1LZOA

Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex in two crystal forms: characterization of catalytic loop open and closed conformations in the ligand-bound state
pubmed doi rcsb
molecule keywords Triosephosphate Isomerase
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 89
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1lzoA00
3RLVA 3A5VA 3TX9A 2ZTJA 4JXCA 3C2RA 3CM4A 1RV8A 4AHPA 4M6PA 1VCGA 2DZTA 4WY0A 1OFRA 3SECA 3P7YA 2WSQA 2ZZ6A 3UWVA 4NX0A 3I7QA 5K4ZA 4NZFA 4UR7A 6TIMA 5IM51 4PA8A 2J88A 3RK8A 3WK0A 1W3NA 4Z1DA 4EF9A 1VLWA 1LCOA 2CLHA 3DHFA 3STEA 1FWNA 3LV6A 3PG8A 2ZQ0A 5ABTA 2NWRA 3W2MA 2ATSA 4HIBA 4OV4A 4LVAA 2Y7FA 3I7SA 3A23A 1FCQA 3EX2A 4LVBA 2G95A 3W1MA 4EWND 3L21A 3BO9A 2EHHA 3KRZA 3SGUA 3W84A 5EL1A 1LRNA 3BLFA 1TIMA 4X22A 2ISSA 1AW1A 4NJIA 4PFMA 3BG5A 2ZBTA 3C4UA 5HR6A 3DKJA 3I6RA 2GQAA 4DPQA 1TPUA 4FX7A 5T26A 5FI8A 3B03A 1H7PA 1LP6A 4FEZA 5KITA 4JTTA 4GE8A 2D73A 2WNNA 1OYBA 2DORA 2E6AA 4UTTA 5D2VA 4NJGA 1JJKA 2BLEA 1OFEA 2BTMA 3L67A 4XTDA 3G8EA 4JN6A 3M44A 2QDGA 3H53A 4O4WA 4MOZA 3NQDA 3KXQA 1R46A 4O18A 3LCWA 1XC4A 3MP3A 1W0MA 4LWWA 4LC8A 1QCWA 3O6DA 3MHGA 1F05A 1JRCA 4POCA 4PCFA 2ZA2A 2V30A 2A7RA 2B7QA 4UFJA 1IIHA 3FJLA 2B7NA 4MYXA 3W1PA 3LCGA 3TFXA 3T4CA 4O11A 4QITA 3WJWA 1H63A 3LHYA 3BW4A 1A53A 3DZ1A 4R34A 2QEZA 5C5YA 1TRDA 4ZQRA 5KZEA 2E1DA 1OG0A 3GB6A 4HSOA 3JRKA 5TBOA 5KMYA 4JTLA 2C14A 3BW3A 8TIMA 3DI0A 2QR6A 4K7YA 1H60A 3O6CA 4DEFA 1O95A 4FX8A 4FF7A 1EP1A 4MY1A 2WV8A 2WJZA 2E5BA 3UZ5A 3W7IA 5EPDA 2GUUA 3W7HA 2JGQA 5HUOA 4NVTA 3W1TA 4LOCA 4O13A 3WFAA 3EWUA 2W0UA 4PC8A 1YXDA 3P8IA 1MEHA 3TU9A 4LTSA 3GDMA 4ZL1A 3E12A 3EX3A 5I3KA 3LHWA 1OFPA 4I7UA 3LLFA 2ZDRA 1GVOA 3G1SA 1P0KA 2VEPA 3T78A 3WK3A 1TPWA 3LCHA 2VXNA 4CQAA 2R91A 3G1VA 3VI2A 5AHIA 4BK9A 3GXPA 3SZ8A 1QPOA 3IIXA 2FB3A 2HMCA 3P8JA 4JIQA 1ONRA 3PSWA 3KOFA 3MW7A 1O60A 3PUOA 3T55A 5AC8A 3MI2A 1YYAA 3HB9A 3N2XA 3NL5A 3RNDA 1KM6A 1ZAIA 4IUOA 3Q94A 4O57A 4QQ3A 4NJJA 3OIXA 1P4CA 4LNYA 3TAKA 1QWGA 5F2LA 4TMCA 3WK1A 1J2WA 4M5PA 4ZZ9A 1EPXA 3W7JA 1OFQA 2NX3A 2RFGA 4JYDA 1R2SA 3EEGA 1JCNA 1GJPA 3BPWA 1BTMA 3EWYA 4Z1AA 1OABA 3T40A 1EUNA 1SW3A 4MLJA 4OQVA 3OVPA 3BARA 1DL3A 1T99A 1FDJA 5FF3A 4UTWC 3CT7A 1SO6A 5LHFA 3UQNA 4H6KA 2Y62A 1SW7A 3PF3A 3W76A 1M7OA 1PS9A 1G7VA 3O6YX 1WQ5A 2WKJA 3KHJA 3NL6A 3NQ2A 1GQNA 4IX0A 1LLWA 3TNOA 4N4PA 1ZJIA 4K8EA 3PBYA 3LI0A 3P61A 2A0NA 2BXVA 3CIWA 3M5VA 1WA3A 3EWWA 2OT0A 3W1LA 3TCEA 1C29A 3N3MA 4ZMGA 1RD5A 4GFSA 3PBUA 5HNRA 3A9IA 1UCWA 3JS3A 4RK8A 1NFBA 4JNMA 4YCOA 4O17A 5HWJA 1SO4A 3NPUA 4IOTA 4QAIA 4AWUA 1ME8A 2TMDA 3A22A 3LDVA 3P60A 4NZJA 3M1ZA 1VS1A 3W7EA 4RX0A 3QMRA 3GDLA 4R33A 3BLIA 1GYLA 5DBUA 4MZ8A 5DN1A 1ZY9A 3IIVA 5LGXA 4MPQA 1F76A 3TUUA 1A5AA 3V1PA 4O4VA 1QDSA 2WSYA 1IXPA 4O14A 2C18A 4GUGA 2JK2A 2ATMA 4EF8A 1QPQA 2H8ZA 2ALDA 4I7VA 4ZVJA 4CNOA 1DORA 4NU7A 2PE4A 5U4NA 1KFKA 3MBFA 3GNDA 5K3VA 5I3HA 2R8WA 4FNSA 3V75A 3M7WA 1KA9F 1VPXA 4U4MA 4XTIA 5CKSA 4YMZA 1YXCA 4UTWA 3LBMA 3EXSA 5F4XA 3VCRA 2OCZA 2AQWA 5AHNA 3BW2A 1L9WA 5K2ZA 4FXRA 1FDYA 4R7JA 3A5FA 4Z0SA 3QSRA 4H4IA 2ZZ5A 2TPSA 3G3DA 5K4XA 2IQTA 4QJ1A 3DAQA 1VC4A 4JX4A 3C0JA 3R2GA 4BI6A 3MP5A 1WDWA 5MHBA 1I2QA 2PRHA 2QCDB 4NQ1A 3LHZA 5H2ZA 1VCVA 4OV9A 1OYCA 1XBXA 2B0MA 3M5XA 3GXTA 1S5VA 3OVQA 3SY5A 4UMBA 3R13A 2XN0A 2Y63A 2J24A 4ADUA 2Q3OA 4AWSA 2H3BA 3GKFA 3NQ7A 1VZWA 5FF4A 5TIMA 4ADTA 1DV7A 2B4GA 4C1KA 3SR7A 2FDSA 4O0KA 4K6AA 3S5ZA 4L4MA 5D05A 4UTHA 1I2NA 3IV3A 1LBFA 2QKFA 1G69A 2DZVA 3ABRA 5DCBA 4O19A 3L0GA 2J9XA 2Z0IA 1W5PA 4IWWA 2E6YA 4LVGA 1MO0A 2GVJA 1TV8A 1AL7A 1K8XA 4DO4A 2XN1A 1OX5A 3QQ1A 4PTNA 5F4SA 1KM3A 4FB7A 5G2HA 1AW2A 4TIMA 3W6YA 2A6NA 1FXPA 1F5ZA 1JUBA 3LXAA 3L66A 1WX0A 1FCVA 1LBLA 3MI6A 4GUHA 2ZZ2A 3S5NA 1SO5A 1XUUA 5KSWA 1B4KA 1MEIA 1SZFA 1W54A 4MLRA 4O1AA 3QRHA 5HJLA 5G4WA 1WOAA 2BSLA 3O05A 5EY5A 2Z6IA 2FFCA 3PS7A 4O10A 4UTKA 5K7JA 4UXDA 3SGZA 3W85A 2ZRZA 5BRBA 5A8GA 5HINA 2E5CA 3SJ3A 4HNTA 1RQEA 4Y96A 3PG9A 3B05A 2QAFA 1GG1A 4ICNA 2CU0A 4N9EA 5BOOA 3L5AA 3PBVA 5DELA 4HPXA 3NXFA 3GNNA 2O7SA 3QJAA 2QCEA 1DJQA 2A4AA 4P2VA 3G24A 1AG1O 3LHVA 4JTSA 4A2SA 1YPFA 3QC3A 4GRSA 1FX6A 1X1ZA 3M43A 1VRDA 1LROA 4AB4A 3G1AA 3NQFA 4QNWA 4RR4A 3DGRA 3CU2A 1Q6OA 1NEYA 3HGSA 3DFPA 2QUTA 3PULA 5G4EA 4JGDA 3GAYA 1UB3A 4BFAA 4UR8A 3CHVA 1TPVA 1C9DA 1F74A 4YXGA 2NUWA 1LRQA 4RCXA 1OFBA 3GDRA 1YADA 4IMGA 3RF9A 3NPVA 1FY6A 1VJIA 3W75A 4QNEA 3HG3A 3FKKA 3HGJA 5AHEA 1TJRA 1X8FA 2Z6JA 3GR8A 3W7LA 4JTIA 1ZAHA 4BR1A 1OX4B 5HMSA 1YTEA 2ISWA 5CSRA 1THFD 1RVGA 2Y7EA 5EMUA 2A2IA 5K9XA 3TW7A 4JEQA 4N9DA 2NZLA 3E49A 1XXXA 2X1SA 3B04A 3O63A 2X1TA 1O94A 5LNWA 3F4NA 4M19A 1JCMP 5AYXA 2YYTA 4AHOA 3OBKA 3GYEA 3W88A 3UWQA 1TPDA 2V5BA 5FEPA 1S5WA 2JKAA 2VC6A 2NV2A 5G1TA 1YPIA 5D32A 3YPIA 4LS2A 1EWDA 2C19A 3C3NA 2WPBA 3PUEA 3DKLA 4I9AA 2RH9A 3ABOA 4HPJA 2BZNA 1TO3A 1SO3A 2GQ8A 1EX5A 3UPWA 1Q3NA 2E6FA 4WOQA 3B4UA 4UTUA 3M47A 3S5OA 3G3MA 4N4QA 1ICSA 5DLCA 1K7EA 1HO1A 4O54A 2HTMA 3DI1A 1ME9A 3IGUA 5LNVA 4W9TA 1KM4A 5CZSA 1L6WA 1W3IA 2EKCA 1KTCA 4WX2A 4KKXA 4ORMA 2PRLA 2ISVA 3UPBA 1OFDA 5F2MA 1G6CA 3OVRA 5E93A 3Q58A 3W7QA 1W56A 1X1OA 3TA6A 1FQ0A 3BK0A 3Q37A 3LCIA 2YYUA 4MZYA 4A29A 4A21A 3N19B 3P81A 3PB2A 3FS2A 1YDVA 3W07A 4ZQOA 1KV5A 3TV8A 2A85A 2R14A 1W5NA 1ZENA 3CPRA 2ZZ1A 5AFDA 3FJ6A 1KTBA 4MKNA 4CCCA 4S2BA 3STCA 1PIIA 4UNKA 1JULA 3LBCA 3KVLA 3W1AA 4XKYB 5F2IA 3EWZA 2A6LA 3S5YA 1K03A 1VR6A 1G4TA 5G2WA 3TDFA 1PHQA 5AHMA 1Z41A 5CZ0A 3HGOA 3LTSA 4MFEA 4BI5A 2OJPA 3G1FA 1A5CA 3FOKA 4DF1A 4EIVA 2FB2A 2JKEA 5DY2A 4WY0B 5BW6A 1GTEA 4RZ6A 5CGQA 3W22A 3SSJA 5G5IA 4NUWA 3S1VA 5LGZA 5K9CA 3A21A 1LTDA 3M6YA 2H90A 2YCEA 3MWAA 4E2DA 3LM7A 5D37A 1GWJA 1MZHA 3ABSA 3U6WA 4K8HA 4JD4A 4M7TA 3T44A 1F6PA 4YWIA 5AC7A 2YDAA 4Q32A 4CNNA 3BG3A 5HQEA 1FWWA 1FWTA 2P10A 2YR1A 4UFKA 3SIZA 3GLCA 3SFKA 3I68A 3PUDA 2NXIA 1G7UA 1UUMA 1DBTA 5CZJA 5H91A 3LCXA 4RXGA 2C6QA 2OZ0A 3VFLA 4HNVA 5C54A 1BWLA 1XKYA 2RDUA 1TQJA 3D0CA 3TJLA 2RHGA 3LTYA 1G67A 1EP2A 3ATYA 5D2YA 3UY8A 3HOJA 2NX9A 2GVLA 2BX7A 4I7WA 2TSYA 3VKJA 1QMLA 2FQIA 3C52A 2QCCA 4O53A 4LVDA 2G96A 3P82A 5LZLA 2V2HA 1B4EA 4GBUA 4AWTA 2QDHA 3IGXA 3G1YA 1YDOA 2FTPA 2ZZ7A 3PB0A 4AMAA 3W87A 3LRKA 1S5TA 1B3OA 4Q4KA 1IIGA 3DH7A 1KM2A 1FCUA 3HPSA 2V81A 1GG0A 2YFOA 2O7QA 5HWMA 3QPYA 3VE7A 2ZRWA 2NXGA 2XFWA 3O16A 4O8RA 2RDWA 2DZSA 3K30A 3EX4A 3G0UA 3GR7A 4UCGA 3EWBX 4IMFA 3L2IA 1L2UA 4RLIA 5EYWA 3LXCA 2J6XA 3W70A 1ME7A 3IGSA 2WNZA 2I9EA 3W7PA 1T8XA 3DFQA 3TXVA 3DFOA 3KRSA 3W86A 1SFLA 5LKYA 1DQWA 2B7OA 2Q8ZA 2VENA 4MUZA 2X2GA 3W1XA 5HR7A 3OHIA 1H5YA 2R94A 3IVTA 3FFSA 2H8XA 3R8RA 1SW0A 3H55A 1TSIA 4PL1A 2V2DA 3W74A 3CEPA 3CIXA 2J9YA 4RKAA 1K8ZA 4XQ6A 2CW6A 5CSSA 2Z1BA 1PVNA 2NLIA 3N9RA 3NEVA 5I3JA 3LB0A 4TX9A 4BWLC 4M6VA 1DQXA 4N02A 1XL9A 3GAKA 3QPZA 2Y85A 1TQXA 3WJYA 4UTJA 1WOBA 3PVFA 1TPFA 3INPA 3QM3A 4JX5A 3IRDA 4E38A 3R89A 1QR7A 3NQ6A 1FCBA 2QCDA 3F4WA 3KVMA 2Y88A 1I2RA 1OF8A 2Y7GA 1H7NA 2J9ZA 3W9ZA 1U5JA 2EF9A 1XI3A 1A5BA 4WXYA 3ATZA 5KTLA 1UUOA 3GIYA 2QUUA 3O06A 3P5ZA 2V2CA 3TE9A 2NWSA 1MXSA 4NX5A 1JRBA 4K36A 3IVUA 1ZHAA 4UIOA 3CWOX 3HBLA 3E0IA 1I4NA 1NVMA 3G18A 2QUVA 1P1XA 3N9SA 4FXSA 1QAPA 1ZALA 3IEBA 4AXKA 5D38A 4DELA 1TTQA 4K38A 2ZCGA 1D9EA 4AEOA 4GWEA 4IMCA 1H7XA 1H7WA 4HHPA 4JICA 2V5LA 4B5NA 1W8SA 2VFHA 4NXSA 2VKZG 3NVTA 4JYFA 1TJPA 1KV8A 3TSMA 3NPWA 4IPIA 5D30A 3BG9A 3UNDA 4WY0F 5AYYA 1GZGA 4PODA 1OF6A 1SZNA 1TCDA 1V7YA 3QH2A 2QJIA 5EBUA 4O12A 4XBKA 4UFMA 1E51A 3W71A 2V82A 3KX6A 2Y89A 2ZRYA 3L0NA 4PH6A 2GQ9A 3W2JA 3M41A 3KVJA 3NL3A 4AH7A 5KZMA 1T96A 1KM5A 1B57A 3F03K 3HJZA 2DZWA 3TJXA 2YZRA 2J27A 1HTIA 2WO5A 2GPTA 5CPNA 1ZAJA 1R47A 5EKYA 3UD6A 4O15A 5HUPA 3EX6A 1AL8A 4LV9A 2X1RA 3QMSA 3WJZA 4UMCA 1VHNA 4IXHA 1PCKA 4ZQNA 1QNVA 4MY8A 2UV8G 2ABAA 1S3HA 3PY2A 3FIGA 1W5MA 3G1HA 1XFBA 3G0XA 3UWZA 3N34A 3TFCA 1LOLA 1RPXA 1LBMA 1NF7A 3W2UA 3NA8A 1TV5A 1SPQA 5FEZA 1YXYA 5DY3A 1F73A 4NJHA 1RR2A 4S2CA 1VGAA 3IIOA 5BNKA 2QAPA 4MFDA 4WOZA 1G4SA 1TPB1 1HL2A 1PE1A 2ZRXA 4IJBA 2HS6A 4M6QA 1OJXA 2FIQA 3S1UA 3PM6A 5CZTA 2QCFA 1EA0A 3R5EA 1QOPA 5D03A 3TQKA 3OA3A 2ZRUA 4YL2A 2G5WA 1G4PA 1XBVA 4S1FA 5IBXC 4UTLA 1JCJA 2X30A 1RQHA 1FDZA 4O52A 3STGA 4P61A 1KLZA 1JUEA 2EPHA 2DJLA 3W7RA 3GDKA 1C8VA 1XM3A 3PR2A 3ZFHA 3LTPA 1PV8A 2CZ5A 3P5YA 3HG2A 3N14A 4YLWA 4E0CA 4KWVA 4H3DA 3O15A 1W37A 3MYOA 1XBYA 4JTGA 4JX6A 3NQAA 3GXNA 3NR0A 5SWUA 2CLOA 1BEUA 2PC4A 2YPIA 5GVJA 2Q8LA 1JCLA 2TYSA 4AHQA 2ABBA 4IGHA 4FNRA 3P74A 4XWUA 3TW6A 3Q2DA 4FIQA 1NSJA 1K3UA 4EOUA 1JCYA 3W7CA 1O5XA 3C61A 4MZ1A 3W2NA 1IGSA 3G0SA 3L9CA 4LW7A 4NXKA 1FUYA 3DBPA 1OX6A 5F1UA 1LYXA 4GUFA 1FXQA 3QW4B 1R2RA 3N2MA 5FF2A 1H1YA 3HQ1A 4J9JA 1H50A 1ML1A 4D2JA 3LCFA 1G4EA 1PCWA 1JQVA 1TMHA 3MUXA 2DZXA 4C1LA 3KFTA 3UWUA 4Y8FA 3F1QA 1AK5A 3HG4A 5DXYA 3SW6A 3MBDA 5E1QA 2EAWA 1J5TA 2A1YA 4JTKA 5L6UA 3FEMA 4KFNA 4DBEA 3C2OA 3S1WA 2WNQA 2V0TA 4Q33A 4N9CA 5D02A 1VYPX 4LS1A 1UASA 3W7KA 3PC0A 2YX0A 3M16A 3EXTA 4RXFA 4KWWA 1B9BA 3E02A 2C15A 1WYIA 2VEIA 3TQVA 2YXGA 4LS0A 1GVRA 3HF3A 5DXXA 2VFFA 4LRSA 4OHQA 5LSMA 4G1KA 4EVZA 3KRUA 3G1DA 3HPXA 1H61A 3DXIA 1GVFA 4Y90A 3MP4A 1KM0A 2CZFA 2RDTA 3LI1A 2PURA 4NNAA 1H1ZA 1XCFA 3E96A 2QCLA 2DP3A 4IMEA 3QEZA 4UTTC 2QJHA 2ZA1A 3B0UX 5C6MA 4O0ZA 4OWGA 3C8FA 5F4WA 2NX1A 4CQ9A 5I3GA 3UXAA 3C2FA 5AYZA 4GJ1A 3S0CA 3NQVA 2E77A 4GUIA 2QJGA 3TC7A 2VEMA 4MYAA 4IQLA 4CLMA 4XUGA 3NDOA 4CCEA 1RQBA 5EA9A 3RMJA 3W7DA 4N2YA 4QSHA 4HSNA 3LHUA 3TMLA 2NUYA 4FIRA 1KW1A 5CG7A 1AW5A 4HNUA 3DU0A 1KM1A 3FA5A 4L4LA 1YTDA 1W5OA 3UZJA 2FPVA 3S1XA 3KVKA 2P0OA 1JQXA 1W3TA 4AF0B 4CQ8A 1PL9A 2QCNA 4DPPA 4IXXA 3NM1A 1IXOA 4JY8A 3UY7A 2CLFA 1XDLA 3MHUA 1UBSA 1A5SA 4A2RA 3LV5A 3ELFA 3I65A 4WD0A 3LRLA 3NQ8A 3ZWTA 3ANYA 4TMBA 2YW3A 2C3ZA 4IMDA 4HNNA 1HUVA 3TR2A 2YW4A 1CX9A 2ZYFA 1YDNA 5D04C 1W1ZA 3DFSA 2Y70A 4O1DA 2LLEA 4JYEA 2E6DA 1ALDA 2KZHA 4WZHA 2A7NA 5E0KA 4LUJA 4ML9A 1LZOA 2QCGA 4RZ4A 2CLEA 1A50A 1R2TA 3U2OA 4N6FA 1LRTA 3TXZA 3QSTA 1GVSA 2GJLA 1R30A 3S42A 2X1UA 4UNLA 4CCDA 5LNRA 4GXMA 1EWEA 3RU6A 1ICPA 3L68A 3VNDA 2CZEA 3VE9A 3NQGA 3SI9A 3E9AA 2FLIA 3IVSA 2I1OA 2DJXA 4Z0JA 3GK0A 3DFNA 1IF2A 4N6EA 4HN4A 1QPNA 3EWXA 3GKAA 4IX2A 4Z08A 1VYSX 1L6SA 1I8JA 4ONVA 3QF0A 4UTIA 4AVFA 4K7VA 1N55A 3S8HA 3LRMA 1FWSA 5FF0A 5FEWA 1ZCOA 4HT3A 1KFBA 1SUXA 2E68A 4UMAA 1SR9A 4Y9AA 5D09A 4JR5A 5F1VA 3NQCA 3RFAA 2X16A 3STFA 3GZ3A 3MO7A 1DVJA 2ZZ4A 5U7SA 4IPJA 4WXZA 4DO6A 3RLUA 3S6DA 4ZQCA 4PEKA 3LCLA 4OGZA 1K8YA 5AN7A 4A3UA 4MJMA 2F7FA 4K37A 1BWKA 4UFIA 1OHLA 2QCHA 2CLIA 3L5MA 3NPXA 2ZZ3A 4DXVA 5D2TA 2VOMA 1NAL1 3P80A 1QOQA 5AB3A 1V5XA 5C55A 5F2GA 2YSWA 2W6RA 2Z2UA 2ZTKA 3GX9A 1WXJA 3NNTA 1SSDA 4LVFA 2CFFA 2CLLA 3USBA 1WBJA 3MI3A 1LM1A 5LNUA 3M5ZA 1SZEA 3CB8A 1W5QA 4LY8A 1H62A 3A24A 5D2XA 3NZ1A 1VYRA 2NXHA 2Y7DA 1TYGA 3TSDA 3TAOA 1W31A 4X3ZA 1M7PA 1SU5A 2PCQA 2C16A 3GVGA 3FKRA 5C2XA 3H54A 5FF7A 1I2PA 4OT7A 3QMTA 4GNJA 4XBSA 3L5LA 5J5DA 3C2EA 5BMWA 3UWYA 3P84A 1U83A 3G1XA 4Z1CA 3TH6A 4UFLA 1L6YA 2XN2A 5KZDA 3LERA 4GC4A 1KBIA 1JVNA 5BMXA 3BLEA 1EIXA 1FWRA 4JTEA 3W3OA 1K7FA 5K9DA 2Y6ZA 3C2VA 1SSGA 1O4UA 1FBAA 4FNUA 1X7FA 5I3IA 4JY9A 2ZFAA 5A5WA 2DU2A 4GUJA 4LUIA 4ALDA 1O5KA 1Q45A 2OMAA 4NT0A 3EXRA 3TC6A 3NYZA 1OK6A 3HO8A 1NF0A 2HSAA 3BGJA 1N7KA 2P1FA 3LLDA 3PSVA 4U28A 5HWNA 4ZQPA 4M7SA 3W7MA 4WJEA 2OX1A 1K02A 3MHFA 1OK4A 4ORIA 2C0AA 2Y61A 3B06A 4N9BA 2A21A 1X6UA 2RKXA 4JTFA 2NUXA 1TRIA 1TTIA 4UTMA 3C6CA 3LX9A 3ABQA 1Y0EA 2EGZA 3DHDA 3NM3A 1YTKA 3ZR4A 3TQ0A 1F7BA 3MMTA 1UJPA 2CWNA 3M0ZA 5LNSA 3CLMA 1VHCA 2NV1A 3ZS4A 4BI7A 1I45A 3HMJG 3HPZA 4MJZA 4X9SA 1YLVA 1KFJA 4WQ6A 2FJKA 3W1RA 1LDCA 3IIPA 5LHEA 2PRMA 5FEXA 1GT8A 5KINA 3HIJA 2C13A 1ZFJA 3NGJA 1CI1A 3W7OA 3B0PA 2FPTA 3ZWSA 1P5BA 3CEUA 1P0NA 3AJXA 2DZUA 3M5YA 2AGKA 4MIMA 4NJKA 3EB2A 1QFEA 3HGRA 4QISA 3DENA 3WJXA 1KLYA 2CLKA 3BV4A 3CC1A 1HO4A 3W7NA 4LV4A 3UWWA 4O1BA 3GDTA 4RV8A 1Z44A 3BGGA 3CTLA 2A5HA 1EUAA 1WBHA 1VLIA 4KFOA 3QW3A 3W2KA 1H7RA 3FLUA 1D3HA 2GOUA 1TREA 2F84A 2VFDA 4MVAA 3NO5A 1TTPA 1WV2A 2VFEA 3AO0A 5D2WA 3R12A 3L65A 1KBJA 2ZRVA 3W23A 4NNCA 1QO5A 4BWLA 4OU1A 5L9FA 4TU1A 1SZGA 1LORA 1IXQA 4FO4A 5AHFA 1HFBA 4JIPA 5CPOA 3O8AA 1PHWA 2FPYA 4LC6A 2GJNA 7TIMA 1I2OA 3NZRA 3FYOA 4XZ9A 3B8DA 1KTNA 4FHAA 2AAMA 4JS3A 3W83A 3O07A 1BKSA 3JR2A 3TK7A 5FESA 3PAJA 2VEKA 1T0OA 1GYNA 4O28A 5DCDA 4FX6M 3WK2A 1TPC1 1GPWA 1F6KA 1EP3A 4JTHA 2CLMA 5D33A 3W1NA 3LGEA 1CW2A 3QQ0A 3EX1A 1JUKA 1DKWA 4X2RA 5AOUA 5G2IA 4E2BA 1M6JA 1LOSA 4HKPA 4LT9A 3QYQA 1Q6RA 2B7PA 2OT1A 3LHTA 4JDYA 2ZA3A 1EB3A 1J4EA 3C56A 3P67A 1OVDA 2CZDA 2I14A 3TSBA 3MJYA 3IIZA 2QF7A 2WSRA 2WOQA 3G22A 2WQPA 3U8GA 2V9DA 3UYCA 4O16A 2HS8A 1VQTA 2TRSA 3QZEA 1IXNA 1TPEA 1Q6QA 3CQ0A 4RZ5A 3PBWA 1XDMA 1KFEA 5AC6A 3S9YA 4DF0A 1OX4A 5I3FA 1H7OA 2JGYA 4DQWA 3W2LA 1QO2A 1TTJA 3CWNA 3W1QA 3LOTA 3KAOA 2JKPA 3TKFA 5AHLA 3L0KA 3NG3A 1VCFA 2E09A 4YCPA 1VH7A 4QM1A 1HG3A 2G97A 1N8FA 2VFGA 3DFTA 3UXDA 3N73A 4MY9A 3M9YA 5DBTA 2Q3RA 3THQA 1GTHA 4O50A 4TO8A 4JTJA 2QCMA 1TPH1 3G8RA 1H51A 2H6RA 1TB3A 3W73A 1D3GA 4ZQMA 3PWAA 3NL2A 1Z42A 1OYAA 1DOSA 2A7PA 4BF9A 4QIUA 3EKZA 4RJEA 1RZMA 1GOXA 1Q6LA 4JDBA 4Y6GA 1LLZA 4K39A 1XUZA 2YFNA 3LXBA 4LRTA 1MSSA 4TR9A 5CPMA 3HG5A 1LOQA 4FNTA 5J5RA 4UC5A 1SFJA 1JR1A 3THAA 3T7VA 4CNPA 2H3DA 4OBTA 1ADOA 6ALDA 1DJNA 3W7GA 1ZNNA 1MEWA 3TROA 4OE7A 3NQMA 1JCXA 3NAVA 1DHPA 4DO5A 1KFLA 4FNPA 3MYPA 2W79A 5G1YA 5IBXA 3W1UA 1K7XA 4AAJA 4DF2A 3TIMA 1OFOA 2BWGA 3NOEA 2VFIA 5HULA 1EEPA 2JBMA 4AF0A 3QFEA 3WJSA 2GVGA 4JTUA 3O1NA 3FYPA 1SQ7A 3BVJA 4ADSA 5CPLA 1AMKA 5DCEA 1TV7A 4PL2A 1WAUA 4Z1BA 1GVQA 2C1HA 1GEQA 2YGYA 4UFHA 4A22A 1Z48A 2V8ZA 4NNBA 1ICQA 1XBZA 4O1CA 4FNQA 3OG3A 4WUIA 4XKYA 3P62A 4KFPA 1F2JA 4R53A 3OEXA 1OFAA 3NQEA 2DZPA 4LU0A 1M5WA 2VELA 3I7RA 3B0VC 3W72A 1KFCA 2E5DA 4UUIA 3TMQA 4DBDA 3EKLA 5TQLA 1QPRA
chains in the Genus database with same CATH superfamily
3RLVA 1TVLA 1O68A 2QV5A 1A5KC 4OECA 1XIMA 2ZTJA 3ZIZA 2ACRA 3QOMA 3BSHA 3C2RA 3R8HA 5FL1A 2DZTA 4NRRA 5HMEA 4URIA 4D9PA 4ZTYA 2WSQA 2ZZ6A 3UWVA 3I7QA 5K4ZA 4R85A 3MTWA 4PMQA 3BWWA 4PA8A 2IXVA 3PAOA 3WK0A 1OD0A 3UF9A 4D6DA 4Q8NA 2E40A 4CGTA 3EDKA 1W9UA 3PG8A 4UQDA 3ZXWA 5ABTA 4W8AA 2GDVA 1KCLA 2XINA 3W2MA 4LB4A 5F7UA 3UERA 4HU3A 4OV4A 2GWGA 3WF0A 2Y7FA 2CETA 3EX2A 1GCYA 4D6CA 2EHHA 2GGGA 2QULA 3W84A 4YTSA 1UP2A 6REQB 2ZICA 4RNJA 2ISSA 1DEDA 4GZ7A 1AW1A 3N2BA 2WMKA 3ZVIA 5HR6A 1TPUA 3CK5A 3TN4A 1LP6A 2NVAA 5KITA 4JTTA 1RHCA 1CLKA 1B5TA 3GYCA 3UEQA 1MRQA 2OB3A 4NJGA 3WD0A 3WDPP 2BLEA 4HNCA 3L67A 4Z2LA 3GY1A 4GJJA 1GHRA 4O18A 4LUTA 3PZOA 4JHMA 4MF4A 1TUXA 4HZMA 1RP8A 1I0DA 2DVUA 1J79A 4J3ZA 2XPKA 1P0DA 4YYFA 3LCGA 3SFWA 4JQ3A 3WJWA 3DOPA 2X7WA 2J66A 2ALRA 1A53A 5C5YA 1TRDA 4MNLA 3VUSA 4HSOA 1P6WA 2DUAA 3JRKA 4JTLA 2W63A 5EFFA 4K7YA 4V2XA 1A3HA 3CQKA 4FX8A 4TV5A 1PB0A 4Q8MA 1W17A 3RM9A 2CIPA 3KLKA 2E5BA 3UZ5A 4IP4A 3KE0A 1KQYA 2X0HA 5CJ5A 4N7QA 1I0BA 3EWUA 2W0UA 4PC8A 3MMUA 3TU9A 3GDMA 4GKTA 3BH4A 4S23A 4CNSA 1LG2A 4XAFA 1BXCA 2J8GA 3ITXA 2V67A 1XYFA 3G1SA 1XQLA 4HOZA 1TPWA 3R0DA 3SGGA 2XSXA 4I9JA 3KTXA 2DSUA 4NAFB 1QPOA 4G56A 2FB3A 1BF2A 1R3YA 4X9YA 4PMRA 4H7ZA 1EH9A 1UIPA 5GQBA 4XAZA 3GTNA 4DJEA 4AW7A 2PF0A 4IP7A 1ZL1A 4QQ3A 3OIXA 1V8EA 3VDBA 2WVSA 1EDQA 4TMCA 1KNWA 3ZYZA 5ABHA 4M5PA 1PX8A 1OFQA 3LQLA 1ITCA 2ODOA 1JCNA 1QUMA 1JF6A 4PMJA 4EKJA 5BU9A 3QQWA 5BXRA 3SO7A 5FSDC 1FDJA 3GWQA 5FF3A 4HYRA 4G9PA 3CT7A 1SO6A 3T07A 5LHFA 4H6KA 3W82A 2VZSA 1SW7A 3DECA 1TKKA 1G7VA 4MNKA 1OGGA 3IK2A 4GISA 2X2YA 4MMWA 3LI0A 1G5AA 4IFKA 3M5VA 1WA3A 2HISA 3WENA 2REQA 4AIEA 3VNJA 3N3MA 4U5KA 2CITA 1E71M 5HNRA 1FKWA 1NFBA 2V5DA 3ZT5A 3P3BA 5FOOA 3NPUA 4AWUA 1YEYA 2TMDA 2GOKA 4D6IA 3LDVA 1HL9A 3W7EA 1C93A 4OBSA 3VM5A 4P7OA 4RX0A 1LQ0A 3QMRA 4R33A 1LF1A 1AJZA 1ZY9A 4QJ4B 1GKQA 2J47A 4CCZA 2A3AA 2XIOA 1AUSL 4O4VA 1YPXA 4O14A 4D6JA 3V0SA 1B90A 1M7XA 2IW0A 4U33A 5U4NA 1S46A 3V75A 4U3CA 1NH6A 1QWKA 2YA1A 3TYCA 2BGNE 5CEWA 4YMZA 1O1ZA 3LBMA 3QZ6A 2EXOA 3EXSA 2NQ5A 2AQVA 2YXOA 1WXZA 4MNMA 3W29A 1R8LA 2VGGA 3NSXA 3A5FA 3QSRA 4H4IA 4ZR8A 4IH3A 4JX4A 1J93A 3THUA 4BI6A 2PDBA 1XYCA 4HTYA 5MHBA 3U5UA 3P93A 1UWRA 4HZ8A 4OV9A 2PZNA 1XBXA 3GXTA 3U4AA 3R13A 2XN0A 3WQWA 1CWYA 4ERAA 3MUZ1 1DV7A 3F5LA 1XPYA 4MWAE 4KIEA 2I9UA 2P50A 4HPNA 4O0KA 3S5ZA 1E3XA 3QOKA 9RUBA 2F6KA 5I2UA 1K77A 3OLIA 2QKFA 3GVWA 1G69A 2DZVA 3UR8A 4TVDA 4EWJA 1Q2RA 3AS3A 3K8KA 4IWWA 3UT0A 4LVGA 1QNPA 2J7EA 1A4MA 4HBKA 1Z9AA 3WQ8A 4DO4A 3K4DA 3QQ1A 4K68A 2G8ZA 1F5ZA 3LXAA 4LF1A 5E0CA 5HNNA 1QNSA 1AA1B 1WX0A 2V3GA 5DRIA 2BVDA 1CXEA 3S5NA 1XPGA 3AXMA 4IZGA 4HNOA 1W54A 4MLRA 4O1AA 1FHVA 1VBUA 4Z2GA 3XISA 1C7SA 4A8RA 1WOAA 2BSLA 1UKPA 3UW6A 2MANA 1NFPA 3T0AA 5A2AA 4PEEA 3PHAA 2WZIA 2ZRZA 4C6IA 3EKGA 3SJ3A 4FAMA 4BEUA 3K4WA 3AOFA 3WD4A 2CU0A 5BOOA 5DELA 3NXFA 3GNNA 2XG9A 5CLTA 1TWIA 1WB0A 3SCOA 3LHVA 1U2YA 3QC3A 4GRSA 1FX6A 1X1ZA 5DFAA 3N4FA 1E6RA 3M0IA 3G1AA 3NQFA 4RR4A 3DGRA 1Q6OA 1XP3A 4NZCA 1O1HA 3HGSA 1HJSA 1C8XA 5G4EA 4C7FA 1UB3A 4BFAA 5M1TA 1C9DA 1FWDC 2NUWA 1YKWA 4AXNA 3QGVA 4RCXA 3RF9A 1F6YA 3NPVA 9XIAA 1FY6A 3QHMA 3HG3A 2GSHA 1X8FA 2QW5A 2Z6JA 5J04A 4JTIA 1ZAHA 3KOXA 4UOZA 6XIMA 1OX4B 1EJUC 3RU8X 2ISWA 1XYMA 5CSRA 3EBVA 1CGUA 1RVGA 2Y7EA 1TIWA 1C7TA 4C6QA 1RA0A 2NZLA 3E49A 5LNWA 1NJJA 4M19A 4OKDA 4AX6A 3OBKA 4JFWA 1TPDA 1OZMA 5FEPA 4JIHA 2VT0A 2VC6A 1QHOA 2NV2A 4KCVA 2GUBA 5D32A 4AY1A 1VRXA 3GNRA 4RZBA 4ZCWA 4AEEA 3FSTA 4HPJA 2PPGA 3AS0A 2GQ8A 1Y5XA 5I79A 2BOEX 3ABZA 4N42A 2V5CA 2BVYA 3IUIA 1KXQA 1OCBA 2XTKA 5LNVA 2HXUA 5CZSA 1UR8A 4L9YA 4WX2A 1WUEA 3KWXA 1CXIA 3W7QA 2ICSA 1G9HA 3L4WA 1PTAA 4KT2A 4MZYA 3KP1A 2ZXBA 3KBNA 4HJWA 4KEUA 3CO4A 3WUGA 1PKLA 1FVPA 2XGZA 3FHQA 4ZFCA 1YDVA 2QZRA 1GOMA 3TV8A 2R14A 1ZENA 4FLSA 2ZZ1A 4MDPA 3PJXA 4C1NB 3FJ6A 3GIPA 3K4AA 4ASTA 3MKCA 1HGWA 4Q3MA 4H04A 3QKEA 4XKYB 2G4FA 3VD5A 4J1OA 1PWMA 1GOKA 1Q7ZA 4JKMA 4EPBC 4LGXA 3NYDA 3TDFA 1UP3A 3QTPA 5DMYA 1TR9A 4C5YA 3D5HA 3WLIA 4WGXA 3G1FA 2VURA 3B8IA 5E9XA 3FOKA 3VA8A 4EIVA 2VI0A 2PDKA 1RCQA 3PTMA 4ZO8A 1JEZA 2V3DA 1VF8A 1FHUA 3S1VA 5LGZA 5K9CA 2H90A 5D37A 1GWJA 3ABSA 2NQZA 4M7TA 4NY2A 1R6WA 4NSBA 2BASA 4YWIA 4CUCA 2YDAA 4MG4A 1EYWA 4E5TA 4CNNA 3WH7A 2Z1KA 4Q8PA 3VUPA 2P10A 1RPKA 2YR1A 3MQTA 5D9MA 5C9RA 4UFKA 1J96A 1BXBA 3E3HA 2FVMA 3FAXA 4TVCA 1G7UA 1AQFA 4UTFA 5H91A 2E3ZA 2C6QA 5C54A 1BWLA 4LH8A 2V5KA 3TJLA 2RHGA 3LTYA 3B8WA 3H7UA 3F2BA 3D46A 2WZHA 3UZWA 1J0KA 3UY8A 2BX7A 3LMYA 2TSYA 4IICA 4O53A 4LVDA 2G96A 4DNMA 2V2HA 4H00A 1HKJA 4JFTA 2ZZ7A 1UWTA 3V7PA 1MUWA 9CGTA 1OZQA 3LRKA 3DBNA 3HA1A 1XH2A 4OBRA 1KM2A 3HPSA 3M0MA 1XLAA 1XSIA 5HWMA 1U33A 2FGLA 2NXGA 2A3EA 4GOAA 3N2TA 2VD9A 3EX4A 2XYLA 3GVQA 1PAMA 4IMFA 2BHYA 4GQBA 1BYBA 1L2UA 1EJSC 5EYWA 1KGXA 1EO5A 3LXCA 3W70A 1ME7A 3IGSA 1R7AA 1T8XA 3TXVA 1H5VA 2FHFA 3UZYA 2PP0A 2Q8ZA 4QQUA 3W1XA 1H5YA 3BC9A 4XIAA 2X1IA 2PBOA 4I8YA 3FFSA 3H55A 3TVAA 4C6NA 3W74A 4RDVA 3CIXA 2J9YA 4JTAA 4RKAA 5EGRA 3N2OA 2CW6A 5CSSA 1ISWA 1PVNA 5I3JA 4CN4A 3IJLA 3SURA 2WCGA 5T9BG 3GNPA 1TQXA 1JYNA 3PJUA 3AWNA 3RMEA 2VWTA 1DJWA 1E72M 2QCDA 2Y88A 1I2RA 2Y7GA 4F8XA 3FK4A 2EF9A 2A3HA 3U5YA 2AMXA 4WXYA 3ATZA 5A8MA 4M0XA 3O6AA 5A6BD 3PPGA 1JRBA 4K36A 3E0IA 1F8IA 4L61A 1NVMA 1M7JA 3G18A 4BS0A 3N17A 1SFSA 4FXSA 3OQ8A 2VEFA 4LCQA 3W81A 3HURA 1VIWA 4V27A 1ZALA 5TAOA 2ZCGA 4P7LA 2C91A 4JICA 3RX4A 3CNYA 2ZUTA 3THCA 1RVKA 2XHYA 1PEZA 3WQCA 3NPWA 3BG9A 1P43A 4XISA 4PODA 4UQCA 1SZNA 3WDHA 1U5HA 4W86A 3L4TA 5CBIA 3QH2A 3OODA 5C9ZA 4CEXC 2OEJA 4UFMA 3N12A 1E51A 2V82A 3L0NA 1MI3A 4D8AA 4LXFA 1UR1A 3KVJA 4AH7A 3MVIA 1HIZA 3GS6A 3N3TA 4P8WA 3AALA 1C92A 5BU6A 4EAMA 1IT7A 5H1WA 2WO5A 2P3EA 2I5QA 2WQDA 5CPNA 1L6FA 3UD6A 4GNVA 1NFGA 2YBUA 3PTDA 1M3UA 4LV9A 1A5MC 4ZSTA 3WJZA 5ABGA 4IXHA 1HVXA 5A1AA 5JQ9A 1XIEA 3PY2A 3AIVA 3G1HA 1MYRA 4MAZA 2XU2A 3G0XA 4AX7A 1UQZA 1QRQA 1NF7A 3NA8A 1YXYA 2GZXA 3VKCA 1RR2A 4S2CA 1VGAA 5BNKA 1XRVA 2UY4A 2QDDA 2PZ0A 1OM0A 3M07A 3B0XA 4XVEA 4M81A 1CXHA 2HS6A 3T42A 4A3QA 1UKSA 5CZTA 2QCFA 1A5LC 1QOPA 2W92A 4I6KA 5HQMA 4GYPC 4HA0A 1A5OC 1BYDA 2PDNA 4LEQA 1FDZA 5LYRA 4KWSA 2DJLA 4NZ3A 2DGAA 5FJIA 1BVNP 1XD0A 1XM3A 3EPOA 4CQDA 2E28A 3HG2A 4BHYA 4C60A 3C3UA 4JTGA 4D6EA 1XH1A 4JX6A 4IQEA 1OD8A 4QG8A 1EZ2A 2CLOA 2PC4A 3VGBA 4HYWA 1R86A 5HMDA 1DTNA 4AHQA 1Q8AA 1US2A 4MB3A 2ADAA 2FHBA 1JCYA 1SVDA 4JBRA 4JKLA 3VIJA 3H70A 4PBEA 4FK9A 4LW7A 4NXKA 1FUYA 5XIAA 1LYXA 2OFJA 3RO6A 4J9JA 1H50A 1HL8A 2IPWA 1ML1A 4D2JA 3LCFA 1G4EA 1PCWA 1JQVA 3GUGA 1TMHA 2DZXA 4C1LA 3ZLHA 3UWUA 2UY3A 3AXHA 4GNKB 1TWSA 3WLRA 5DXYA 3ICJA 4IUGA 1J5TA 3N6QA 4KFNA 4KS0A 6REQA 2DPEA 3S1WA 4Q8OA 2WNQA 1TZ7A 2OLAA 4PCPA 1UASA 3VIGA 3M16A 2OO6A 4UQEA 1B9BA 2ZUWA 3A4JA 4I5RA 3VKAA 4AISA 2HVMA 4LS0A 3S2CA 4F66A 2PU0A 3WQDA 5EBAA 1MQQA 4MAVA 4EAYA 4E6MA 2DIEA 4DLFA 2FMNA 2RDTA 2G4JA 4HQVA 3W27A 3LI1A 2IXUA 4Y9NA 4CD8A 5IXEA 1UR3M 2QCLA 2DP3A 3QEZA 4UTTC 2YDRA 4L65A 2OOGA 2QJHA 1YNPA 4AIOA 5T9CE 1CGXA 3A13A 5C6MA 2X7VA 2Z29A 5JBDA 1K70A 4CD6A 5FD0A 3NJ3A 5I3GA 3SRDA 4D1IA 3W24A 3C2FA 1XIFA 3I4KA 3NQVA 3B8TA 1CXFA 1LL6A 1OADA 4IQLA 1TVPA 1X6LA 4HN8A 3WH5A 3RLHA 3PZNA 3R6IA 5A3HA 3HFTA 3RMJA 3RXZA 2QVNA 2P0IA 4QSHA 4AVNA 3AUOA 3TMLA 1KW1A 3WDIA 1AW5A 4PB4A 1BXNA 1KM1A 4GVGA 2FPVA 3S1XA 2HVOA 1PL9A 2OQYA 2OYKA 4U31A 1IXOA 4JY8A 2CLFA 3MHUA 1UROA 1NARA 3V0TA 3VC5A 4LAMA 4CU7A 3TR2A 2WMJA 1G1YA 3MT1A 2VMFA 1ONWA 3BAKA 3DFSA 2Y70A 3VVGA 2LLEA 2OU4A 4HA1A 3A4WA 2FTYA 2A7NA 4GGHA 2QCGA 2YDQA 5MF5A 2CLEA 1A50A 1R2TA 3EDJA 1LRTA 3QSTA 3IAPA 4Q8VA 3HN3A 4WDTA 1GVSA 3WMSA 5CG0A 4LYRA 4Q4PA 2XVKA 3TNBA 2FGZA 4QXIA 4GXMA 5FJTA 1P0BA 3VOIA 3VE9A 1QHZA 1WZMA 3DFNA 2ISFA 3EWXA 1FKXA 4Z08A 1GOQA 1JZ3A 4DY1A 1VYSX 1EF3A 4JHOA 1Q6CA 4ONVA 4UTIA 3ZSSA 4E8GA 1W1A1 4BQ5A 1N55A 3S8HA 3C5QA 1FWSA 5FF0A 1EL3A 1GGOA 4IG2B 4HT3A 1KFBA 1SUXA 3N13A 4ES4A 5HATA 4UMAA 1SR9A 4JR5A 5B80A 1E0UA 1GKPA 3VMNA 5D4YA 4YWSA 2POTA 2NQJA 5DMNA 1XYBA 3CHEA 5EMMA 3S6DA 2XM2A 3GXFA 4V1YA 3UZZA 3LCLA 4OGZA 1K8YA 4A3UA 4GIRA 2F7FA 4K37A 1W3LA 3MWCA 1BLIA 2CLIA 3IGHX 1P48A 3KBVA 3FSUA 1Q6DA 3FN9A 4Z42C 4L1WA 2F6UA 1QOQA 1JPDX 1SJCA 4R7OA 1PZ0A 3NNTA 1S2TA 1TJ2A 1RCOB 1AFSA 4H2CA 3M5ZA 1B30A 2C7FA 5D2XA 3W00A 3FV9A 5BOFA 2POZA 2Y7DA 4X3ZA 3ITTA 1DIDA 1BRLA 1SU5A 5C2XA 4JTCA 3E38A 4WSKA 5FAGA 4OT7A 2NVDA 5T8GA 3NQBA 4GNJA 3GC5A 3L5LA 4WCJA 4ZEPA 2JF6A 3P84A 1U83A 4Z1CA 3TYUA 1JDAA 5KZDA 4GC4A 1JVNA 5BMXA 4QROA 1E1CA 4P5UA 4JTEA 1ZUAX 3W3OA 5HJXA 3C2VA 1O4UA 4FNUA 1BHGA 1VKFA 2D2GA 3BOFA 5I3IA 4JY9A 2ZFAA 2E9MA 3OG2A 3MJMA 1O5KA 4NT0A 3MCMA 3N2CA 3TC6A 1V51A 2WC7A 3TLLA 5EMJA 4GQRA 3NYZA 1OK6A 3I4EA 3QKZA 1HKWA 4PMYA 1FFQA 3U2CA 2EJ1A 3O0FA 2P1FA 3LLDA 3W7MA 2X8RA 1OK4A 1RCXB 3B06A 2A21A 1J18A 1NP2A 4RPQA 4MADA 2RJGA 3C6CA 1DWFM 3B8SA 2CWNA 2JEPA 2J4GA 5LNSA 1XCWA 4C6DA 1CGVA 1T41A 5TD4A 3GRIA 4MJZA 2HV5A 1R9XA 3C0LA 2PRMA 1ZQ5A 3KZSA 1Y65A 3ZWSA 1WDDA 1V03A 3AJXA 2DZUA 1R9ZA 1MFVA 3EB2A 1QU4A 2VRJA 1QK2A 1AD4A 3OU8A 5FL0A 4H8UA 3CLWA 3W7NA 4W5UA 4LV4A 4J2PA 2A5HA 4QLLA 2FH8A 1OGSA 3QBUA 2IMRA 1W32A 2VFDA 4MVAA 2WVVA 5D9NA 6PTDA 2DSVA 4AVOA 2VFEA 3R12A 2ZRVA 3W23A 2WB5A 1BQGA 3EDDA 4NNCA 2X42A 5L9FA 2Z4GA 4CD5A 3QYSA 3WEZA 1W2PA 3GD6A 4FO4A 5AHFA 3MSGA 3CAQA 4MJ4A 1PHWA 3ITCA 4H6EA 4DUWA 2Y5EA 4XZ9A 2CBUA 4FHAA 3W83A 3O07A 1BKSA 1TWZA 1QJWA 1J12A 3CZJA 4ACZB 4B9ZA 2Q71A 3SQLA 4DAFA 4FX6M 1KGUA 1F6KA 4CN6A 2CESA 1CW2A 3EX1A 2R1KA 1JUKA 5AOUA 5C2CA 3URNA 4BEQA 3T4WA 4LT9A 4B5WA 1CECA 2OT1A 1MW1A 3LGDA 2ZA3A 4S3JA 1J4EA 2I14A 3ID7A 1WPCA 3A4XA 3KHDA 1IZKA 2WSRA 1NDWA 3LEPA 3ONBA 3H2NA 2WQPA 2YCKX 4LBRA 3QZEA 2HWGA 2TRSA 4W89A 3N29A 4RZ5A 2AOSA 1B3ZA 3PBWA 4IGMA 1V3IA 4DF0A 1OX4A 1E5JA 3VIKA 3KTSA 3BAJA 5AYBA 1TTJA 3CWNA 1LL4A 3LOTA 4JTDA 3TKFA 1W1TA 5AHLA 3OJGA 1ZBCA 1VCFA 3D6NA 3AISA 3IS4A 1P7TA 4NP7A 4UQBA 3PANA 2IQ0A 3N73A 2BBFA 4D6GA 4MY9A 3EAUA 1DYSA 4O0QA 2QCMA 3GVRA 1TPH1 4F3HA 3KOZA 4Z2JA 1HKMA 1TJ0A 2PDCA 2BY1A 1W9DM 1EIBA 4B3LA 1TB3A 3W73A 3PWAA 1Z42A 1OYAA 4ZB2A 2A7PA 4BF9A 4EPEC 4EX4A 4RJEA 4JEJA 1RZMA 4FLRA 3NIYA 3WSUA 1LLZA 4ZOEA 2VJXA 2D0GA 2IS7A 1MSSA 3FVDA 2P3ZA 4DLMA 1EKOA 4TR9A 5CPMA 1LOQA 4FNTA 4JN8A 4ZB0A 4UC5A 1YIXA 4HP5A 1ZNNA 4MKVA 1G01A 1ZPTA 2W67A 3RJYA 3NAVA 1DHPA 1ISYA 2Z28A 3MYPA 2PTWA 2VX6A 4JQ4A 1E43A 4JAWA 3AQUA 3DERA 4DF2A 1FHLA 1OFOA 1K4HA 3NOEA 3QY6A 1EEPA 2CPUA 3TYEA 4B4HA 1A5NC 2GVGA 3WBYA 3FYPA 1EDTA 1SQ7A 4ADSA 1E73M 4R7WA 4Z1BA 4GACA 3CS2A 4AWEA 4FP1A 2PS2A 3CGTA 1ICQA 1XBZA 5I7GA 2OGJA 2WJFA 1RY8A 3VNYA 3PJTA 4XKYA 1XISA 2VCBA 1F2JA 1C3FA 1EJTC 3BAXA 2PDMA 5C2GA 5FIPA 3OEXA 3T05A 4S3GA 3NQEA 1XKJA 3DG6A 2DUZA 1J0IA 3W72A 3TMQA 3EKLA 1QPRA 5GNZA 1X8CA 4Y9OA 4WF7A 5JUVA 3VOCA 3A5VA 4JTQA 4M6PA 4F2BA 1VCGA 4LUYA 4C6BA 4ZOCA 2WMIA 1A47A 1UD2A 3KL3A 5CH9A 1BKHA 1FH8A 1OFRA 1E55A 3OZYA 4EPKA 4ACYA 3BOLA 4AD0A 3S1GA 3F5JA 5AZ1A 3ABXA 2V3FA 4JTRA 6TIMA 5IM51 2BV9A 3RK8A 1GW1A 3VZYA 4PTMA 1LCOA 2CLHA 1BSIA 1PZ2A 2BVTA 2NWRA 2J75A 1Q7MA 4HIBA 4LVAA 1ODUA 3KLLA 1AQHA 3E74A 3KZPA 3L21A 3KRZA 3QPEA 5EL1A 1LRNA 3BLFA 1KXTA 4X22A 4A3HA 4HHMA 3AFBA 2GQAA 3GHRA 4NI3A 3G2GA 2QJJA 2FH6A 5T26A 3EB3A 2BG5A 3KCJA 3AMDA 4GE8A 2D73A 1UIOA 3HZ3A 4GC3A 3W01A 1OYBA 4CU8A 1V0NA 4JPGA 4UTTA 5D2VA 1JJKA 1OFEA 3GO2A 2BTMA 3M0XA 4XTDA 1A4LA 2CHRA 4MOZA 1UD5A 3KXQA 2Z2BA 3WF4A 4EP8C 1RBLA 1GVEA 1XSKA 4I8DA 3L4XA 1RLCL 4Q4SA 1EFZA 3MU7A 1QCWA 2X0SA 3O6DA 1F05A 1MVYA 3ZJKA 4PCFA 2PD9A 2ZA2A 2V30A 3IRSA 1IHIA 4WDWA 3GHUA 4UFJA 1IIHA 3FJLA 1S2WA 4I9TA 3VGGA 3W1PA 7REQB 3TFXA 4B5SA 3T4CA 4QITA 1H63A 3LHYA 3VFCA 3RLGA 3BW4A 1OSEA 2ASHA 4R34A 3DZ1A 3SBFA 3SCPA 1O12A 3XIMA 3C0QA 3CMJA 4LQ1A 4DZIA 3G77A 1OG0A 4ZODA 2OO0A 1QBAA 1NWTA 5TBOA 5KMYA 3BW3A 8TIMA 2VP8A 2VUNA 2QR6A 1H60A 1FWIC 4K3ZA 1L8PA 3ZJ7A 2GYIA 4L80A 4ZB5A 3W7IA 2GUUA 1TELA 4F0HA 4QFUA 4LOCA 3I3DA 3VOJA 4YPJA 3WFAA 2WMGA 1L8NA 3QHNA 1MEHA 2BHZA 1W1VA 3AS2A 3E12A 1PKNA 2VX5A 5I3KA 2D23A 4INFA 4J3UA 3LLFA 2ZDRA 1GVOA 4QP0A 1ITUA 4DIAA 4GIAA 2GJXB 1XD1A 3G1VA 3BJFA 5AHIA 1JNDA 4X61A 3IJ8A 1ONRA 2JIWA 3KRBA 3KOFA 3WH6A 3T55A 1UR4A 3EOUA 3HB9A 3N2XA 3NL5A 4BQ2A 2XIQA 1DTUA 4NJJA 4D8LA 1EF2A 2YA2A 3PFRA 1P4CA 3B8VA 5LXEA 1EOMA 3HV9A 1QWGA 3MUIA 1JFXA 2QS8A 3N6HA 2WC3A 1EZWA 3WK1A 5I6SA 3LLXA 1EPXA 2NX3A 1TV3A 1EA9C 4W85A 3BURA 1GJPA 1Q13A 3BPWA 4XO7A 1YNQA 1OABA 3T40A 3GHSA 2QUNA 3ARQA 4MLJA 6ENLA 3PZ9A 3BARA 1DL3A 2VGBA 4H9MA 1E0XA 3UQNA 3PF3A 4ATLA 3T2QA 4MHBA 5C7VA 3NVDA 1UZ1A 1EJVC 3KHJA 1KCZA 3NQ2A 4IX0A 1ISZA 4AZ5A 5I77A 3P61A 4KEVA 2HK0A 3P14A 3CIWA 3EWWA 1C29A 1U30A 1RD5A 5I09A 4GHRA 3TYAA 3OB8A 4JNMA 4PRWA 4GD0A 4IOTA 1B2YA 2PA6A 4HU4A 3P60A 1V02A 4O1EA 3T0CA 3WO8A 4LY4A 3GDLA 2IKJA 3EYPA 4GLEA 1FWCC 2OEKA 2XSAA 8RUCA 2XISA 3HPAA 3IUHA 3V1PA 2FZMA 3NUKA 4GUGA 2ATMA 1A5UA 2VDGA 2PODA 2RGLA 2O4MA 1OB0A 4H83A 1DORA 4NU7A 4IGNA 1R3SA 3MBFA 4ZO7A 3NO3A 2QQ6A 5I3HA 1ZJHA 3WQPA 1KA9F 3SJNA 2UZ9A 5CKSA 3L2MA 4XTIA 3VD9A 1WCGA 4UTWA 3FEQA 2YCIX 3VCRA 2I5IA 5HA7A 1XYZA 4F0MA 2VQUA 2AQWA 4JIRA 5AHNA 2ON3A 4JCMA 1L9WA 4KCWA 3UG5A 1RK5A 1OCQA 2ZUUA 4PMVA 1FWBC 1LL7A 2I17A 5CBJA 4P8XA 2ZZ5A 3G3DA 1KFWA 2IQTA 1PUDA 1VC4A 3MVTA 3C0JA 4DZAA 3WX7A 3NOYA 1Y8BA 3VU2A 3M5XA 2GL5A 1QVBA 3CQIA 3CBWA 4XD5A 2Y63A 3F4VA 1FRBA 3RPDA 2HRWA 2J24A 4AWSA 2H3BA 3GKFA 3NQ7A 3VOFA 4US5A 5M03A 4ADTA 2B4GA 4C1KA 3OPSA 3SR7A 4K6AA 3ZT6A 3VGFA 3MUCA 4QGCA 4DUVA 3WLHA 5LIXX 1RD6A 1KR1A 1XLFA 4Q7BA 5DCBA 4B91A 4KGJA 5KETA 2VTFA 1E6XM 1VFSA 1AL7A 4XZWA 3WKZA 4KMQA 1ONEA 1OX5A 5I06A 4PTNA 3H6OA 1KM3A 3EWDA 4TIMA 1FXPA 1E6NA 4G1NA 3B9OA 1YW1A 3L66A 5A8OA 1FCVA 3MI6A 4PUMA 3WIJA 3CUXA 3DFYA 8CGTA 4NHVA 4HZ7A 3WD2A 4F9JA 2WLYA 2WC4A 3D3FA 2GK1A 2FFCA 4UTKA 5K7JA 1JZ2A 3W85A 2YB1A 4QS5A 1XG4A 2E5CA 2EPNA 4HNTA 1AJ2A 5ABFB 3H2CA 4Y96A 4XZLX 4GINA 3PNUA 3B05A 4W7UA 1J6OA 3H2MA 1W3HA 4N9EA 4HZ6A 3AU2A 4S3KA 3QJAA 4J40A 2KX9A 3AYVA 4IL0A 1XW8A 4L9XA 1AG1O 4JTSA 3CL6A 1LUCA 1K9EA 4S3EA 3GSMA 3VMOA 4H8HA 1UG6A 3T0DA 3TN6A 3L4UA 1NEYA 2INZA 5DQPA 1JF5A 5IOBA 1YBQB 3U48A 3RX2A 3PZMA 1IT8A 1F74A 3A64A 2DIJA 3VNKA 1PYMA 2EPKX 2O55A 2PTZA 3RN6A 1CYGA 4K2SA 3L4YA 4QNEA 5CJNA 2B31A 2Y5SA 1XIJA 2NSOA 1WDPA 5GNYA 2O56A 2V6AA 3IV8A 1UKTA 5HMSA 2WJEA 1THFD 5EMUA 3VCCA 3WELA 2A2IA 4AZCB 3UG8A 2ZUSA 1QI4A 3CV2A 3KOYA 4N9DA 5CCZA 3B04A 2X1SA 2WJDA 2X1TA 3JW7A 4YYCA 3OBEA 2CC0A 3VIFA 3W88A 3UWQA 2BXZA 3V1HA 1S5WA 3VXGA 3VPLA 1F3EA 2RDXA 4GX9A 1IEVA 1IYXA 2C19A 3C3NA 4XVDA 1KC7A 2J79A 3SQSA 1UR2A 4RNFA 3DKLA 3ABOA 3I3EA 4JQ1A 4XBJA 2BZNA 1SO3A 2CLPA 3UPWA 4WOQA 3B4UA 1PIGA 3G3MA 4N4QA 3PTQA 5DLCA 3M46A 1XX1A 2Y8KA 1W1YA 4L1XA 4WSHA 2DY3A 1WZLA 1W3IA 2EKCA 3BXWA 1UJQA 4KKXA 4ORMA 2ISVA 5F2MA 3OVRA 5E93A 2TAAA 1RP9A 3RGTA 1W56A 3VIOA 1X1OA 3H23A 3Q37A 3LCIA 5DRCA 1XIHA 2DT2A 4A29A 1K4GA 4A21A 3MV01 3SUTA 1E56A 3COTA 2BY2A 3CH9A 6XIAA 3FW6A 1IE7C 1X1NA 4A3YA 1N82A 2A85A 4ZE5A 5I00A 4J3TA 3H4GA 3MZNA 5AFDA 3TLQA 4CQBA 4PCNA 5CC7A 1R87A 4AFYA 1HF6A 2G37A 4B92A 4KRUA 3WDQA 2DFAA 3STCA 4UNKA 3KVLA 3W1AA 4PMUA 2ACQA 3P0WA 4UQ9A 4PRRA 5F2IA 1YNYA 3FA3A 2AL2A 3EPMA 4RPPA 5G2WA 3DC0A 2H9AA 5CXPA 5AHMA 1MXGA 2VZOA 4MFEA 4BI5A 5BXPA 3UR2A 2GFTA 1ZBKA 1US3A 2QJNA 4A05A 4L64A 5DY2A 5FJUA 4WY0B 1GTEA 1H3GA 2WPGA 3W22A 1NOUA 5MKGA 3OLGA 2AMGA 4PMXA 3A21A 3MWAA 1EGZA 3AIUA 4GGBA 1ECQA 3ARRA 2EG8A 2VOTA 4Q32A 4XAYA 1XGDA 4JL1A 1FWWA 1FWTA 1X7IA 3SFKA 3I68A 3PUDA 1V02E 4FI4A 1UUMA 1YRRA 1DBTA 5CZJA 4HU0A 4QDPA 1IR1A 4RE3A 4RXGA 4Q22A 3GW3A 3AC0A 3VFLA 1XKYA 2PAJA 2RDUA 1TQJA 4G2DA 3CPUA 3WLTA 2PDHA 3NSMA 2VGFA 1F9CA 3VZZA 1UZHA 5D2YA 3HOJA 2NX9A 2WBKA 4I7WA 4GI9A 1JI2A 2FQIA 3C52A 2QCCA 4Z17A 2E8YA 4YTUA 4UOQA 3P82A 5LZLA 1E70M 1B4EA 4KQNA 4GBUA 4H41A 4HOXA 1HJXA 4AWTA 3G1YA 4GXWA 4AMAA 2DSKA 3ALFA 1JFHA 1VBJA 7XIMA 1IIGA 1EXPA 1KO0A 1ADSA 2YFOA 2O7QA 5DMLA 3QPYA 1NOWA 3VE7A 2ZRWA 4EXAA 3G0UA 3GR7A 3T2PA 3DFQA 3LNPA 5G4HC 1ZRQA 4DBSA 3ZMRA 3LSBA 1JPIA 1Q4WA 1SFLA 5LKYA 3GIQA 2B7OA 3GQYA 5CSUA 3RHGA 1Q63A 3RG6A 3IVTA 1J0HA 3UYIA 1JXKA 3R8RA 1SW0A 1S2CA 2YXXA 3H2OA 3CEPA 3QGKC 3WMLA 2IPFA 1IT0A 5C8BB 3CIVA 4ERGA 3N9RA 3B97A 4M6VA 4W88A 1XLBA 1K1DA 1XL9A 3UXKA 3KW3A 4LPCA 3DG7A 4Q8QA 3NO1A 3JUGA 3INPA 3WLMA 3C2YA 3QM3A 3IRDA 4E38A 5A94A 2GQ3A 4MJ2A 3L23A 3VABA 1QR7A 3NQ6A 3KVMA 3N11A 1F4HA 1H7NA 4DWSA 3TYZA 4ACZA 2J77A 1XI3A 1A5BA 3UA3A 5KTLA 1UUOA 3GIYA 2PLCA 3VYLA 2C8NA 3IJ6A 3UXIA 4NX5A 3UR7A 3IVUA 1B54A 4NL1A 4UIOA 3URBA 4X0NA 1I4NA 4E2VA 1BG9A 4CN1A 3N9SA 3WNNA 3WFLA 1WZAA 1QAPA 5A6SA 3TJIA 4EXBA 3KL5A 4AXKA 4DELA 4KPLA 1P1MA 3QVQA 3UWEA 4LF2A 1S3TC 1ZJAA 3EA3A 4HHPA 2V5LA 2VFHA 3WUEA 2FVKA 3WYZA 4GQGA 3REQB 1R9YA 3UNDA 1J0JA 3RPTA 4B3ZA 5AYYA 1GZGA 1CTNA 1LT7A 1OF6A 2MUCA 1XYLA 2INEA 2OKOA 5EBUA 4U10A 4O12A 2W62A 1L2QA 2WSKA 4R3UA 2PSNA 1J11A 3KX6A 1SJAA 1FP9A 1PSCA 1TV4A 3W2JA 4M1BA 5FAJA 5KZMA 1T96A 2F8QA 1TMQA 4ATWA 1B57A 3H12A 3HJZA 5D9PA 4RW5A 2I56A 1GOIA 3FGCA 4GY1A 1ZAJA 1R47A 3SCNA 1SM9A 3IARA 3PZUA 2NT1A 1CGYA 1FTXA 1AL8A 3CO8A 3CUZA 2X1RA 3QMSA 2QHAA 3QY7A 1VHNA 3UVIA 3OW1A 1QNVA 1W3JA 4MY8A 2UV8G 1E5NA 5A6KA 3FIGA 1W5MA 1XFBA 2QT3A 1VENA 1MUMA 1LBMA 1R3WA 3W2UA 1TV5A 5FEZA 1P0EA 2WMFA 4NJHA 4REQB 2QAPA 3TTSA 3WNOA 1G4SA 1MWOA 1T8QA 1X98A 1XIIA 2ZRXA 4M6QA 1OJXA 2FIQA 2XSBA 3RRAA 4DM1A 2Q8XA 4E4PA 3TQKA 1ADDA 2PDJA 4D1JA 4YL2A 1LQAA 1XBVA 4S1FA 1FWAC 1N8WA 4PRTA 1JCJA 1VAHA 1E6QM 1IR2A 1RQHA 1EJWC 1XG3A 1V3LA 3M0KA 1J0ZA 1KLZA 3BMXA 3W7RA 3GDKA 4XD6A 5H8PA 2VC7A 1G94A 3BSMA 3AIBA 2CZ5A 3P5YA 3N14A 3VIHA 4KWVA 3O15A 1W37A 1XBYA 1KCXA 3GTFA 3GXNA 3ARWA 2J7FA 4B5XA 2ZX6A 1RUSA 1DIKA 5CGMA 3EOEA 3L7RA 2Q8LA 2TYSA 2ABBA 2TODA 3OQEA 3TW6A 3Q2DA 3CT2A 1K3UA 4IPNB 4LSBA 5ENLA 2PWVA 2HDJA 1TG7A 3XINA 2NQHA 1IGSA 3G0SA 3IWPA 3NZPA 3S2NA 1GUVA 1OX6A 2J8TA 1JDFA 3PP7A 4KRZA 5I23A 1FXQA 3QW4B 3R10A 1WP6A 1BYAA 3ARSA 4MB5A 2PP1A 2YDSA 3AUJA 4NKCA 2QYGA 4ZOAA 1E9YB 1IWPA 3SW6A 5E1QA 4JZ5A 4XZHA 1DWIM 1JD7A 3T81A 1MNSA 4V33A 2ZC8A 4LYQA 1VFFA 4Q33A 2V0TA 5D02A 1JPMA 4N9CA 1VYPX 3W7KA 3BQ6A 1FHDA 4DZHA 4QE4A 2XIMA 4KWWA 4MWAA 4HCDA 2C15A 4YN5A 1MXDA 3BCJA 2YXGA 4H9XA 3U2ZA 3SCVA 4EACA 4PR4A 1R7OA 4LRSA 4OHQA 1DWHM 1NDYA 4NILA 4G1KA 1GEHA 3G1DA 1H61A 3DXIA 7ODCA 1V6XA 1OG6A 3E1F1 2PURA 1UP0A 3CASA 4G5DA 2V3EA 2ZA1A 3MSDA 3GG7A 4Q4OA 4R88A 3UXAA 4U2ZA 3S0CA 4GUIA 2VRKA 2QJGA 2PU1A 4R9OA 3OYZA 7REQA 4DJFC 2EG6A 4NRSA 4XUGA 4XD4A 5C9WA 1UWAA 1RQBA 5I78A 3W7DA 4HSNA 1Z3NA 4FIRA 1GW9A 1NU5A 1M1BA 3APGA 3THDA 4L4LA 3GW0A 2G3MA 3ITLA 4Q6JA 2QPUA 1M68A 3KVKA 2P0OA 1JQXA 3I6EA 4WKFA 4CQ8A 4DPPA 4W7VA 1UD8A 3E5PA 3NM1A 3UY7A 4C6KA 1UBSA 5HXMA 3S83A 2IKGA 3WZ0E 1A5SA 4A2RA 2R1PA 3Q45A 3UJFA 4DBUA 1NP0A 4H1ZA 3LRLA 3NQ8A 3I6TA 4LCRA 3ANYA 2C3ZA 5I3DA 4HNNA 1HUVA 2NLYA 1D8CA 1V79A 1ZP4A 2KZHA 4WZHA 4E3VA 3T9PA 1DXIA 4B5TA 5E0KA 2GJXA 3DESA 4HU8A 1E9LA 2UBPC 4RZ4A 3OIHA 4XG1A 4H6QA 1U1JA 3TXZA 4IQDA 3AHVA 1KQZA 2VYOA 5LXXA 3M0JA 2GJLA 4C6CA 2PWFA 4CCDA 4C6FA 1EWEA 3RU6A 5IDIA 4E8CA 4YVXA 3VNDA 3USZA 1BSLA 1GJWA 1YQ2A 1V0LA 2FLIA 4LBSA 1X96A 4DRSA 4Z0JA 3IAQA 2EBNA 5JIPA 1IF2A 2FDMA 3WUBA 3VCNA 4ZA0A 3CHDA 1J9YA 1AVAA 1I8JA 2BOFX 3LU2A 2OGYA 1Z89A 3TTOA 1ZCOA 5C9UA 4H9ZA 2E68A 4FPSA 4Y9AA 3DC8A 3U0HA 3BQ5A 2YJQA 3STFA 1CDGA 3AZSA 3DYOA 1QASA 3GH5A 6CGTA 4PEKA 2ZKMX 1GVYA 3N25A 7TAAA 1VFTA 5AN7A 3PZQA 5BWAA 1BWKA 4WJ8A 1CZ1A 3TEVA 3ITGA 3NPXA 2ZZ3A 4DXVA 5D2TA 3P80A 3B8UA 1XCXA 2Z2UA 3GX9A 1G0CA 3T8LA 1WXJA 2JEQA 3CUHA 1SSDA 4LVFA 3QV6A 4D71A 3OA5A 3ZJ8A 1LM1A 2NQ9A 1W5QA 4NYYA 4KW2A 1F3WA 1UR0A 3A24A 2J13A 1VYRA 2NXHA 2WAGA 3TAOA 1S38A 2C16A 3GVGA 3TTQA 2ZX5A 4XK2A 3H54A 1K6WA 4UCFA 1RJRA 4XBSA 5BMWA 3G1XA 3JZEA 3TH6A 1X6NA 4QG6A 1KBIA 2OEMA 4DJDC 5D8WA 1EHAA 3I10A 2WKLA 1FWRA 1B31A 3GG8A 1C91A 3E0FA 3MB9A 3E2RA 2YOCA 2Y6ZA 3WQ6A 1SSGA 5LIUX 4QCEA 4L6HA 1FBAA 1VJZA 1E9IA 4F79A 4ALDA 2GSJA 3SRHA 2OMAA 2WWDA 1TV2A 4ZE4A 2YCLB 3P6LA 3HO8A 1OIMA 3AXIA 3BGJA 2NW0A 1N7KA 3GFXA 4U28A 5CGTA 2DIKA 4YHEA 5BOEA 1K6AA 2Y61A 2O9PA 4U3AA 1HKVA 3CV1A 4AD1A 4IQJA 1I1WA 2RKXA 5A8NA 3CZ8A 1E0TA 1XF0A 2PGFA 1Y0EA 3DHDA 3NM3A 3ZR4A 3VD3A 3MMTA 3WLOA 4HB7A 1CEOA 2NT0A 1UJPA 1Q6FA 4H01A 3I3BA 2ZIDA 3CLMA 2NV1A 4GA8A 3HMJG 3CUFA 4X9SA 3JVAA 4GH3A 4WQ6A 3W1RA 1D3CA 5LHEA 1Y5VA 3EMCA 3HIJA 3IK4A 5BZAA 3NGJA 1ZFJA 3S6TA 3MV11 1H0IA 4PZVA 5LA1A 1P5BA 3CEUA 3U9IA 1M53A 2AGKA 3ES7A 3WY1A 4L4OA 2I57A 4PTWA 1QFEA 1KLYA 3B9AA 4I90A 3BV4A 2VO5A 3CB3A 1GOWA 4S3DA 3UWWA 3GDTA 3R8GA 1VLIA 3HFYA 4QLKA 4KFOA 3GXMA 1PJ9A 1DXEA 2F84A 3S5SA 3M0VA 1BQCA 1GKRA 1WV2A 5D2WA 4J27A 1I60A 5DF0A 2DQXA 2DSWA 4HCHA 1SZGA 3GFYA 4O8AA 3AZTA 2D22A 2R9RA 3ZOAA 3HM7A 5C9XA 1XRFA 1NDVA 1HFBA 2FPYA 4IFKB 4LC6A 2GJNA 2VZUA 1CXLA 4J3WA 2FHCA 1I2OA 2QUMA 2REQB 3W53A 3B8DA 3WMCA 1KTNA 1C9WA 2QPSA 1D7KA 3FX4A 3TK7A 1DQUA 2SFPA 5FESA 4ZGYA 4M6UA 3PAJA 7ENLA 2VEKA 1XFCA 2WZMA 2ZX9A 4GG9A 2OZ3A 1TPC1 1EP3A 5HMFA 2C1GA 4AC7C 3LGEA 3QQ0A 1XLMA 5G2IA 4TQTA 1HP4A 4E2BA 2ZUVA 1LOSA 3V35A 4HVXA 4W5ZA 4B4FA 2PEVA 3LBOA 5XIMA 1Q6RA 2B7PA 3UFYA 3LHTA 1OCJA 3VOGA 1EB3A 3C56A 3CAWA 3CYJA 2PC8A 4XAGA 3BUVA 2QF7A 3P2VA 2WOQA 3P0XA 4S3AA 3PJWA 5A6BA 4GVFA 4O16A 3GDBA 3ITYA 4S3CA 1E40A 4CU6A 1TPEA 2VC5A 3AAMA 1DJYA 1XDMA 2OYMA 2WHMA 3S9YA 5I3FA 4EXQA 3AHYA 2DEPA 1IEXA 4PUDA 4ZSUA 3W2LA 4A6GA 3BJSA 4JNZA 1QO2A 3KAOA 2DT3A 3AYSA 3L0KA 1IGWA 3QR1A 2O9RA 2G3FA 3CPGA 3BAWA 4QM1A 2GGEA 2VDIA 2IKIA 1HKIA 2PWHA 2VFGA 1KRBC 1F61A 1EX1A 5FJRA 5DBTA 1R0MA 3OLEA 3RR1A 4O50A 4TO8A 3EA2A 1KCKA 3CH0A 2VCCA 2FZ9A 3G8RA 3STPA 2H6RA 1HXJA 4FOUA 4ROQA 4ZQMA 5DMMA 1MUCA 2F9RA 1PDYA 1GZJA 3H2AA 1GOXA 4JDBA 4K39A 3OLDA 4MDOA 5HQLA 4LRTA 4MNJA 3GU2A 3HG5A 4PE8A 2IKHA 2CCRA 4A8LA 4L9ZA 4Y8EA 2BP1A 3THAA 2ZWZA 5A6JA 3IACA 6ALDA 3B4YA 3W7GA 1VFMA 4BQ4A 4OJYA 4YTTA 1JCXA 5E0FA 4FNPA 3N15A 3K8MA 3W1UA 4AAJA 1GJUA 4XX6A 3Q67A 5BXTA 4HMCA 2J7HA 2BWGA 3TIMA 1XRTA 1JZ4A 4AF0A 1E15A 3PPFA 4C90A 2ZUNA 2VWSA 1VBRA 1VEMA 3DX5A 3WNKA 5AZ0A 2QGHA 1BYCA 3AYTA 1VJSA 2C1HA 1GEQA 4A22A 1GQJA 4KWUA 1CLVA 1FOBA 3WMBA 4GY7A 1UA3A 3OHMB 1EOKA 2AAAA 3A3HA 2DZPA 3B0VC 3S47A 3IJ7A 5TQLA 2PD5A 4FZIA 2WCSA 5IRPA 3TX9A 1PKYA 4JXCA 1RV8A 4WY0A 1E4IA 1EC9A 2PLJA 1HJUA 1VBGA 4AD3A 3DFHA 3MCNA 2DUXA 1Z69A 4GY0A 3CZEA 4EF9A 2PGEA 1VLWA 4C6LA 3DHFA 1FWNA 1ZS2A 5HJYA 3PWIA 2PDLA 2JF7A 3I7SA 1Z8AA 4KRTA 3GBEA 4QJ5B 3BO9A 3SGUA 4LAOA 3WF2A 1S2VA 3QV9A 4PFMA 2ZBTA 9XIMA 2WWCA 1TE1A 1UOZA 3C4UA 2BS9A 4DPQA 4X60A 4FX7A 1PTDA 5FI8A 1H7PA 4FEZA 2BOGX 2YBVA 2L5HA 1OC5A 3OGRA 4QDMA 3WCZA 3VDAA 2WNNA 1EXBA 3G5EA 1DIEA 3TWBA 1FWGC 1JNEA 2DORA 2E6AA 1DE6A 4FXJA 3H26A 4AUBA 3G8EA 4JN6A 3WH8A 2QDGA 4JFVA 1XLGA 3H53A 1NQKA 4FLQA 4AC1X 3BLOA 1W0MA 1FWEC 4LC8A 1FH7A 1VBHA 4F2UA 3EGJA 4B3KA 2ZOXA 4POCA 1WNOA 2A7RA 3E2SA 3IPWA 4UZSA 3O7UA 3SB0A 4AMCA 3GZAA 1XGEA 2QNEA 1UHVA 2XIJA 1RJPA 4ZQRA 1QT1A 4IJRA 2HBXA 5KZEA 2E1DA 2C14A 1FA2A 4RDWA 3VGEA 1US0A 3CL7A 2O9OA 3WLLA 4I9MA 4XB3A 3D3AA 1EP1A 4MY1A 2WJZA 3W7HA 4BF7A 1O66A 3VIIA 2ESCA 3DG3A 3W1TA 1B3XA 3LQGA 4LTSA 3GNOA 1A80A 2A79A 4ZL1A 3CQHA 3EX3A 5A95A 3LHWA 1OFPA 4RUBA 2Q01A 2VEPA 3T78A 3T6CA 3TN3A 4HK6A 2EKGA 3LCHA 3WLKX 2R91A 3ZVHA 3VI2A 1W3KA 1Z7AA 3SZ8A 3IIXA 2W5FA 1R3QA 3O0KA 3PUOA 1REQA 2KAUC 4LFYA 2XWDA 4JL2A 3MI2A 1YYAA 3RNDA 3RRXA 4IUOA 3T0TA 2Q02A 4GYKA 4ZBCA 2G3IA 4F4RA 4WDXA 1J2WA 4JIIX 4MUPA 3W7JA 3ONCA 1QNOA 5EMLA 1VPYA 4JYDA 3EEGA 3OZMA 3M64A 1J6PA 1XSJA 3BL3A 3HQNA 4KERA 4LYPA 1BTMA 3EWYA 3RJXA 1EUNA 1SW3A 3WBWA 1EGVA 3OVPA 2WHJA 1JCTA 3GU1A 3HTWA 3NXLA 3CWHA 6TAAA 4IT1A 3OGSA 4DX3A 1FP8A 1BWVA 2Y62A 3W76A 4US5D 1PS9A 2WKJA 1ZTVA 3AMCA 4GBDA 1E4NA 1WKYA 3B3DA 1N8IA 3CZGA 1HKKA 1U22A 3PBYA 2A0NA 1BAGA 3H22A 2OT0A 1TCMA 1LT8A 1E6SM 4KGLA 4ZMGA 1RH9A 1Q6GA 4GFSA 4XZMX 1UCWA 2CKSA 3ORWA 1JAKA 4YCOA 3BAIA 5HWJA 4KF1A 1SO4A 5J8LA 1ME8A 4IM4A 3QV7A 1VS1A 5E6YA 4G6CA 3BLIA 5DBUA 3BICA 2OX4A 2IUZA 2PDPA 2YKKA 1LQ2A 3ANUA 1ZCCA 3L4ZA 1GQLA 4PUNA 2WSYA 4REQA 1IXPA 2D1ZA 2C18A 4EK7A 3QN3A 1C8QA 1OC7A 4EF8A 2H8ZA 4MGGA 2ALDA 4I7VA 4ZVJA 1GORA 2PE4A 4WVXA 3ZSTA 1M01A 5K3VA 2R8WA 3M7WA 1VPXA 1EHNA 5DX7A 4TTGA 3H8AA 4YTRA 2F61A 3GHTA 5F4XA 3BCFA 3BMWA 2OCZA 4DI8A 5IHRA 5K2ZA 2EPOA 5JH2A 1CIUA 3OP2A 4Y2WA 4Q4MA 4Z0SA 1ENUA 4QJ1A 3WH9A 5H8UA 3R2GA 1RSCA 2GGHA 2JFEX 3MP5A 3NEHA 2O9TA 1I2QA 2PRHA 3EOSA 2QCDB 1VCVA 3CTTA 2ZVRA 2XVGA 2B0MA 1TWWA 4F0RA 2O92A 5EMKA 3KBJA 4HMDA 4YS1A 4WKHA 3LPGA 1O6IA 2Q3OA 3APTA 1VZWA 5FF4A 4LUSA 5TIMA 2YLLA 1GPFA 1QPKA 1XLJA 1XC6A 4HMEA 5A2CA 5D05A 2A3LA 4F48A 3VD7A 2P76A 1I2NA 1QBBA 2X09A 3WL0A 5GJMA 3FY1A 2J9XA 2Z0IA 4NAEA 3SN1A 1MO0A 2GVJA 1TV8A 4PB3A 1K8XA 2XN1A 4FB7A 1XINA 1AW2A 3W6YA 3QY8A 2BNJA 3AIRA 5DO8A 3N4AA 1JUBA 5GJPA 4GZIA 1BD0A 3VC6A 5TF0A 1LBLA 1SO5A 1XUUA 4DYJA 1ZBWA 4ZO6A 3OGVA 5REQA 4M51A 2WW5A 3ZJ6A 2FJUB 5EY5A 2Z6IA 4O10A 1R3RA 1B3YA 2WNWA 3GG1A 3SGZA 3WLQA 1A49A 3GNXA 5HINA 3T0BA 4WSJA 1RQEA 4PFHA 4B2DA 3PG9A 3AU6A 1GG1A 4ICNA 1GQKA 3F2CA 1XLHA 3ARVA 3PBVA 4HPXA 3UG4A 3TA9A 2O7SA 5GNXA 1DJQA 1UA7A 3AHXA 5GJNA 4P2VA 1FWFC 1YPFA 2G0WA 1V93A 4HMNA 2B81A 4BY3A 4MM1A 1ECEA 1B0IA 1XYAA 3DFPA 4UBPC 3CHVA 1NTHA 4YVPA 4YXGA 2V38A 3EPNA 3GDRA 3M6DA 3BCDA 1YADA 4IMGA 4M82A 2XFFA 3W75A 1TJRA 3UP8A 3UVAA 2Z7KA 2CERA 2OKTA 1LLOA 4J28A 4DZ5A 1ZBVA 5HK4A 3EMZA 3N6JA 1ZGDA 3S9IA 1H4PA 5I5RA 5K9XA 4JQAA 3L12A 3TN5A 3O63A 1KR0A 2VHLA 1ONXA 2D0FA 1V3JA 3F4NA 4GZEA 3MMDA 1C8YA 1JCMP 3PZIA 5AYXA 1YHTA 4AHOA 1PDZA 5LIYX 4WR3A 4H7CA 3QXBA 4DJFD 5G1TA 1YPIA 3YPIA 4OIFA 3OYXA 2W27A 3W4RA 1EX5A 2XJ7A 1Q3NA 5AECA 3K2GA 4UZUA 4UTUA 3UCCA 3ZM8A 1ICSA 1D8WA 1K7EA 1E1EA 1HO1A 1V3HA 3DI1A 3IGUA 5RUBA 3QR0A 1HZYA 3GC4A 4W9TA 1KM4A 1L6WA 1EPVA 1UQYA 3A12A 4BZYA 4PCSA 2PRLA 1G6CA 2ZXAA 1W9XA 2DVXA 1KD0A 3POCA 3SN0A 4AG0A 1GZ1A 4IPPA 3SQMA 1QW8A 3P81A 3RPMA 3GH4A 3PB2A 3A47A 1SGJA 4HSHA 1XDJA 3FS2A 5A6LA 4WJXA 3W07A 4ZQOA 1E1FA 1F4AA 3CPRA 3MUAA 1RALA 4TX8A 5AC4A 3TJ4A 1KTBA 4B5UA 1HT6A 3L2LA 2ZX8A 3AIWA 4CCCA 4S2BA 1PIIA 1JULA 3LBCA 2OLHA 3TZNA 3QZAA 2WHKA 2Y8VA 2R1LA 3WD1A 4PUWA 2A6LA 2EG7A 3S5YA 1K03A 3WDRA 2Z24A 4J2MA 1X38A 2I16A 4LYKA 2QIIA 4NAFA 5CZ0A 3LTSA 2OWXA 4Q7NA 4PUUA 3IUDA 2JKEA 1OEPA 2Z26A 3DEQA 3AIEA 5CGQA 2WVTA 1MMFA 2VRQA 3SRKA 1U5VA 1LTDA 2YCEA 2OVLA 1PWLA 2GUYA 3IANA 4GCAA 4JD4A 3T44A 1J2BA 4IIHA 2XGBA 1OT1A 2BXYA 3LN3A 3K8LA 2YCLA 3SIZA 3GLCA 3H7VA 2NXIA 4DWSD 4TVUA 5CZKA 2VZVA 3LCXA 1A3WA 1CENA 4HJFA 4HNVA 4EPDC 2MNRA 3D0CA 1YDYA 3LA4A 3POHA 1TX0A 4A4AA 2J62A 1EP2A 2YCJA 3ATYA 2GVLA 3NDYA 3VKJA 2ZE0A 2Y2WA 2E4TA 1WKFA 1UYQA 1E0WA 4WKAA 3S9ZA 4DJDD 1JGIA 3R58A 4Y9MA 1DJHA 2P53A 1V0KA 1YDOA 4B90A 4HA3A 1RK6A 3NDZA 4Z2IA 2OG9A 1XR2A 1HJWA 1FCUA 1QI3A 1GG0A 2EO7A 2QDEA 4X2PA 2P5NA 1OC6A 2VX7A 1XS2A 2XFWA 4O8RA 1LWHA 1E9ZB 4IFRA