1LZOA

Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
b'RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Structure of the Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex in two crystal forms: characterization of catalytic loop open and closed conformations in the ligand-bound state
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 89
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1lzoA00
3ZS4A 3P74A 4TX9A 4YMZA 1A53A 1SW7A 4A2SA 2VOMA 2AGKA 2PCQA 1XI3A 3OG3A 4Y8FA 5T26A 3MUXA 5CZTA 3HGJA 1R2TA 3HJZA 4LVDA 4M7TA 3NO5A 3IVUA 5F2MA 3T78A 1EPXA 3MW7A 2OMAA 3W23A 5D2XA 1CI1A 1MO0A 1XUZA 1F7BA 3BGJA 2GQAA 3TDFA 1VS1A 4HHPA 3BO9A 3UY7A 3MYPA 3G1YA 1IF2A 3PUDA 4QM1A 2JKPA 2GVJA 2E77A 1TPH1 2DORA 2V82A 4KFOA 3O1NA 3GIYA 1G69A 1VYRA 1P4CA 3LRLA 3N2MA 5C6MA 1MXSA 3B4UA 5K7JA 2WSQA 3E96A 5FESA 2LLEA 1OK4A 2ZRUA 4Z0SA 3G0UA 3TU9A 3W1RA 3SZ8A 3E0IA 1AL8A 3KRZA 3BVJA 1S5TA 1OG0A 1WBHA 1I8JA 4MZYA 4CCDA 3C2RA 5EKYA 3C0JA 3G3DA 1ICSA 4ZQOA 5DY3A 4MPQA 5K2ZA 3NPUA 5KSWA 3UWVA 2EAWA 3UWYA 2FB2A 4FNPA 3W75A 1EWEA 1T99A 4XQ6A 1VCGA 3DI0A 4KWWA 2EF9A 1UCWA 3S8HA 1W5QA 3P62A 2Y88A 1UUMA 1OHLA 5DCBA 1K8ZA 1PE1A 3W74A 1KM5A 1O4UA 3GNDA 3O05A 3W84A 4BI7A 3O6DA 3A23A 5FEWA 2V0TA 3M41A 1AW5A 3M1ZA 4QIUA 2NUWA 4O11A 5G2HA 3TKFA 3USBA 5I3KA 3W72A 5D03A 3TJLA 3LBCA 4B5NA 2Y70A 1LRQA 1J5TA 3HBLA 3LHYA 2DU2A 4RJEA 1FCVA 3M5YA 1JQVA 3TQVA 2YW4A 3HPSA 3CB8A 2ZA2A 3EWZA 1VCVA 3LTSA 2YR1A 1EB3A 5TQLA 1KFLA 4NQ1A 4NJHA 4E38A 4O54A 4UMAA 5AYXA 3L5AA 4RV8A 5D2WA 4JR5A 2FIQA 2Y63A 1VR6A 2NXHA 1TPVA 3S1XA 1JQXA 3OVPA 3QYQA 3HG2A 3A5FA 5I3IA 3QW3A 2WV8A 2YYUA 4UFKA 1S3HA 1QOPA 1VCFA 2V5BA 4PL1A 4UC5A 1TJRA 4GXMA 1XBXA 2E6DA 3G1SA 4BK9A 2WO5A 3DFSA 3W1NA 3W86A 2J24A 3L0GA 1NVMA 3SW6A 3MYOA 1R2RA 4GE8A 2PE4A 2XFWA 2ZZ1A 3R89A 3LHVA 5J5DA 2CLIA 5F2LA 2VFEA 1TYGA 3BGGA 3RF9A 4ICNA 3DKLA 3S1UA 5HMSA 4JTTA 3I68A 4FXRA 2E68A 3STFA 2V2CA 1F6KA 2O7SA 3FKRA 1XBVA 3O07A 4L4LA 1G4SA 5TBOA 3NQ2A 2E1DA 4NNBA 1GOXA 2D73A 2X1TA 4MFDA 3W2MA 1FWRA 1JCLA 3L21A 3W7OA 3DHDA 3EWUA 3B04A 3W71A 2ZZ7A 1W3IA 4Z1AA 3IRDA 1TPDA 3GK0A 5IBXC 4NZFA 2P1FA 3STEA 3SFKA 5IM51 3N19B 3QMTA 1VPXA 1J4EA 4LTSA 1OFPA 3G1XA 3MP3A 4JY8A 1RQBA 1GEQA 4ORIA 1H7XA 5ABTA 3GZ3A 4OU1A 3GNNA 3RK8A 2A7PA 3KRSA 3RLVA 1OFEA 4MVAA 2QDGA 3CC1A 4UIOA 3NNTA 1LOLA 3KFTA 4WQ6A 2WPBA 1I2NA 1OFDA 1M7OA 1YDNA 4KFPA 2NXIA 2QCLA 4XKYB 4CNPA 2YGYA 3CIWA 5F1UA 3DH7A 4PL2A 2R91A 3FYOA 4DBEA 1EA0A 1SSDA 3CWNA 3KXQA 3MP4A 2HS6A 4AWSA 3G18A 2RDUA 5AYZA 1G4EA 4GUFA 1ZENA 1OABA 5BOOA 1FXPA 4JTFA 3W2UA 1XM3A 2YZRA 3GKAA 4LUJA 1WX0A 4A2RA 3NGJA 3R13A 3KHJA 3PF3A 4UTUA 4Q33A 1KM3A 1GYNA 1QOQA 4HPXA 2Q8LA 4XBSA 2DJLA 2VELA 1QO5A 4YWIA 3NM3A 3C2VA 2ZBTA 1G67A 4MZ8A 1TMHA 3D0CA 2B7QA 4FEZA 4AVFA 4GFSA 3DBPA 3CHVA 4AHQA 3PC0A 5U7SA 3W83A 3W3OA 3QW4B 3M44A 4U4MA 1SO4A 5G2WA 3TFCA 3DXIA 5IBXA 4NVTA 3WK1A 2CZFA 2DZWA 1Q6OA 1UJPA 4QJ1A 4N9CA 1K03A 3W1AA 3PR2A 7TIMA 3P8IA 4O57A 1CX9A 3MWAA 4FNQA 5KTLA 1EUNA 3I7SA 4WUIA 4BFAA 4H3DA 3C56A 4FNSA 2WNQA 1VH7A 1H61A 1W5NA 2Q8ZA 2EKCA 2YYTA 1I45A 5L9FA 3W22A 3ZR4A 4KWVA 2DZTA 6ALDA 3RLUA 2FFCA 3MI6A 1RPXA 2YCEA 4UFMA 2UV8G 3W7RA 5FF4A 3PBWA 2DZVA 4CQ9A 3I6RA 1K7FA 1SW3A 1K7EA 3C2FA 4IX0A 4KKXA 1KTBA 3UWZA 4A29A 4K7VA 1H7WA 4JDYA 2QAPA 3PS7A 3F4NA 4MLRA 4Z1BA 1RQHA 1QR7A 4LU0A 1W5OA 4K8EA 1OF6A 3KVMA 3LV5A 3GXPA 4O14A 1ICQA 1EP1A 3PM6A 2X2GA 2V5LA 3A24A 4YXGA 3I65A 5AYYA 3NQFA 2DZPA 1KFCA 4M6QA 2ZTJA 2YPIA 1FWTA 3MO7A 1U5JA 3PBYA 1W5MA 4JNMA 1TO3A 3W1MA 3HO8A 3BG9A 3TMQA 1EP3A 1HL2A 2V30A 1I2QA 4O12A 4MYAA 1RR2A 4XTIA 1JR1A 1JCYA 4YCPA 3M5VA 1H7OA 1XBYA 2BLEA 3UPBA 2QCHA 2WNZA 4NU7A 3TXZA 4X3ZA 4ZQPA 5DXXA 3C2EA 3QQ0A 3W88A 4FF7A 1A5CA 1LBFA 1DVJA 4Z08A 3W7LA 3NAVA 4EIVA 3L66A 4D2JA 3NXFA 1V7YA 3C52A 4LS0A 5CPLA 3LLFA 2YDAA 2NUYA 4YCOA 3EB2A 1MSSA 3W2NA 3UWWA 3CM4A 4O52A 3B8DA 3E12A 1NEYA 4KFNA 3L5MA 2GVGA 4ONVA 4O19A 4NJJA 1DHPA 1KFBA 1W54A 3TR2A 2E5CA 1YADA 1TREA 4HNNA 5LHEA 1YTKA 3OEXA 3Q2DA 4JX6A 3WJZA 3S42A 4RKAA 4LS1A 3UNDA 4ADSA 3S0CA 3G1DA 4O10A 5EA9A 3PBUA 3QQ1A 1ME8A 1W5PA 1XUUA 3P8JA 3OBKA 5LKYA 3C8FA 4UTWA 4HNTA 5AHLA 1HO1A 2YW3A 3MI3A 2GVLA 3GB6A 1TPEA 3C4UA 3S9YA 1TTIA 4K37A 4UFJA 3GYEA 2VEIA 3LCLA 4PA8A 3TQKA 5D04C 3S6DA 2OT0A 5LNWA 4GNJA 3ATZA 4P61A 4Z1CA 2JKAA 3LHWA 5C54A 2Q3OA 2Y7DA 4O8RA 1HFBA 2A85A 3DHFA 1UUOA 3HOJA 1FQ0A 2CZEA 3EXRA 1L6YA 4JS3A 3UWQA 3GDRA 5LNSA 1IXOA 3LCIA 3W7EA 1JRCA 4IWWA 5D2TA 3PAJA 2E09A 1XDMA 4GUGA 1EUAA 3B05A 4R34A 3UQNA 1T0OA 2B7OA 4GUHA 3O6CA 3W6YA 3H54A 3EWXA 2Y7FA 1TPB1 4LV9A 2CLKA 1QO2A 2GUUA 5CZJA 3VFLA 1S5VA 1OX4A 1IIGA 5FEZA 4N02A 3CLMA 4NX0A 3WJSA 4LVGA 1VHNA 3NM1A 3TW6A 1C29A 4UFHA 1PL9A 5CSRA 3ATYA 1LORA 3LI1A 4HT3A 4WD0A 1H7PA 3TMLA 3R5EA 5A8GA 3GR7A 4O0KA 1K02A 1T96A 4Y90A 1LTDA 4O17A 4JTLA 3SR7A 5KITA 3GLCA 4MFEA 1TRDA 3P60A 4DPQA 3ZWTA 1VC4A 3QZEA 1TV7A 3S5YA 2CLMA 5EYWA 2A7NA 4UUIA 2OCZA 2WQPA 3NL5A 3RU6A 1KTNA 4RXFA 5AHIA 1SW0A 5HQEA 3U8GA 2X1RA 4TIMA 1XFBA 3WK3A 1QNVA 3G0SA 3L68A 4AF0A 2G95A 4Q32A 3CWOX 1FXQA 3G3MA 3TK7A 2ZFAA 3NVTA 3TH6A 2VENA 2A5HA 2A6NA 3PWAA 1W37A 2ZTKA 4DPPA 4CLMA 3QPYA 1WOAA 4BI6A 3W1XA 2NZLA 2OT1A 4ZQNA 1LOQA 4I9AA 1W3TA 3W2LA 3W9ZA 5I3JA 2NV1A 1KLZA 1FWWA 1NSJA 3CEPA 4HSNA 3LM7A 1GVOA 4QISA 4NXKA 4C1KA 1QMLA 4WXZA 4RK8A 1MEWA 4ORMA 3C6CA 3LGEA 4FNRA 3W1LA 5F2IA 3L9CA 1G7UA 3ZWSA 2X1UA 5HWNA 2C0AA 4MKNA 5BMWA 3LCFA 4M6VA 3CPRA 2PURA 2NWRA 2E5DA 4MJMA 1PHWA 3ABOA 3KX6A 3W2KA 3W7NA 1DJNA 5HR6A 2H8XA 4DF1A 5HUOA 1TQJA 4IMGA 4XKYA 4MZ1A 5BNKA 2I14A 4A21A 5HWJA 1YYAA 1JJKA 5EL1A 4FB7A 2GQ8A 1SZNA 3QSRA 2FLIA 4I7VA 3PG9A 5LNRA 5DCEA 3GR8A 3O06A 5CGQA 3EWBX 3P7YA 3P5ZA 4ZQMA 4LNYA 1OFRA 1RVGA 4N4QA 1OFAA 2Z1BA 1TTPA 1W8SA 1AW1A 1N55A 4MOZA 1G6CA 4OE7A 5D38A 2GJLA 2H3DA 3C61A 4OGZA 5D32A 4O1BA 4UNKA 1ZNNA 3F03K 3W1UA 2NLIA 1E51A 2XN0A 5AN7A 3THQA 2FPYA 2VEPA 1O5KA 5I3GA 3L2IA 1X6UA 2VXNA 8TIMA 4BF9A 3I7RA 2QCEA 2BXVA 1WDWA 3W7DA 4J9JA 3IGSA 1GG1A 3LB0A 3EX6A 3ANYA 1OX4B 5HNRA 1N7KA 3E49A 3PB0A 3EX2A 3B06A 5CKSA 3RMJA 3NR0A 2C19A 3AO0A 1ZAJA 5D02A 1AW2A 1B4KA 3N14A 2E6AA 4S2CA 2QUUA 4L4MA 4O4WA 3HB9A 1FUYA 2QJHA 1S5WA 4IMEA 4FX6M 2ALDA 2C1HA 4QNEA 4DEFA 5HWMA 4UTTC 1DBTA 2QDHA 2ABBA 3IEBA 2ATSA 5F4XA 5D30A 4N6EA 5C5YA 3W7GA 3WK0A 3CT7A 4HNUA 2QCFA 1EWDA 2P10A 4PFMA 3BG3A 1ALDA 3S1WA 4LVBA 4Z1DA 1A50A 4AF0B 1Z48A 3LXAA 3NEVA 2FTPA 3NPXA 1ZY9A 1LCOA 4FNTA 4TMCA 4A22A 2GPTA 1D3GA 2X1SA 4TO8A 1ICPA 3IIOA 1BEUA 1VHCA 1OFBA 3QMSA 2Y89A 1T8XA 2ISWA 1G4PA 3KOFA 2HTMA 1X1ZA 1QPRA 1U83A 2WNNA 3V75A 5AC7A 3DAQA 2WSYA 3GX9A 3C2OA 4RZ5A 3EWYA 4WY0B 4NJGA 3U2OA 4LS2A 2JKEA 4ZQCA 1KFJA 3LBMA 1KBIA 1ML1A 2NWSA 4O1CA 4BWLC 3FJLA 1TPC1 3CTLA 1YDOA 2HS8A 1L2UA 3LCWA 3DI1A 4DF0A 5KZDA 1LYXA 1VQTA 2A0NA 3OIXA 3G1HA 4UTTA 1QPOA 1Q45A 4GC4A 2CU0A 3VKJA 1ZALA 3T7VA 3EWWA 4FHAA 1Q6LA 3LHTA 3P82A 1R46A 1DQWA 4X22A 1F76A 4HNVA 5AB3A 1K8XA 4LRSA 4WJEA 2C13A 4UTHA 1IIHA 4QSHA 3MBFA 1TTQA 3BLFA 3HG4A 2VFDA 1YTDA 1GTHA 3IVTA 3R2GA 2DP3A 3JRKA 3W1TA 1ZAIA 3BPWA 6TIMA 2YFOA 4JTSA 1FX6A 1EEPA 1LOSA 5EPDA 1LLZA 3TNOA 3FKKA 3EEGA 4WOQA 2TRSA 3A22A 5KMYA 1YTEA 2VFIA 3P80A 5FEPA 5K4ZA 1KW1A 3TIMA 3HGSA 3LV6A 4TR9A 4IOTA 5DN1A 3B0UX 3SGZA 1B3OA 3LHUA 1GTEA 3BW3A 4MY9A 5AHNA 1YDVA 2QCCA 4I7UA 3ABQA 3H55A 2QR6A 5DBUA 2ATMA 1QAPA 2H90A 1LRNA 3ELFA 5J5RA 4BWLA 4MJZA 4X9SA 2GOUA 1KM6A 5K3VA 1KV5A 2ZZ6A 3AJXA 3WJXA 3W7PA 3T40A 1K3UA 1UB3A 1RD5A 1OYCA 3VE7A 1TB3A 2TMDA 3LX9A 1KFKA 3FFSA 3PULA 3BW4A 3MJYA 2FB3A 3BLIA 2ZRYA 3LRMA 4PH6A 2H6RA 1SUXA 4JTHA 3UWUA 1SR9A 4N2YA 1GQNA 3DFNA 1VRDA 1PCWA 3DFQA 1H51A 3FYPA 2NX9A 3W1PA 4AH7A 1PHQA 3W7JA 4M19A 4O53A 1AK5A 3EX1A 4LY8A 3UD6A 5AC6A 1OVDA 1JCXA 3NZ1A 4JTGA 4W9TA 1P0NA 3QFEA 5CPNA 3S5NA 4JYEA 1SSGA 1PVNA 2B7PA 3M9YA 1DKWA 4ZMGA 5E0KA 4NXSA 3EKLA 3N9SA 2V2HA 3KVLA 1GZGA 1H7NA 3NPWA 1ZHAA 3PB2A 4AWUA 1HG3A 3O16A 1UBSA 2OJPA 5LGXA 2VFGA 1AL7A 2FPVA 4XBKA 1D3HA 4UTWC 1WYIA 1KM4A 5EBUA 4JYDA 2ZRZA 2PC4A 1JCNA 3G24A 4M7SA 4IMDA 4ML9A 3TSBA 3TW7A 2C18A 4E2BA 1VLIA 5LZLA 1ZJIA 1D9EA 3TROA 5F4WA 2FJKA 1GVSA 4Y9AA 3TQ0A 2NX1A 2WKJA 1H7RA 4FX8A 4DBDA 4LVFA 5L6UA 1K8YA 3VE9A 3OA3A 3HG3A 4O1AA 1ME7A 3NQCA 2Z6IA 4JEQA 2QCNA 1PS9A 4IPIA 2CW6A 5D37A 3C3NA 4ZVJA 4O13A 3M5XA 3R8RA 1LDCA 3CU2A 4UNLA 2YSWA 1A5AA 1TV5A 4UTIA 3HGOA 2Y7EA 5C2XA 2XN1A 3MI2A 4XWUA 1P5BA 4FXSA 2R14A 1FDZA 4A3UA 2CZDA 4MUZA 1YPFA 3FIGA 2BX7A 4BR1A 1P1XA 3WJWA 4CNNA 4GUJA 1IXPA 1OYAA 4XZ9A 4DELA 3L67A 4JXCA 4U28A 5KZMA 3PBVA 1H63A 2CLOA 4JGDA 5C55A 2EHHA 1LBMA 3MHGA 1ADOA 2CZ5A 4AAJA 1OYBA 3TE9A 1K7XA 3L0KA 1DOSA 5DBTA 4QAIA 1F2JA 1NF7A 5D2YA 2QCDA 1TJPA 1VLWA 3LI0A 4RZ6A 4XUGA 5CZSA 1NAL1 4AWTA 2ZZ3A 2NV2A 4UCGA 3NQEA 2DZSA 1EX5A 2J9XA 4NUWA 4O50A 3T4CA 1XL9A 5FF2A 2IQTA 5KZEA 3Q58A 3N9RA 4I7WA 1YLVA 4WXYA 1L9WA 4TU1A 4HSOA 1YXDA 5E93A 1SZFA 3HGRA 1RZMA 1JULA 4PCFA 3MP5A 4PTNA 1JVNA 1BTMA 2OX1A 3SSJA 4HN4A 4UTJA 4EF8A 5K9CA 2RHGA 3TJXA 3W07A 3LXCA 4JTJA 3M7WA 1NFBA 3GAYA 3LXBA 4IGHA 4K7YA 2NXGA 5U4NA 4OQVA 5K9DA 3NYZA 1O5XA 3FLUA 3E9AA 1M7PA 2JGYA 1I2RA 1OFQA 1OK6A 2CLFA 2ZZ2A 3M47A 4ADUA 3W73A 2F84A 1M5WA 5CSSA 5EMUA 5DCDA 1TPUA 1KFEA 1DL3A 3KVJA 3KRUA 4GRSA 1TTJA 5DLCA 4ZZ9A 3FEMA 4LW7A 3UXDA 1B9BA 1RQEA 1ONRA 2ISVA 4EOUA 3NQMA 3DU0A 4CCEA 3NPVA 4ALDA 1J2WA 1X1OA 3V1PA 2B7NA 1ZAHA 1OFOA 5AHFA 2H3BA 1TCDA 5F1VA 2Y7GA 3L65A 3HPXA 1W1ZA 1OJXA 3W76A 1GVFA 3G8EA 3IVSA 2QAFA 3BK0A 4ZL1A 3BG5A 1FCQA 1FDJA 3M6YA 3UXAA 3N2XA 2WOQA 4ADTA 3F1QA 4NNAA 4N9DA 4GUIA 4CQAA 1ME9A 4NZJA 3TSDA 2Y61A 4UFLA 4AHPA 4WY0A 1VGAA 1FWNA 2W6RA 3G1AA 1KM2A 4MY1A 2ZZ4A 1F74A 1SPQA 1H62A 1W0MA 3TUUA 3QJAA 3VI2A 3HF3A 3SI9A 3OHIA 3IIPA 3NOEA 3M0ZA 2Z6JA 4UTLA 5CPOA 1Q6QA 1W31A 3TCEA 2F7FA 5TIMA 2FDSA 4GBUA 3WJYA 1GT8A 3G1VA 5CZ0A 4X2RA 5HJLA 2FQIA 1KLYA 2CFFA 2R8WA 2WJZA 2PRMA 1YPIA 2QCDB 3KAOA 4RZ4A 1MEHA 3DGRA 3HMJG 4QQ3A 3FOKA 3CIXA 2GQ9A 4NJIA 4FX7A 4S2BA 3HQ1A 3L5LA 1SFLA 4EWND 3W7QA 1H1ZA 1FWSA 2X30A 5LHFA 1VJIA 4CQ8A 4E2DA 3PVFA 3W7HA 1DQXA 2C16A 2E6FA 1TV8A 2YX0A 3A9IA 1MEIA 4O18A 2BWGA 3CQ0A 3M43A 4LOCA 5LNUA 2AAMA 1X8FA 4LWWA 5HR7A 2G96A 3G8RA 3PUOA 2EGZA 1C9DA 3UZJA 1F5ZA 4CCCA 1FDYA 4OV9A 1GPWA 1XKYA 1O95A 3EXTA 3NQAA 5F4SA 1P0KA 1PIIA 2Y6ZA 5D05A 4AB4A 2XN2A 4RCXA 3BV4A 5E1QA 4R53A 1THFD 4IX2A 3KVKA 4LVAA 4NJKA 4MIMA 2R94A 4JTUA 2CLHA 4IXHA 1GG0A 3DENA 3DFTA 1LM1A 1SZGA 5BRBA 1Y0EA 3UPWA 3TC7A 1KTCA 4MYXA 4K38A 3NQ6A 2I1OA 4E0CA 1GVRA 3UZ5A 4OHQA 4FNUA 1SQ7A 3LCHA 3R12A 1IXNA 1XXXA 1WA3A 4JY9A 3SGUA 5K9XA 2KZHA 3EX4A 4JYFA 2CLLA 5GVJA 1NF0A 2BTMA 1MZHA 4S1FA 3BLEA 3G1FA 2C3ZA 3NL3A 5G1TA 3DFOA 3T44A 4JICA 1V5XA 5G2IA 3G0XA 1BWKA 2ZZ5A 3P5YA 3LTYA 3JR2A 1QWGA 3G22A 4BI5A 1H60A 4OV4A 1DV7A 2ZRVA 5D33A 1FBAA 3GDMA 2ISSA 4HKPA 3N73A 5CPMA 4JX5A 1X7FA 3P84A 2QCGA 3E02A 4O4VA 3TFXA 3LCXA 4NT0A 1A5BA 1KA9F 1VYSX 5G4WA 5EY5A 1QPNA 1B4EA 4IPJA 2VFHA 2Y62A 4LUIA 3SIZA 3IIXA 1TPWA 4G1KA 3NG3A 1Q6RA 2JGQA 3IGXA 4TMBA 3NQ8A 1ZCOA 3LHZA 1WV2A 1AMKA 2BSLA 3YPIA 3INPA 2J6XA 3THAA 3M5ZA 4QITA 2NX3A 3I7QA 2CWNA 2X16A 1I2OA 3W7IA 2P0OA 3Q94A 5BMXA 3H53A 4WX2A 3QRHA 3FA5A 1DJQA 3LRKA 2Q3RA 1VYPX 4RR4A 2RKXA 1OX5A 4JN6A 2DJXA 5FF7A 4WY0F 4WZHA 3W2JA 4JDBA 1FY6A 3NDOA 2ZYFA 2FPTA 2DZUA 3PSVA 4UMCA 1LROA 3NZRA 3QC3A 3QEZA 1I4NA 3Q37A 3FS2A 1I2PA 1JUEA 1R47A 3LTPA 5DXYA 4NX5A 3O6YX 4Y96A 4RLIA 3W7KA 3EXSA 5H2ZA 1LLWA 4DO6A 4UXDA 1XC4A 3NL6A 2A4AA 4UR7A 4DF2A 1EIXA 3FJ6A 3GXNA 4NNCA 2A21A 4LV4A 3IIZA 4FIQA 1Q3NA 2ABAA 2Z2UA 2VKZG 4FO4A 4PC8A 3RFAA 3ZFHA 1G7VA 3EX3A 3TXVA 3GAKA 1JRBA 3W87A 3UY8A 4K36A 1ZFJA 3A21A 1WBJA 1CW2A 4DO4A 1H5YA 4JX4A 3STGA 1L6WA 2HSAA 4MY8A 3TV8A 4H6KA 1FCUA 2TSYA 3QMRA 3TAOA 5A5WA 4K8HA 1LP6A 3MBDA 3W7CA 2V2DA 2B4GA 1WAUA 4OWGA 4JD4A 5SWUA 1HUVA 2VEMA 4HIBA 3LCGA 1LZOA 4ZQRA 4AXKA 2YFNA 3P81A 4FIRA 3IIVA 1O60A 3QF0A 2RDWA 5I3FA 5AHEA 3MMTA 2HMCA 2A2IA 4WOZA 1R2SA 4RXGA 3NL2A 3EKZA 4Z0JA 2ZRWA 3CEUA 3W70A 3O8AA 1XBZA 1FCBA 4UTKA 5DELA 2QF7A 2QJIA 3K30A 3GDLA 3OVRA 4AMAA 2A6LA 4HPJA 2VEKA 1OX6A 3QSTA 2O7QA 3MHUA 1KM0A 1SZEA 1TRIA 5G1YA 2ZQ0A 3QH2A 4CNOA 4GWEA 3BARA 5BW6A 3P61A 2EPHA 2OZ0A 3ABSA 5HULA 3WK2A 3QM3A 2JK2A 4IMFA 3TA6A 1M6JA 5G4EA 2GJNA 2RH9A 4IUOA 3IGUA 3B0VC 3UYCA 3O63A 3GXTA 2E5BA 5AHMA 5G5IA 2V9DA 3LDVA 1PCKA 4OBTA 2J9ZA 3RNDA 1PV8A 4DXVA 2RDTA 5D09A 4UR8A 4UMBA 3HIJA 4XTDA 4C1LA 5FI8A 2ZA1A 4DQWA 2W0UA 3SY5A 2I9EA 3GVGA 2YXGA 1JCJA 2PRHA 1A5SA 3QPZA 4OT7A 3PG8A 1WQ5A 4EF9A 5LNVA 3M16A 1W3NA 1GJPA 1DORA 1VZWA 4LT9A 3PSWA 1IXQA 1YXYA 4DO5A 3VCRA 4R33A 2A7RA 1KV8A 3L0NA 3NQ7A 4PODA 3GKFA 2TPSA 3NA8A 4YLWA 1SU5A 3JS3A 2G97A 5D2VA 1WXJA 1H50A 4K39A 5FF0A 5H91A 2V8ZA 1IGSA 1TPFA 1Z42A 3LLDA 4N4PA 3W85A 1G4TA 2W79A 1JUKA 1WOBA 3DKJA 2Y85A 2NUXA 1QDSA 4JIPA 5K4XA 2QJGA 3PY2A 4Q4KA 2ZCGA 3WFAA 5FF3A 1BKSA 4P2VA 2A1YA 1C8VA 5FEXA 5DY2A 2ZDRA 5KINA 5I3HA 3N3MA 1GYLA 3NQGA 1KBJA 3NQDA 4EVZA 3B03A 3O15A 3GDKA 4QNWA 1F6PA 1EP2A 4M5PA 1SO6A 1TSIA 1SFJA 1AG1O 1SO5A 1L6SA 1YXCA 3S5ZA 4N6FA 2ZA3A 3IV3A 4LRTA 4AEOA 3F4WA 3TSMA 2C14A 1QCWA 2Z0IA 5MHBA 1KM1A 1LBLA 2RFGA 1BWLA 1QFEA 3SECA 3GDTA 4O1DA 1HO4A 2CLEA 2J9YA 3HPZA 3U6WA 1RV8A 2AQWA 2BZNA 4PEKA 2C6QA 3S1VA 1Z44A 3OVQA 3LERA 1JCMP 4UTMA 4JTIA 4POCA 4M6PA 3STCA 1UASA 1OF8A 5LSMA 1F05A 2E6YA 5CG7A 1B57A 3SJ3A 3P67A 1XDLA 1N8FA 5AC8A 3TC6A 3T55A 1SO3A 4JTEA 4R7JA 3N34A 2QUVA 3B0PA 1JUBA 4YL2A 3MHFA 4IJBA 1R30A 4O28A 1Z41A 4N9EA 1GVQA 4IMCA 2VFFA 5HUPA 2J27A 2QKFA 5AOUA 4H4IA 3HG5A 4N9BA 4LC6A 1HTIA 1TQXA 3W7MA 4IXXA 4IQLA 3DZ1A 2J88A 3BW2A 1LRTA 3A5VA 1W56A 3VNDA 5LGZA 1O94A 2ZRXA 2JBMA 4O15A 1XCFA 3TAKA 3TX9A 4GJ1A 2QCMA 2VC6A 3S5OA 2QEZA 4JIQA 4JTKA 1GWJA 4K6AA 1TIMA 4MLJA 5AFDA 1QPQA 4O16A 4AHOA 2V81A 5F2GA 2TYSA 3DFPA 4RX0A 2B0MA 2C15A 3PUEA 1H1YA 4UFIA 4LC8A 2WSRA 1F73A 4O0ZA 3W1QA 2H8ZA 5HINA 2DZXA 2PRLA 3LOTA 3NQVA 2QUTA 3ABRA 4Y6GA 2G5WA
chains in the Genus database with same CATH superfamily
4HVXA 1GZ1A 3DFHA 4YMZA 1EYEA 1UWIA 2JQXA 2VOMA 3OG3A 4ROPA 3THDA 3VIJA 5CZTA 4LVDA 3ARPA 1JI1A 1XIMA 3IVUA 3W02A 3UXLA 3M46A 3W23A 1MO0A 4ATDA 5BOEA 5REQB 2GQAA 1VS1A 4PULA 3BO9A 1R3SA 4M1BA 4HZ8A 2JKPA 4J3SA 4AXNA 1O1HA 1TPH1 2V82A 3T05A 3GIYA 2EKGA 3E1F1 1VYRA 3PZQA 1P4CA 2D0HA 3MO4A 1SJCA 5C6MA 1S38A 2WSQA 2OZ8A 2GFTA 4GKLA 1OK4A 3G0UA 3TU9A 4HNOA 3SZ8A 4GGBA 4Z42C 1IT7A 4CCDA 3AQUA 5EKYA 4S3EA 5GJMA 5KSWA 1UA3A 4FLOA 2GGEA 3EMQA 2PSNA 1TKKA 4GZEA 1R3WA 4XQ6A 1VCGA 3ARQA 3ZVIA 1VFFA 2PDMA 2VWTA 4P8XA 5DCBA 5BU9A 3W74A 1R38A 3VIPA 1U30A 3OIHA 2INZA 3I3EA 3GE7A 5H8MA 3O05A 4BI7A 4AIEA 1VJZA 2D0GA 2V0TA 1S1PA 4QIUA 2FMNA 4O11A 4H9YA 1EJSC 5EGRA 1ZP3A 2OGYA 3T0BA 3FGCA 3DUGA 3USBA 3OGRA 3W72A 3TJLA 3VIIA 3WEMA 3QFWA 3HBLA 1ZL1A 1E4IA 4H7ZA 5EU9A 1D8WA 3HPSA 3A3WA 3CB8A 3GVWA 3QGKC 3WBYA 5TQLA 1KFLA 2GDVA 1WZMA 2XINA 4H8UA 4UMAA 4N0RA 5AYXA 2BY0A 1CPUA 3L5AA 4JR5A 4KH2A 1E9IA 2BGNE 1TPVA 3GBDA 3QYQA 1L8PA 4XIAA 3A5FA 4DAIA 1AQFA 2WV8A 1QOPA 3MQTA 4UC5A 4GXMA 4YS1A 4HMEA 2VL4A 4J1OA 2E6DA 1J6PA 4RDYA 2NSOA 2OELA 3W86A 1JF5A 2GGIA 3F5JA 4B5TA 1R2RA 4CU8A 2ZZ1A 4XBJA 3R89A 4QQUA 2PP0A 1BLIA 1W2VA 2GK1B 2W91A 2NVDA 1M04A 4RDVA 4JHMA 2I57A 3RF9A 1F8MA 5HXMA 4JTTA 1PTAA 3FA4A 2O7SA 1G4SA 2DUXA 2E1DA 1ZRQA 4QX4A 1JCLA 2PGRA 2G3IA 3URNA 2W67A 1TA3B 2QIWA 1MW3A 3IARA 4GD0A 2AQOA 3IJ8A 4XZLX 5IBXC 1Y7VA 3STEA 1XYMA 2DW6A 5FSEC 1IT0A 1ITXA 3MP3A 1S2VA 1RQBA 1V77A 5ABTA 3KRSA 4MVAA 3WH5A 4UIOA 1WUFA 1LOLA 4V33A 2VEGA 3GH7A 4IF2A 4WQ6A 4XKYB 3N6HA 5F1UA 4PL2A 1WXZA 3NSMA 1UJQA 4QHRA 4DBEA 1R3VA 3BCDA 1XF0A 2RDUA 5AYZA 4A6GA 1JZ7A 2QIIA 4GUFA 1ZENA 3N3TA 2ACSA 1PAMA 1XM3A 1E1CB 2YZRA 3GKAA 1WX0A 1VB9A 3NGJA 3R13A 2VX5A 4UTUA 1KM3A 4HPXA 1QOQA 4V27A 5JVLA 3ITGA 1H3GA 1G0CA 2WXDM 2ZBTA 4HU0A 4UB9A 5HMDA 2ZC8A 2J78A 1UC5A 2QDEA 4AHQA 3PC0A 2DH2A 5AYBA 3W3OA 5C0QA 7A3HA 1RLDA 1SO4A 5G2WA 3DXIA 5IBXA 4NVTA 4F48A 1C92A 5C2GA 4E4PA 1K9TA 3IV8A 1K03A 3EDFA 2CESA 3E74A 4AIUA 4O57A 3HJEA 4OFCA 1CX9A 5BZAA 3MWAA 4WUIA 4BFAA 2OEKA 4MWAB 5T9BG 3WG6A 2I5IA 3HU7A 1JGIA 3SO7A 4Q4MA 3HQPA 2YYTA 1T5AA 1VAHA 3OLGA 3E3HA 5CXPA 5L9FA 4NI8A 2VR2A 5DFAA 6ALDA 3MI6A 2BP1A 2YCEA 5M3WA 2UV8G 3MSYA 2CERA 3KWXA 2V5JA 3O6AA 3LPOA 1K7EA 2ZWYA 1KTBA 4DWSD 4EANA 3F4NA 1XG3A 1B90A 2OQLA 4NASA 4LU0A 4B2DA 4DM1A 1OF6A 1PDZA 3KVMA 4XD6A 3GXPA 2CLPA 1EP1A 3PM6A 2V5LA 3ARZA 2WLYA 3SCPA 2QLYA 4YHEA 3UR8A 3GFZA 5LIWX 3IK4A 3RJYA 3OGVA 3BMXA 1GOMA 3T6CA 4DWSB 1E4LA 1W5MA 2P3EA 1ISVA 3HO8A 3NIYA 1TCMA 1R7AA 2F6XA 2V30A 4EPBC 4MYAA 3NCOA 1JCYA 4U5IA 3M5VA 1XBYA 3UPBA 4LYRA 4LUSB 2V6AA 3WF4A 4X3ZA 3STPA 1EH9A 3W88A 3N15A 4FF7A 1A5CA 1LBFA 4Z08A 3RYSA 4B3KA 4PZVA 3FVDA 3BJTA 3L66A 4QG8A 1V7YA 2YCLB 2NUYA 2PDQA 4A3QA 4MUPA 3CM4A 3B8DA 2I7GA 3E12A 4QE5A 1PBGA 1B3ZA 4ZO6A 1SYTA 1KFBA 3M0LA 1W54A 1TREA 3OEXA 1RJPA 3QR3A 4UZSA 3DFYA 4TUFA 4RKAA 4ADSA 4PMVA 3PBUA 1E6SM 1W5PA 1XRTA 3N13A 5LKYA 4UTWA 3OQ8A 2ZXBA 1DWFM 1EDQA 1OQFA 3GB6A 4K37A 4AZBA 3CXOA 1OZMA 2NQHA 3SCUA 1MWOA 1DWIM 4P61A 2EPKX 5C54A 3TZFA 2FVMA 4O8RA 2ZICA 3HOJA 4UR9A 3BZGA 4MAZA 3VVGA 1XGZA 4KETA 3UWQA 3GDRA 3LCIA 4AD1A 3RCYA 1JRCA 1XLKA 2VYOA 3E6EA 3I3DA 5BYWA 4M51A 3I4KA 4R5EA 4UOQA 3KL3A 3B05A 1WDSA 4DXKA 3O6CA 3EWXA 1TPB1 2CLKA 2DW7A 3T1GA 3VFLA 1CXKA 4N02A 1KR0A 3B9OA 4LVGA 3ITXA 3MUIA 3LI1A 1CZ1A 1NM9A 4HT3A 4F9DA 1H0IA 2UY3A 3R5EA 3V16A 3VC6A 4ZOEA 3XIMA 2O9PA 2XJ7A 3FNDA 2XH0A 1TRDA 3ZWTA 1TV7A 3CS2A 3VD5A 2OCZA 2WQPA 3NL5A 3BAIA 1FVPA 4BEQA 1XFBA 3WK3A 1IZJA 5CPTA 2CXEA 2Y8UA 1MUCA 2O9TA 4PMZA 4AF0A 2BNJA 2G95A 2YXXA 4F0HA 3TH6A 1W9BM 2DQWA 3PWAA 3T2QA 2X8RA 1XLEA 1E6PA 2NZLA 1M68A 3VFCA 1G94A 1NIUA 2C1GA 3EWCA 3L4YA 3MV01 1W3TA 3W9ZA 1JL8A 2ACUA 1X96A 3ABZA 2F61A 5I3JA 2NV1A 4PCPA 1KLZA 1NSJA 2Q71A 1PPIA 2XSBA 4QISA 5HJXA 4LQ1A 2XHYA 4WXZA 3PJUA 2PD9A 4A8RA 5XIAA 4ORMA 3C6CA 4FNRA 3BLPX 3L9CA 2X1UA 3K5XA 1NQKA 1W1VA 3DYMA 5BMWA 3WQCA 3GXIA 4GO8A 4IIFA 3LCFA 2QUMA 3IPWA 1DTUA 2E5DA 4XO6A 1U33A 2WVUA 2PDCA 3L4UA 1A47A 4DF1A 2GDQA 1ODZA 1QI0A 4X0NA 3AIQA 2GQ8A 4G5DA 1E3XA 2FLIA 4I7VA 5LNRA 3O06A 5A69A 3EWBX 5EFFA 3RR4A 3M07A 3OG2A 3RILA 3BH4A 3OA5A 3L4VA 4R3UA 3WUEA 3LMYA 3UP8A 1AW1A 1PZ1A 1VRXA 3C61A 2ONEA 4UNKA 5A8MA 2DSZA 3G2GA 2DVTA 3F4CA 3M0KA 3AZTA 2OOGA 4ZO9A 4HGXA 1U1JA 1ZS2A 5M03A 2IS7A 5I3GA 3L2IA 1X6UA 8TIMA 4BF9A 1XH0A 3VX1A 5M1TA 3BV7A 5MKGB 2NQ9A 1GG1A 1UC4A 3LB0A 2G3JA 4M29A 4L6DA 4Q22A 2UY5A 2HK0A 2FZ8A 3E49A 3NR0A 4PMJA 3USZA 3O0KA 1B4KA 2BASA 4S2CA 4O4WA 3E38A 2ALDA 2C1HA 1N8IA 4HBKA 1YQ2A 3CZGA 2ABBA 1RVKA 5CEWA 3E2VA 4PRWA 1E3ZA 2ATSA 3H21A 5F4XA 1QHPA 1E9LA 3CZLA 3BLDA 3VDAA 2P10A 3U4FA 3BG3A 4EPEC 3BAKA 5M2FX 4LAZA 3NPXA 1LCOA 4IJCA 2VR4A 4FNTA 4A22A 2GPTA 3BOLA 1UYQA 2CKSA 5CAHA 2XH2A 1RCOB 3GNPA 2YL6A 3CLWA 2D0FA 5CLTA 1OFBA 5GJNA 4PE8A 1T8XA 2ISWA 1G4PA 1W17A 1UR8A 2VVSA 3KOFA 1H49A 1RBAA 1U83A 4H9ZA 1IR2A 1BYDA 4AZ6A 4AYGA 5AC7A 3AHYA 2WSYA 1XLMA 4BS0A 3C2OA 4WY0B 3U2OA 3PFRA 4LS2A 2JKEA 2VUNA 4C6DA 2NWSA 4O1CA 2OPJA 4P8VA 3KZPA 3UT0A 1TPC1 2YL8A 3LCWA 4DF0A 1GNXA 1R7OA 1ZALA 1E1EA 4W88A 1BF2A 3BLKA 4GHRA 1Q6LA 2C0HA 1A5NC 4RW3A 5AB3A 1K8XA 5AZ0A 2C13A 3U5YA 4QSHA 2VFDA 3R2GA 2NQLA 1J12A 3W1TA 1EEPA 3TNOA 3KL5A 2TRSA 5AVHA 3WLJA 1W6TA 1GQJA 5KMYA 5AVNA 1W3LA 1KW1A 3ZVHB 3T2PA 3HGSA 4BQ3A 4TR9A 3QN3A 3F5LA 4HJFA 4EXBA 2JIWA 5DN1A 3B0UX 3BW3A 3H55A 2QR6A 1JDAA 1UMYA 2IXUA 2ATMA 1NH6A 4LCSA 3BANA 4AG0A 1Q8JA 1J11A 3OZYA 4MJZA 3N11A 2BHYA 1H11A 3TZNA 3W7PA 2DY3A 3S2NA 1RD5A 1NFPA 1DJXA 1OYCA 3VE7A 3QLDA 2MUCA 1GCYA 3PULA 2VMFA 3MJYA 3OGSA 3BLIA 3TVAA 2QXWA 2ZRYA 4D71A 4JTHA 4KEMA 1BXNA 1EJUC 3CV1A 3VD4A 1PCWA 3DFQA 4DWDA 2VC9A 3KHDA 2C79A 2NX9A 3W1PA 1MFVA 1AK5A 1HKJA 1C7TA 1JCXA 2ZUNA 4JTGA 3RX2A 1P0NA 8XIAA 3T0CA 5A94A 1RCQA 4JYEA 1SSGA 1CEOA 1AVAA 4YYFA 4JIHA 3M9YA 3CPGA 3U2ZA 4DZAA 3BC9A 2V2HA 1ZHAA 2QF8A 3PB2A 1HG3A 3O16A 1UBSA 3WQ5A 4XK2A 3W6MA 4XBKA 1PSCA 4PSPA 1KM4A 4D6JA 4RL3A 2ZRZA 2V68A 3DG6A 4LJ3A 5C70A 4IG2A 3MC5A 3EB4A 4E2BA 1VLIA 5F4WA 4Y9AA 2NX1A 3GFYA 2E67A 2W63A 4DBDA 2IPGA 3TJ4A 1DWAM 3BE7A 4ML4A 1K8YA 5L6UA 3ZXWA 3OA3A 3VNKA 3OQEA 2GDUA 4JEQA 3K8KA 1UR1A 4BCEA 4C60A 1UZHA 3HQNA 1UR4A 2E3ZA 5FAGA 2CW6A 1LWIA 3C3NA 4ZVJA 3H8AA 4RE2A 3M5XA 3R8RA 2Z2BA 1TWSA 2OKTA 4B5WA 2R14A 2V67A 1FDZA 2CZDA 3VNLA 3B9DA 4MUZA 2GSJA 3AXXA 4IIEA 4TVDA 1V0LA 1XLDA 3WD0A 1P1XA 2WSPA 4U31A 2FHBA 4LYKA 4ATWA 1OYAA 1U5VA 1POKA 1UWAA 2CLOA 3G5EA 4L4OA 1ADOA 1JFXA 2REQA 4LYPA 1QW7A 3ZO9A 3M0YA 1F2JA 5D2YA 5FIPA 1XV8A 1VLWA 1MW1A 4XZHA 4YTQA 5CZSA 2Z24A 3RX3A 4UCGA 2J9XA 4O50A 1SM9A 1XL9A 3K4DA 3REQA 5KZEA 1GJWA 1XLHA 4IZGA 2I16A 3AZRA 4MDOA 5D8ZA 3G6LA 1L9WA 1C8XA 5E93A 5AYIA 3RRAA 1SFSA 3VGFA 4AUBA 4Z2LA 3TOYA 2AMXA 3MP5A 2AL1A 1OBAA 5E6ZA 4QJ4B 3W07A 1PZ3A 5HNNA 2DIJA 2W66A 2EG7A 1NFBA 4JHZA 3LXBA 2FKPA 5C9RA 2WMGA 4NZ3A 4IGHA 2NXGA 4GK8A 2Z4GA 1M7PA 4M3PA 2PAJA 1I2RA 1EFZA 1XLGA 1OK6A 1KRMA 1V0KA 1YBQB 3M47A 3HFYA 1AQHA 1XIJA 4ZSTA 4ZE4A 1MQRA 1BRLB 4XZWA 1TTJA 1VBRA 2W62A 4GMEA 1ONRA 3CQHA 1DIKA 3SUWA 4EPKA 4M8UA 4ALDA 2AL2B 4RUBA 3V1PA 2B7NA 1OGBA 1ZAHA 4KMQA 5AHFA 3E0FA 2WCGA 2Y7GA 3L65A 1W1ZA 1OJXA 1GVFA 5CBJA 2YCKX 1J0ZA 4IH3A 3M6YA 1HXJA 2WOQA 5FJPA 1ONXA 4ERIA 3WL0A 4DXXA 4YVPA 3N12A 3MJMA 3TSDA 4GYPA 5B80A 4UFLA 4AHPA 4F0SA 1OIMA 1VGAA 2G0WA 3AMKA 4IQJA 2FTYA 4MY1A 1SPQA 1W0MA 1U22A 3VI2A 5AKQA 4IQDA 3SI9A 2VVNA 2HNHA 2NQZA 1ZTVA 3T9PA 5CC3A 2OWCA 9RUBA 1W31A 2X1IA 1JAKA 2F7FA 5TIMA 4YVXA 4GBUA 3SDOA 3KM8A 4HOWA 3G1VA 3GU2A 5HJLA 5J8LA 3MVTA 1MFUA 4I6KA 3PJWA 1YPIA 2QCDB 4AWEA 1MEHA 3FOKA 1ZPTA 4NILA 4NJIA 1O68A 1T41A 2X09A 3B9NA 1FWSA 2X30A 4C6PA 4CQ8A 3RIKA 3GH4A 4H2HA 1MXGA 2C16A 1VBUA 2YX0A 3PAOA 3ARYA 4IPPA 3VABA 3VKCA 2WYSA 3W25A 3CQ0A 3M43A 3GVQA 2F38A 2AAMA 3BJFA 4LWWA 5HR7A 1FDYA 2OB3A 1FHDA 1XKYA 3LZ5A 3PP7A 1O95A 3EXTA 4H9XA 2J7DA 5F4SA 4DN1A 2XN2A 1FP9A 4MM1A 3BV4A 5XINA 3JZUA 3PJTA 4MGGA 4F4RA 4GIAA 4CCZA 2E40A 2PDUA 2CLHA 1XYZA 4IXHA 2WCAA 4OVXA 1UKQA 1SZGA 1DP0A 2HXUA 4DLFA 1KTCA 2OVLA 4K38A 3NEHA 3AU6A 3OPSA 4C1NB 4E0CA 3UZ5A 4PCSA 4PMNA 5BXPA 1XXXA 4JY9A 3MKVA 4C7FA 4REQA 2KZHA 5GVJA 4JYFA 4DZ5A 1NF0A 4L80A 4GABA 3UCCA 3NL3A 3GH5A 3KBVA 3SEPA 4EP8C 5G2IA 3P5YA 1QWGA 1N82A 3L2MA 3MUY1 4BI5A 3TA9A 1UD8A 3TTOA 3OLIA 3N73A 1Q4NX 3URBA 3M0VA 3OW1A 3PHAA 3LCXA 5G4WA 5M5DA 1B4EA 3VZYA 6REQB 3NGFA 4NY2A 3W37A 3SAZA 3PZNA 1NWTA 1Q6RA 5HAOA 5DEZA 3CJPA 1WV2A 4GQGA 3PTQA 3EWDA 4AY7A 3BURA 5FL1A 1EC9A 3W7IA 3Q94A 4LB4A 3H53A 4WX2A 1DJQA 2ZADA 2GJXA 2Q3RA 2VWSA 2X7VA 3H4GA 3R79A 1VYPX 2RKXA 4JN6A 2DJXA 3CV7A 4GNVA 2YLAA 1VEMA 1VF8A 2DZUA 4AMCA 3PSVA 5CGMA 4J5NA 3Q37A 2DH3A 3FS2A 2WJDA 2ZX8A 1M53A 4HJWA 3T09A 5ABFA 3TN6A 5DXYA 5A6JA 1PWMA 4RLIA 3KLKA 3W7KA 4TX6A 5DX7A 2HK1A 3CNYA 3FVMA 4UR7A 1E5JA 3FJ6A 3M4HA 3GXNA 4GCXA 4NNCA 1GHSA 3MPGA 4QP0A 2QT3A 4FIQA 3GC2A 3R10A 3UJSA 2J62A 4FI4A 2Z2UA 1JZ2A 1Q7MA 1P6BA 3ZFHA 1HVQA 5C7VA 2HJPA 1MRQA 1HJXA 3A21A 1WBJA 5I79A 3AMLA 1GVYA 3DDMA 4DO4A 3XINA 1F6YA 4I6VA 1JNDA 4CVUA 4S3KA 3G6MA 4Y9OA 4C7GA 3TV8A 5E9XA 4DHGA 1FCUA 4ZSUA 2FGLA 3QMRA 3A4WA 3GXFA 3OZMA 3VC5A 4JTDA 4OWGA 1UQZA 2P0IA 4C6OA 4UQCA 1BG4A 4ZQRA 5FJUA 1R6WA 1KKRA 1Z89A 1NOUA 3GTIA 3BDKA 1Y8BA 4XKMA 5I3FA 3ES7A 1R2SA 4BA0A 2ZRWA 1YIXA 4JN7A 4LANA 1XIEA 5BRQA 4XUYA 3OVRA 4AMAA 1TZ7A 2VC7A 1W2PA 1Y65A 3VOGA 3V1HA 2O7QA 2AKMA 1O66A 1SZEA 4XVEA 3PZGA 3QH2A 4CD4A 4CNOA 4GWEA 3BARA 1NOFA 2EPHA 3ABSA 1R9ZA 4KERA 3WK2A 3QM3A 4IMFA 3TA6A 5DANA 1QVBA 3W01A 5G4EA 4ZGYA 4E6MA 3W81A 4IUOA 3CO4A 1H09A 3ZT6A 1SFTA 1UHVA 3O63A 5G5IA 2V9DA 2ISDA 3VX0A 5CAKA 3AOFA 4DXVA 5D09A 2AGTA 2HE8A 5FI8A 1PUDA 1NU5A 2Y2WA 2PRHA 1EL3A 4EF9A 5LNVA 3FHAA 1W3NA 4Q4RA 3KS5A 4V1YA 3RRXA 2J7CA 2BFGA 1IXQA 2A3BA 1E70M 2CWXA 2PCEA 2QPSA 3KDOA 4MJ4A 4R33A 4PODA 4GY1A 3VIFA 5JU6A 5H91A 2V8ZA 1IGSA 3TWAA 1ONWA 4N4PA 3W85A 2W79A 1JAEA 4R88A 2EXOA 4A05A 1O1ZA 1E9YB 3RM8A 4HTBA 3OODA 4JIPA 2QJGA 3UZXA 3EDKA 3WFAA 1XGEA 2VX6A 2WJFA 4IGSA 4PRRA 4G1NA 3QTPA 5DY2A 5KINA 5LIXX 3NQGA 3RO6A 3LD5A 1BXBA 3NQDA 2X2YA 3O15A 2V3GA 1V7AA 3SUTA 3LUTA 1V3LA 4LRTA 4OJYA 2IQDA 3UG8A 2C14A 2VEFA 7ODCA 5MHBA 1KM1A 3UVIA 3U48A 3SECA 4G7EA 1W8GA 5D4YA 2CLEA 1BPLB 4PEKA 4UQBA 4S3CA 3S1VA 3A47A 2ZXAA 4M6PA 4YTTA 3KL0A 1OF8A 1F05A 1E6XM 4GNKB 3UCDA 4D1JA 4FMVA 1N8FA 4DUWA 2J79A 1F61A 1ISYA 1E5NA 3LY0A 5I0DA 2GGJA 2QUVA 4W87A 4DYKA 1X98A 3MHFA 4JNZA 3SY8A 3ZJ7A 1R87A 3DHPA 2CCRA 4GQRA 3PTMA 2VRKA 4CQDA 2QKFA 1LWJA 5AOUA 3HG5A 3BSGA 4N9BA 3W28A 3P2VA 4IIGA 3SN4A 3W7MA 1KCZA 2HVNA 2PBOA 2Z1WA 5HATA 2X42A 2PLKA 3THUA 4W86A 3OOQA 4W8BA 3JUGA 1IYXA 5E6YA 4AHOA 1TX0A 1W1IE 3WD1A 3TTQA 1YRRA 3U5UA 3PUEA 4UFIA 4HPHA 1IWPA 4LC8A 5HINA 4PUJA 3ABRA 3CUIA 4Y9MA 3P74A 4J3UA 1A53A 1SW7A 3CT2A 4A2SA 3ZZ1A 2PCQA 2I56A 4QE1A 4Y8FA 3UJEA 3HGJA 3ARRA 5F2MA 3T78A 1R3QA 1W91A 3T08A 4IT1A 3UR7A 5DMMA 3WLIA 4HHPA 4MG4A 3UY7A 3G1YA 1B3XA 2XGIA 4AEEA 2GVJA 2E77A 2DORA 4QE4A 3DESA 3VNJA 3N2MA 1TUXA 3UBPC 3L4WA 1MXSA 3B4UA 1UA7A 1F07A 1C3FA 4S23A 1HN1A 4Z0SA 4YJ5A 4MHBA 1CXLA 3MCNA 3KRZA 3E0WA 1S5TA 4MZYA 3H70A 4B5XA 1EHNA 1QU4A 4TQTA 3K4AA 4G8TA 3C0JA 3UA3A 3G3DA 1GQLA 5K2ZA 4KW2A 2EAWA 3WEOA 2FB2A 2Z00A 3KOYA 3GG8A 3W75A 2INFA 4HOZA 1T99A 4KWWA 2EF9A 3DERA 1GPFA 3WNLA 4UQAA 4OOUA 1OHLA 3A3HA 1EO5A 1US3A 1KM5A 3GHRA 2V5KA 3UFYA 3A9BA 3O6DA 3A23A 3ZIZA 5G4HC 1AW5A 1TWDA 2JFEX 5DT5A 4WKHA 5JIPA 4IIBA 2HBXA 1QNPA 4B5VA 2WB5A 3J7HA 5M17A 5D03A 1SZRA 3LBCA 4B5NA 3T81A 2Y70A 4L56A 3F2CA 1J5TA 3VM7A 3TQVA 1ZBWA 4IIHA 2XWDA 1CBGA 1FWDC 2WBKA 2GVYA 2ZA2A 2OYKA 1VCVA 3GW3A 3LTSA 1WP6A 1N2VA 4NQ1A 2HDJA 3SCTA 3AFBA 4AY8A 1OIFA 2E9BA 3MUAA 1RD6A 2ZX6A 1E55A 3EOUA 1VR6A 4QTGA 3HMCA 3GU9A 4HB7A 3FDGA 3CL8A 4U2ZA 3OVPA 3HG2A 1XKJA 3EB3A 1S3HA 1VCFA 4PL1A 4ACZB 4F0MA 1MW2A 1XBXA 1Q85A 4IFOA 4LUTB 3W1NA 3QV9A 4HN8A 4JQ2A 2J24A 1E6ZA 3L0GA 1NVMA 2Z1SA 1AD4A 2DZBA 2Q6ZA 3SW6A 4Q6JA 4GE8A 2OSXA 5LYRA 2XFWA 2W4XA 2DPEA 2UZ9A 4JQ4A 5F2LA 1KKOA 3BGGA 2PDPA 3S1UA 3IK2A 1F6KA 3BSMA 3O07A 1XBVA 4NIRA 4IPNB 3TCSA 3NQ2A 2E8YA 3VKDA 2D73A 2X1TA 3S5SA 3NZPA 1FWRA 3GG1A 3K1DA 3EWUA 1FWAC 3GK0A 3VNYA 3WD4A 2VTFA 5IM51 3QMTA 4LTSA 3OZPA 3WN6A 1GEQA 2CITA 4ORIA 3ZJKA 3GZ3A 3RLVA 3V36A 3CC1A 2YDQA 1NY1A 3KFTA 4LFYA 3VCNA 3A3XA 1GORA 1GOOA 3CIWA 3R7MA 4EKJA 4TV6A 2BODX 2R91A 3FYOA 1K9DA 3V0UA 4PMUA 1SSDA 3KXQA 3MP4A 3PUGA 1B5TA 4LUYA 4ZXLA 5BOOA 1X38A 1RALA 4QXIA 1CECA 3PF3A 1GYNA 2PZNA 3P0WA 3TN4A 4L61A 1XIDA 1KGUA 1G67A 1REQA 4MZ8A 1TMHA 4BQ4A 2B7QA 4I5XA 3DBPA 5TAOA 3FGCB 5U7SA 5H8PA 3M44A 3SM0A 3VGBA 2F6UA 4N9CA 2OO6A 2VQUA 3W1AA 3N25A 4E8GA 4HA3A 3FX4A 3PR2A 7TIMA 1Q7QA 1HIZA 3IJDA 1GUVA 2HPIA 1DE5A 3ZM8A 2DUZA 3C56A 4H2CA 3PPGA 4FNSA 1H61A 1VBJA 1G01A 1I45A 2DSUA 4H8NA 5C9WA 6CGTA 2R9RA 5PTDA 3LBOA 1D2KA 4KWVA 4D6CA 3W7RA 1DTNA 4TTUA 1IE7C 5FL0A 3VK5A 2DZVA 2HZGA 4R7WA 1K7FA 1SW3A 4IX0A 1F3XA 3VINA 4JDYA 3PS7A 1J96A 2EPMX 1TZZA 4GVHA 1QR7A 2V3DA 4OECA 3LV5A 4EAYA 3KBWA 4M6UA 1J5SA 1NFGA 1MZRA 4ZODA 4M6QA 5HA7A 3MO7A 3AALA 2PLMA 4JNMA 1GOWA 2D22A 3R0DA 2XDFA 1B2YA 2BOEX 5ENLA 1QJWA 1HL2A 4X61A 4XTIA 1H7OA 3TXZA 4DJEA 4NZ4A 4M24A 2F2KA 3SRHA 1TIWA 3NAVA 4EIVA 4D2JA 3NXFA 4QJ5B 2PWFA 5CPLA 2YDAA 3W2NA 3W82A 1TZ9A 3UWWA 4H01A 2VDIA 1VPYA 3UA4A 2GVGA 5I77A 4YWSA 2OZTA 4NJJA 1A0DA 4WDTA 5LHEA 3Q2DA 5A6TC 1TELA 2I9UA 4WDUA 4LS1A 1IEIA 4PBFA 5D9OA 1XUUA 3OBKA 1TV3A 2QV4A 4WVXA 1NDYA 1EGMA 1TPEA 4X9YA 1ISXA 3QGVA 3UWEA 2VEIA 3LCLA 4PA8A 5D04C 2OT0A 4RPPA 4GNJA 3WLNA 2JKAA 3CHDA 3LHWA 2Q3OA 1E4NA 3BCFA 1H0GA 5EFDA 3T0AA 3T0TA 1Q2RA 1JEZA 1FQ0A 3CWHA 2CZEA 4B9ZA 2P5NA 4LH8A 1L6YA 4JS3A 5EMJA 3ORWA 1TJ0A 1HKIA 5LNSA 2Z1KA 5I02A 4IWWA 3GG0A 3QOMA 3LG3A 4ACYA 2RUSA 4GUGA 1A0EA 1EUAA 4OZOA 4E3TA 3WLHA 1DXEA 1T0OA 1FHLA 1XICA 3W6YA 3GNRA 1S5VA 5FEZA 1L8NA 2ICSA 3CLMA 1YMYA 1E72M 2J74A 4P7RA 2NVAA 4XD3A 2D2JA 3NM1A 3TW6A 1C29A 2INEA 3VIMA 1CGTA 5CSRA 3ATYA 1YKWA 2GSEA 2VC5A 1QT1A 5TF0A 2AMGA 5T9CE 1K8CA 4ILSA 4JTLA 1AUSL 3HTWA 3GLCA 4IP4A 4MFEA 3P60A 2DT3A 1VC4A 3DC8A 1R85A 3S5YA 2CLMA 5EYWA 1NWSA 4UUIA 3VKBA 3QHNA 3RU6A 2VQTA 5AHIA 2PLJA 5C9UA 4TIMA 4NF7A 1ITCA 2WC3A 3SN1A 3L68A 4GYJA 3CWOX 4B3LA 4KIEA 3WF2A 3TK7A 1X6NA 1RXOB 4D9PA 2VENA 1S5MA 5DMLA 1C91A 2ZTKA 3VNIA 3MZNA 1B30A 1MI3A 4EE9A 4ZQNA 1LOQA 4I9AA 3W2LA 2BXYA 1MVYA 2YCIX 1XISA 1U1UA 4TV5A 3KS6A 4NXKA 4GYKA 3M0MA 4U5KA 2E9MA 2BMBA 1MEWA 3V5OA 3DYOA 1UKPA 2G8ZA 1S1RA 2BXZA 5F2IA 3CH9A 1V0MA 1E0WA 4XVDA 2C0AA 1Q6GA 3CPRA 4HK7A 1R9XA 4MWAC 3W2KA 1JPHA 5HR6A 1IR1A 4XKYA 1QI3A 4A21A 5HWJA 1YYAA 5EL1A 3TNBA 4FB7A 1ZP4A 4X2PA 1SZNA 2XU2A 2DT0A 4RDWA 4I3GA 4ZQMA 4LNYA 1E1CA 1OFRA 4LALA 4A3HA 4DZHA 4N4QA 4Q8TA 3RO8A 4XAYA 4RNFA 2IXVA 2Z1BA 1TTPA 4EK7A 3WMSA 2G3NA 2EEXA 4LAUA 4Q4OA 4R9XA 5D32A 1PO9A 4KEUA 1M1BA 1ZNNA 3F03K 4GZJA 1A49A 4C6EA 2QUNA 2WMFA 4INFA 3AHXA 2WC4A 2PUZA 2E4TA 4NI3A 5DRIA 2VXNA 4WRHA 2QCEA 4IL2A 2BXVA 3W7DA 2J7GA 2RGLA 2PDKA 3BMVA 4MWAA 3OJGA 3PB0A 1R0MA 1LL6A 5CKSA 3V4BA 3RMJA 3AO0A 1ZAJA 4FOKA 3N14A 2QUUA 4L4MA 1FUYA 4D8ZA 4IMEA 3RN6A 4H6QA 1JZ6A 3T4WA 2A3AA 5HWMA 1DBTA 3ZJ6A 4JTCA 4BEUA 3IEBA 1WZAA 3AISA 4Q7IA 1PKYA 3SRDA 2ZVIA 4N6EA 1XLIA 2WM1A 4BHYA 1WO2A 1VFLA 2QCFA 5EMMA 1EO7A 1KB3A 1OC5A 1ZU8A 3WUFA 1ALDA 3T8QA 3IS4A 4J35A 4AF0B 3LXAA 1A0CA 3NEVA 2FTPA 1ZY9A 4EXAA 4NYYA 4DBSA 1B3VA 1D3GA 4GH1A 4TO8A 2W5FA 4JNYA 4M56A 4B91A 2PTYA 1X6LA 3SSZA 3IJQA 2D23A 1QPRA 5E0CA 2WNNA 1CLVA 3M64A 1F4AA 1OCNA 3CHEA 3GDBA 4IJRA 4RZ5A 1MMFA 2HE5A 3K4WA 4NJGA 2PTZA 4HA1A 1IQ8A 1POJA 4YPJA 1KFJA 1VFMA 3LBMA 3WQWA 1VD6A 2G3MA 3WBEA 1PTDA 4LUSA 1YDOA 2HS8A 3ZYZA 3U2CA 1LYXA 1R8LA 3V7PA 1L6FA 3OIXA 2R1PA 1K6AA 3Q45A 3QR0A 3EWWA 1E15A 3LHTA 1Q13A 4MNJA 1DQWA 2O55A 4GXPA 1F76A 4HNVA 4LRSA 3I6EA 5I09A 3BLFA 1SR0A 1GTHA 2DP3A 2FMOA 1ZAIA 1GKPA 2J13A 2YFOA 3EPOA 5DMYA 4W93A 5EPDA 5LA2A 4F66A 4WOQA 4RE4A 3W38A 3L2LA 5I2UA 4IPLA 3P80A 5K4ZA 3AICA 2BGSA 5D9MA 4MMWA 1J0IA 2BVYA 1B3OA 1GTEA 2VNCA 1V6XA 4C6NA 1CIUA 2H90A 3OYZA 3L4ZA 5A6MA 5CBBA 4X9SA 2IPFA 1KM6A 2OEMA 1KV5A 1O5RA 2FH6A 4P7OA 3S46A 3WJXA 4HZ7A 3M0IA 3T40A 3GZAA 1NARA 4ZOBA 3VNMA 1TB3A 5JXQA 1KFKA 1ZSXA 4RE3A 3LRMA 4PH6A 2H6RA 3GW0A 1VFSA 2B31A 3UWUA 1U2YA 4L1GA 2PF8A 1XIHA 2CETA 1GQNA 4PRTA 1F8IA 1VRDA 4I5RA 1Q7ZA 3W7JA 1V4YA 4JKLA 4M19A 4GACA 4U3AA 2QJJA 3WH9A 5CPNA 2Z1VA 3AHZA 3OZOA 1PVNA 1F3TA 2GQ3A 2PS2A 2WPGA 3R6IA 3NO1A 2PDNA 4YIWA 3EKLA 3VPLA 3WY1A 1H7NA 1OGGA 2FZDA 2JALA 1J9YA 4AWUA 1AFSA 2VFGA 4GQQA 3O7UA 1AL7A 1QNSA 3KCOA 1OWQA 1XWYA 1D3HA 1M3UA 4JIEA 2F9RA 4N42A 6TAAA 3T07A 1AZ2A 2PC4A 4M7SA 1C90A 4Y7EA 4IMDA 1JZ4A 4AEFA 2C18A 2XYLA 3B8UA 4KEVA 1CNVA 3EKGA 5LZLA 1ZJIA 2VUYA 3TROA 4QLKA 3U3HA 2WKJA 1H7RA 2ZVRA 4ROQA 3N9KA 3HG3A 3PPCA 4KIRA 1Q6CA 3KBNA 1XH1A 1DPMA 3NSXA 3EEZA 3IJ6A 1PX4A 4O13A 1EOKA 3LGGA 1BYAA 3A4AA 4UTIA 3HGOA 2XN1A 1P5BA 2ZIDA 1V79A 1CGUA 1YPFA 2DT2A 1KFWA 3MTWA 2PWVA 4HU4A 4UOJA 1NP0A 4OOZA 2UY2A 3WJWA 5ABEA 4GUJA 1YNQA 1IXPA 3ZOAA 5IOBA 4XZ9A 1GONA 2PGEA 3PWIA 4DELA 5KZMA 5C7HA 1JZ8A 3W26A 1KGWA 4F40A 2CZ5A 4P7NA 5MF5A 4KF1A 3TE9A 1K7XA 3L0KA 5DBTA 1NF7A 2CC0A 2OX4A 4XUGA 1EC8A 1I75A 2ZZ3A 2NV2A 4E3VA 3CO8A 1EX5A 3L7RA 4AVOA 3KE0A 3T4CA 3VDBA 3MMUA 3Q58A 3C0LA 4P7LA 1RK6A 1HJUA 3ABXA 5LXXA 4I7WA 4WXYA 3TN5A 4QS5A 2X0YA 2PTXA 2Z1XA 1YXDA 2E0PA 3HGRA 4PYSA 4PCNA 1TMQA 1JULA 4YU1A 4PUDA 4PCFA 4JN8A 2XISA 1BTMA 3SSJA 2RHGA 3PANA 3GUWA 2OR2A 3DOPA 1MW0A 2J8GA 2DSKA 4MKSA 2TAAA 1QI4A 4N7QA 2VO5A 5U4NA 5CH9A 3NYZA 3FLUA 5TD4A 1HZYA 3QZ6A 1IHIA 5B7ZA 1CXEA 3CMGA 4QEEA 1TVNA 1RHCA 2CLFA 1TV2A 3N2BA 3W6LA 1M5WA 2BOGX 1DJHA 3NTYA 3BGAA 5JMUA 4WJXA 3VU2A 4A4AA 2RAGA 4GI6A 1KFEA 1DL3A 4S3FA 1EIBA 4H8VA 3KVJA 3H2OA 2NQ5A 1JF6A 3K13A 3KRUA 4GRSA 1CTNA 5DLCA 1CLKA 3ITCA 2CYGA 3GO2A 3UXDA 4IG2B 1RQEA 1V3IA 4Q8OA 3CGTA 2QHAA 2ISVA 3AIUA 4MSSA 2ZX5A 2JEQA 4CCEA 3NPVA 2JEPA 1X1OA 4BZYA 1UWRA 3AU2A 2H3BA 5A8NA 5F1VA 1EJTC 3HPXA 3IVSA 3R4IA 2PFHA 1FDJA 4KCVA 2CHRA 3WDRA 3N2XA 4ADTA 1XIBA 2PGFA 3F1QA 4GUIA 4CQAA 4NZJA 2Y61A 4QLJA 4HHLA 4W89A 3WQOA 4WY0A 1UH4A 4M0XA 3G1AA 2J7HA 4B16A 1F3EA 2ZZ4A 4NZCA 1V02E 3VIOA 3SFWA 1KQZA 3QJAA 4C6BA 3AROA 3HF3A 5I6SA 1XR2A 4C6KA 3OHIA 3IIPA 1OT2A 2Z6JA 3S6TA 1UH2A 4DJDC 2EO7A 3WX7A 4QEHA 1OZQA 4J3ZA 1TV4A 3TCEA 3OO2A 1LF1A 2Z25A 4BJHA 3HURA 1GT8A 1R5YA 2FQIA 2WJZA 2BGQA 2PRMA 4I9MA 5FAJA 1OB0A 1VFOA 3DGRA 3HMJG 4QQ3A 2D2OA 2IW0A 4QS6A 2R6OA 4EWND 3W7QA 1I0BA 5LHFA 4ZEPA 3REQB 3WLMA 4E2DA 3PVFA 3SIMA 4NRSA 3W7HA 1DQXA 3AS0A 2E6FA 4PBEA 1TV8A 3VM5A 3BQ5A 3NZQA 4S3JA 3WQ6A 2WVVB 4IL0A 2G96A 2OYMA 1C9DA 4GA8A 4CCCA 4GIEA 2XIMA 4OUEA 1GPWA 2QNEA 2PTDA 4JCLA 2Z26A 4G2DA 3TTSA 3KTSA 5D05A 4AB4A 1JDEA 2PP1A 5FSDC 4DJDA 4R53A 1THFD 4NJKA 4PTVA 3K8MA 4MIMA 1C7SA 2ISFA 4S38A 4B92A 1LM1A 3QYSA 4BF5A 3TC7A 1AZ1A 3NQ6A 2WLZA 3ZSTA 4JIRA 1E43A 5FACA 1YE6A 1UR2A 1SQ7A 3LCHA 3SGUA 5K9XA 1FOBA 2CLLA 3K46A 1WDPA 3VOJA 4AZCA 1XQLA 3GRIA 4WSJA 3WCZA 3BLEA 3G1FA 2YA1A 2J4GA 3T44A 2DV0A 3R11A 1V5XA 2VGFA 3G0XA 1JYNA 2ZZ5A 4CUCA 1WB0A 1V6TA 5BXRA 1H60A 4OV4A 1DV7A 1C9WA 2HVOA 1P6CA 2DDXA 5CPMA 1QNQA 1UWTA 4DIAA 1X7FA 1PB0A 4MNMA 3TFXA 3CUFA 3LU2A 5EY5A 4IPJA 4TOQA 2F8QA 3AZSA 3TTYA 1EJXC 5I07A 2O4MA 4G1KA 3SJNA 1AMKA 2BSLA 4W85A 3WLOA 2J6XA 3AMCA 1BAGA 6A3HA 1UP2A 2PA6A 4QITA 1FKXA 3I7QA 2X16A 2A3EA 3MSRA 4FXFA 3FA5A 1QK2A 2XM1A 3KOZA 1BD0A 2NT1A 1OX5A 1DE6A 4WY0F 4WZHA 3KP0A 3ZLFA 2VGGA 1FY6A 2FPTA 1CWYA 3QC3A 3NURA 3QEZA 1I4NA 1FTXA 4Q4QA 1R47A 4QR6A 1KRAC 2QZRA 1DYSA 4W4QA 5CC7A 3O6YX 3D6NA 4UXDA 2I5QA 1EDTA 2YLLA 3UCQA 3FYYA 4DF2A 2PWGA 3WUGA 2A21A 4LV4A 3IIZA 1Z6KA 3S1GA 5C71A 1NJJA 3RFAA 1G7VA 3EX3A 1JRBA 4K36A 4QCFA 1CW2A 1V6UA 1H5YA 3NZGA 1XC6A 1J18A 1V6WA 4QAWA 3RU8X 1KR1A 1KCXA 2TSYA 5A5WA 1D8CA 2BVTA 2GL5A 3QV6A 1LP6A 3MBDA 1VIWA 3VO0A 2QJMA 1MUMA 1WAUA 3JU2A 4JD4A 3SRKA 1KBKA 2VEMA 4KPLA 5A8PA 1MNZA 2G4JA 1GW9A 4HIBA 2NSXA 1Q63A 1KXHA 3GU1A 4XX6A 2PDFA 4CQBA 4AXKA 1L0PA 3N29A 5GJPA 4FIRA 4AVNA 4REQB 3QF0A 2RDWA 4C6IA 3EDJA 3MMDA 3WQ8A 2A2IA 1TWWA 1YPXA 3C0SA 4WOZA 3EGJA 3RAOA 3PZ9A 3HFTA 3EKZA 4J40A 2OQHA 3O8AA 3WIJA 4UTKA 3GD6A 3VIHA 2EPNA 3H12A 4HZMA 2A6LA 5IHSA 4XZMX 2VEKA 3OU8A 3QSTA 4KBXA 1IEXA 5E09A 2XVGA 1GZJA 1M6JA 3RXZA 1HGWA 2GJNA 3ALFA 3IGUA 1J0KA 3UYCA 3CL7A 2E5BA 7PTDA 3LDVA 3RNDA 1PV8A 1KC7A 2RDTA 4W7WA 4JTRA 3XISA 1H1NA 4XAGA 1TG7A 4QSFA 4OT7A 2GJXB 1GVIA 3FDKA 1VZWA 1EZ2A 4S3BA 2G41A 2A7RA 1KV8A 3H4XA 3L0NA 3NQ7A 4Q6XA 2OOFA 4HZ6A 2PWUA 1SU5A 2WZEA 3JS3A 5BROA 4K39A 1XCWA 1TPFA 1Z42A 1G4TA 3ITOA 1JUKA 4AU0A 1NOWA 3II1A 3WMCA 2QPUA 5CSUA 2Y85A 1QDSA 2EQDA 1SGJA 2BY3A 3W00A 5FF3A 4Z17A 2A1YA 1C8VA 1QW9A 3WH6A 1GYLA 1A5MC 4DUXA 1KBJA 4EVZA 1GQIA 2VRJA 2ASHA 1D3CA 1F6PA 1SFJA 1MDLA 4IM4A 2BB0A 1XYBA 3ID7A 4CKQA 2DIKA 3IV3A 5HDRA 1QCWA 3UGRA 3UR2A 1EF3A 1LBLA 3NWRA 1QFEA 4YNGA 2J9YA 3U6WA 1RV8A 2AQWA 4F2UA 2BZNA 2C6QA 3ARUA 1Z44A 3OVQA 3LERA 1JCMP 3B8VA 3UZYA 1UASA 3QLLA 1PYMA 1VEOA 3GY1A 1W9XA 4XV0A 1DJYA 1R3YA 3SJ3A 2H9AA 3ZLHA 2PGWA 3P67A 2DT1A 3NVDA 3T55A 4JTEA 4E5TA 2A3LA 2VCBA 3CIVA 1A3HA 5FOOA 5GNZA 3IWPA 1D7KA 4N9EA 4L65A 3KEHA 1AODA 3B8WA 1V3HA 3SBFA 3COTA 3E0LA 3CUZA 4DLMA 1DHKA 2X40A 2Z7GA 4IXXA 5CJMA 1LRTA 3A5VA 1EXBA 2PTWA 2ESCA 1O94A 2BHZA 2ZRXA 4ASTA 1RK5A 1XCFA 3TAKA 1FKWA 3TX9A 1UH3A 2VC6A 4JIQA 1GWJA 3VD9A 3M7SA 2GVEA 4MLJA 4NKCA 4WGHA 3MKKA 5F2GA 4JQ3A 3DFPA 5EMYA 4OBSA 2WSRA 4O0ZA 2DZXA 2PRLA 3I10A 2QUTA 1KQYA 5HMEA 3IUDA 3ZS4A 3WQDA 4TX9A 3TTEA 4JTQA 1XI3A 5T26A 2ODOA 3MUXA 5IFTA 3UERA 1R2TA 4GI8A 3E2SA 4M7TA 3W0KA 4PUMA 3NO5A 1EHAA 1RA0A 6ENLA 4B9YA 3R25A 4LPCA 3QV7A 5CJNA 1CI1A 1XUZA 1F7BA 3MYPA 2KAUC 4RPQA 3IJ9A 4DI8A 1IF2A 3PUDA 4QM1A 4V15A 1XP3A 4HU8A 4WGXA 3O1NA 3LSBA 3LRLA 1GK8A 2IUZA 2WK2A 4HNLA 5FJOA 3E96A 5FESA 3B0YA 2LLEA 3MB9A 3HZ3A 2PU0A 1AL8A 3BVJA 1IEQA 2WC7A 1YNPA 3U2EA 1KXVA 3APGA 4PMYA 1QUMA 3U7BA 1AJ2A 2PC8A 1ICSA 4ZQOA 3GNXA 1VFHA 3NPUA 3TYDA 3K1GA 3UWVA 3NDYA 1JPMA 4CNTA 3UWYA 1YE4A 1B31A 4FNPA 1EWEA 4G7EB 2XIJA 4UQDA 1O12A 1UCWA 3S8HA 1W5QA 3QV8A 1UUMA 4GH3A 4D72A 1K8ZA 2FVLA 3TYZA 1O4UA 4QG9A 4XZIA 4UCFA 3RJXA 3SURA 1HJVA 4JFWA 4DYEA 3GM8A 1NDZA 4HU3A 4R7OA 4IICA 2WWCA 5CGTA 3AIWA 5I3KA 4A8LA 1LRQA 4NAEB 4PTDA 3LHYA 4RJEA 5XIMA 5JUVA 3M5YA 1JQVA 2OKOA 3AI0A 4PUNA 2VJXA 3WZ0E 1US0A 2E7FA 2YR1A 4NJHA 4E38A 2OO0A 3CL6A 2NVCA 2XZ7A 1RP8A 2OXNA 2FIQA 2Y63A 4A3YA 4FXJA 2NXHA 1ELSA 3S1XA 1SMDA 3VAVA 1H2JA 5I3IA 3WKZA 3QW3A 3OVGA 5C8BB 4UFKA 2V5BA 4A3RA 2YB1A 4Z2HA 3GWQA 2Y1HA 3IJLA 4BK9A 3DFSA 1WCGA 1XRSA 5BOFA 3QBUA 2ZWZA 2Z7KA 1HQTA 2VT0A 5T91A 1Q6FA 1ZJHA 3LHVA 4AD5A 5JBFA 1TYGA 1JIBA 4ICNA 4HPGA 3NYDA 3GTNA 4L64A 1ITUA 4CU6A 3GHTA 3H2CA 3I68A 2R1LA 3H2MA 4FXRA 3TWBA 2V2CA 3LN3A 5TBOA 1LUCA 3BOXA 4NNBA 1TR9A 2PDBA 5GNXA 1UMLA 3W2MA 2RGMA 3N2CA 3DHDA 1WDRA 3W71A 3ZT7A 2ZZ7A 1UD4A 1W3IA 1LG2A 1DQUA 1UPMB 2P1FA 1EJRC 1E1FA 3SFKA 2EG8A 1VPXA 1J4EA 3CZJA 1OFPA 3G1XA 4JY8A 2PDJA 1J01A 1E40A 1A4LA 1H7XA 1WKFA 4L6OA 2RJGA 3RK8A 2A7PA 1TR1A 1S2CA 2R1NA 1FWIC 1V6VA 1VKFA 4IFKB 1OFDA 4EX4A 3MS8A 1M7OA 4KFPA 4CNPA 4ICMA 5HQMA 3DH7A 4JTAA 7REQB 2RDXA 1P0DA 1CYGA 1B1YA 2Z27A 2ANUA 1EA0A 3LYEA 3TQPA 1CT5A 2HS6A 3G18A 3EPNA 1G4EA 2OG9A 5E70A 1XLJA 3ONBA 1LQ2A 3SB0A 3W2UA 4HYVA 4P7QA 4LUJA 1BHGA 3KHJA 3PZTA 4Q33A 2WHMA 2Q8LA 1JXKA 4CVWA 4XBSA 1XYCA 2DJLA 2VELA 3ZR5A 1DJGA 2PB1A 3C2VA 3AJ7A 1HKKA 4WR3A 4FOJA 3D0CA 1T8QA 4GFSA 4CNSA 3CHVA 4GKTA 2YXOA 3R0UA 3W83A 5DQPA 3QW4B 2ZUVA 3WK1A 1RAKA 1ZUAX 1E56A 3QHMA 1TX2A 1UJPA 1SJDA 1YNYA 2DUAA 3C86A 4RDZA 1BSLA 1FA2A 1XYAA 4MAVA 4S3GA 4B15A 3A64A 3LMZA 5IDIA 2WMHA 1ESWA 1EUNA 3PBMA 4H3DA 3Q65A 1UPPA 1K9EA 4AFYA 3H6OA 2WNQA 1ADSA 1OADA 4AC7C 1VH7A 1W5NA 2Q8ZA 4US6A 2EKCA 4ZO8A 4DRSA 3W22A 3ZR4A 1OD0A 3PK7A 2DZTA 3RLUA 2FH8A 2IPWA 4UFMA 4DNHA 1UUQA 5IHRA 2AOSA 3I6RA 4NRRA 1KWKA 4KKXA 3MY9A 3EZ4A 3H26A 4K7VA 3C0QA 2BBFA 1H7WA 2PDWA 4KRUA 3UW6A 3WQFA 1NP2A 4Z1BA 1W5OA 4K8EA 2UWFA 1Z7AA 3SCRA 2KX9A 3WLRA 1ICQA 3F4DA 3A24A 3I65A 4NL1A 1S2AA 5AYYA 1FWGC 3NQFA 3AIBA 2HCVA 4YN5A 5LXEA 1XRFA 1JDCA 2DZPA 2QDDA 2ZTJA 4CN1A 5AECA 1FWTA 3UXKA 4LBSA 1U5JA 3PBYA 1R3TA 1TO3A 3W1MA 3TMQA 2O56A 1WUEA 4MTVA 1I2QA 3AS1A 3GXMA 1UKSA 3Q67A 4YCPA 2BLEA 1V6YA 2WNZA 4JQ1A 1EBHA 1TWZA 3VZZA 4ZQPA 5DXXA 3S83A 3DG7A 1DVJA 2ADAA 3W7LA 3CPUA 5TNVA 3C52A 2VOTA 2ZUMA 4MB5A 3EB2A 1Y5WA 1MSSA 1X7IA 2XG9A 1UOKA 1VFTA 3WDHA 3RCNA 2ZUSA 4FR1A 4LY4A 3FJ4A 1CGWA 4O19A 4XB3A 3TR2A 4HNNA 1YTKA 1X8CA 3WENA 3IANA 4L1WA 1Q6EA 3WJZA 3G1DA 4YTUA 5EA9A 1REQB 1ME8A 3P8JA 1UD3A 3C8FA 2XIBA 5AHLA 4K1GA 2YW3A 3S9YA 1TTIA 2FYMA 4UFJA 3GYEA 3QKZA 5F7UA 3WLLA 3TQKA 4PMDA 4HA4A 1RPKA 1W3HA 4C6QA 5LNWA 2OWWA 2Y7DA 1JZ3A 2JF6A 1K77A 1HFBA 2A85A 3AHVA 1JDDA 3I6TA 3DHFA 1ZQ5A 5H8UA 5I3DA 4XO7A 4UOZA 1V03A 1SJBA 3EXRA 3FSTA 4HP5A 3QHOA 3WLKX 3WO8A 4LB3A 1VBGA 4J3XA 2VZTA 1A4MA 3W7EA 3N2TA 4JQAA 5GQBA 5D2TA 1W1TA 3PAJA 2E09A 2WHKA 3AXMA 3UJFA 4R34A 2FVKA 3CV2A 2B7OA 3H54A 1ZJBA 1P43A 3E5BA 2J25A 2GUUA 4QGCA 1OX4A 1XPGA 4IIDA 4NX0A 3W24A 1WXYA 3WJSA 4HTYA 3APYA 3TLLA 3CZ8A 1VHNA 4UFHA 5BWFA 1EEXA 1LORA 8RUCA 3UYIA 1G5AA 1XW8A 3SCWA 3TMLA 4DJED 2VDGA 3VNZA 4O0KA 1K02A 4Y90A 4O17A 4GFIA 5EMLA 1M9HA 4ACZA 1CXIA 3RPDA 1JPDX 1PIGA 1D7FA 3QZEA 1I0DA 4LBRA 1M01A 2VCAA 3QY7A 1Q5MA 1LJYA 3LS9A 2DSWA 4RXFA 4C6FA 1SW0A 4PMRA 1UWSA 2XIQA 3RLHA 4JEJA 4OUIA 3LPPA 1QNVA 1JYVA 3AYRA 1GOIA 1FXQA 3G3MA 3NVTA 1KBLA 3H23A 2WVTA 2A6NA 3F5KA 3QPYA 4BI6A 4MADA 1M03A 4B90A 3OLEA 3WNPA 1UP0A 4HYRA 3CK5A 1FWWA 3CEPA 4HSNA 1I6NA 3LM7A 3T2OA 1GVOA 3TR9A 1DJZA 4JBRA 3GC5A 1QMLA 1E0XA 3BQ6A 2EBNA 2V5DA 4RK8A 3TYEA 1BYBA 1DWJM 3F2BA 3ZWSA 2FZ9A 4MKNA 1LL7A 4M6VA 2PURA 3IAQA 1AA1B 1S2TA 1X39A 4MJMA 3ABOA 2BG5A 3WBAA 1DJNA 2H8XA 2ZOXA 3GUGA 4IMGA 3TYAA 4MZ1A 2I14A 1VFUA 3ENLA 4HMCA 5DRCA 5IDZA 3PG9A 3GR8A 6XIAA 1OC7A 4GX8A 1BTCA 1RVGA 1U5HA 3ARWA 4TVCA 4LF2A 3I3BA 1N55A 4MOZA 1QOXA 2H3DA 3APTA 4O1BA 1MRAA 1XLBA 2CNCA 3E2RA 3CMJA 4UTFA 3TN3A 1J0JA 2ZX9A 1E51A 2XN0A 4YVVA 1B3WA 1DXFA 3THQA 5EMKA 4ZE5A 3GHUA 5HPOA 4EACA 4NAFB 1O5KA 4FK9A 3I7RA 4Z2JA 1WDWA 2E1WA 4O1EA 4JZ5A 4J9JA 2P8CA 3IGSA 3EX6A 3ANYA 4QBXA 4P8WA 1SMAA 7TAAA 3B06A 3H2FA 4AD2A 2C19A 4CD7A 1GHRA 2IQ0A 2E6AA 3M0JA 2QYGA 1JG9A 1UD2A 1LT7A 4QNEA 2YBVA 5ABHA 1V08A 1JI2A 1WZKA 3WQGA 1PXGA 2G3FA 2OODA 3B40A 5C5YA 1ZLPA 5A1AA 5B7YA 3CT7A 4HNUA 4AD0A 3QOKA 4LF1A 4PFMA 3VDGA 4Z1DA 2ZXQA 1K6WA 4I90A 1Z48A 3P0XA 3B8SA 1ODUA 3BXWA 3LGDA 1SJAA 4JFUA 1UZDA 4MNLA 4OIFA 1ICPA 3FJNA 1W3JA 3A12A 1VHCA 3QMSA 2Y89A 1X1ZA 1K4GA 3KTCA 4G6CA 3V75A 3GX9A 3P3BA 4US5A 3IGHX 4X0VA 4AY1A 2WZIA 3EWYA 4IISA 1FHVA 3CAKA 3WNNA 4ZQCA 2XVKA 3V35A 3AC0A 6XIMA 4BWLC 3O0FA 3FJLA 4G7FA 4WSHA 1L2UA 5A2BA 4AQLA 2VI0A 3KW3A 5KZDA 5J04A 3VKAA 4ZFMA 2A0NA 3LPFA 5AY7A 2UBPC 3G1HA 1QPOA 1Q45A 2JF7A