BX2B 1WIPA 2B15A 4OFPA 2G30A 4UM9A 4XXCA 3V6OC 3EIFA 1AI1L 3ALWA 3HRZA 5GRWA 1R34A 3DK2A 1IBYA 3DECA 3LNIA 2HXAA 3ULUF 1X9RA 1G87A 3HC3H 4GMSL 5J13B 4Y16B 1FNGB 1G5GA 3ELAT 4OZFG 1A7OL 1IO4C 3IFPA 5A6IA 1AH1A 1NM4A 1SQMA 4HKXB 2ICWI 1NAMH 1T22A 4GIOA 1G7MA 3O3AA 4M00A 3QUXD 4RGOL 1SN5A 1MCWM 3PFUA 3V9EA 1NGPH 4WAFA 3VTAA 2BIQA 3U2SB 4UF7C 1RI8A 3OVUB 4WQOA 3TYFA 4C83A 1PEWA 1IAOA 3EFFA 4HJ0C 4FQLL 1KGJA 4XCFH 3PJNA 5I8CB 4UT6H 2QFPA 4G6MH 3DSFH 3UJTL 4ALAH 9CGTA 1A6UL 3U0PB 4XNYL 4B9GA 5IW6A 2J21A 2JLLA 2PTTB 5KBPA 4P2OA 4GS7B 5HXMA 1MCEA 2LQRA 4PJIE 2BVPA 3CG8A 2AV7A 3HC4H 3CHOA 5INCB 3G3LA 5JZ7C 2XVLA 1GGYA 3W38A 2JMRA 1DVTA 5K39B 3D4YA 2IXQA 1MWAL 3B7RL 4WK0B 1HXMB 4WW2C 1TTRA 2JKXA 3BMWA 4MMYB 5D4QA 1SEQH 3AABA 2MNWA 4OZGF 5IEKB 1HWWA 1EDQA 1PX8A 3AT9A 1HSBA 4RMTA 5CINH 1UB6A 2WQWA 1JNJA 2DQDL 2WSDA 4UYQA 3TN0D 3X12B 1ZTXE 5IHWA 1M05A 1O7SA 1CDYA 4L2YA 5AKVA 4B53A 1EEZB 3REVA 3ARSA 4PRBA 3HOGA 3G5WA 3MRPB 4FA7B 5DMIL 4F8TA 4KC3B 4G11A 3FU9A 4XNUL 2YD1A 2E5EA 1BFVL 2VDNL 3K7UA 3K6IA 4BZ1L 3GXUB 3DYMA 1QFWH 1WBXB 2OK0L 4PJIF 1MRDL 1LO4L 3ASWA 3DGGA 1Y6KR 3HNSH 4U1IA 4DP1X 1NUGA 1JBJA 1FL6B 1OTSD 4ONGH 3QUMH 4QRUA 2ZTBA 3ZL4H 4DKEL 1P53A 2Y1AA 1CVSC 3H53A 1MREH 6PAZA 1C16B 5C8JA 5LJYH 3GMMB 2CHXA 2FUQA 1S5IH 4XWGL 2NUPA 3BW9A 3K4AA 5FYKE 4W70A 1CD1B 5PAZA 4FG4A 3GSVB 4A66A 5IJVA 2AQPA 3ZRSA 3VI3F 3SDAD 3PAYA 1HT6A 2X4PB 4NO2A 4S10A 5AVQB 2X4NA 4JZJB 4G83A 2SODB 4W68A 4XP1H 2ALWA 1BOYA 1JWMB 1K3ZA 4Y4HB 1PSKH 2W60B 3T0EB 5KVMC 5HDBB 5K1JA 1T0OA 1VGKB 3CSTA 5E2TL 3SDXB 3IN2A 4V1DD 4G8GD 1JXGA 4YFLI 4YEFA 2DI9A 4GQQA 5AW4B 5IW1B 1DBML 2FWOB 1YRKA 2CJUH 4KOCA 4YHNA 2QGDA 4NZUH 3MKGA 4R84A 3DI3B 2V9TA 1F11B 3D52A 5JIMA 3T3ME 1AKJA 3C60D 1Q9KB 3Q6FA 5CP7A 4NBYB 1OTUC 1U3NA 4Q9QH 4XHQA 1MDTA 1NCBH 2F8IA 4WHDA 5KG9B 2R59A 4RSVA 4LP5A 4LLQA 3QORB 3GS4A 2NXYD 1VLXA 2IOOA 3LHPL 1NOLA 2VXUH 5EU6D 4WJ5A 1KTKE 3I3EA 4UU9B 2OMVA 5I1JH 3CZFA 3K1KC 3MGTA 1NDGA 1N18A 1CLOL 1LL1A 4JHUA 2WNKA 3OB0H 5A43C 3IMWA 1L7IL 2KH2B 4FDWA 3T0DA 2JKWA 3QUYB 4CVZB 5IUSA 1A47A 5JIPA 1B0RA 1D9KA 3ARQA 1COBA 1DQQA 3NIGB 3ZKXB 1NM9A 1IGFL 2J88L 2DQFA 3I02B 4EI5A 4ZOAA 3WD5H 3VXSA 8PAZA 5J12C 3JWNH 1CMOA 4WCYH 4ODVH 1FVDA 4XR8C 3IM1A 3T3MF 2AFNA 4N2EA 2V8MA 3HJEA 3B2XA 3N85H 1E4WH 3DROB 4FCAA 2CDFB 1IFHL 3O6KL 2VLRA 5C0IA 3QHFL 5EU5B 2IEPA 3IDYB 1YPZE 3MLVH 1NDMA 4NQVB 4QXGL 3L3GB 5EU4B 2X88A 5FUZL 5CEZD 4G8EB 1QYGL 2CA3A 5CJBA 4G9DA 3HNVH 3A4EA 3JT0A 4A38A 1BG1A 2R29A 4A1RA 1QG3A 4GW4B 5IHUH 4PBVC 5LKNA 2A9ML 2PO6A 5BOZG 2EDMA 2O5NA 3UTOA 4DP4X 2W9EH 3HRZC 3C8KA 5DEZA 1NC2A 3CVHA 5IQ9A 2B1HH 4JL1A 4AL8H 3OL2A 4GXUM 1MG3C 2NDFA 5T1LD 2EIZA 4N1CA 2G5BA 1NBYB 4XBPA 4LAJH 1Q94A 1RULL 1SN2A 5F1IB 1GZPB 1AC6A 1S9KC 1JV2B 1E67A 2VXQA 3ALXA 3FT3B 1IC4L 1F1DA 4ONFL 3RTQB 5DLLA 3IJHB 4W4NA 4O9HH 3RVUD 4ZRGA 1SNRA 3MRBB 4WZ9A 4YUEH 1FZKB 1KYOK 5BMFL 2ZWNA 4KJYA 2P5WD 4QY8A 2KI6A 1YPZF 5H35B 5AB2A 3FTYA 4JFPA 3HFML 2V9QA 5F1OB 3UP6A 3AVEA 4IHOA 4Q8BA 5JYLA 2X7LA 5LBGA 3APCA 1XF4B 1RK1A 2X9ZA 1ACCA 3BUBA 4W9CC 5LB1A 1KIPA 1OQXA 1WA0X 2UZIL 1HQRB 3A47A 4V2BA 4P2OC 3AZUA 4G9FD 2QQKH 3L3HA 4XNBA 3EDEA 2NNRA 1DSFH 1PZDA 5DJ0A 4BRJA 2XQYK 2WBJD 4AT6B 1U41A 3HS0A 3KCPA 1R5WB 1RERA 1DJGA 4LOUC 2DLFL 1E4XH 4NDMA 3ZTEA 4L3FA 3T8XB 1DDHB 5TDOB 4UDTB 4GXVH 3G6JA 4X98B 5KSAB 2AXGA 3KNBB 1XF2A 3STBA 1NMAH 2WVTA 4ZTPL 3PHAA 4R4ND 3ROOA 3S8WA 3UTTB 1OP4A 5E5MA 3X14A 4HK0A 2O5ZL 1F2XK 3ZGHA 3R8BB 4WEUD 5LDUA 5I8OL 1A1MA 4PMFA 3ZIYA 4PJFE 3VD7A 1UH2A 2LTQB 2XQ0A 2CK2A 1YG9A 3NSCA 4V33A 3I9IA 4GSRA 3FO0L 1UVQA 5B7EA 2IPUK 1ADQH 4PS4L 1U95A 4ELMB 1BAFL 2SEBA 5IROA 4H5SA 1MCRA 2YPVA 3EGSA 3K0WA 3NG5A 5J8OA 1IT9L 1AG0A 1X4XA 1KG0A 1RHHB 5I19H 3U6RA 3PQYA 1GGBH 2DLGA 4EF3A 1KXTB 1C08B 1QUNA 2XZAL 3LYRA 4GW5B 3U6XS 5JYMA 3P2BA 4FQIH 1Z9LA 2DQJL 3ZQWA 2VITA 4CVXB 2EXTA 2YMXH 1YNKL 1P4BL 5FGCB 3ARZA 3LRMA 4TSAL 3MV9E 4HGKC 3BP7B 3ARWA 4PJ9D 4KMTH 3E2HC 5EBWB 5CKGA 2Y6TE 4XC3L 4LU5L 5F3BA 2GEQA 2N7BA 2IANB 2R0WH 5LCVA 4PREA 3SJVA 3CN1A 1KN2H 2YRZA 5EOTB 3PPSA 3QZBA 5FA3B 1UA6H 4JRYE 4RFEA 5G4MA 5SV3A 1CF8L 3G6AB 4Z3TA 1QSFD 3FF7A 4QCIA 5TDNB 5ICZB 2VUYA 2GJ6B 2ZWSA 2OZ4A 3FMGL 1XIWA 4PPTA 5TGBB 1BMZA 1YA5A 5E8DL 2CR3A 2B08A 4GRWE 3RVXD 3H54A 4JQXA 2WNWA 2EDBA 1NZRA 1UENA 3JT2A 4OJYA 1QFHA 3BUYB 2JXMB 1D2PA 2GQHA 3EO9H 4NYLB 4ZUWB 4HIJB 4J3TA 3CLEL 3UGUA 3EOBA 3VXRE 3QA3A 5E5RB 3LNEA 3IFNH 2ZXGA 3UFIA 3V4PL 1WD9A 3LNDA 3P3RA 2VWEC 3LKRB 2XFGB 2GJZB 3DHUA 4N6QA 2X6BA 4AW7A 2V5RA 3Q5TA 3VU1A 4E5XB 1RSYA 1D9KC 1I9RH 3SKJL 5CZVH 2IH1B 1CURA 5INDA 3W9DB 3FYIB 2E59A 3FT2B 5C9KA 4ODWB 2VM9A 3RTLA 1OGTA 3ZKNC 5DO2C 2PYEB 2W07B 1PZAA 4TVPE 2IBZX 4KO9A 1AC0A 3PWNA 2B0SL 4PRAB 3VYNA 3WIAA 1OM3H 3L5HA 3UTZB 4LSTH 5DZ9A 3THML 1OTTC 3L4YA 1OVZA 3S5YA 3IAGC 4X5XB 4HKBB 3PL6A 4DTGL 4YPGA 2FATL 3H3KA 4UV4L 5LAXB 3PDOB 3GEWB 4YZFF 4M6NL 4JDEA 3GMPA 3IXTA 4N2AA 4RGNC 3QWRA 1INQA 1F8TL 3BD4A 4NN7C 5EUOB 3O3EB 5A2BA 1NGZA 3D9AL 5M7QA 5AYUL 4PJ8D 5JHLL 5AVSB 2XN9B 2Y0SA 4J1UA 1VIWA 2H9GA 2BP8B 4NN5B 3D05A 4EVNA 1BXXA 3AB0C 1I82A 4F33A 3WTWA 2OR7A 3AS0A 4LCYB 2H0PA 4W9KC 1DVUA 3LPGA 4HXBH 5DZJA 4IBQA 1HESA 3WTXA 1TVDA 1U92A 2R1XA 4N2OA 4Y19A 3MLZL 5CLTA 1ZT1A 4Y9EA 4HFUL 2PXYD 5EV7A 1E8ZA 5GZND 1I85A 4FHBD 5FECA 3MA9L 1HYSD 2AF2A 4DZ8B 4AUYA 3EGXB 4YHOH 1HC1A 4UAOC 4K9EC 1N8ZA 4P07A 3EH3B 1DJXA 2X4RA 2DWTA 3L5XL 1CF1A 3WIHA 4KAQL 4F80A 2ZX8A 1LEIB 3SDDD 5PCYA 2XYCA 3IJEA 1X5YA 4TKWA 2YKKA 1K5WA 1K2DA 5KVGL 1IM3D 2I9LB 2LAGB 1Q9LA 4K55A 3UXFA 1VKXB 4AKOA 4R83A 1IJ9A 3DIFA 4PRPA 3S2CA 3OGCA 2NQCA 5IWLA 1ONQA 1VACB 3OKOB 1QSVA 4OZGA 4LSUL 1E50A 4KVNH 3GZPA 4HP5A 4NJAH 3EADA 4ZTEA 1N70A 1S9WA 3HS0C 1V3LA 2RQEA 3WUZA 1UJ3A 2IWKA 3IT8D 1OL0A 5ICYA 5IFHH 4HGMA 4JZNA 2HUEA 3WLBA 2WKGA 4O02H 4KI5C 4ZAKB 2QBWA 2CUIA 3NA9L 1OAUH 4EN3B 1DDTA 1J1PH 2AP2A 3DRQB 4FQXB 4NKIL 4QRTB 1DBJH 1AXIB 2XC8A 3ILPB 3O4LD 4GSQA 1GGUA 4M6OL 5B22A 5J1AA 3MBXH 4LSQH 5CF3A 2ICEA 4JFQA 1XVSA 1WBZA 2CM5A 1YEIH 4LVHC 4XPHL 2X41A 1QWHA 4I2XB 1E3ZA 4IOIA 4OIAA 4N5ED 4PJ7E 1N7ML 4XO4A 1RJLA 1XBRA 2XFXA 1ZLWH 3JBG7 3NQIA 2FIKB 2N1KA 4W9GC 5IROC 4PTTB 3QIUA 1IGMH 3RY5A 2J25A 1S8DB 3A6CH 3KPPA 4BEIA 3O81A 5BW7A 5SWQB 4JFVA 3PHQA 5D9SB 4NUJB 4LZKA 4MD0B 4NAMA 4LLVA 3TIDA 3VI3A 1L5GA 2K7PA 4JPWL 1Q4NX 3MBEA 5KANG 3NZ8B 4Z8FH 5GHWH 4ZOCA 1VEPA 3CX5J 3NJXA 2JKTM 3OKDA 1T4KB 3EH4B 1E6JL 2HFTA 1CS6A 3F58L 1E28B 3DC0A 4HEPA 4MZRA 4BZ2H 5KVFE 3GPSA 1MUJB 4ODUB 1VCAA 4UOQA 1I9IL 2AV1B 3HI6L 2YKLL 4KK8C 5EN2B 5CU9A 4KZCA 1RQ5A 4PJ7F 1ORQB 2OMXA 4P4KD 3QFDB 3GHPA 4OCXL 4EDXB 1DVQA 4KROD 4XBEL 4F7CA 1XIWC 4HEPG 3QQ9C 1SFDA 4R0LA 2ZCHL 4XAKD 3T0EE 4J3UA 1X6NA 4JQXC 3N9GL 2NY6D 3EJZC 1T5WB 2QADB 4FLOA 1QBBA 1SJHA 4Q52A 5EB9A 2RH0A 2YD3A 3MRJA 1CFQB 4Y2DB 3VD5A 1I1YB 2WO4A 4N8PA 4GP5B 3SPJA 3WN6A 4PMEA 4AITA 2V7NB 1KLGB 4MQTB 2V5MA 3VB9A 3D39A 3GLDA 4O2FB 1JHTA 4XP5L 3QHZH 3SDCB 1A02N 1VPOH 3QIWB 5KSUA 2EE3A 3HVNA 2ZONA 2QPDB 5SWSE 2JK5B 4FXGB 4G8IB 3BVNA 1RZKH 2X4QA 4CGTA 4YE0A 5I1DB 4UQ2B 1AJ7H 2OMYA 5LG6A 3ZTNL 4OR1A 3ZHKA 2AJXH 4HCIA 1ESOA 2DAVA 3KH3A 2ZPKH 3OHXA 4GIAA 1S9VB 5B3JE 1OSZA 1QFUH 1WE5A 3FO2A 3V0VB 4EZLA 3T6ZA 4XBMA 4GSDL 4TMPA 4PLNC 4XMKH 2ZXWB 1JZFA 1B2WH 4JPKH 1B88A 2ENSA 1R3HB 4NM4H 1NIEA 4P2QB 3NIGE 5FYKU 4NM8L 3SB3A 7TAAA 4HSAC 3FZUD 3PL6C 3L9BA 5F9JA 4TSBH 5DEJA 2Y72A 4F92B 4BFFA 3B2VH 5IMLA 2BWIA 4KPHL 1P6FA 1G6RH 2DWYA 1PDKA 2IADA 3DJTA 3B4NA 5E0QA 1QHQA 2BDNH 4DKTA 5MENA 5K9OB 4JFXA 3BPLC 4YSAA 3GLZA 3TBSB 1QACA 2O5XL 3DUUA 5HDRA 5I66B 5D2NE 3X11B 5F7HA 4IDLA 1NMCC 4AVIA 3QVAA 3ULUC 3LXBA 1WFJA 5I9QC 15C8L 1B0GB 3HB3C 3K72B 3CK0L 4L37A 1DN0B 4QWWC 3UEQA 4Q6IB 4XRCB 1SHMA 2V5TA 1TTUA 1CICD 5TPWL 1I8KA 2X1OA 4JLRA 4N0UB 1TXKA 3EJRA 4NO0D 1GCFA 1HOEA 5D1XD 1YEDB 3QQ3A 3R8QA 2YUXA 3SGDH 2MCPH 4LCWE 1A65A 3AMLA 4N8VB 5D4IA 2YGQA 1ZLDA 4C56D 2R29L 2FEEL 5JPNB 2GAZA 3WV0A 5ILTH 4CW1A 2B1HL 2R69A 3QPXL 3DJ9A 3CVHL 3L45A 3O6FA 2LE9A 1KY7A 2WLJA 1J0KA 4PB9H 4GKOA 3WEMA 4FA6A 4LF3B 1L9NA 3FT1A 2A73B 3A22A 43CAB 4L3EE 1RHFA 4OD3H 4XNXL 4AG4H 1NIDA 5DHMC 1HEJC 1BVOA 5DJ8B 4IGBA 2VXQL 4YUEL 1ROWA 4LHUA 4OLUH 3ZSTA 4TYUA 1RKRA 5FO9A 4S0TD 3ZL2A 4UQ3B 5DZPA 4L8DA 2NTSP 5IVNA 1EHKB 5D1ZD 3O0RL 5C0EA 4K9EL 5HJ3B 3ISWA 4MD4A 4QLWA 2LU7A 5AZ2H 1XV8A 1ZS2A 3L9RB 3QJFA 4HJUA 1OD9A 2NY1B 1R4XA 3LRSA 2FBJL 4QJ5B 4LEXL 4LHUG 4E42B 4L8BB 4OB5H 5L6YL 4OF5A 1CVRA 2HFEB 2ICEC 4QO1A 3S0PA 4F9LA 5HYJB 2NW2A 5AVTB 3HG1E 3JUZA 1TTGA 4L8CA 1K3IA 1WD8A 4PUBL 2YQGA 4OSUH 4WU5B 2A6IA 2Y7QB 2A74B 2FLMA 4Z0XB 3OMZA 4X50A 5DUBA 3HAEB 3CFBB 4NNXB 5C08D 3T08A 2OULB 1JIBA 2VLKA 1MFCL 3BWUC 3QIUC 5D72H 4KNTA 1M9WA 1ROCA 1NEZB 1UXSB 2D9QB 2LW3A 2BVTA 4OBSA 1BGXH 3QARA 4M7JL 4MMXC 3JWOH 4J8RB 5BW7C 4CC1A 2Y06L 1QMUA 2XN2A 1N10A 4OCSH 3VCLA 3HC0B 3STLB 4CVWA 1UD2A 4G8FA 1UZ8B 4AX3A 4YC2B 3SQRA 3MBEC 5IP4A 1CGYA 3HCVA 3DUSA 2WLZA 4JM4H 3TTSA 4H8WC 1QO3A 3CLWA 1EUUA 1HKFA 3RJQB 4MNQD 4BQBA 4ICXA 4JAMB 2XYBA 5J9PA 1U2CA 4K7PH 4FP8L 2XIBA 4PG2A 2EAEA 3MCKA 4YDNA 5DJZA 3WJMB 2Z91B 1I7ZA 2EH7H 4O51A 2G3MA 2YPVL 4AZ8A 5ESVB 3RIKA 4DVRH 3L5IA 4GOSA 2XY2A 1KTRL 1W0VB 1FJ1A 1ZY9A 5I0YA 4M1CD 4QYAA 4GQPH 4Z7UB 1QPPA 2AK1L 1RIUL 2NZ9D 5G5DB 5I74C 3EH5B 3Q6GL 2IANE 2QKIA 4XCCH 3LZFL 2CAKA 3I6GB 4JJ5A 2D7NA 1H6TA 3IK2A 2BNUB 3L9EA 4YNYB 1U58A 3O11A 2BSED 3KGTA 1F18A 1ZWIA 2GEEA 3NJFA 4ZXBD 2VDLB 1KCUH 3H7LA 4KI1A 3DMMD 5EU3B 1YMMD 1MI5A 2ESVB 4QT5B 5DFVC 2B3RA 4P2YA 5JLZB 1GYAA 2FL5A 3VGAC 3RAJL 5F1NB 5LCVL 1YECH 4H7VA 5FW8A 4F37F 1KPRA 3LN5A 4JFHD 5C3IA 5FM5M 4X7SH 2VDKB 4JHVA 4PGZA 4X80H 3FUDA 4OTXL 2OQJB 2WJ5A 1U3ZA 2OZ4L 3HG0A 5B1BB 1KBVA 5TDPB 1HH9A 3W3BA 2EZ0D 5FM8A 1F1GA 3FHAA 1QHPA 2Y07L 5B4MD 3KVQA 5D5ME 5EU7E 3EO9L 3AREB 3AAZB 5I30L 4ZFFB 3MTRA 3NJLA 2R56H 5IJDC 3V0WH 4JFFB 1A7QL 1NC4A 2TSAA 5DYOB 4HVBA 3ARBC 4JKKA 2K0RA 2Q20A 5I1EL 1L7TH 5DXWA 2UX6A 1W8NA 2EILB 4K7PX 4J7RA 3CZJA 5AAMA 3FFCB 1FYHB 3PWJA 3QI9D 1TQCC 3EYVB 2PYEE 3IDJA 2M2DA 2VN7A 1A14H 1DQTA 3S35X 4RMRA 5BJTB 1JHKH 4LESA 4MCMA 4FQCH 1WA2X 4XWOD 2G9HA 5LQBL 1QQDA 4EXKA 5C0CA 3QH3B 4XVTH 2DQHL 4OBRA 3VMPA 3GF8A 4O4YL 5D8JH 2JELL 4EDWH 3QDGB 5E94B 3BVUA 5D5MF 5FKPA 1M7IA 1DN2A 3KPRB 5I6MA 1C7TA 4MDJB 4DUVA 1U8PA 5L2KD 1OGPA 3LH8A 2CA4A 3TBYA 4XOAA 2HJKA 1EBPA 1DLFH 2XN9E 5MI0C 2F2HA 1AFVH 4FNPA 2XOTA 1A3LH 4JN1H 1D7BA 1KYUA 3IRZA 2EUWA 1ZDQA 4YDLB 4P46A 2F74B 2KQNA 3KR3H 5KN5A 3APFA 5ACLA 1CXLA 4TUJA 2YOCA 4HBCH 3H1ZA 3ULUL 1D7CA 2PCYA 3O6FC 1OP5K 5CU5A 3U0TA 4DPAX 3K2KA 4H1LH 3EGDB 3DBXB 3F84A 3G9AB 4RFNC 5B1JA 2ZXAA 1MLBA 2F53A 3GSRB 1YEHL 3BC9A 4V2CB 3CSYA 1WO2A 4RLDA 1T0MA 4ABVA 4RVBA 2CO2A 1AO7E 1KTLB 5D71L 4IGBC 4NUGH 2VN4A 1WS7A 1ZS8A 4K8RH 1WP6A 2V2TA 1KFAL 2A99A 4QXUL 7CGTA 2DS4A 4KRPB 4EUPA 1NLDL 1S3RA 2G3NA 4DK6A 1MVYA 4ZQKA 3LRHA 3SQOH 2P44B 3QJSB 4FQJL 5JQ6L 3NFPB 3O6ML 3T65B 1XSJA 4K4KA 4HMDA 4PBWD 4DW2H 2MQ0A 5D7KE 4O58L 2ZUVA 1QTPA 1MG2C 3QEHB 3GRBA 3MLSL 3SE9H 4F3FA 4XMTA 3NCYP 1RUKH 3W39B 5AALA 2CBOA 3NIFB 1G94A 2CRIA 1A1OB 3ZT5A 2FYYB 1TKWA 4YHZL 1EA9C 1JF6A 3CZKA 1CDGA 5F88A 4AC4A 3FN3A 4HGWB 1ZHBB 1BM7A 3VXPA 2XQYA 3CN4A 1CJYA 1J11A 3MOAL 2ARJB 4XP9H 3UBXB 2PR4H 2VC2B 4HHAA 3A5VA 1SUHA 2A5UA 1NAKL 4NSKB 4QNPE 4WDIB 5TE4L 2F7PA 2LU5A 2GSGA 4DKAA 4Z3GA 4XNQA 4DP0X 2BLFA 3MXWL 1TQSA 4X8JB 5HD8D 4Z7OE 1CDIA 2DIEA 4HZAA 4RAVA 5BS0A 1GH7A 2NYZA 3QUXB 1L9PA 4PW4A 3SO3B 4I2XE 3ZZLA 4ZG1A 2Q2LA 3UYRL 5FO2A 3WNOA 2Y7NA 3HR5B 5ANHA 5DD6A 2OLDA 1MQKL 4KMQA 3GB7A 5T1KD 1KNOA 1J5OL 3CSFA 2PCFA 3PP4H 5DMKA 1DBAL 1GRWA 1PYWB 2JIXA 2HCZX 1KGXA 2QVIA 2ERJB 4WEMB 1FZJA 3WJJA 4PG2C 3KL3A 4LLDB 2EIMB 4J3WA 3TX4A 1ZE3C 4J6RL 4L23A 5C0NC 2DLTA 2LFGA 1TFPA 1LP9B 4I4WA 3GSQA 2HKHL 3OZKA 4XN5A 1UWYA 3BWAB 2V8LA 4XPGH 2I9TB 4N8CH 2GYSA 3TVMB 3WEOA 2V2WB 3EOTH 1A4KB 3HNTH 1RZ8A 1ZCRA 4F7KA 3WU1A 2YD7A 1FNEB 3MRMB 1K4DB 4W9LC 1ES0B 1YYCA 1S7RA 4PIRF 5LGHH 1FH5L 3NDZE 1FI8C 4Z7OF 2IPUG 3AJ7A 3W0WD 1PGRB 1NAMB 4H8WL 5DU7A 1FVCB 3LSOA 4GP8B 3TN0B 3TPUA 1G0YR 2BOCB 3PJLA 3TYGH 3BGFB 2OTUB 2FJFB 4ABUA 1X5XA 3SGEH 5JOPE 4OV5B 5TF0A 3VB8A 1PMYA 1JN6A 4DPCX 4P57B 4B96A 2ATAA 2ZOOA 3UMTA 3EJJX 2YD8A 3OMNB 2VAAA 3NCXA 2WZ0A 3NH7H 3ETBF 3QXAA 5C3LD 3MODL 3KYNB 4YXHL 1GHFL 3HMWH 3QDAA 4JO4H 4WNQB 4ZUUB 1MRFH 1TZGH 3GXFA 2XIDA 1QSEE 4POUB 3ZXAC 2DKUA 1XGTA 2H3KA 5I73C 4M43H 4RBPK 3FN0H 2X28A 3DO4A 2NY3D 4PW3A 4XCYB 1KELL 1R3IL 4N5UA 2BNRD 1IQDA 4XXWA 3LEVL 1X7QA 2EDRA 3RKDC 5GJSL 2BXZA 1F58L 2VO5A 1DANT 2HSIA 3GIZH 2A4ZA 4ABWA 1QHOA 3C12A 5DRWB 3WSQH 5SX5H 5AAMC 4IRZL 1QKZL 3GI9H 5KOVC 1NIBA 3EOAA 3VXUE 2W0PA 1UM4H 3SDAB 4M7ZC 2H6PA 2XKNB 2BJML 4QF1A 1Z3GH 1U8CB 2MTPA 2VAJA 5JHAA 1HI6A 3CU7A 4IIQA 1H15A 1QEWA 5C09A 4JFZH 3T1FA 5IY5B 1JD7A 2OMNA 4V1DB 4MHHG 3LKQA 4G8GB 1NOAA 1AXTL 2RHEA 4N1HB 1QLFB 3QJTB 4ZD3H 4XO9A 5LLIC 3G9VA 5F9AC 3BPOC 1NJ9A 1UCBL 1WRFA 4D0BA 1DUYB 4JHWL 5C0GB 4FS0A 2NY5C 1ZVYA 3BP5B 3OAYK 3QR0A 1WV7T 4O2EA 4U1SB 3V6ZB 3EXLA 1B3IA 3C60B 3OKKB 4J8QA 4DP7X 3MLWL 3HG5A 3FQWA 3GGWB 3LRGA 4Y4KD 5HGBB 2R2HB 1G9NH 2NLJA 5DC0A 4Z77A 1KJMB 3PWPE 1UFGA 3VM5A 2NXYB 5EU6B 3WY2A 4P46C 1JDDA 4JANA 1G5AA 4N0UE 3D69A 5FM4A 3BVVA 5ITFA 5F89A 1RUMH 1SVCP 3DTXA 3T1WA 4IRSC 1OK0A 1U0QA 1G7QB 1DCLA 5B1JC 1GAFH 2P5EE 4YHYC 2B4CC 5E6IA 3VH8A 3N42B 3QCTH 2VN5A 4HS3B 4PBXA 1JZ8A 2PP8A 3HHSA 3L7EB 1KCVL 3CPLA 3NOIA 2QTVA 2ZCLH 3MRHB 4I0CC 5TK2A 3SN6N 4ANWA 2JJUA 3WTUA 4YO0B 5D1QA 3TIEB 3FXIC 4EAEA 5I6XC 3FH8A 1EZVX 3H9YA 4XN2A 2BW5A 3QG6A 1FBIH 1CZ8L 3BISA 2D31A 1A64A 4H8HA 1M56B 1MXDA 2UVFA 4MSWB 3VH8G 3EFOA 1VESA 5FAAA 1A4AA 2R69L 4WKXA 2H3NB 4HOXA 5AOLA 5FCUL 5FX3A 1PZSA 4E9VA 3CFMA 5GIRA 4P5TA 5FUOH 1LM8V 2CCLA 5ADPL 4J23A 4EBQL 4OFKA 5DC2A 4BQ6A 4ZTOL 2K6ZA 4IOFC 2O61A 1G84A 4RESB 4QYOA 3I74A 1KFGA 3LAFA 4ATTA 5ELIA 1ZT7A 4FERA 1LNUA 4IU2A 2P1YA 3NACH 3M6DA 5B8CC 3PY9A 2BSTB 2J72A 4P4RA 3RWGA 3LKNA 3WENA 4JQIA 1SMDA 1EO8H 3QEQE 5T1LB 3BVXA 5DZLA 5D7LD 3C9NA 3T2PA 2CDEB 3VSUA 1XCTB 1NFAA 3ZL1A 5CGYC 4XNAA 2ICES 3NFNB 3U1SH 1AQHA 2MHAB 5KYWA 1KLUB 1DE4B 3DTDA 3L4WA 3MKKA 3QBTB 2P5WB 4I9WE 4U1NB 3VFNB 5I6KA 4PY7A 5AAWA 5FGSA 4N0YL 4OD2B 1BOGB 3CFUA 2Q7NA 4TUOA 3KG5A 5DEFB 1E43A 1I8MA 4LPVA 3KLAA 4PJ5E 2J5LC 4IMLA 1RP9A 2WINB 3ARDA 3WJJC 1BBDH 4HYTB 2WQUA 4QTIH 5ES4B 3FFOA 4G9FB 2VH5L 3BAYA 4PLJD 1HHHB 4LFHD 1BGXL 1MJUL 3BZ4A 3FSAA 1A7BA 1PKQA 1XH3A 2C7UA 4LLYB 4XN8A 3TT1L 1F00I 2WBJB 3AUWB 2BSSA 4P5SA 2VABA 4KUCD 4URTB 1DUZB 5GJTH 2FNBA 2F7OA 3LKPB 5HGAB 5A2AA 4X7TB 3ZDXE 4ZPVA 2ODHA 1C8QA 3IU3A 3FU7B 1B4JL 3QFJA 3SPVB 2IDCA 5IKCA 1URLA 5F96H 4ZI8A 1I9JH 2J20A 1UT1A 4BK5A 4Z3HA 2OFQA 2EP6A 3FH7A 4OIIH 1DBBL 3CJJA 4HUNB 4Z7UE 3S35L 1JXDA 4D0DA 2FB4H 2XVGA 5IFJB 1HILB 4C59B 3FTGA 1C5CL 4YE4H 2DKSA 2EXWC 3FULA 4IBLT 1I4FB 1LEKB 3GTNA 5T5NF 5K9JH 4B41A 2CIKA 3BE1H 5T3ZL 2ESVE 2XZQH 1BM3H 3BGAA 4PIBA 1JD9A 1T7XA 3TOPA 4CA4A 3CXHK 4YGAB 1KIQB 3IU4H 2P3YA 4N20A 1ZJAA 4DEWA 1YSOA 4L9LC 3WELA 4TQHA 2D8KA 4XXWC 3KPMA 3SOBL 3ZDXF 1AR1C 4I1PA 2OYKA 1IZKA 1JUFA 3ARGA 1UOLA 3C5JA 1TETH 3N43B 3QQXA 4H25A 5IR1B 2WSPA 1XR8A 2BH0A 4ZDHA 1U8LB 1NGQH 2BNQE 4FQ1L 3WLWC 4GAJH 2CGYA 3NCWA 4WK4B 4L05A 4AIXA 4QHLB 1Z2KA 2EABA 2HWZH 4PJ9B 3WNKA 3CTTA 1A3RL 2UWEB 2EKSB 3U36A 4J2XA 2JSFA 1NFDE 2K8QA 4YHLL 5IHBA 1G7IB 4IIQC 3F01A 4H40A 5E9DE 1MAML 1RUPH 1R19A 3WIIH 4ZX3A 1QSFB 4G6FB 2FQEA 4UM9D 3TH3T 2XJLA 3WHE1 3RIAK 3AT8A 1F4WL 2WLLA 1RZPA 5GS2H 3DX2A 2X6AA 3PHOB 4FHJA 3PIQA 4R7NA 3ZE0E 3KWXA 4NQCD 1INEH 3V4VH 1KCKA 4L8SA 4LLMB 1DO5A 3BYYA 3HMXH 4NOFA 3RWFB 3E9UA 3LRLA 1M6UA 4Q7DA 1JFQL 3ZDZE 1LO2L 1ZV9A 1G0DA 3N1FC 4NRXA 4PV9A 1FYTE 1HQ4A 1WG3A 1YYLL 1A9VA 1ACYL 3QDGE 1ADWA 1DVFA 3MA7A 2HJFB 1A9BA 3GO1L 3VE0B 4D9RE 5HPMB 2XDHA 3H55A 4DGIL 5EA0L 3U7YL 3QDHA 4DHLA 5CZXC 1P84J 3DYPA 1GS6X 5D2NC 1NFDF 4DERA 2G2RB 4MNHA 3IS1X 1G7PB 5E6IC 4DGYH 2NY5L 4KY1H 5MEOA 5F0LB 1SYVA 3GIVA 3L3DB 2NCMA 3QUZA 4LHJB 4YGVA 5E2WH 1A3LL 5DHYB 1MVUA 5D1QC 5I1HH 1Q0EA 4P2OD 4P04A 2X44D 5DD5H 5KJ7E 1EHXA 3M46A 3FOLA 1L6ZA 2IAMA 3NJIA 2WXGA 1XGQA 2NX5A 3MUJA 4POYA 2LLNA 3FQRB 3ZE0F 2FAUA 2GJJA 3QZPA 3L16A 3V0DA 1I7UA 3WEBA 4XGZB 1NCDH 3QPQC 5F9OH 3BP6B 4RGMC 4TPRL 3ZDZF 5C9JB 4P5TC 2PMZA 5E1QA 5I16A 1N26A 1MFEH 2B4CL 4OCYH 4NQDE 4ZFZB 5HYFA 1J7VR 1IIKA 1ZRUA 4F2MB 3LV3B 4RRPA 2IQAA 1YEEL 1TU2A 3WE6B 4WWKA 3ZOAA 1EHNA 3EHBC 4HAGA 4PJ8B 5AW7B 3TFKC 3BUIA 5JUEH 2RR3A 5BQDA 4NP9A 1AXSA 2C9PA 2OW7A 2TRHA 3HZKB 4LCUA 1SMAA 4G7SB 3BWSA 4DF9A 5EEWA 1NCCL 2BHFA 4ONHB 3T3PF 4Y0GA 5CBAB 5F3HB 4RRPG 2IG2H 3T8MA 3IJYA 3KLHC 2PXYB 3BKYL 3M1BB 3QNYA 3SKOA 4HS6B 1M2OA 3V7MA 1X5LA 1KYAA 1VFMA 1H3WM 5F1KC 3N44B 4QHNA 4F8QA 1E4HA 4F7TB 4BM7A 1RY7B 3KBFA 2DQIL 2VDOB 2R2BB 1F86A 5GGQL 2Q8AH 5CD3A 2DRUA 5KANI 3NIDE 4OFQA 1KB5A 4B9YA 1XMWA 3SDDB 3LEXA 4FEMA 4X2UA 3UPCA 2W88A 1UACL 2WWNA 3ARDC 1IM3B 4FCHA 4OAWA 2DM2A 3D30A 4J3XA 3CC1A 3OKLB 1EMTH 2W38A 4APXA 2GITA 2OTWA 4CC4C 4DAGL 2EIKB 2UYLA 3UTPE 5EIIB 4R7DA 4WUKL 4CBZA 4OUUA 4PVNA 3RZCA 1BZ7B 1U8QB 2BSDA 1T6WA 2FX7H 4K7FB 2R1WB 4Q74A 1LXMA 1D5XB 3KBPA 4G59C 2YEVB 3AU1B 3N50A 2AEIT 1WISA 3EO1A 1EV2E 4HDIB 4KH9A 4U1LB 2JB6A 4ZBJA 4WJKB 1YNTA 3TXAA 4BK5C 1QNZH 5BCAA 2LVEA 3CX2A 3O4LB 3KJ4C 3QJQB 3VA6A 4ZMXA 2WYTA 4H2AA 4OW6A 4A2LA 4U1JA 3NIDF 2UY7A 1EHLL 3UZVA 1PCSA 1U42A 3G6DL 4RMVA 3LCYA 1J88A 3EDFA 3RWJB 4LNRA 2MEJB 5HPOA 4Y8DC 2UV3A 1SQ2N 5F93C 3K80A 4ONOA 1BFOA 3TCLB 2DTML 4KJQC 1ORSB 2ZSWA 4KV5E 4O5LH 1JK9A 4R4BB 3VFSA 1SXNA 4MJID 4H4NA 4TLUA 3MRCB 1FGNL 2EICA 2VSCA 3KXFA 5AB9A 1D9KD 1H3UA 4HUVB 1U21A 1UZGA 1F6AA 3C87A 3VWJA 1CLZL 2IBGA 3CPUA 3UJJL 1JYXA 2V6HA 3NK4A 5DWUL 1EZLA 3UABA 1MJJB 2OMUB 2HG0A 5GGVH 3TL5A 3VXSD 4BQ9A 2RALA 4GKLA 2IH8A 5DHVH 3FH5A 2P42B 3ARGC 3ZKND 1YNLL 5DO2D 2XY1A 4O02B 3CFCH 3ILDA 4HG4K 4YBLC 3TEZA 2DQTH 4PRID 1GYCA 1UOKA 4F7MA 2XWDA 5JXAL 3MFFB 3V5DA 1CLCA 1OTTD 3RL2B 4RX4A 2VLRD 3U9WA 3E1F1 1A6ZA 2CK0L 4MNGA 4EOWH 1NWOA 3DURB 4H13C 3NVQA 3P4MB 2GHWB 2V3EA 1UM6H 3QUKA 4OLXL 3ZW3A 2KZKA 1K8IA 2GCYB 3PWLB 4GPVA 2RD0A 4M5YL 5HYQA 5HYEA 1AIFA 3OZ9H 2Y36L 1O6SA 4P4KB 5LDSA 1LE5A 5BUGA 4KV5F 2HH0L 3GIZL 4KVCH 4DT2A 2CJTA 3DNKA 2FQFA 4KROB 3NTCL 4X7DC 4G43B 4U0RB 2FEDC 3US0A 1FFNB 4AUJA 3QXUA 5MHSD 4DZBB 3DX8A 1JTPA 2NY6B 2XHNA 2XSKA 3B2UC 4L8SC 4V1DE 3A21A 3FB7B 5C6TL 3PNWB 4K07A 4OZHE 2WWMC 4LIQH 3BLPX 3A6BH 5AB0A 4XP4H 3QNZB 2EEXA 1DVFC 4LEOA 3ZKQD 4ZMLA 1RSFA 1UM5H 1RVFH 1WWCA 2XWBA 1YQVL 4AIZA 1RZFH 2A9DA 3CSGA 1Z0MA 3OR7B 1D6EA 1A6AA 3IDNA 3PPEA 4M61A 3EBAA 4JG5A 5EU6E 1JDCA 3CH1B 3QUZC 3DARA 1L0QA 1O9ZA 3HC2A 3P0YH 2YZ1A 3K5RA 3U7WL 1DEEB 1G1YA 2EXSA 2DJUA 3BUQA 1I8IB 3PWVA 4NN6C 4XOCA 1BDYA 2IAMC 4CSTA 1QLEL 4GMTL 4PJHB 1EJOH 1MAJA 2VOTA 5E8NA 4G7VL 1NANI 4MAYA 1RUML 4WY7L 2H1XA 4KQ4L 5AW2B 1BG9A 1Q0YL 4B9ZA 3OHMB 5SWZA 1IGJA 5EO1B 3KPSA 4OZHF 1ZHNA 1J12A 4ZPTB 4YQXL 1PU0A 2FX8L 1MIEH 2HLAB 1HXYA 2YXVA 4KI5D 5F9DC 2AERT 2CUHA 4LSRH 2ZE0A 1OWWA 4YHPB 1GKOA 5CAYB 1KWGA 3GBML 1BPLB 4I87A 4LCCB 1ML0A 3ARTA 4OLYL 4XPFL 3KLKA 4AQEA 1MCDA 1MIMH 1BJ1H 1D5BB 5IESH 3IEAA 2GVYA 4XVSH 4LQ1A 1S7QA 2RFXB 3GJFH 4JDVB 2CIIB 5CEZE 1TQBB 1MW3A 1U8NB 3AXHA 2VW6A 1KBGH 1CICB 4JFDA 3VVWA 4MJ6B 1P1VA 3UC0H 4HCRH 2YPLD 4AQ1A 2APBA 5D1XB 4F7EA 3MRQB 1JVKA 1LD9B 5C2BL 3AT0A 3CHRA 4CN4A 5ANMB 3B6SB 4D3CH 1YCSA 4LKXA 4GRMB 4QRBA 4C56B 4Z7VA 3PQYD 1JPFB 1XCXA