1LYXA

Plasmodium falciparum triosephosphate isomerase (pftim)-phosphoglycolate complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Structure of the Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex in two crystal forms: characterization of catalytic loop open and closed conformations in the ligand-bound state
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 97
structure length 246
sequence length 246
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1lyxA00
1KM5A 3QC3A 4UTLA 5CZTA 3EX1A 3H54A 4BR1A 4XQ6A 1KTNA 5AHEA 1H1YA 1KBIA 1QFEA 4R34A 3INPA 1LLZA 1RQBA 1W5NA 3DFSA 1F05A 1RV8A 2RDTA 1LTDA 4UTKA 1XL9A 3B0VC 4JEQA 3NQGA 5F1VA 2GJNA 1KTBA 3VI2A 3EKZA 1ME9A 2HSAA 3HGOA 3QYQA 5G4EA 2QJGA 3UD6A 2W6RA 4LVAA 3ABRA 1ZNNA 3BG5A 3TJLA 4HPXA 2CFFA 1FQ0A 3DFNA 1J5TA 3W88A 3TSDA 3FIGA 1HL2A 3G3MA 2TYSA 4O12A 1XI3A 3UPWA 2R8WA 1P5BA 3UXAA 1GOXA 1G4PA 5AC6A 3P61A 1X1OA 2X1SA 4H6KA 4YCOA 2DZUA 3F1QA 4P2VA 3W22A 5DELA 1HUVA 4HHPA 1W5MA 4CCCA 3O15A 2XFWA 3NQMA 3TW7A 5HINA 4TIMA 3NYZA 3GDRA 5AHLA 4CNNA 3UZJA 5EL1A 4DF1A 3WK3A 1SZEA 3O16A 3STCA 3TQKA 4FIQA 2XN0A 4PA8A 2WNZA 5D09A 2QJHA 5F2LA 3GR7A 1M6JA 4GE8A 3T40A 1TPVA 1VZWA 3F4NA 1VRDA 3I7SA 3S0CA 4WY0A 2WNQA 5KITA 4O1BA 4JTUA 4Z1BA 4LWWA 1GG0A 4X22A 4Y6GA 2WSYA 4JY9A 1M5WA 3QQ1A 3S5NA 1SPQA 1KV8A 1K7EA 1TJPA 2P10A 4LT9A 4JTIA 4K36A 5FESA 5F2MA 1I2RA 4CQ9A 4LS1A 4JTHA 4HNUA 3O06A 3WJSA 2V2HA 4GXMA 4OGZA 2B0MA 4LVFA 1ZCOA 1RR2A 1JUBA 1PHQA 3CIWA 5CSRA 3TJXA 3B0UX 3W73A 1VPXA 3Q58A 4K39A 4OT7A 3W7DA 2DZXA 4BI5A 4O10A 4AHPA 3HG4A 3SR7A 3W84A 5AYYA 1X1ZA 2OMAA 5AHFA 3IVTA 2CZDA 1SO6A 2Y63A 3P82A 2CWNA 2QEZA 2GVLA 3TC7A 4K7VA 1IXOA 1YDVA 1TTIA 3G1HA 4K7YA 1UASA 1IXPA 1W0MA 4RK8A 1EUNA 4IMGA 4DF2A 3LI0A 2QUUA 4JTFA 2A7NA 3HGRA 2NZLA 3NL6A 2VOMA 1G67A 5I3HA 3G3DA 3IGUA 4UTJA 3SGUA 1FDZA 5L6UA 5K9DA 3AJXA 4NXKA 4QJ1A 1OYAA 2QR6A 1ICPA 2H3BA 3BV4A 2WNNA 3CM4A 4KFNA 4D2JA 4ZQOA 4XTIA 4K8EA 3DAQA 3PG9A 5KZDA 1P0KA 3S1XA 1ADOA 2QUTA 3NPUA 1QO2A 2ZCGA 1NSJA 4MIMA 5C2XA 3K30A 1GG1A 4NX5A 1EWDA 3VE9A 2JKAA 1FWSA 1TIMA 4NX0A 2E6DA 1AG1O 1BEUA 3MO7A 1ZENA 3DHDA 3NPXA 3VNDA 2TRSA 4LC6A 3L0GA 2QAFA 3LM7A 3M1ZA 2H6RA 4N6FA 1OHLA 3UWYA 3LHUA 3RLVA 1WAUA 4EOUA 4NT0A 2FDSA 4MFEA 2WKJA 4BWLC 2TSYA 3TCEA 3EX2A 5LHFA 3CEUA 4GBUA 1TPFA 5LNWA 1C9DA 3NL3A 2FQIA 1AL8A 2Y85A 1H60A 1R47A 2QKFA 4EF9A 1YTDA 1VCVA 1TTPA 1FXPA 4RZ6A 4Z1CA 4QQ3A 4UMAA 3UY8A 1I2NA 4N9EA 2JKPA 3I6RA 1MEIA 2A21A 4JR5A 4U4MA 3FJLA 3HB9A 2BSLA 1FY6A 1OK6A 4FNUA 3W7OA 4GUGA 2OT1A 1NFBA 1G69A 3GR8A 3UQNA 3QW3A 3BK0A 3HBLA 3M47A 1VHNA 3USBA 4E2DA 4UR8A 3HGSA 4O52A 2FPTA 5J5DA 2EGZA 1FWRA 3QPZA 1A5BA 4FF7A 3QMRA 4ZQRA 5FEXA 4JX4A 1AW2A 1OFQA 2J9ZA 1PS9A 4MLJA 5HMSA 6TIMA 3GKFA 3ANYA 3CEPA 4K6AA 1HO1A 3GDMA 1JQXA 5FF3A 3KVKA 5AOUA 4G1KA 3B05A 4K38A 4X2RA 4UTIA 3SI9A 3BGJA 3O6CA 1R30A 1XC4A 1FCBA 3CB8A 4QISA 1S5WA 4HNNA 4LRSA 4QITA 3RU6A 4RKAA 2VEPA 3HJZA 2PRLA 2DJXA 4UTMA 5KZEA 4LW7A 3QW4B 5G2WA 3W3OA 5DY2A 3G0SA 3ZR4A 1YTEA 3LCIA 4Q33A 2GVGA 2QCDB 4N9DA 5HR6A 3W7CA 4DBDA 3HQ1A 3G0XA 1ZALA 3TFXA 3G1XA 3NZ1A 5AC8A 2Y70A 1Z44A 4IJBA 1OX4B 3QSRA 3OIXA 5DY3A 3O07A 4UIOA 3W86A 1OFOA 1LLWA 3BPWA 1TPWA 1Z48A 3TU9A 3DU0A 5D32A 4I9AA 1W8SA 2DZVA 1KA9F 2B4GA 1OFDA 2G97A 4O57A 1PCWA 2A1YA 3LXCA 3R89A 3M16A 4FXSA 4JYFA 3GYEA 2VEMA 3T7VA 3IVUA 1F6KA 2WPBA 3IV3A 3TMLA 2GQ9A 3N14A 1QPQA 2GVJA 3GZ3A 4AHOA 3MI2A 2DZSA 3VCRA 1H7PA 4CQ8A 3M9YA 2FLIA 3UXDA 3NM1A 3TDFA 5A5WA 3NNTA 1GPWA 4A2RA 1FCVA 4UC5A 4H3DA 2A85A 2V0TA 3DFTA 3U2OA 1EA0A 1LOQA 3D0CA 4ML9A 1A5AA 1LROA 4AAJA 3W72A 1LZOA 3GAYA 1K02A 1KM2A 1UBSA 3MYOA 3R5EA 3LI1A 1YADA 2CZFA 4PC8A 1GZGA 1DJQA 3EXTA 1SO5A 3P8JA 2ZYFA 3HG2A 2DJLA 3PG8A 1GVRA 4O19A 4XTDA 4AB4A 4ORMA 3EX4A 5CG7A 3GDTA 2DP3A 4Z1AA 4ORIA 1HFBA 3F03K 3W2LA 1OYBA 3TXZA 4GUJA 4O4VA 4I7VA 1BTMA 3KVJA 1WA3A 4O18A 3M0ZA 1ONRA 4O17A 1YXCA 3LCLA 4NJGA 1R2SA 3RLUA 1P1XA 1TTQA 4S2CA 3MHGA 3HG3A 4HNTA 4OBTA 1KFEA 2JKEA 4ICNA 3W1LA 4L4MA 1OJXA 4Y8FA 1ML1A 1W3NA 3BLFA 4E2BA 4Z0JA 4WD0A 4QNEA 1G4TA 3IVSA 5F4WA 4UFKA 1O5KA 2NUXA 4UTHA 1JJKA 3OEXA 2Q8LA 1ICQA 5D33A 4OQVA 4N02A 5HQEA 2CLHA 1D9EA 1P0NA 2E5DA 3FKKA 1X8FA 3BO9A 2PCQA 3RF9A 4JTLA 5U4NA 5T26A 3P5ZA 2V81A 4UCGA 3THQA 1OF8A 3DXIA 2NXIA 3PBWA 5C54A 1TPUA 3M6YA 1I2OA 5CPLA 4IOTA 1WBHA 3W1TA 1C29A 3PUDA 3S5OA 4MOZA 4O28A 1GVOA 5FF4A 4YMZA 4X3ZA 3ATYA 3SZ8A 1XBYA 5G4WA 5LZLA 4RZ4A 2C3ZA 4PEKA 5CZ0A 3PBYA 4K8HA 1KBJA 1QPNA 2YYTA 1KW1A 3M5ZA 5D38A 5A8GA 2X1TA 3MBDA 2V30A 1VR6A 3QJAA 3WFAA 1FCQA 1MO0A 2E6YA 2W0UA 3RNDA 2Y7GA 2YSWA 2GQ8A 3S1UA 3C61A 4XKYB 1NAL1 4WX2A 1TO3A 3QEZA 3TXVA 2J24A 3LB0A 2HS8A 4HKPA 1Y0EA 4Q4KA 1H5YA 1H62A 3IRDA 1WXJA 1JCXA 1LDCA 4P61A 4O54A 2EHHA 3CWNA 5CPMA 4TX9A 1WOBA 2FB3A 2JGYA 3R13A 1K3UA 3QZEA 1WOAA 4JS3A 1UB3A 1RVGA 2ALDA 3CU2A 4JY8A 5K9XA 2A0NA 3BLEA 3STGA 3LRLA 3HG5A 3NM3A 4JTJA 3NA8A 1Q3NA 5HJLA 3FA5A 1M7OA 3E49A 3LRMA 2HMCA 4YCPA 3VFLA 4PCFA 2FJKA 3TQVA 5D2TA 2ZRUA 4CCEA 3TMQA 5D2XA 5LNSA 3L0KA 3L21A 4ZQCA 3OHIA 1TREA 1VLWA 3EKLA 3DFPA 2FFCA 3TR2A 5LSMA 2CZEA 3M7WA 2YFOA 4FX8A 2F84A 3V75A 1OFBA 4ZL1A 2E1DA 1LORA 4A2SA 2AGKA 3C0JA 2QF7A 1IXNA 1YXDA 3W74A 1THFD 2J9YA 2OX1A 3S8HA 5EY5A 4FO4A 1PV8A 4B5NA 1JCYA 1DJNA 3I65A 3C2EA 3W7IA 2J9XA 1TB3A 1AW1A 3I7RA 2ZRYA 3O6YX 3G1VA 3QFEA 3WK1A 3LRKA 3GB6A 2YR1A 1ZAIA 3BG9A 4JX5A 4ZQNA 2VC6A 2X16A 1KFKA 4LTSA 5E0KA 3UPBA 5AHMA 3VE7A 4MPQA 1QAPA 1I2PA 3B8DA 3EWBX 3SY5A 4YLWA 5K2ZA 2G96A 3L66A 1ZJIA 4JN6A 4XZ9A 1Z41A 5K4XA 1VQTA 3W7HA 5AB3A 1VHCA 4JTKA 1K03A 1I4NA 2VEIA 1GVQA 3P5YA 1JR1A 3W7GA 3QF0A 3KFTA 3W7RA 5I3FA 3UZ5A 4AWUA 4PTNA 4ZQPA 3UWQA 1NVMA 4DBEA 1FUYA 1KFLA 1XCFA 4LU0A 3HGJA 4IXXA 5EPDA 1MEWA 2V2DA 1N55A 2XN2A 3UWUA 1FDYA 3HO8A 4I7UA 3L65A 4FHAA 2A6LA 4MUZA 1SUXA 3QM3A 3G1AA 3E02A 3GK0A 1MXSA 3IIZA 3WJWA 4LV4A 1S3HA 5AC7A 3PAJA 1F76A 3N73A 3PY2A 4ALDA 3BGGA 4O1DA 4AHQA 3LV5A 2YW3A 4HT3A 1W3TA 2YX0A 3NVTA 1OVDA 3RMJA 1TV5A 1GT8A 2AAMA 1QR7A 3MMTA 1TSIA 1BWKA 2VFDA 4BWLA 3KVLA 2H3DA 3QMSA 3KOFA 2YDAA 3W76A 2O7QA 3W1NA 5HWJA 1B4EA 3M5XA 1DKWA 1LRTA 2QDGA 2QCMA 1TTJA 3QH2A 2V8ZA 2BLEA 4M7TA 4M6QA 1HO4A 2C6QA 4IGHA 1KLZA 2ZZ5A 3TAOA 3W1AA 2B7NA 1G6CA 2WV8A 5H91A 5I3GA 3ABQA 3GDLA 3EXRA 3L9CA 1YDOA 3BLIA 3W7LA 4ZQMA 2J27A 2BTMA 2ZTJA 1F74A 2G95A 3L5MA 4I7WA 1R2RA 3KHJA 1Q45A 1VCGA 1EPXA 4QM1A 1F7BA 1GVFA 2V9DA 1OFEA 3LHZA 1GWJA 4UFLA 1GTHA 4DO4A 3C2OA 3NL2A 4BF9A 1EEPA 1KFCA 3R2GA 3IIXA 2C1HA 3LCFA 4UNKA 2NUWA 4XUGA 4UNLA 4MFDA 2CLKA 5AYZA 3L0NA 3TK7A 1H7RA 2FPVA 2HS6A 3NQFA 3O63A 2QUVA 1K8XA 3FYPA 3M41A 1PL9A 3O05A 3QMTA 2WJZA 5DCEA 5LNRA 3NR0A 5D2WA 3UWWA 4Y90A 3YPIA 4CCDA 1SQ7A 4NZJA 3DI0A 1A5SA 5DLCA 1B9BA 1S5TA 1B3OA 4NNAA 4CNPA 3C6CA 2A6NA 2RFGA 2Z6JA 1OG0A 1QPRA 2QCEA 3SGZA 4AF0B 4DO6A 5D37A 3UWZA 4LY8A 1FDJA 5IBXA 1DV7A 1R2TA 1W37A 3SW6A 1MZHA 4NXSA 4POCA 2VFGA 3G1SA 2NWRA 4N2YA 4NZFA 1YPIA 2Z0IA 1DORA 3N9SA 2J6XA 2FIQA 3LXAA 4NJIA 4EIVA 4UTTC 1I45A 3KX6A 3BW2A 4RX0A 3N2MA 3SJ3A 1F2JA 3LLDA 3PVFA 4MLRA 5DBUA 3RFAA 4JTTA 2C18A 1YPFA 5MHBA 3U6WA 1G7VA 3OG3A 1GQNA 5F4XA 3NXFA 5CGQA 2ZZ6A 2ZA3A 1K8YA 3SFKA 3G8EA 4NJJA 4MYXA 4LV9A 1FX6A 3G18A 1Q6LA 4R7JA 3A23A 1H1ZA 1RZMA 1VH7A 1QNVA 3EXSA 5G1YA 3W7QA 1JULA 3LHVA 4ONVA 4N4QA 1NF0A 4LNYA 2P0OA 4MZ1A 5U7SA 2YPIA 1TV7A 3NZRA 2TPSA 3MWAA 1LBMA 3DFOA 4W9TA 3GXPA 1PHWA 5LNVA 4EVZA 2A7PA 3LHYA 2G5WA 1TPB1 1L2UA 3LXBA 3NDOA 1AK5A 2ZRXA 5BNKA 2J88A 2F7FA 3C3NA 3DFQA 3NQ7A 3QRHA 5AHIA 2ISVA 1XBZA 2OCZA 4O0ZA 4C1KA 3IIPA 1L6WA 2NX1A 3NAVA 4L4LA 4O0KA 1ZY9A 3E96A 4EF8A 3AO0A 4WOQA 5IBXC 2VEKA 3P7YA 2WOQA 4H4IA 4S2BA 5G2HA 1AW5A 3PBVA 5HUOA 1KFBA 3W6YA 4FX7A 5I3KA 3TAKA 1W54A 3CLMA 3NPWA 4BFAA 5CPOA 4BK9A 1FWWA 1H7OA 3W7EA 4FB7A 1O95A 1QOPA 3TA6A 1GYNA 2D73A 4UFJA 5BOOA 2CW6A 2ISSA 2DZWA 4UFHA 5J5RA 3TE9A 2I14A 3B03A 4TU1A 4O1AA 2CLEA 1KM6A 4NU7A 2CLIA 3G24A 3DBPA 2R91A 3DZ1A 4YXGA 5LGZA 5TQLA 3R8RA 3PS7A 3TW6A 5D30A 1D3HA 5G2IA 4UMCA 1WBJA 3W71A 4PH6A 1O60A 4NQ1A 2X1UA 4GRSA 3NOEA 2RKXA 2WO5A 2Q3RA 4JDYA 4MZYA 3MP4A 3BARA 3N9RA 2ATSA 2ZZ1A 2OJPA 2I9EA 1GEQA 1TMHA 3P62A 3W2JA 1NEYA 2H8XA 1X7FA 3O1NA 4UXDA 5D03A 4YL2A 4K37A 4O13A 3LTSA 4UTWC 2X30A 2EKCA 5K7JA 3BW3A 2ZZ2A 3MYPA 4O50A 3KRSA 4TO8A 3PC0A 4EWND 1DL3A 1UUMA 3G0UA 2GJLA 3A22A 3P74A 1XUUA 1H63A 1DBTA 3S42A 4WY0B 1O5XA 4IUOA 1W5QA 1QCWA 3LBCA 4LOCA 2Y88A 4LVBA 1H61A 3N34A 1IF2A 2YGYA 3NQEA 4DPPA 3STEA 3QQ0A 4PODA 4WY0F 3LHWA 3OBKA 5CPNA 3E12A 1LBFA 3NGJA 3A9IA 3LDVA 1KM0A 3TUUA 1RPXA 3T55A 1ME7A 4RV8A 4JYEA 3PUEA 1UJPA 3DKJA 2GPTA 4XBSA 3W1UA 1DVJA 3FKRA 1SW3A 1SW7A 2Y7DA 3IGXA 4M7SA 5FEZA 2Q8ZA 2ZQ0A 1HTIA 3IEBA 3MBFA 3P80A 4NNBA 5BMWA 4JYDA 1O4UA 2E09A 1TQJA 3EX3A 4N6EA 3NQ6A 3G1YA 3EWUA 1L9WA 4M6PA 5FI8A 4M5PA 2DORA 4DELA 2PURA 1VYPX 5TBOA 1S5VA 5KSWA 1EP2A 1LBLA 3GVGA 4WQ6A 1FWNA 4ADTA 4TMBA 2CLFA 3W7NA 2GUUA 2CLOA 4KFOA 3L67A 4NVTA 4FNPA 2ZBTA 2Q3OA 2ZA2A 2AQWA 3LV6A 3C2RA 3DI1A 1KM3A 5HR7A 3OVRA 1QDSA 4O16A 1VYRA 3A5FA 4JTEA 4X9SA 3TNOA 2QCNA 3PR2A 3HIJA 4GUHA 3MI6A 4OWGA 1D3GA 3P60A 3EEGA 3TX9A 5D05A 1YDNA 2X2GA 2BWGA 3O6DA 3H53A 1BWLA 3JR2A 3GIYA 1OFAA 2Z2UA 2NLIA 1KM1A 1VGAA 1V7YA 2PE4A 5AN7A 3WJZA 4MZ8A 1Q6RA 1H7NA 3FYOA 2XN1A 3PUOA 3FFSA 1EB3A 3MI3A 1EP1A 2ZZ7A 4O1CA 4DF0A 5D02A 1SFLA 2X1RA 4E0CA 1J4EA 4MKNA 3DHFA 3PB0A 2QJIA 1L6SA 5K4ZA 2UV8G 3LX9A 3W87A 1JCMP 1XFBA 4WJEA 3S1VA 3FEMA 2Y89A 1ZAJA 2B7OA 1Z42A 3TSMA 4U28A 1T0OA 2CLLA 2I1OA 5F4SA 2RDUA 4GNJA 1H51A 2KZHA 1KTCA 5EKYA 2W79A 2QCCA 2Y7EA 3STFA 1LP6A 1PCKA 3W23A 1N8FA 4MJMA 3ZFHA 4AWSA 3UNDA 1O94A 3NO5A 1A50A 4AVFA 4UMBA 2A7RA 3W83A 2Y7FA 4UR7A 1F73A 1QMLA 2QCDA 5LHEA 1RD5A 3NQAA 4TMCA 4FNTA 2WQPA 5FF2A 3CT7A 4OV4A 3W7JA 2WSRA 2JBMA 1OX4A 3CQ0A 4NUWA 1OX6A 4QSHA 2B7QA 4JICA 2FPYA 3HOJA 2ZTKA 4KKXA 1MEHA 3GLCA 4GUFA 2H90A 3Q94A 3TSBA 4XWUA 1I2QA 3LHTA 5FEWA 3FOKA 3KAOA 4RXFA 2E77A 3SECA 1UCWA 2RH9A 2ZRVA 6ALDA 1GTEA 5L9FA 4O4WA 2ZA1A 1GYLA 3IIVA 4IMFA 4IXHA 1TPEA 4IX0A 4GWEA 2BXVA 3C2VA 3LCXA 3A24A 4E38A 3PULA 4DXVA 1H7XA 3GKAA 3FLUA 4LUJA 1SO4A 4JD4A 5HULA 3NQ2A 1B57A 4XBKA 1MSSA 3WJYA 3W7KA 4AWTA 1P4CA 5ABTA 2BX7A 1W1ZA 2ZZ3A 3BG3A 2VELA 3L5LA 3GNDA 1XBXA 4RXGA 5CKSA 2RDWA 3G22A 2JGQA 4LS2A 3LTYA 4KFPA 4M19A 1H50A 4Y96A 1JUEA 2ABAA 2E68A 2C16A 4FX6M 2YXGA 1BKSA 3G1DA 1WYIA 3N3MA 3Q2DA 1C8VA 2GOUA 3WJXA 4A22A 2C13A 3R12A 2Y61A 1AL7A 4ZMGA 5FF0A 1LRNA 1XDMA 3PSVA 3KRUA 1VC4A 4HPJA 2EF9A 2OZ0A 4KWVA 1K8ZA 5K3VA 1ME8A 5F1UA 1FWTA 5KINA 3TROA 2R94A 4LVGA 3LTPA 1YYAA 3DH7A 4JTGA 4IQLA 1V5XA 3L5AA 1LOLA 2EAWA 1NF7A 3L2IA 1H7WA 2VFFA 3CPRA 1SSGA 1EX5A 3GAKA 5HWNA 5HNRA 3NQVA 1K7FA 1QO5A 5DCBA 1OK4A 3LERA 4RR4A 3TQ0A 4DEFA 1OX5A 1Q6OA 3HF3A 4WZHA 2IQTA 4GUIA 3A5VA 5GVJA 4HIBA 3LBMA 2R14A 4CLMA 1W5PA 4UTTA 1TPC1 3JS3A 2VFIA 7TIMA 1HG3A 1ZHAA 2WSQA 3PB2A 3G1FA 1U5JA 1LM1A 2HTMA 4JTSA 1FBAA 5EMUA 3M43A 1J2WA 3T78A 2ZZ4A 5DN1A 3G8RA 3ATZA 2C19A 1RQHA 4BI7A 3W1RA 1LRQA 4UUIA 3GDKA 1FXQA 1XBVA 3W85A 5F2GA 4OU1A 1XM3A 3B04A 4DO5A 4ZZ9A 2E6AA 3W1XA 2E6FA 1T99A 1TRDA 1TPDA 1TRIA 3M44A 4A29A 3LCWA 4UFIA 3TFCA 4S1FA 1WX0A 2LLEA 4A21A 4MY8A 1IIGA 4OE7A 3E9AA 2Z1BA 5BW6A 1TPH1 2CLMA 4XKYA 4QAIA 1N7KA 4Z1DA 1VYSX 3N19B 1W5OA 1E51A 3H55A 3IGSA 5LGXA 4HN4A 1U83A 4NJKA 4LRTA 4FXRA 3ZWSA 5IM51 3C8FA 3S1WA 1OYCA 4FEZA 3W1PA 1SFJA 5BMXA 5D2VA 4A3UA 4Z08A 2NXHA 1GJPA 3OVQA 3MUXA 2C15A 3B4UA 4JIPA 1W3IA 1YTKA 4OHQA 3CTLA 3MJYA 4LUIA 4NJHA 1VCFA 3EWWA 3B0PA 1EUAA 4FNQA 1AMKA 1M7PA 4IMCA 2NX9A 4PFMA 4DPQA 3P8IA 5D2YA 1F5ZA 5DCDA 3I68A 8TIMA 4N9BA 3EWZA 1XKYA 3TV8A 1ICSA 1OFPA 2E5CA 3S9YA 1PVNA 3N2XA 3TC6A 4ADSA 1KLYA 4R33A 3C52A 1A5CA 4LVDA 3I7QA 5AHNA 5AYXA 2RHGA 1XXXA 4CQAA 5DXXA 3TKFA 1JCJA 2QCHA 3KXQA 3CWOX 4J9JA 2GQAA 1UUOA 1IIHA 3NL5A 3HMJG 4RCXA 4O15A 1SSDA 5E1QA 5DBTA 1IXQA 1SZNA 3P84A 2FTPA 4UTWA 2ZRZA 5I3IA 4FNSA 3KVMA 5TIMA 1G7UA 1RQEA 1TQXA 2QAPA 5C5YA 2DU2A 3W1MA 3B06A 1JRBA 3M5YA 1JVNA 2PC4A 2ZRWA 3W07A 4TR9A 4N4PA 1ZAHA 5CZJA 5KZMA 1GVSA 2DZPA 3LOTA 3U8GA 5LNUA 2YZRA 2CZ5A 3MP3A 4MJZA 4AXKA 5SWUA 3W7MA 1A53A 3EWYA 3W2KA 5D04C 1KV5A 4ZVJA 2V82A 3UYCA 3JRKA 2QCFA 3W2NA 4HSNA 4MYAA 5CZSA 4JXCA 3T44A 4UFMA 1TJRA 2ZFAA 3ABOA 3W9ZA 3LGEA 4DQWA 3S5YA 4HSOA 3BW4A 1JCLA 1VS1A 4MY9A 1WDWA 5EBUA 2A4AA 2V5LA 3P67A 3MHUA 1LOSA 2V5BA 2QCLA 1Q6QA 3WK0A 3LLFA 3QPYA 2A2IA 5LKYA 5H2ZA 4IPIA 4JIQA 4YWIA 3LCHA 5FF7A 5I3JA 4R53A 2ATMA 3ZWTA 4Q32A 3W70A 4M6VA 2YYUA 3NQCA 5AFDA 3O8AA 3PM6A 3ZS4A 4WXZA 3VKJA 3W1QA 4AEOA 4FIRA 4BI6A 4PL2A 4JDBA 1VLIA 4PL1A 5FEPA 1FCUA 3HPSA 3LCGA 1DQXA 1SW0A 3W2UA 2Z6IA 3E0IA 3W7PA 1IGSA 4RZ5A 1QWGA 1XUZA 4ADUA 3UWVA 2JK2A 3NQDA 1DOSA 2VFEA 3PSWA 3PBUA 3FS2A 1ALDA 1W56A 2VENA 2A5HA 2O7SA 3RK8A 4CNOA 2VXNA 2YW4A 3W2MA 4N9CA 1KFJA 1CI1A 3SIZA 1T96A 1CW2A 3TIMA 2QCGA 1F6PA 2FB2A 3A21A 3NEVA 3NG3A 1VJIA 4JNMA 3UY7A 2P1FA 1OF6A 1SZFA 3ABSA 5C55A 5HUPA 1SR9A 1L6YA 3EWXA 4RLIA 3GX9A 1YLVA 2H8ZA 3HPXA 2VKZG 4IWWA 5K9CA 5BRBA 2EPHA 3C56A 4GC4A 4LS0A 5HWMA 2E5BA 1JCNA 5F2IA 2ZDRA 1ZFJA 4RJEA 3MHFA 3TH6A 2B7PA 4QIUA 5E93A 4MY1A 1B4KA 2NUYA 1PIIA 2CU0A 1XDLA 1G4SA 2NXGA 4IMEA 3C2FA 4AH7A 4GFSA 4LC8A 3S5ZA 1SO3A 2OT0A 1LYXA 3FJ6A 5DXYA 4IX2A 5C6MA 1TCDA 2NV1A 1WQ5A 1SU5A 4NNCA 2ABBA 3NQ8A 1R46A 5KMYA 1YXYA 1PE1A 4AF0A 3ELFA 1LCOA 3PF3A 1OFRA 4Z0SA 1TYGA 3F4WA 1TV8A 1KM4A 1CX9A 4C1LA 1EWEA 1WV2A 3S6DA 4O11A 2V2CA 4WXYA 1X6UA 3HPZA 3L68A 3OVPA 4O8RA 4FNRA 3QSTA 2NWSA 4QNWA 3IIOA 3KRZA 4Y9AA 3THAA 5KTLA 4WUIA 3NPVA 5G5IA 3CIXA 3GNNA 2NX3A 4KWWA 3T4CA 1QOQA 1EP3A 2VFHA 3EX6A 1JUKA 3P81A 5EYWA 4GJ1A 3EB2A 4O14A 2BZNA 3GXNA 4JX6A 3GXTA 4JGDA 4UTUA 2QDHA 4IPJA 3DGRA 3OA3A 1W31A 2DZTA 1SZGA 2PRHA 2Y6ZA 1T8XA 3M5VA 1EIXA 1G4EA 3DENA 2Y62A 4OV9A 1JQVA 2YCEA 2YFNA 4O53A 2C14A 1I8JA 1QPOA 3CC1A 5G1TA 2NV2A 3DKLA 3W75A 1K7XA 3BVJA 4HNVA 1DQWA 3C4UA 3WK2A 1DHPA 2ISWA 2PRMA 5CSSA 4WOZA 3CHVA 1JRCA 3V1PA 2C0AA 4AMAA 3MP5A 4MVAA 5EA9A 3SSJA 3MW7A 3Q37A 3PWAA 2TMDA 1OABA 4IMDA
chains in the Genus database with same CATH superfamily
4HHMA 3BICA 3GBEA 2QV4A 1KTNA 2UZ9A 1H1YA 3INPA 4WR3A 1RQBA 1DTNA 1F05A 1RV8A 3R58A 2E1WA 1LTDA 4UTKA 1U1JA 4JCMA 2VJXA 1XWYA 5F1VA 1AJ0A 1UR9A 1KTBA 1UP0A 5M03A 3L4VA 2Q02A 3OG2A 3TN6A 6REQA 1ME9A 3OZMA 3IJQA 3PBGA 2EEXA 5FL0A 3GXDA 5G4EA 4RNFA 1GQJA 3BG5A 4GPNA 4ZSUA 3TJLA 4EP8C 1FQ0A 3FN9A 2PTZA 2PD5A 3W88A 1PKNA 3CUJA 5FJJA 2WSKA 3VZZA 2E25A 5JH1A 1K9TA 5AC6A 3C86A 2QJMA 4H6KA 1JZ5A 3QV9A 2DZUA 1J0KA 2ACRA 5DELA 1JGMA 1W5MA 1E4NA 4D8LA 2XFWA 3MO4A 1H2JA 3GDRA 3IS4A 2DQXA 4KCWA 1ZJHA 4DF1A 1RY0A 3TQKA 2XN0A 5D09A 5F2LA 2PWHA 3FHAA 3GR7A 4L1WA 4AZ6A 1M6JA 4J3TA 1VZWA 2EKGA 1WAWA 5KITA 1M3UA 5DMNA 4JTUA 3GNRA 4X22A 1NDVA 1KV8A 1JYXA 4GY1A 1XHGA 2P10A 1B0IA 4GCAA 4JTIA 4K36A 3VC6A 5F2MA 3UEQA 5H8UA 3TTOA 3RJYA 3U2ZA 5C9WA 4LS1A 1QHOA 2DT2A 4HNCA 3PFRA 3SDOA 1TA3A 3EDKA 4NI8A 3WJSA 2V2HA 4GXMA 2HE5A 2VCBA 5I78A 3PFMA 4Z2JA 4ACZB 2QGYA 2PTXA 1W9VA 1Z89A 4DWDA 5BOFA 2O56A 1MFUA 1O5QA 4GNKB 3W73A 1OBAA 1VF8A 1AA1B 4YIWA 1K1DA 2WSPA 1WDQA 4AY7A 3DYOA 2DZXA 1ITCA 4O10A 5BRQA 4AHPA 3HG4A 3SR7A 5AYYA 3RO8A 3EOOA 3GWQA 1UR0A 1Q6DA 3IVTA 1DYSA 3AHTA 3AJ7A 1SO6A 2Y63A 3UA4A 4JAWA 2CWNA 3TC7A 4K7VA 5C7HA 4IMAA 2QJNA 1UASA 3WYZA 4EKJA 3AYRA 3VIHA 1A3XA 4LANA 3RIKA 3VXGA 1KWKA 1EC7A 4UTJA 5H1WA 5L6UA 5K9DA 4QJ1A 1AODA 2QR6A 1W1PA 2WNNA 3HFTA 4ZQOA 1Z32X 1M9HA 5KZDA 1A4MA 3NTYA 2QUTA 3NPUA 5CC5A 1HNYA 2YDRA 4XZIA 3K30A 2FVKA 1WB0A 1TIMA 4NX0A 3S9IA 2HNHA 3V0SA 3RGTA 1BEUA 3MO7A 1ZENA 2QZRA 3FJNA 2Y5EA 3CMGA 2WZMA 1GOMA 3B9NA 4LC6A 4I5XA 3M1ZA 3CUHA 1NP0A 1HVXA 5D9OA 1QWKA 1SFTA 1AH3A 2V3EA 3LHUA 1Q65A 3WMBA 1DIDA 1WAUA 4GQQA 4M51A 4OZOA 4MFEA 4BWLC 4HQVA 3CEUA 4W8BA 5LNWA 1AL8A 1JG9A 3B8UA 1YTDA 1TTPA 4RZ6A 3SUSA 2XVNA 1I2NA 4N9EA 4OOZA 1FHVA 3I6RA 2DW7A 2NQLA 2A21A 4JQ3A 1FY6A 3H2OA 1DXEA 4Y9MA 3DFHA 3QKEA 3QW3A 1BQCA 4E2DA 1VHNA 4PUWA 3SN0A 1XKJA 4IIHA 4O52A 1FWRA 3AIUA 3M07A 3QMRA 4ZQRA 2D20A 1OFQA 2J9ZA 3L4WA 2PI6A 3FGCB 3H4XA 1E71M 3ANYA 2GQ3A 2WMIB 1HO1A 2DQWA 4ZO8A 3ITXA 3KVKA 4LBSA 5AOUA 4G1KA 4K38A 4X2RA 3SI9A 4NYYA 1YBQB 3P0WA 3UR2A 4QAWA 1FCBA 5E09A 3CB8A 4OUIA 4HNNA 4EPEC 1BAGA 3WLPA 1UZHA 1EDQA 2PWEA 2RUSA 4UTMA 3W3OA 3T0BA 3KZPA 4H6RA 1ZBCA 3G1XA 4DI8A 1VFUA 3NZ1A 5AC8A 4IJBA 2ZICA 3QZAA 1OY0A 1EXBA 5DY3A 3O07A 1KB3A 4JFTA 3F2BA 1UR4A 3W00A 4DLFA 3ARTA 4S3KA 2G97A 4O57A 1JGIA 2AL2A 3RG6A 1IHIA 4JYFA 3II1A 3SQSA 2WPBA 3TMLA 2GQ9A 1QPQA 2A3EA 1XYCA 2FZDA 3S3GA 1WZAA 3UETA 5HMDA 2PMQA 1BG4A 2CNCA 4MB1A 3TOYA 1RPKA 4A2RA 1P0DA 4LAOA 2W61A 2V0TA 2O9OA 2DIEA 1MYRA 1L2QA 3I4EA 3B97A 1UH3A 3WDHA 1LROA 2FZMA 3GAYA 3DHPA 1K02A 5BCAA 5AECA 2DSZA 3P8JA 2ZYFA 3IJDA 1QW7A 3FXYA 4ORMA 4IFRA 2WWDA 4O1EA 2DP3A 3UR7A 3F2CA 4RW3A 4S38A 7REQB 4TOQA 4PB3A 3W2LA 1OYBA 3SCQA 4I7VA 1BTMA 1A5NC 1WA3A 4DJFD 2JEQA 3B8VA 4JFSA 1XG3A 1CENA 3RLUA 4C6NA 3G2GA 3BCDA 1TTQA 4OBTA 1F8MA 3UESA 1VBRA 1A49A 4L4MA 1OJXA 4F0SA 1ML1A 4MHBA 3QPEA 1J0YA 1DWFM 1O5KA 2NUXA 1ICQA 3RR1A 1WP6A 1F8IA 2HXTA 3CK5A 3CQJA 2VUYA 1P0NA 2E5DA 1U30A 1E43A 3RF9A 4HA3A 1TR9A 2V81A 2VC5A 4UCGA 1ZS2A 3THQA 5JBDA 2NXIA 5C54A 1I2OA 1J0ZA 2VRQA 3TJ4A 3A4XA 3W1TA 4D6DA 4MOZA 5FF4A 2GJXB 3MJMA 3BLPX 3B9DA 3SZ8A 1XC6A 1UWQA 2JIWA 5G4WA 5LZLA 3W4RA 1PKMA 2C3ZA 5CZ0A 4DUWA 2ZUWA 1EKOA 2ADAA 1KBJA 1QPNA 5CPSA 3WLQA 2YYTA 5GNZA 1PPIA 2X1TA 5T91A 3VIFA 5CBBA 3F2DA 4UQ9A 1CECA 4WX2A 2BGSA 1QJWA 1TO3A 1R86A 3TXVA 3E2VA 1H62A 3B8SA 1Q7MA 1JCXA 3RMEA 4I6KA 3TR9A 3V3WA 4O54A 2EHHA 4DJDD 3R13A 3QZEA 2WVVB 1TMQA 5K9XA 3BLEA 4B3KA 3N1AA 3HM7A 1TFVA 2X0HA 3WH6A 2ONEA 1C3FA 3SJNA 2W9MA 2HMCA 4K8GA 2OWWA 4YCPA 4ZB0A 4YJ5A 4E6MA 1O68A 3N9KA 2FMOA 2VMFA 3TOPA 4ZQCA 4CU8A 1XYLA 3OHIA 3TW9A 2E40A 4YYCA 2CZEA 2XH0A 4QQUA 1G94A 3K2GA 3M7SA 4JOMA 4FX8A 3V75A 3NCOA 4A2SA 1R3RA 1S39A 3KCOA 3C0JA 1RLCL 2QF7A 1IXNA 1THFD 2OX1A 1C8XA 2VDGA 3AZSA 2CETA 3CL8A 1DJNA 3I65A 3PJWA 1D3CA 4BJHA 1TB3A 3EB4A 3O6YX 3W82A 3H7RA 4H01A 2VDIA 3GB6A 4M81A 3M6DA 2E7FA 3BG9A 3FDGA 1PX8A 4KERA 2X16A 1D7KA 1FWFC 5AHMA 9RUBA 4XZNX 1I2PA 2G96A 5CLWA 3L66A 2OTDA 5K4XA 3LYEA 1VQTA 2UY5A 2VD9A 1VHCA 2BY2A 5LIKX 3T09A 3HJEA 3MZNA 3CQKA 4R9XA 1JR1A 3RCYA 3R94A 3AMGA 2V63A 1FUYA 1JFXA 2FJUB 1MEWA 2V2DA 2XN2A 4HOXA 2PS2A 4ERAA 3L65A 4FHAA 3E02A 1Q85A 3OBAA 1S3HA 3ARPA 1L6FA 4GK8A 2PWFA 3PY2A 1EEXA 3BGGA 1BPLB 3AI0A 4Q7BA 1OZQA 5XIMA 2YX0A 1JI1A 1QR7A 2NLYA 4JTCA 1UBPC 3IJ9A 2OYMA 3W76A 4UZSA 5HWJA 1DKWA 3VMNA 1LRTA 3HV9A 1XV8A 3VZXA 3AICA 2QVHA 1KLZA 4O8AA 3O0KA 3W1AA 1UD8A 3OGRA 4H6EA 3UJFA 2CHRA 5H91A 5I3GA 4HU4A 1YDOA 3MUAA 1R2RA 3KHJA 3GTXA 1EPVA 2ICSA 1EPXA 1LWIA 1H3GA 4JTRA 2O9PA 3K4WA 1OFEA 1GTHA 4B3ZA 5HXMA 3EA1A 1JYNA 3E2RA 4UNLA 2NT1A 1OC5A 1ADDA 2HS6A 3NQFA 4KMQA 5D8ZA 4AQLA 4YPJA 2QUVA 1K8XA 4G56A 4Y90A 1GGOA 1E6ZA 4CNPA 3C6CA 2A6NA 3BDKA 3S5SA 1QPRA 1VBUA 2CERA 3VILA 4GH1A 4DO6A 1UWAA 2XZ9A 1W37A 3PZGA 2P76A 3MANA 4BEUA 4POCA 3FCPA 4N2YA 1VEMA 2CLPA 1YPIA 4X9YA 3QY8A 3GFZA 2J6XA 2WMHA 5I06A 1DE5A 4C6FA 4RX0A 2W4XA 3PVFA 1LJYA 5DBUA 4I8YA 2HJPA 1UR8A 2C18A 3PNZA 3U6WA 1S5NA 3LPPA 1OZMA 1OGBA 1UWIA 3AS3A 2WHLA 3NXFA 4EANA 2ZA3A 2P3ZA 1CXLA 1WDDA 1JF5A 3NURA 4NJJA 4LV9A 1FX6A 4D72A 4R7JA 4EPDC 2OQYA 1IWPA 4K1GA 3W7QA 1ISXA 4GX9A 4BQ4A 4ONVA 4Q8WA 3BLKA 4XVDA 1NF0A 4GYPA 3BTNA 1V03A 4RE3A 3MWAA 1LBMA 5HAOA 3U7VA 3FV9A 4ZA0A 4DJED 1I6NA 1NDZA 1L2UA 1BF6A 3LXBA 3GD6A 2HVOA 1K6WA 3WENA 3AALA 3WLHA 3DFQA 5AHIA 3M0YA 1I0BA 4O0ZA 1CGWA 2NX1A 2BMBA 3QHMA 5A2BA 4JQAA 4ZO9A 4EF8A 2ZUNA 4WOQA 4JQ2A 2WKGA 3FSTA 4H4IA 3W83A 1Q66A 3N2CA 3TAKA 3U3HA 3IARA 3B4YA 1OD8A 3GXFA 1Y5WA 4AZ7A 1H7OA 1V08A 1OCJA 4LAMA 1O66A 5BOOA 1TWIA 2VNCA 4GGHA 2BASA 1KRCC 4MPKA 4B5XA 3TE9A 1EJRC 4ILSA 1GOKA 2BHUA 1KM6A 4NU7A 5HDRA 3G24A 1YPXA 5A1AA 3DZ1A 3PZNA 5TQLA 3R8RA 1O1ZA 3D46A 5G2IA 2R1KA 1ZBKA 1WBJA 1XH1A 3LGDA 1O60A 4NQ1A 1PZ3A 1D8WA 2XYLA 4XAPA 3MUY1 1MUCA 5M3WA 2ZZ1A 2I9EA 4F79A 1B3XA 5D03A 4DBUA 1TUXA 4O13A 2C91A 4J27A 2J13A 1KR1A 3KS6A 5K7JA 4LUYA 3WF2A 4HD5A 3MYPA 1LG2A 4EWND 4IIBA 3G0UA 1XUUA 3BE7A 2WC4A 1DBTA 3S42A 3T0TA 1DWHM 1O5XA 3AHXA 4IUOA 1POJA 3ORWA 1HJQA 2AKZA 3A47A 1QCWA 2ASHA 1NM9A 4LOCA 4DZHA 1W3LA 2XFFA 1XSJA 1GOOA 4GVGA 3AS2A 2WVSA 4AD3A 3EAUA 3TUUA 4RV8A 3VNJA 5BWAA 1TA3B 1FWCC 1NARA 2Z2BA 1JZ6A 1JD7A 1XLAA 3APGA 2Y7DA 3IGXA 4M7SA 5FEZA 3WUEA 2Q8ZA 1HTIA 3LN3A 4JYDA 1NDYA 4Z2LA 1TQJA 1FOBA 4N6EA 3G1YA 2YDSA 4JN8A 4CKQA 1KNWA 3AS0A 5TBOA 3UZWA 2R82A 4IP4A 3GVGA 3E0FA 4KGLA 3UU0A 4IQEA 4TMBA 4I6VA 1W9XA 3L67A 2D2OA 2RDXA 4XBJA 2Q3OA 3C2RA 2BVYA 3PZVA 1QBBA 4JTEA 2DVXA 2FGZA 3PR2A 4NKCA 3AIRA 2OEMA 3EEGA 3WDJA 2IPGA 1FWHC 5D05A 1J2BA 1Q2RA 3SURA 3H53A 1BWLA 5LYRA 4PTWA 3JR2A 3GTIA 1OFAA 1VFHA 3T2OA 2NLIA 1KM1A 1VGAA 5AN7A 3WJZA 1H7NA 1OT2A 1R9XA 3AU6A 4GXWA 2WJFA 3PUOA 4H6QA 3FFSA 4U33A 1EB3A 2XGZA 4C60A 4GJJA 3SN1A 4RDWA 4O1CA 3VD3A 1DWIM 3R6IA 3P6LA 3WD0A 3OYZA 4D8AA 3S2CA 3CHCA 1MNZA 4CNUA 2Y89A 2QPSA 1T0OA 3ABZA 4BQ3A 5F4SA 4GNJA 4AD0A 3HA1A 3SSZA 5ECVA 2W79A 5C8BB 5CEWA 3UG5A 1PCKA 4MNLA 2XINA 3ZFHA 1QW8A 3IAPA 2A7RA 1J0HA 4QJ4B 1F73A 3ES8A 4FNTA 3BGAA 1CNVA 3W7JA 5DQPA 2ZXDA 3PPCA 3CQ0A 2CHNA 1JZ4A 5EMMA 4L9YA 3FAWA 3OYXA 1V6VA 4JICA 1GQLA 3TYAA 1MFVA 3AISA 1PAMA 5DRIA 4X60A 4C6KA 1GW1A 3TSBA 1QK2A 1OINA 1W3JA 3ITVA 2D0GA 3SCNA 1I2QA 1XGEA 3AQUA 1AQFA 3ARVA 3FOKA 1DHKA 2FFIA 2E77A 5FJRA 2OLAA 5JMUA 3MZ2A 4M24A 1XIGA 4GWEA 3WUGA 1E6RA 3A24A 1XH2A 1H7XA 2CBVA 4JD4A 1PWMA 3OLDA 1XLKA 2VRJA 3CV1A 3W7KA 1W1ZA 1GQIA 3GNDA 4PFHA 1LG1A 3G22A 1MRAA 3C8NA 2ESCA 3T05A 3FA4A 1CGXA 1W9BM 2GFTA 2YXGA 3WJXA 3NSXA 1AL7A 1XDMA 4ZXLA 3KRUA 2EF9A 2OZ0A 2XJ7A 4QE5A 1K8ZA 4J2PA 4RW5A 1FWTA 2NQJA 1JAKA 5KINA 2R94A 4LVGA 2ZUSA 4JTGA 4IICA 2AL2B 3BJTA 4M0XA 1LOLA 3ZMRA 4E8DA 4Q8PA 4IGNA 4B2DA 1NF7A 3N11A 3ZZ1A 1EX5A 3GAKA 5HWNA 2MUCA 4I5UA 3NQVA 3LERA 4DEFA 3HF3A 2QGHA 2AOSA 2WKLA 3LBMA 4C90A 4CLMA 1WKDA 4UTTA 3IUIA 2VFIA 3CPUA 2NQZA 2WSQA 2W27A 4S3JA 2Z1VA 2AQVA 3GVRA 3GW0A 1LM1A 2HTMA 5AYIA 3EDDA 4A3QA 3JW7A 1E56A 1E9ZB 2DEPA 3ATZA 3N13A 3RPMA 3CV2A 1P0EA 3B8IA 3GDKA 1X8CA 1XBVA 2C7FA 4OU1A 4BQ5A 4ZZ9A 1FFQA 2E6AA 3W1XA 1EIBA 3JUGA 5CH9A 1TRDA 1G01A 4AZBA 3M44A 4BY3A 1SJBA 4U5IA 3LD5A 4MY8A 2PGWA 3XIMA 1EZ2A 1XIHA 4NZ5A 3CAQA 2XU2A 5D4YA 2IKIA 2WMGA 1CXIA 4XKYA 4ZOCA 1N7KA 3U7BA 3L4ZA 4W7VA 4FXRA 4PUKA 4CNSA 2GSHA 3IPWA 4I5RA 5IRPA 3ZWSA 3CO4A 2XUCA 1VJSA 1ODUA 2HZGA 1SFJA 1UWTA 1UKSA 3B4UA 1CYGA 3ZOAA 4QG9A 1HJSA 4Q4OA 2DZBA 3ALFA 4L56A 3BQ5A 3TN5A 1VCFA 4KF1A 2V69A 2BVTA 3VMPA 4PFMA 4DPQA 2WAGA 3H12A 1HN1A 5D2YA 5DCDA 1AQHA 4LX4A 4N9BA 1ICSA 2E5CA 3ARYA 4XIAA 3GR4A 4ADSA 1F3XA 3UGRA 1KLYA 2PDQA 1A5CA 2V3FA 1TMLA 1UWRA 2YIHA 5DXXA 4JIEA 1VRXA 4H9XA 6TAAA 4GKLA 4Q4PA 3MUIA 1JZ3A 1XCXA 3CWOX 3THDA 3VNMA 2CHOA 2WCGA 1IIHA 3NL5A 1NWTA 1AZ2A 1Q4WA 1U5VA 3PN8A 3B9OA 1SZNA 1UIPA 2XISA 2ZRZA 4IHCA 4HTYA 4KCTA 1P6BA 4LSBA 1JVNA 2ZRWA 4FSAA 1M7XA 1J6OA 2WJDA 1ZAHA 4GACA 4GD0A 4N4PA 1GVSA 4AEEA 4Q4RA 2DZPA 3U8GA 4PUJA 2EPMX 2CIPA 2OOFA 4MJZA 3EBVA 4AXKA 5SWUA 3W7MA 3EWYA 4WKHA 1YRRA 1FWDC 3W2KA 4G2DA 3DG3A 1KV5A 4ZVJA 3ZR5A 4OUEA 1XQLA 4QSFA 1MZRA 3JRKA 3W2NA 3H7UA 1TJRA 3ABOA 1NOUA 2BGNE 3S5YA 3LA4A 2OB3A 5H8PA 2V5LA 3AUOA 1EZWA 3WQWA 3GIQA 1KBKA 3SN4A 2IMRA 3WK0A 1NFPA 5KZ6A 4WK9A 3LU2A 3LCHA 5FF7A 2ATMA 2GGGA 2YYUA 5AFDA 3O8AA 3PM6A 4WXZA 3VKJA 1XLMA 4JDBA 1KRMA 1RVKA 3HPSA 1V8EA 1NP2A 3SQMA 3E0IA 3B3DA 4YN5A 1QWGA 1QXLA 1QBAA 1XUZA 3UWVA 2WMKA 2JK2A 1GKPA 3GSMA 3PSWA 3FS2A 4PRRA 5I03A 4DYEA 1MXDA 2VENA 3RK8A 3CT2A 5CAHA 1EJVC 3AZTA 1EGMA 3W2MA 4B91A 3SIZA 4S3DA 1V79A 1KCXA 4H00A 4DB7A 1ZBVA 4F8XA 3AZRA 1S2WA 3T9PA 3QVQA 2Q09A 4HBKA 4DBSA 2P1FA 7CGTA 1SZFA 2YBVA 2IUZA 3HPXA 3GH5A 5CPTA 3U0HA 5K9CA 3WH7A 5BRBA 3VOFA 5E9AA 3GS6A 4LY4A 2RJGA 2YCIX 3CYVA 2NT0A 4INFA 3KBMA 3MHFA 3N6JA 2B7PA 1QI0A 4QIUA 5E93A 4MY1A 4H9TA 4LEQA 1XLJA 2NXGA 4IMEA 3JZEA 4GFSA 2WYSA 1PDZA 3S2JA 4W4QA 3WL0A 4L6OA 2OT0A 4CEXC 4IX2A 1J6PA 4Q6XA 2QS8A 1WQ5A 1YQ2A 3WD2A 3TTQA 2WHKA 1OG6A 2G50A 1W3HA 1R46A 3TLLA 5KMYA 1YXYA 4NRRA 3VDAA 1LCOA 4KEZA 4JIIX 4DXXA 2FKPA 3KDOA 5A6MA 4C1LA 1CX9A 1EJTC 4O11A 4Y9PA 3JU2A 3L68A 2CEQA 4O8RA 4RNJA 3KL0A 4AW7A 3QSTA 4IPPA 3IIOA 2PTDA 3KRZA 5EMYA 5KTLA 3QYSA 2IW0A 3NPVA 2O0TA 4QCEA 4FA3A 3GNPA 4H2HA 1EFZA 4KWWA 3Q45A 2P8CA 2HVMA 2BZNA 2WZHA 3GXTA 2QDHA 3ECQA 3RU8X 1KQYA 1K77A 5A2CA 1VEOA 4DBWA 3A3HA 1PDYA 1WCGA 1HIZA 2P88A 2OSWA 3GO2A 1KR0A 1JQVA 3TNBA 1I8JA 4MGGA 1ISYA 1K7XA 3KCJA 4HNVA 1DQWA 3WK2A 3NVDA 4WOZA 3R8GA 3W01A 2YLLA 1JRCA 4OBRA 4YU1A 4AMAA 3SCTA 1ZGDA 2A79A 4JKKA 3MW7A 3Q37A 3PWAA 1PYMA 4B5UA 1VP5A 4IMDA 2IPWA 2PP1A 4BQ2A 1V3HA 2WLYA 3EX1A 4AU0A 3ICJA 4ATLA 1VAHA 2BG5A 4C7DA 4S3EA 4X0NA 1V3IA 1UMLA 1QFEA 3LPOA 2OEKA 2EG6A 1W5NA 1IZCA 2RDTA 8XIAA 1M01A 1XL9A 2G37A 3QHNA 4JEQA 3WLNA 2F6XA 1E0XA 1EO5A 1CLKA 4LCQA 3PP7A 2GJNA 3VI2A 4YWSA 3EKZA 2REQA 4Z42C 4PMQA 3QYQA 3TLQA 1E0VA 2D0HA 3A9BA 2J7FA 2VWTA 5H6HA 4LVAA 1ZNNA 3K4AA 2YBUA 2Z7KA 4PR4A 2CFFA 3FIGA 1HL2A 3EA3A 2X41A 1XI3A 2R8WA 1P5BA 4GNVA 1G4PA 1C9WA 1XIMA 2B31A 3B0XA 4E2VA 4YCOA 1FHDA 2FTWA 4HYVA 1TJ1A 1GKRA 3CJPA 4HHLA 1UR2A 4P2VA 1EJ7L 1K6AA 3K5XA 1HUVA 4HHPA 4DZAA 5FOOA 3O15A 1GVYA 3VUPA 3CZLA 3IJLA 1PZ2A 2AKMA 3D47A 4WJXA 2CYGA 3NYZA 3H6OA 3KM8A 5AHLA 3T07A 3UZJA 4C6BA 3VD4A 2QJHA 1JCTA 2UY4A 4GE8A 1TPVA 1IEQA 2A3AA 3I7SA 3V16A 1ADSA 2O9TA 3PJTA 2BOGX 1EOKA 5GJMA 4Y6GA 4JY9A 3GU1A 2P5NA 1SPQA 2WPGA 3S46A 2VO5A 1QU4A 4X61A 4LT9A 1FVPA 3BV7A 4J3VA 4JTHA 2PGEA 4GY7A 3GTFA 3T42A 1ZCOA 2OLHA 1C93A 1RR2A 1JUBA 3QOKA 4CQCA 1JDEA 1Q13A 3Q58A 2FHBA 5FACA 1PIGA 5T9CE 3IK2A 2GDVA 4J3ZA 3W7DA 1UKPA 3K46A 3RXZA 4EXAA 4J3WA 4FR1A 2OMAA 3PPHA 3LMZA 1HP4A 1FH9A 3CL6A 2CZDA 2CXEA 4US5D 1DXIA 3M0XA 3VGDA 4BS0A 1YDVA 1TTIA 4V1YA 1IXPA 2VX4A 3LI0A 3WEOA 4GA8A 3NUKA 4Y2WA 1PIFA 3HGRA 5AC4A 3FA3A 4XB3A 3UJEA 1DJIA 3S9ZA 5ECUA 4ICCX 3VYLA 3G3DA 4RE0A 1FDZA 1UZ1A 4H83A 4NXKA 1ICPA 4KFNA 3PG9A 3UXKA 1SFSA 4RUBA 2PDHA 2J7GA 1VFOA 3P14A 2ZCGA 3ZVHB 2I17A 5B80A 3KBJA 3WQVA 2E6DA 1AG1O 3R79A 4LAUA 3NPXA 2TRSA 2PDYA 2G3IA 4N6FA 1EHNA 4R5EA 3AIQA 2FDSA 2WKJA 2ZXAA 3I3BA 3EX2A 4HNOA 2D24A 4XD3A 5EU9A 4UZUA 2J75A 3U4FA 3NL3A 2FQIA 2Y85A 3VD7A 1H60A 2QKFA 4EF9A 1VCVA 4GJIA 4DLMA 1E9IA 8CGTA 3NWRA 4NP7A 1MEIA 2UBPC 2O4QA 4JR5A 4U4MA 2CWXA 2INFA 3V18A 3HB9A 2BSLA 2CESA 2X0SA 4FNUA 2ZXBA 3W27A 3GXIA 1EJWC 3USBA 1K4GA 3HGSA 2ISDA 2FPTA 5J5DA 3QPZA 4FF7A 3OGVA 1GQKA 1PS9A 4MLJA 5HMSA 6TIMA 4IP5A 1UP3A 3L7RA 4K6AA 1E1CB 2J25A 2D23A 3NDZA 4UTIA 3BGJA 1XC4A 4HU3A 1S5WA 3RU6A 2UY2A 4JL2A 5ABEA 3M0LA 5G2WA 3GVVA 1W32A 4J35A 1YTEA 3LCIA 3RX3A 2GVGA 4BF5A 5HR6A 3W7CA 4DBDA 3HQ1A 1ZALA 3TFXA 3AXHA 4LF2A 2Y70A 3IRSA 1TZZA 3QSRA 2HE8A 1XDJA 3GC5A 4UIOA 3CAWA 1LLWA 4HPGA 3TU9A 3DU0A 5D32A 4I9AA 4QX4A 1US2A 4JKLA 2I57A 4JNZA 5A8QA 2YBTA 1XPYA 3MU7A 4P8VA 5A3HA 1JIBA 2VEMA 1V6WA 2F8QA 3I10A 1SJCA 4MJ4A 4EAMA 3PZMA 2DZSA 1I9CB 3LLXA 2J7HA 3W38A 3NM1A 1UJQA 3TDFA 1E4LA 4FS9A 3O2LA 4GCXA 1WZLA 2JALA 2CPUA 3D0CA 1NOFA 3H24A 1LZOA 1RBLA 1KM2A 1UBSA 1NDWA 1YADA 3NO1A 3W6LA 2CZFA 3EWDA 1Q7QA 4PMVA 1XIIA 1F3WA 3HG2A 4QEHA 1TE6A 2DJLA 2ALRA 4AB4A 1V51A 3VIIA 4N42A 5CG7A 4EXQA 3IV8A 5JBFA 5CC6A 1HFBA 1BVZA 5IXEA 1FH7A 1IYXA 3E74A 4GI4A 3RM8A 5E70A 3W26A 4O18A 3OVGA 2ZE3A 4NJGA 2W92A 4S23A 3MS8A 3TYEA 2OPJA 1P1XA 3WBAA 5HPCA 1Z7AA 4S2CA 4HNTA 2JKEA 2G41A 3EA2A 4Y8FA 5HOSA 3LZ5A 4R27A 4Z0JA 2DIJA 2WLZA 1G4TA 4DI9A 4XD6A 4UTHA 3OEXA 2GGIA 4YVXA 2Q8LA 1A5LC 3WMSA 5HQEA 2CLHA 2RAGA 1D9EA 3CZGA 4L6HA 1X8FA 3BO9A 4JTLA 5T26A 5E0FA 2WQDA 1DP0A 3P5ZA 1JXJA 3NXLA 1TPUA 1DIEA 5CZKA 1VENA 1C29A 4D6JA 1BFNA 3S5OA 3WLIA 2XWEA 3WQPA 4MADA 1O6IA 2QHAA 4DXKA 4H7VA 4XAFA 3KHDA 3PBYA 1K70A 5GJPA 5A8GA 5D38A 2ZC1A 2CCRA 4CVWA 2V30A 3S6OA 1UD5A 3S1UA 3C61A 5M17A 4XKYB 1NAL1 3A3WA 2CZVA 2V5KA 1CEOA 1JDCA 1XISA 3PJXA 3QEZA 2J24A 4UQDA 3SQLA 4QGCA 3QHOA 4Q4KA 1H5YA 4Q8VA 1H4PA 3TYDA 5I0DA 1NWUA 3W25A 4PN2A 1JPMA 1WOBA 1WOAA 5A69A 2ALDA 3CV7A 4JQ1A 1IT8A 4DYKA 3OTRA 3STGA 4NAEA 4C6JA 4XAYA 1FWIC 5I00A 3NA8A 1XD1A 1CGTA 4AISA 3E49A 1E3ZA 2IKHA 2ZUUA 3U2CA 3O7UA 1LWJA 2FJKA 1E9YB 2ZRUA 3DCPA 4ERGA 3R10A 2I9UA 3TMQA 5D2XA 5LNSA 3PZIA 3L0KA 3L21A 2F9RA 1D2KA 2Z25A 3EKLA 3DFPA 2FFCA 3U9IA 3TR2A 4B5WA 4CQDA 1UKTA 3VX1A 3AIBA 1RJQA 3M7WA 1CB7B 2E1DA 3NZQA 4JTAA 1QVBA 3TTSA 4IL2A 1YXDA 4XX6A 2J9YA 4M8UA 2DPEA 3TEVA 2VM8A 5EY5A 4FO4A 4D8ZA 4B2DD 4F9DA 4B5NA 4GABA 4NF7A 1PUDA 2J9XA 5TD4A 9XIMA 1AW1A 2BOEX 1WXZA 5FSEC 3WK1A 2C79A 3M0JA 2YR1A 3H2EA 2E9LA 4A8NA 1F3EA 1I60A 1KFKA 4JBRA 1HKKA 3UPMA 1BF2A 3VE7A 1QNQA 3UP8A 4QHRA 4JHMA 1J96A 3EWBX 3SY5A 3H2MA 3GBDA 1V6UA 1ZZMA 2J6VA 5CJ5A 1Q8AA 3SAZA 1XRTA 1MRQA 1YNYA 1K03A 4KWUA 1HP5A 1PEZA 4GO8A 1GVQA 2WZTA 1OC6A 1Z3NA 3KFTA 5I3FA 3F4DA 1NVMA 1XCFA 1MI3A 3A64A 2PF8A 4LU0A 1B30A 3HQPA 4CD4A 3HGJA 3UWUA 4PTMA 2YXOA 1FDYA 4MUZA 3QM3A 3GK0A 4W89A 3N4EA 4XSMA 1MQPA 1MXSA 1YNQA 3MUCA 3N18A 5AC7A 4XISA 3TZNA 1ZCCA 1DJZA 2VX5A 3N73A 4ALDA 4O1DA 2I5QA 2YW3A 4HT3A 5HQLA 3R0UA 5LIXX 2VP8A 3C2YA 1OVDA 3RMJA 1EO7A 2AAMA 1BWKA 3SCRA 3QMSA 1VFMA 3S2MA 4NZCA 1B3WA 4G7EA 3GE7A 2QCMA 2Z2AA 4XZWA 1EBGA 4M7TA 2DUXA 4IGHA 5J04A 3VNIA 5MKGB 5DEZA 2HISA 5M1TA 3TAOA 1KKRA 1KXHA 1HKIA 4DJDC 1G6CA 3RLGA 2ZX5A 1E6QM 3L9CA 4PEEA 1OD0A 3KDNA 3JZUA 4BEQA 2F38A 4ZQMA 2J27A 3RCMA 2BTMA 4Y9NA 3L5MA 1P1MA 1Q45A 1WDSA 4GH3A 2O4MA 3TP4A 2DSWA 3S47A 4QM1A 2Y1HA 5G1MA 2V9DA 2P0IA 3C2OA 1EBHA 3R2GA 4U31A 3N3TA 3LCFA 4UNKA 3TQPA 1OCNA 3CASA 5JUVA 4PMUA 2CLKA 4PBFA 4GZJA 2OWCA 4W88A 1RA5A 3M41A 1PL9A 2PDBA 3WD1A 2WJZA 3T1GA 3NR0A 1SQ7A 4NZ4A 4NZJA 1KD0A 1A5SA 4ZO6A 4DAFA 3Q65A 4NNAA 2RFGA 2Z6JA 3LSCA 1C90A 3F4VA 2EXOA 3DBNA 5J8LA 4O0QA 4HCLA 9CGTA 1R2TA 3VOHA 1AH0A 3TN4A 3N12A 5I5RA 4Q8NA 2G3NA 1D8CA 4IGMA 4Q7NA 2Z0IA 3NSNA 3AMKA 4KIRA 4TVUA 4EIVA 2KX9A 2R9RA 3KX6A 3BW2A 1LQAA 1TG7A 3C0QA 1QATA 4MLRA 4DWSA 4JTTA 1CXFA 5MHBA 1V77A 5HPOA 2ZWZA 5CGQA 4JCLA 3E0VA 3PUGA 1BXNA 2R6OA 4AD5A 4DHGA 2ODOA 2VC7A 1JL8A 3G18A 1F3TA 1Q6LA 3T08A 4HMNA 4ZFMA 1KCZA 3T0DA 4FALA 1JULA 1XYMA 4QLKA 3CGTA 1R3YA 4N4QA 4Q8QA 3MVTA 2DFAA 3PTQA 1IEWA 3PPGA 5CGMA 1XIJA 4EVZA 2A7PA 3LHYA 3QR1A 2G5WA 3CS2A 4E3TA 4B16A 4Y7EA 2QPUA 5BNKA 2F7FA 3C3NA 4WDXA 3QRHA 3T4WA 3KS5A 2ISVA 1XBZA 2OCZA 2D3LA 3CZJA 4XG1A 1J0IA 2QUNA 1JD9A 4L4LA 3TN3A 1HJXA 3HN3A 3VIGA 1ZY9A 1UG6A 1VEPA 2IKGA 1UZDA 2VEKA 3P7YA 2WOQA 5G2HA 1KFBA 3RM4A 1W54A 4FB7A 1QOPA 3GHRA 1GYNA 2REQB 2YL8A 4GYKA 4UFJA 3PNUA 5CJMA 1I1WA 3GC4A 5XINA 2I14A 3M0MA 1P48A 1J79A 4PTDA 4TU1A 4AZCA 2PDNA 2CLIA 1DIOA 2R91A 1TJ2A 4YXGA 4IZGA 5DFAA 3VNKA 1UWSA 2DZAA 1O12A 1D3HA 4QBXA 4UMCA 3ZSTA 3AXMA 3W71A 4H9UA 4PH6A 1UKQA 3W53A 4TTGA 2X1UA 1JDDA 3NOEA 2WO5A 2Q3RA 2AQOA 4NG3A 4JDYA 3DOPA 3N9RA 4FXFA 2QLYA 4KPLA 1YEYA 4DY1A 1GEQA 3KTSA 3W2JA 2KAUC 2DT1A 3WNNA 2H8XA 3MCNA 3S1GA 3PHAA 1X7FA 3ARWA 4K37A 3LTSA 4UTWC 2ZZ2A 4O50A 1WUFA 3PC0A 4QFUA 2I56A 3SCSA 2GJLA 4LEFA 4S3BA 4H7CA 2WWCA 1DEDA 1X6NA 3LBCA 4QS6A 4LVBA 1H61A 3THUA 3N34A 2YGYA 4DPPA 3WKZA 3MVIA 4PODA 3LHWA 3OBKA 3LG3A 5CPNA 4H41A 3SFWA 4C1NA 4PTXA 3LDVA 1ENUA 3T55A 2INEA 4JYEA 2WM0A 1A0DA 4X2PA 1GVEA 1SW7A 3B8WA 3FKRA 2YZ5A 4GISA 4DUXA 2ZQ0A 3MBFA 3AHVA 1S2AA 2DGAA 3EB3A 2PZ0A 3NQ6A 4QRNA 3EWUA 1L9WA 3W02A 1IR1A 3GUGA 2WCSA 2PURA 3REQA 1VYPX 4YTQA 4Z2KA 1XRSA 4LYPA 1EP2A 3GVWA 4ADTA 2CLFA 3W7NA 1AJ2A 3S6TA 3RX4A 1U1HA 4KFOA 3WQ8A 4NVTA 1H0IA 2GZXA 3GG7A 4DJEC 3PWIA 1W1IE 3LM3A 1VYRA 2AMXA 4X9SA 4E2OA 3TNOA 3MI6A 4AXNA 1D3GA 4KRZA 4PCSA 3WLRA 3GTNA 4PMYA 3TX9A 2OQLA 1A0CA 3GIYA 2Z2UA 4H9VA 1V7YA 4YS1A 2Y24A 1XINA 1PTAA 5FJPA 1A0EA 1Y5XA 3ARUA 3FYOA 5LA0A 1Q63A 3VDCA 1NH6A 3MI3A 4KEMA 1YDYA 1JPKA 4MKNA 4BA0A 1L6SA 1ISWA 3LX9A 3WNMA 1XFBA 4WJEA 1LUCB 3E6EA 3H26A 4MWAB 5AKQA 3S1VA 1C7SA 4A3YA 3TSMA 4G5DA 2I1OA 3TONA 2EO7A 2KZHA 3KW3A 1HVQA 2QCCA 2Y7EA 1N8WA 1FWAC 3BMVA 3AC0A 4L4OA 2GGJA 4LB3A 1KC7A 4AVFA 4GO9A 5BXPA 2QNEA 3CV6A 3Q67A 2Y7FA 2QCDA 4AD1A 5E0CA 1JFHA 3EPNA 2JBMA 3CUFA 3V5CA 3KBSA 1S1PA 1OX6A 2VZVA 3I6EA 4QSHA 3RM9A 4RNHA 4JQ4A 2J8TA 2YXXA 3HOJA 1XIBA 2D22A 4RPPA 2ZTKA 1CGVA 4KKXA 1QOXA 3S83A 4GUFA 2BGQA 3SRHA 2W62A 1CXHA 1S5MA 3MCMA 3VD5A 3RCNA 1YX1A 3TA9A 4W84A 1W1YA 3KAOA 3V0TA 4F0LA 4RXFA 1IT7A 4GI9A 1UCWA 2ZRVA 1GTEA 2V5DA 2ZA1A 4JPGA 4IXHA 1TPEA 1XP3A 3C2VA 4MKVA 3UWEA 4E38A 1UW9A 3MWCA 3GKAA 1BVNP 4LUJA 1SO4A 1ZRQA 1Z69A 2J74A 2F2KA 3SUUA 3WJYA 1P4CA 4HHHA 3AYSA 2PU0A 2ZZ3A 2YA1A 2OWXA 5CKSA 4V33A 4QJ3B 2JGQA 4LS2A 4GYJA 4AYGA 1VIWA 4KFPA 4UOQA 4RDVA 1H50A 4HK5A 2OSYA 4Y96A 2VYOA 1BGAA 1P7TA 1BKSA 1RA0A 3BZGA 4A22A 4B90A 2Y61A 1LRNA 3PSVA 3WIJA 3UVAA 1UOZA 1ME8A 5LA1A 1EHAA 4Q4MA 1CPUA 1YYAA 3WELA 1V5XA 3L5AA 3WBYA 2YB4A 3L2IA 1W3KA 2VFFA 1J10A 1SSGA 4LH8A 5HJYA 2ZDSA 2ACQA 1WKFA 2D2HA 5DCBA 1Q6OA 4WZHA 3A5VA 5GVJA 1L8PA 4LAZA 4MWAD 1TPC1 3JS3A 7TIMA 1ZHAA 4NI3A 3DYPA 4KRTA 2ZX9A 1BRLA 3G1FA 1MQQA 1V6XA 3ITYA 2IPJA 5LIUX 5EMUA 3M43A 2CKSA 3K1GA 1IZKA 1GORA 4V28A 3T78A 5DN1A 5BU6A 5IHSA 4L6DA 4EXBA 3CZEA 1EF2A 3ENLA 2C19A 2EG7A 2HQAA 2PWGA 4UUIA 1EOMA 3DDMA 1FXQA 3B04A 5I3DA 4RPQA 2Y2WA 2E6FA 2PP0A 4P8WA 1TPDA 3WUFA 1RSCA 3GC2A 3WDPP 4A29A 3LCWA 5H8MA 4W8LA 3TFCA 2EQDA 4S1FA 4C6PA 1WX0A 2LLEA 4A21A 2BDQA 3E9AA 4MG4A 1L6GA 1F4HA 4FXJA 4LAKA 4F0HA 1VYSX 3H55A 3IGSA 4GZEA 4CU6A 4HN4A 1U83A 2OSXA 1T7LA 2YL9A 4XV0A 5IM51 3F5LA 3ONBA 3C8FA 3UCQA 3S1WA 1E15A 5HBFA 2WM1A 3POCA 4V1XA 4KWSA 3RUBL 3S2NA 3OVQA 3MUXA 2C15A 1XIDA 5BXTA 4JIPA 1DIKA 1CGUA 1J93A 1YTKA 3XISA 3ZJ7A 3W28A 4LUIA 1R5YA 4NJHA 3CH9A 1AVAA 1AMKA 1M7PA 4UR9A 4DM1A 2JIEA 2VTFA 4RL3A 2Y8KA 1HKWA 3I68A 4I90A 2XFYA 8TIMA 3EWZA 1HJUA 3S9YA 1PVNA 4Q8OA 4MWAE 2CBUA 4R33A 3C52A 2XDFA 2PD9A 4CUCA 3A4WA 4BF7A 1ODZA 3KXQA 4J9JA 3R1ZA 1UUOA 3HMJG 1XSIA 4IGSA 3PZUA 3SRDA 5E1QA 7XIMA 3P84A 2PF0A 2FTPA 3SM0A 3LBOA 1E6NA 3MKKA 2BY1A 4NAEB 5TIMA 1G7UA 1TQXA 3WN6A 1EGVA 3WF4A 4AY1A 4URIA 1V6TA 3M5YA 4C6DA 4D6HA 5CZJA 1UUQA 3LGGA 1REQA 4ZOEA 1XRFA 2YZRA 3RR4A 2FYMA 1R3TA 3ARRA 3IJ7A 4LFYA 2G3JA 4AIUA 1TWWA 3F5KA 1F61A 1T40A 2QCFA 2HDJA 3BLDA 3V5FA 4HSNA 4B5SA 5CZSA 4KBXA 3BUVA 4JXCA 4UFMA 5JIWA 2ZFAA 3W9ZA 2I7GA 3UJ2A 4W87A 4FMVA 4FZIA 1PZ1A 2D1ZA 2V5BA 3WLSA 4B9YA 2QCLA 1Q6QA 3LLFA 3QPYA 1QASA 2YB1A 4JIQA 5H2ZA 3AXXA 1H0GA 2ZUVA 5I3JA 2HPMA 3KTXA 3ZWTA 3W70A 3H23A 3CQHA 3W1QA 3WUBA 4YTUA 3DN5A 1UR1A 3V7PA 5FEPA 1HKMA 1FCUA 1H1NA 1JZ8A 1R3WA 1IGSA 1R9YA 1KFWA 4RZ5A 3N6QA 1OGSA 4ADUA 3UCDA 1OGGA 2BS9A 2VFEA 1V7AA 5CXPA 3WDRA 2Y5SA 4DVOA 1YMYA 2YW4A 1CI1A 5JH2A 1K9FA 3LENA 1UPMB 3CO8A 3CLWA 1F6PA 3AOFA 2OKTA 3SY8A 2FB2A 2XIQA 4TX6A 1HKJA 1HQTA 1QI5A 3QY7A 1TWDA 3NEVA 1VFSA 2QULA 1EH9A 5TF0A 5C9ZA 3ABSA 5C55A 1L6YA 3EWXA 3GX9A 2VKZG 3PJUA 4F3HA 4UOJA 2BVDA 1XICA 4GC4A 4LS0A 4H2CA 1IT0A 3WQFA 2XIIA 4E5TA 4ACYA 3VKKA 5F2IA 3V5OA 2OKOA 1ZFJA 4RJEA 1ZSXA 3UZXA 1ONEA 1DJXA 1B4KA 3EMZA 3PTDA 2BY0A 2NUYA 2CU0A 4C6CA 1XDLA 2PBOA 1KBLA 4F2BA 3FK4A 5XIAA 2CC0A 4G7EB 2PLJA 3RHGA 1RXOB 1SO3A 1GHRA 1LYXA 1VJZA 3MKVA 4HJWA 4AD2A 2TAAA 4IH3A 2G4JA 1TCDA 3WF0A 2NV1A 4MNJA 4C6QA 2ABBA 4ML4A 1CBGA 3CB3A 2VURA 1PE1A 4AF0A 1DWJM 2OZ8A 3PF3A 4Z0SA 1PJ9A 1TYGA 2WZEA 4E4FA 4ECLA 4CEUC 2CBJA 2J7CA 4DUOA 1K4HA 4IIDA 3MPGA 3M4HA 3S6DA 1BWVA 1G5AA 1QNRA 2J8FA 2NSXA 2V2CA 5IOBA 3NEHA 2QUMA 2WMJA 1QPKA 3THAA 1M7JA 1EP3A 3CYJA 4C6EA 1B3ZA 4H9YA 1M04A 1QI4A 3GXNA 4B9ZA 2PUZA 4ZTYA 3M0HA 3KOXA 3UG4A 5GQBA 4P7QA 2DZTA 3HQOA 1T8XA 5MF5A 4OV9A 4L1GA 1V3LA 3RRAA 5HJXA 3CC1A 3SIMA 1OIMA 4GIAA 5GPRA 4G8TA 3ITGA 4HU0A 3C4UA 1DHPA 2ISWA 1QHZA 4ERIA 2PSNA 2DSKA 4DNHA 4YYFA 5B7YA 3USZA 3VDBA 3MP5A 4MVAA 4C7FA 3LSBA 1RCOB 3SSJA 3BOXA 1OABA 3WG6A 1KM5A 3QC3A 1I1XA 4PUUA 1BVWA 1N2VA 5CZTA 4X0VA 1LL7A 4BR1A 4XQ6A 1UYQA 3TVAA 5A8OA 4B5TA 4J7RA 4WKFA 1KBIA 3THCA 1LLZA 2YA2A 4DWSB 1R3VA 2NVCA 4IF2A 1WDPA 3KUMA 1OSEA 4NAFA 4K2SA 4HZ7A 3R4IA 3MC5A 4D6EA 3D6NA 3W81A 5JQ9A 3VOJA 1ONWA 2QV5A 4FI4A 1V0NA 2V38A 2QJGA 1HJVA 1B31A 2XSBA 3BJFA 5A6TC 3DFNA 1J5TA 3ZJ6A 2GK1A 4XD5A 3RJXA 3DUGA 4PUDA 1BGGA 3G3MA 2TYSA 4O12A 3UPWA 4Q7IA 2EPOA 1GOXA 3EWCA 3FVMA 3VINA 3P61A 2XM1A 2X1SA 1GEHA 4WKAA 4WIWA 3F1QA 4P8UA 3ARSA 4KESA 3K13A 4NRSA 3TW7A 2DVTA 4RNIA 2PLCA 4TIMA 2YCKX 4CNNA 1R7AA 7ENLA 5EL1A 1IR2A 3WK3A 4MB5A 1MDRA 3WL1A 2WNZA 4AX6A 3ARXA 3SCVA 1F6YA 4R7OA 1GOQA 3F4NA 2WNQA 4PUEA 4O1BA 4PSRA 4Z1BA 3QV8A 1GG0A 4WDUA 3OLEA 3VK5A 3QQ1A 3H4GA 4AZCB 1M1BA 3MSGA 5AZ1A 3CZ8A 4J3UA 1HL8A 2OYKA 2Y5JA 4DO7A 4ZOAA 1SM9A 4XSLA 2WMFA 4HNUA 1UOKA 2E67A 3A4AA 1EC9A 2Z29A 1MQRA 3MSYA 3MT1A 4LVFA 4IFKA 3VAVA 4C6OA 1PHQA 3VIMA 3CIWA 1C92A 5CSRA 3TJXA 3FAXA 1JF6A 4KETA 1ITXA 1VPXA 3L2LA 1XX1A 4K39A 4P7OA 1AJZA 4DZIA 1XW8A 2J47A 4BI5A 1GZ1A 3W84A 5D8WA 3RLHA 1X1ZA 3MSRA 4HYWA 4XZBA 3MKCA 2PB1A 2QF8A 2QEZA 2GVLA 2E9BA 5FSDC 3G1HA 4DWSD 3O6AA 3VIJA 5EFDA 1EUNA 4IMGA 2VL4A 3Q4DA 4TVCA 4C1NB 2QUUA 2GSEA 2NZLA 5AYBA 2VCAA 2VOMA 1G67A 3IGUA 2VGFA 3SGUA 3QBUA 3AJXA 1OYAA 3VVGA 3HV8A 4GX8A 4IFOA 3WLKX 4JIRA 4XTIA 4PB4A 3DAQA 5A6BA 1GPFA 1P0KA 4F2TA 1B1YA 3S1XA 5JIPA 1ADOA 4KH2A 3ARQA 1QO2A 2JEPA 1NSJA 4MIMA 3P0XA 4NX5A 1EWDA 3REQB 5LA2A 1W2PA 2IXUA 3DHDA 3VKBA 3VNDA 4NYUA 4HB7A 1MW1A 3L0GA 2QAFA 2HXUA 2POTA 4FOJA 1W91A 3VX0A 3RLVA 2P50A 3KOZA 4EOUA 4NT0A 2TSYA 1NWRA 3QZ6A 3TCEA 4FLQA 2HNEA 1TPFA 2J79A 4GINA 1IEIA 3GTHA 1R47A 2WHMA 4Z1CA 2OO0A 4UMAA 4US5A 4H9MA 2JKPA 1BKHA 3TYZA 5DMYA 4KCUA 1OK6A 2NSOA 3W7OA 2G4FA 1NFBA 5BOEA 3UQNA 1XD0A 3HBLA 4UR8A 2X05A 2EGZA 4D6IA 1UZ4A 2DSVA 5FEXA 4JX4A 1AW2A 3IUDA 1CZ1A 5FAJA 3GKFA 2OGJA 1DJYA 1KGXA 4PMJA 2VR2A 4AZGA 1K9DA 2VX7A 1GOIA 5DRCA 1JQXA 5FF3A 4GMEA 1G0CA 3B05A 3AROA 1FWBC 2J62A 4HN8A 2QMKA 3WQ5A 3ITLA 1MDLA 4W8AA 4PUMA 4LRSA 2YA0A 4QITA 3LEPA 3ZLGA 2VEPA 3HJZA 4A4AA 3WQDA 4EK7A 4BZYA 2DJXA 4PCPA 4LW7A 3QW4B 5DY2A 1N8IA 3G0SA 2FMNA 5A6JA 3BLOA 2QCDB 5DX7A 4E4PA 3G0XA 1SR0A 1Z44A 3WEMA 4YHGA 2HEJA 3N04A 3W86A 1OFOA 3VOCA 2YCLA 2O9RA 3ITOA 4AFYA 3KZSA 3H70A 1W8SA 4KCVA 3C0SA 1Y5VA 2DZVA 5IFTA 1CXKA 2B4GA 2P3EA 1PCWA 2A1YA 3R7MA 3R89A 2ON3A 1X7IA 3M16A 1S2UA 2NV9A 2Z27A 3OO2A 3WEZA 1A5MC 2PWUA 3UZZA 2J66A 2BB0A 4I9JA 5FJOA 3UERA 3N14A 1V0MA 4AZHA 3GZ3A 4RZBA 4AHOA 4XD4A 4QDMA 1K8CA 3OB8A 1UD4A 1H7PA 3VCRA 3EOSA 4CQ8A 3VM7A 3AMDA 1G9HA 2F6UA 4HA4A 4IT1A 5A5WA 1A47A 3NNTA 4XAGA 4H04A 3OW1A 1J8VA 4UC5A 4H3DA 2A85A 3OZPA 4GYPC 5DF0A 1HW6A 3DFTA 3KBVA 1H11A 3U2OA 2VVNA 1EA0A 4HZMA 4ML9A 1P7TB 1QNPA 3MYOA 2OYLA 5JU6A 1W1A1 3TWBA 1OC7A 1J11A 1GZGA 5E9XA 2GJRA 1XLBA 3EXTA 3PG8A 1GVRA 4O19A 4XTDA 5I02A 4JHOA 3ANUA 4GIYA 2A3BA 4ROQA 4G1NA 4Z1AA 2VC9A 4ORIA 3F03K 1KQZA 1HZYA 2GWGA 4JN7A 4O4VA 3KVJA 5A8NA 1ONRA 2J77A 5I2UA 4O17A 1IQ8A 4XK2A 3WFLA 3SO7A 2EPLX 3GUWA 3LCLA 1TJ0A 1R2SA 4GQRA 1X97A 3MHGA 3HG3A 1KFEA 1UA7A 3W1LA 4U5KA 2ISFA 4PGLA 4E2BA 2C8NA 3KTCA 4WD0A 4QNEA 3IVSA 4UFKA 3URNA 1JJKA 3WCZA 3ZVHA 5D33A 1DTUA 1CXEA 4OQVA 1BRLB 4N02A 1BXCA 2WW5A 2VOTA 2BODX 3WLLA 2PDGA 2G3MA 4DAIA 5U4NA 4HMDA 4WVXA 3BAIA 3A4JA 8A3HA 1OF8A 3DXIA 1TV3A 3AYTA 3M6YA 3QR0A 3SCWA 3BH4A 4IOTA 3UNTA 3VGEA 1WBHA 1GVOA 1ITUA 4YMZA 3LUTA 4Q8UA 4X3ZA 3VKAA 3ATYA 3URQA 4V2XA 4B92A 4RZ4A 4DIAA 3ZLHA 1WNOA 4K8HA 2QT3A 3IAQA 3M5ZA 1XLLA 1QTWA 3QJAA 2E6YA 4ZE4A 4Q4QA 2YSWA 2GQ8A 4GI6A 4PZVA 1NQKA 4EX4A 1S3TC 4Q3MA 3LB0A 4HKPA 3CUZA 3IRDA 1LDCA 4P61A 3WQCA 4XO7A 3CWNA 4TX9A 1HKVA 2FB3A 2JGYA 4JS3A 1K3UA 1UB3A 3VFCA 4JY8A 4UCFA 2I16A 3HG5A 3NM3A 3VZYA 3FHQA 4JTJA 5EGRA 4RE4A 2X8RA 3AFBA 1Q3NA 1E1CA 5HJLA 1A5OC 3AAMA 3NOYA 1M7OA 2BXYA 1TV2A 2AGTA 1R7OA 1PBGA 4UOZA 4LYQA 2QMJA 5GNYA 1KXTA 4PCFA 3BSGA 3VOIA 1TCMA 1H09A 1MW2A 4U3AA 2JQXA 1F9CA 1B3YA 3VC5A 2YCJA 3BQ6A 3W29A 1TREA 3CZKA 3WQOA 1DJGA 4PYSA 1EXPA 4FR6A 2HBVA 4DZ5A 1XSKA 1CLXA 3WQ6A 2YFOA 2F84A 4ZL1A 1OFBA 2XGIA 1GCYA 3W74A 3S8HA 1DWGM 2R1NA 2HK0A 5CQ1A 3WMLA 3CWHA 4KT2A 3UG3A 4JFVA 1KCLA 3W7IA 3QQWA 3I7RA 2ZRYA 3G1VA 1C91A 3LRKA 2BOFX 5IDZA 3WSUA 4JX5A 1A5KC 1OWQA 4L5ZA 5E0KA 4LTSA 1REQB 5HQMA 1YIXA 1M41A 4M1RA 4MPQA 3UJRA 4C91A 1QAPA 2DUZA 2PDXA 5FKYA 3KWSA 1XGDA 6XIAA 1BSLA 1ZJIA 4JN6A 1UP2A 3WDIA 4J28A 1ZL1A 4JTKA 4MNMA 3HU7A 2MANA 4ENLA 1R3QA 2BFGA 3UZ5A 3OZYA 4DBEA 1OQFA 1R9ZA 2R1LA 3TTEA 4IXXA 5EPDA 4GLEA 1V3KA 1BG9A 3HO8A 2ZUMA 4I7UA 4BKNA 2BNJA 7PTDA 1SUXA 3G1AA 3IJIA 3DC8A 3WO8A 4CN1A 5HK4A 4Z2IA 4B15A 1XGZA 1F76A 1XH0A 3CHEA 4AHQA 3LV5A 3GQYA 3HPAA 2VVSA 4UTFA 3NVTA 3ZT7A 1TV5A 2PDPA 1GT8A 2GVEA 3RPDA 4BWLA 2VFDA 3KOFA 6XIMA 2O7QA 3W1NA 2WC7A 1B4EA 3M5XA 4L7ZA 3VIKA 2QDGA 2VR5A 4FLRA 1FKXA 2V8ZA 1E73M 4F0MA 3ALGA 2DT3A 1HO4A 2C0HA 2C6QA 2OGYA 3UBPC 2GL5A 5DT7A 2WXDM 2ZZ5A 2B7NA 3PK7A 2WV8A 4F2UA 3GDLA 4GIRA 3BLIA 2F2HA 1F74A 3BZJA 2G95A 3M0IA 4FF5A 4I7WA 3S2LA 3T8QA 3M46A 1V4YA 1XLGA 1VCGA 4F9JA 1M68A 1GVFA 2YJQA 3BJSA 1WE5A 2WCAA 1QI3A 4DO4A 2ZVIA 4C6IA 1N82A 3D3FA 1XLCA 1RJPA 1EEPA 4G9PA 1IWBA 3LK6A 3RILA 2VCCA 2NUWA