1LZOA

Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Structure of the Plasmodium falciparum triosephosphate isomerase-phosphoglycolate complex in two crystal forms: characterization of catalytic loop open and closed conformations in the ligand-bound state
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 89
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2002-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1lzoA00
4TR9A 3DU0A 4O0KA 2FJKA 4J9JA 5AB3A 3HB9A 3LHTA 5C2XA 1JJKA 2C6QA 3W2LA 2YW4A 1RD5A 1K8YA 3UXDA 1A53A 4Z1CA 3LXCA 4Z0JA 3W6YA 1KBJA 1LTDA 1SO3A 4FXSA 5FI8A 1XXXA 3M5YA 1O5KA 3BLEA 3NQVA 3SJ3A 1DKWA 1QO5A 4LNYA 1KTCA 2EGZA 2XN0A 1WA3A 3S5ZA 5DBTA 1RVGA 1Z48A 1H5YA 4ZQOA 4QISA 1DOSA 4HSOA 3O1NA 4NJKA 4LVGA 4UUIA 3L67A 3G3MA 4GXMA 1Y0EA 1FCQA 4K37A 4JYEA 2Y7DA 4AEOA 3PM6A 3CLMA 2DORA 5G5IA 1EP3A 1QMLA 3EKLA 3QF0A 3G18A 3LV6A 3S0CA 4NT0A 2E1DA 4K39A 4WUIA 5HR7A 3CQ0A 2QJHA 3MW7A 1B4EA 3CPRA 3AJXA 4JTGA 5LGXA 4DF2A 3N73A 3W72A 4YCOA 1SUXA 4KWWA 3KOFA 1JUKA 4K7YA 3FA5A 1BEUA 3GDTA 5I3FA 3W73A 3NQFA 3QPZA 4JYDA 1QNVA 1EUNA 3C2EA 3M6YA 4HNTA 2ZZ2A 1I8JA 2YDAA 2RDTA 1M5WA 1SO4A 3T7VA 3P67A 1H61A 3KVLA 3W75A 5HJLA 4OHQA 1GJPA 4LC8A 3GYEA 2QEZA 4BI5A 3LCXA 4JIPA 5C54A 4NJHA 1TV5A 3EXRA 1VYSX 4PL2A 1JCYA 3FKKA 3NL3A 3S8HA 3SIZA 1P1XA 3MWAA 2NWSA 2TRSA 2ZZ6A 3KHJA 2VFFA 4UTTA 2VFGA 3EXSA 5D2YA 3EX6A 3W1LA 3W2MA 3DKJA 3GXPA 3TNOA 3LTSA 3LOTA 3QMTA 2G95A 4FNQA 1A5AA 1Z44A 4XUGA 2H3BA 4QNWA 1FWNA 1XFBA 4O1CA 4UTTC 2AGKA 3P74A 4HHPA 4TU1A 4UTLA 4YCPA 3C4UA 2E77A 3M44A 4JY9A 3MUXA 3GIYA 4UFLA 4CNPA 3F1QA 4BK9A 2RFGA 2PE4A 3G0UA 4Q33A 3CEPA 3S5NA 5A8GA 3C0JA 4DBDA 3TXVA 2E5DA 1THFD 1YPFA 3TFCA 1BKSA 1ME9A 3STCA 3BVJA 4RXFA 3NQDA 4JX4A 3W7MA 5J5DA 1HO4A 1VPXA 4FX7A 5EL1A 1R2TA 1QWGA 1RR2A 4BWLC 2GJLA 3KX6A 3U2OA 1H7RA 2B7OA 3M41A 5L6UA 1FY6A 3UWQA 2BLEA 4CCEA 1ME7A 3LHVA 4K36A 4RKAA 3P8IA 1X8FA 5CPOA 1H51A 1H60A 1KLZA 3NQCA 3NL2A 2NV2A 4KFNA 1U5JA 1GWJA 1F6KA 4MLRA 3LCGA 3LHUA 1GQNA 1B4KA 4AWSA 1TB3A 3ATYA 4AB4A 4FNUA 5E93A 2NXGA 3Q58A 3MBFA 3NQMA 2R8WA 3LERA 2CLMA 3L0KA 4CNNA 5D37A 1OABA 3KRUA 4WD0A 5LGZA 3LM7A 1LROA 4DQWA 3W7LA 3TX9A 3RFAA 3NL5A 3LRKA 3AO0A 3DKLA 5G2IA 1I2NA 6ALDA 5HWNA 2OT0A 4O12A 2D73A 5H91A 1MEHA 2C18A 2I14A 3O6DA 3PUOA 1UASA 1SW3A 2B7QA 3W7QA 2YW3A 2ZRUA 2G97A 2PCQA 4N9CA 4JGDA 4MZYA 1AK5A 2Z1BA 3GNNA 4UR8A 3PULA 4I9AA 3HG2A 3USBA 2CU0A 3PBYA 2CFFA 3MO7A 1ZFJA 4AH7A 4FNPA 4MJMA 2QCNA 2WO5A 4UMAA 1XBXA 1GVRA 2GOUA 1MZHA 2E5BA 1I2QA 2F84A 3G3DA 3N9RA 2QR6A 4IMDA 3MYPA 4JD4A 4M7SA 1QO2A 1PVNA 2ZFAA 4R53A 2OCZA 1QPRA 4E38A 4N9EA 1VYRA 3IVTA 1KM0A 2JKEA 1ZY9A 4M6VA 3ABQA 1V7YA 3U8GA 4BI7A 3LCIA 2BXVA 4PFMA 4WX2A 3SR7A 3T40A 1OFOA 1H1YA 3BPWA 1OFDA 1AL8A 1EX5A 4HPJA 1WOAA 2Q8ZA 1FDYA 3W1NA 4UTWC 3EWZA 4C1LA 2QCCA 3EB2A 2Y7EA 3EXTA 1PHQA 4N6FA 1R2SA 1LRNA 5D2XA 2CZEA 5K2ZA 4O0ZA 3TE9A 1JRCA 2ALDA 2DZSA 2HS6A 3WK0A 4IMEA 1SZEA 3GLCA 3WK2A 3MI6A 2A7PA 1YDNA 2DZWA 2J9XA 2Y62A 4XKYB 3TMLA 4K6AA 5E0KA 2OX1A 3G1AA 2ZDRA 3G0SA 3GKFA 3W23A 1K7EA 3W83A 1Z42A 4O54A 3W7CA 4N4PA 3GAYA 3OVQA 3LCLA 1VLIA 1QFEA 2X1UA 2ZTKA 3C52A 3C2OA 4WZHA 3NZRA 5FF4A 2V81A 4MVAA 2TPSA 5AYXA 1I2OA 5LNVA 5FEWA 1X6UA 3N14A 3RU6A 4I7VA 4HNUA 1KBIA 4UC5A 4LRSA 4Z08A 3N3MA 1X1OA 3A5VA 2B7PA 3WFAA 5CZ0A 3SZ8A 3RMJA 3CTLA 3IIPA 1QPNA 3HGRA 5ABTA 3GDMA 1GZGA 3LXAA 1SFJA 1TSIA 4LC6A 2HTMA 3NO5A 5I3HA 5DCEA 4O8RA 1FQ0A 5D32A 4JX5A 1YADA 1F76A 1FDJA 1O60A 4M7TA 1PCKA 3HBLA 1S3HA 3MYOA 1F74A 5C55A 3IIXA 1WAUA 5F2IA 1QOPA 2ZZ4A 3B0VC 3UWVA 3MI2A 1TPWA 3W76A 1I2RA 5FEPA 3LHZA 2QCMA 4ADUA 1G69A 4UR7A 1SU5A 5J5RA 2RHGA 2GJNA 2QAFA 4FB7A 4HNVA 3G1YA 4B5NA 1AL7A 4JTIA 1IF2A 3RNDA 3WK1A 2CLEA 1ML1A 3B8DA 2RDWA 1W3NA 4NQ1A 4LWWA 1M7OA 1GPWA 5EYWA 1W8SA 1NFBA 3TR2A 4UTIA 4ZL1A 1X1ZA 2DU2A 2NX9A 3BLIA 1YTEA 2O7SA 2P10A 3PSVA 1CW2A 5K3VA 1PCWA 4R34A 3TIMA 5F2LA 4AXKA 3PR2A 4NZJA 1ALDA 2E6DA 2FB2A 1IGSA 3KVMA 5CZJA 4IGHA 4RV8A 1XBYA 4OBTA 4MKNA 1QPOA 4BR1A 3CWNA 1TTJA 1YYAA 4UFKA 2QUUA 3M43A 5KSWA 2C15A 4HSNA 1EA0A 2JKPA 4PH6A 1OFAA 3WJWA 2NLIA 1I4NA 1UUMA 4RK8A 2ZA3A 4K8HA 5DBUA 5F2MA 1TRIA 1LOSA 2YSWA 4P2VA 2GUUA 1XBZA 3SW6A 4PC8A 4BI6A 3NQ7A 4X3ZA 1OFEA 3MI3A 5CZTA 5C6MA 1W5NA 5K4ZA 4O57A 3Q94A 4IOTA 1RQEA 2YZRA 2VELA 4DEFA 3PAJA 1JULA 5I3KA 5DY2A 5A5WA 5U4NA 4UMCA 1H7PA 3FOKA 2ISVA 4ADTA 2Z6JA 2V30A 1SW0A 1TRDA 4JTJA 4LV4A 4NVTA 4XKYA 5FF2A 4EWND 3S5OA 5AYZA 2YYUA 3ATZA 2QF7A 3QW4B 4Y90A 3P5ZA 1PL9A 5HWMA 1IXQA 3G1HA 1P5BA 2NWRA 5AOUA 4KFOA 3LX9A 1KM6A 1PV8A 4Y9AA 4O4WA 2FPTA 3W1PA 5KMYA 3IVUA 1LRTA 2Y7GA 4QJ1A 5AHIA 5CG7A 1KM4A 1NF7A 1IXPA 5EPDA 3N19B 1WQ5A 2VFIA 1KV5A 2C3ZA 3WJSA 1K03A 2CZ5A 3BLFA 3DFTA 3PB0A 3I7RA 5AHMA 4H4IA 1LDCA 1I45A 5H2ZA 4JS3A 3M5XA 2ABBA 1OHLA 3V1PA 2VOMA 1XBVA 2I1OA 4AF0B 3O6CA 5IBXC 3TC7A 4WY0B 1OK6A 2VEMA 3HF3A 2EHHA 3C3NA 1YDOA 2JBMA 3P62A 1PE1A 2Z6IA 3JRKA 3B03A 3DI0A 5FF7A 3W7DA 4O15A 2XFWA 3DHDA 1CX9A 3HJZA 2JK2A 4DO6A 5I3GA 3QM3A 1WV2A 2CLLA 2FTPA 3M5ZA 4LVBA 3EEGA 2FFCA 2RKXA 2YCEA 2GVLA 3EWYA 4OT7A 2BX7A 3UXAA 5DCDA 2WV8A 4IQLA 3G8EA 1G4PA 1AMKA 1M7PA 3L21A 4MOZA 2J27A 4RJEA 1L6SA 1G4EA 2WSRA 3TJXA 3A21A 3H53A 3K30A 2A6NA 3QZEA 4POCA 2QJGA 4RCXA 3UZJA 5AC6A 4E2DA 4HN4A 3LHWA 5DXYA 5HUOA 1K3UA 3R89A 3STFA 1JQVA 1AW5A 4ORIA 3THAA 4L4LA 3KAOA 4JXCA 4DF1A 5CKSA 4GC4A 4P61A 3B4UA 2OJPA 2ZRZA 4E0CA 1ZCOA 2ZTJA 4MY9A 3BW2A 4ZQCA 2CLFA 3HGSA 3PB2A 4KKXA 2NXHA 5HWJA 3IEBA 3W84A 4UIOA 3W7RA 4A21A 1XL9A 1O4UA 4NUWA 4O17A 1KLYA 2ZRXA 2VXNA 3NPWA 2QCFA 4I7WA 2A7RA 3G24A 2J88A 5DCBA 1WX0A 3Q37A 4GBUA 3YPIA 1S5VA 3LDVA 1WYIA 5EBUA 5G1YA 3EWWA 3L65A 2WPBA 4M6PA 4QITA 3TJLA 1FBAA 1Q6OA 4IXXA 1FXPA 2ZZ3A 3W7KA 3NQ2A 4NX5A 2FPYA 4NXKA 3IVSA 2F7FA 1TPC1 3IGXA 3P84A 1KM2A 3QMRA 1O94A 3EWBX 1JR1A 2QKFA 3HPSA 3DFQA 3GKAA 1NF0A 1GEQA 4LOCA 3SI9A 2W79A 1LP6A 4RZ6A 1J5TA 2OZ0A 1A5SA 2Y7FA 3CIXA 2AAMA 3TAKA 3TA6A 5AYYA 1C29A 4BFAA 2BWGA 1KW1A 4HNNA 3L5LA 2YYTA 3T55A 1K7FA 2PRLA 1OFBA 4UFMA 1FXQA 5BNKA 3WJYA 2DJLA 3C61A 3MHGA 3MP4A 5C5YA 1VYPX 2EF9A 3FIGA 1T99A 4MUZA 1K02A 3ANYA 2V0TA 1TPH1 1IIGA 1BTMA 3HOJA 4GJ1A 3GDLA 5GVJA 4EF9A 2QCLA 4O1BA 3NG3A 3C8FA 5F4XA 4PL1A 3A23A 2C0AA 3DFPA 4JTHA 3LI0A 1GVFA 3CC1A 4GFSA 2V9DA 1Q45A 3PSWA 3W1QA 3N34A 4GUGA 4AF0A 2W0UA 2Y70A 3CU2A 3M47A 4ZZ9A 3THQA 4MIMA 5E1QA 3LLDA 2R91A 2A6LA 1I2PA 1VJIA 3HIJA 1ICQA 3HGOA 3TSMA 4FIRA 4E2BA 5D02A 5FF0A 3HPXA 5LNUA 3NPVA 3E9AA 4RXGA 4N2YA 5K4XA 3INPA 3OG3A 3UPBA 3LTPA 3Q2DA 4WQ6A 4JTUA 3W85A 1TREA 1B57A 2PC4A 3QC3A 3FS2A 2NV1A 1SO5A 4PCFA 4A2SA 3SSJA 1L9WA 4Q32A 2E5CA 3STGA 4A22A 3PBWA 1RV8A 2FB3A 1P0NA 1FCUA 4LY8A 4AVFA 3W7JA 1FWRA 3NPUA 4FIQA 3WJZA 3M1ZA 2DZTA 1KFBA 4X2RA 3L0GA 3T78A 1JUEA 3HMJG 1W54A 1SSDA 1EEPA 2ATSA 3QPYA 1H50A 3P81A 3W7PA 2CLIA 1OG0A 2YFOA 3D0CA 2YR1A 3PVFA 2R14A 2TMDA 3VFLA 3BG3A 2B4GA 1TTQA 3C2FA 3TQVA 2NUWA 4JNMA 1W5QA 2QCDB 2V82A 3VE9A 2IQTA 1DJNA 3O6YX 3R12A 1YLVA 2ZCGA 3HG4A 3MP3A 3S42A 3JS3A 4AHPA 2XN2A 1CI1A 1MEWA 3UWWA 4UTKA 1RPXA 3M9YA 2YX0A 2GQ9A 1MSSA 3P7YA 3EX3A 4JY8A 2QDGA 1VRDA 4IPJA 1JRBA 3O06A 1TMHA 3TH6A 3PC0A 4MFDA 3S9YA 3NYZA 3CIWA 3KFTA 3CEUA 4N02A 3W1TA 3R8RA 3QQ1A 2A1YA 2VFEA 1Q6LA 3MMTA 1OYBA 1XCFA 1DV7A 1ICSA 4ICNA 3HPZA 4QQ3A 2A21A 3ABOA 3NNTA 4O14A 2Q3RA 5TBOA 4NJJA 5K9CA 4WOQA 4CQAA 1UB3A 3I7SA 1RZMA 3LBMA 1FUYA 3NDOA 5HINA 4DF0A 1G4SA 2Y85A 4EF8A 2BTMA 3B05A 8TIMA 4CLMA 1HFBA 3S1VA 2FIQA 2PRMA 4K7VA 4ZQNA 1FDZA 3W3OA 1ZHAA 3W2UA 4BF9A 4AHQA 3DH7A 1BWLA 3NGJA 4OGZA 2G5WA 2C14A 2PURA 3W7GA 3GAKA 4AHOA 5D30A 2YFNA 1QCWA 4RZ5A 3ZFHA 3QH2A 3B0UX 3P60A 1SSGA 5BW6A 2C13A 2ZRYA 1SPQA 4LRTA 2WNZA 3N2MA 3MBDA 2BSLA 2ZA1A 4CNOA 1LBLA 3ABSA 5LHEA 3UQNA 4TMBA 4XBSA 4IWWA 1TO3A 2H6RA 5CSSA 1J2WA 1DHPA 4KWVA 1QR7A 3I6RA 1EUAA 3GR8A 1RQBA 1UJPA 1W31A 3FFSA 3GB6A 4Z1AA 1WXJA 2V2DA 2WKJA 4WXYA 3PUDA 4QNEA 3ZWTA 4XTDA 5BRBA 3L68A 4PTNA 2JGQA 5LNWA 1VR6A 1FCBA 2RH9A 1DJQA 1ZAHA 2ISSA 1OVDA 3W88A 3P61A 2YXGA 5AC8A 4JICA 5DXXA 3BK0A 1G6CA 5D33A 4Y8FA 2FLIA 3CHVA 2WNNA 3L66A 5D09A 3TSDA 5I3JA 3TAOA 4NJIA 4JTTA 2WOQA 2OMAA 4O19A 2J9YA 2VFDA 4ALDA 1B9BA 4O11A 3S5YA 1T8XA 1P4CA 4JYFA 5G4EA 3DAQA 1OF8A 1TQJA 4FX6M 1OX6A 3LRMA 4UTMA 3QJAA 1LRQA 4M5PA 4ONVA 1KFCA 4TO8A 3LXBA 1ICPA 4HT3A 1PIIA 1GVQA 1W3TA 4IPIA 5TIMA 4AMAA 3PBVA 1N55A 3W9ZA 4WOZA 2QUVA 4JDBA 4O16A 5AFDA 3DGRA 4IUOA 3DI1A 2X30A 3P82A 5HQEA 2VEKA 2QCDA 3LB0A 3TCEA 3TFXA 3G22A 2GPTA 4S2BA 2E68A 5LNRA 3FLUA 1NEYA 1OYAA 2WNQA 1HO1A 2TYSA 3NA8A 1WBHA 3UWYA 1L6YA 2OT1A 1G67A 4GE8A 2CLOA 1S5TA 4TMCA 1NAL1 1VZWA 1JCJA 1ONRA 3G1DA 3GDRA 5HULA 5K9DA 1MXSA 1OYCA 1A5CA 4QIUA 1JCNA 2P1FA 1LOQA 1LBMA 1OX5A 2ZRVA 2ZQ0A 3DZ1A 4OV9A 1FWWA 1XDMA 5CGQA 4FHAA 5D2VA 3M16A 4IX2A 4UMBA 4EOUA 2WQPA 3KVKA 1G7VA 1RQHA 4R7JA 4CCDA 1XUUA 3QW3A 4U4MA 3N2XA 1HL2A 1YPIA 4N9BA 4G1KA 4YLWA 1Q6RA 4NZFA 1DORA 3NL6A 1F2JA 3LBCA 1LCOA 3E02A 2Y61A 3EX4A 3W1RA 3S1UA 1EP1A 3W1AA 1LLZA 2A7NA 1H7NA 5FF3A 4FXRA 3VKJA 2Y63A 1C9DA 5HR6A 4WY0F 3DFNA 3G1SA 3E12A 3EWXA 2V8ZA 4RLIA 1E51A 5K7JA 1N7KA 3DBPA 4LT9A 3A9IA 3S6DA 5CPNA 3TV8A 4IJBA 1G4TA 4QM1A 3MP5A 3ELFA 3NQAA 4NNAA 1EIXA 2ATMA 1LOLA 1TJPA 2WSQA 1VC4A 2E6YA 1OK4A 3NPXA 1TCDA 3W74A 2CLHA 5SWUA 3NR0A 1JCXA 4LS0A 3UD6A 1KA9F 4GUIA 5HMSA 3LGEA 1K8XA 4LTSA 3FJ6A 4UXDA 1QPQA 2A0NA 3FEMA 4FF7A 3STEA 3W86A 4I7UA 1XM3A 3W70A 2YPIA 1GVSA 3GVGA 3O15A 4LS2A 1H7OA 2CLKA 1MO0A 4LW7A 1W37A 1W5PA 3FJLA 3L2IA 2O7QA 1VCGA 2FQIA 2WJZA 3P5YA 2DJXA 4ADSA 1G7UA 4JTKA 4LV9A 1A50A 3DENA 1AW2A 3W7HA 4JTEA 4S2CA 4O50A 3NQGA 4PEKA 2JGYA 5BOOA 3GXTA 3SGZA 2ZA2A 2H90A 3W1MA 3UPWA 5D05A 4Z0SA 2VEIA 4HPXA 5IM51 3HQ1A 3CWOX 4UFHA 3UZ5A 4MYXA 3FKRA 3O16A 2A4AA 3QQ0A 1VHCA 1D9EA 2QCEA 3OHIA 1VH7A 1C8VA 4YMZA 1GTHA 1OFRA 1DQXA 5EA9A 2VKZG 1DVJA 3G8RA 3JR2A 1LLWA 1HTIA 1P0KA 5KITA 2NUXA 3C6CA 5DY3A 4DELA 1SZNA 1GG1A 3A22A 3EKZA 1EWDA 3WK3A 4DBEA 5CSRA 1YXCA 4ML9A 1T0OA 4OE7A 4O4VA 4X9SA 3C2VA 3TUUA 3DHFA 1ZALA 2H8XA 4OQVA 4FEZA 3GNDA 1Z41A 1X7FA 4OV4A 3NM1A 2NX1A 5HNRA 3PG8A 3EX2A 2FPVA 5DELA 3PS7A 2DZUA 1K8ZA 3QEZA 3QYQA 2P0OA 3OEXA 3BG5A 3GXNA 5G2WA 2DZPA 1W0MA 1DQWA 4UCGA 1Q6QA 2ZBTA 1FX6A 5KTLA 4NNBA 3TQKA 2VEPA 3UWUA 3NEVA 4HIBA 1QDSA 5LNSA 3KRSA 5AHNA 1F7BA 3LV5A 3QMSA 3H54A 1EB3A 1J4EA 2CZFA 5D03A 4D2JA 5D2TA 4W9TA 2NZLA 5AC7A 3DFSA 4A2RA 1GG0A 1KFKA 4A3UA 4AWTA 1R30A 2TSYA 1QOQA 3LRLA 1IXOA 3VE7A 3PBUA 1O95A 4CCCA 4H6KA 3L9CA 1UCWA 3LCFA 1XC4A 3W7EA 2ZZ7A 2Y6ZA 4UFIA 1BWKA 3VI2A 4ZVJA 3DXIA 4LUJA 4EIVA 5LSMA 3NVTA 2V2HA 4UNLA 2J9ZA 4AAJA 4QAIA 3B0PA 4NJGA 1R2RA 3I7QA 4NX0A 3TK7A 3TW6A 2UV8G 4PODA 4IXHA 2GQAA 4JN6A 4LVFA 5LKYA 4UNKA 1YXYA 1KM1A 4M6QA 2CZDA 3SFKA 1SR9A 3F4WA 4TX9A 5KZEA 4ZMGA 1TQXA 5FESA 3L5MA 4DXVA 3HO8A 4K38A 5T26A 5D2WA 4WY0A 3GR7A 1UBSA 1NSJA 1WBJA 2ABAA 1ADOA 3NQEA 3TW7A 1OX4B 2QAPA 1GVOA 3QRHA 3HG5A 3GX9A 1LORA 4BWLA 1DBTA 2C16A 2HSAA 3KVJA 3TROA 1XKYA 1HUVA 3GZ3A 3C2RA 3G0XA 1VLWA 1EPXA 2GQ8A 3MJYA 2E6FA 5G2HA 4X22A 4Y6GA 3IIOA 3W7NA 3LTYA 4JTFA 4YXGA 1LM1A 2V5BA 1F73A 2E09A 1JVNA 4QSHA 5EY5A 3SGUA 1XI3A 2B0MA 1B3OA 1W56A 3RLVA 4MZ8A 2C19A 2ZRWA 4JEQA 5LZLA 3OIXA 2DZVA 4CQ9A 4EVZA 1TPEA 1VCFA 3ABRA 4FO4A 2E6AA 4FNRA 1OFQA 3TSBA 2W6RA 4NXSA 4XZ9A 1JUBA 3IGSA 3S1XA 1ZNNA 1YTKA 5F1VA 2Y88A 3M5VA 4Q4KA 2Z2UA 3LLFA 3WJXA 5AN7A 2QUTA 5KINA 3TKFA 3H55A 1M6JA 5BMXA 1IIHA 1GT8A 4Z1BA 2HMCA 1VS1A 2X1TA 2Y89A 4JX6A 1KFEA 1KTNA 3HGJA 3B04A 4O18A 1R47A 3HG3A 1TIMA 5AHFA 5DN1A 3DFOA 2QCGA 4O1AA 4LVAA 3IIVA 4O1DA 3LCWA 2VENA 2GVJA 5EKYA 1VGAA 1SZGA 2NX3A 3MHUA 4O10A 3C56A 1LZOA 3W2JA 1KM3A 3W2NA 4PA8A 3RLUA 3BW4A 1LBFA 3BG9A 1TPUA 3PY2A 4Y96A 1FWTA 2H8ZA 3IGUA 1DL3A 3E0IA 1F5ZA 3SY5A 4UTJA 1SFLA 4IMGA 1TYGA 2VC6A 3F4NA 4N6EA 4UFJA 1W1ZA 4O28A 5FEXA 4LUIA 1ZJIA 3UNDA 1KM5A 5K9XA 1JCLA 1VQTA 2A85A 3A24A 4MY8A 3TC6A 1WDWA 3UY8A 1EWEA 2Z0IA 3CB8A 1KTBA 2X16A 2H3DA 3W1UA 2B7NA 4UTWA 1XDLA 1AW1A 3ZWSA 2RDUA 1IXNA 4L4MA 4UTUA 2DP3A 3G1FA 2JKAA 6TIMA 4ORMA 1WOBA 3W7IA 2EAWA 5F4WA 5F4SA 3W71A 3G1XA 3BO9A 1YXDA 3BGGA 3F03K 4U28A 3T4CA 3R2GA 2VFHA 4DPPA 1H62A 2V5LA 3M7WA 2BZNA 4IMCA 2GVGA 1TPFA 1QAPA 3A5FA 4DO5A 4YL2A 2ZZ1A 5CPLA 5KZMA 1NVMA 3W2KA 3TXZA 4ZQPA 4RX0A 4C1KA 4DPQA 1OX4A 1Q3NA 3PWAA 3EWUA 2QDHA 3OVRA 1SW7A 4FNTA 4OWGA 3L5AA 4CQ8A 1ZAIA 3LCHA 4ZQMA 2ZZ5A 1VHNA 1YDVA 5EMUA 3PG9A 3PUEA 4HKPA 2AQWA 4H3DA 4GUJA 2EPHA 1R46A 3BW3A 3RF9A 3ZS4A 3NQ6A 3W87A 3N9SA 4ZQRA 1W5OA 1L2UA 3MHFA 3KXQA 3NAVA 5G4WA 5U7SA 1TPB1 3VNDA 3R13A 4NNCA 3V75A 1AG1O 5D38A 3E96A 3TU9A 4XTIA 1GYNA 5DLCA 4JR5A 4GUHA 2I9EA 1FCVA 1YTDA 2A2IA 1F6PA 5I3IA 4GUFA 1TPDA 4LU0A 4WJEA 2XN1A 3OA3A 3W7OA 4UTHA 3OBKA 1TTIA 3QSRA 3I68A 5AHEA 3UWZA 3G1VA 4JIQA 3BGJA 3GDKA 3NXFA 3TQ0A 5G1TA 3PF3A 3S1WA 2R94A 3GK0A 1N8FA 1OF6A 4DO4A 1TV8A 1H7XA 2ISWA 3L0NA 4O53A 4FNSA 3BV4A 4NU7A 3W07A 1HG3A 3CT7A 5KZDA 2LLEA 1F05A 1ZAJA 1O5XA 3UY7A 2C1HA 1U83A 2KZHA 1FWSA 4IMFA 3LI1A 4XWUA 2PRHA 4OU1A 3FYOA 3O07A 2X2GA 2EKCA 1SZFA 3TDFA 3ZR4A 5F2GA 4S1FA 4GRSA 4LVDA 4LS1A 2A5HA 1EP2A 4JDYA 4MFEA 3B06A 1VCVA 4YWIA 2Q3OA 4RZ4A 4MJZA 1W3IA 3IIZA 3E49A 4O52A 1JQXA 2FDSA 1K7XA 1T96A 1D3HA 1ZENA 1D3GA 2X1SA 2YGYA 2J6XA 7TIMA 1H63A 5AHLA 2Q8LA 1KFLA 5BMWA 4N9DA 3U6WA 2CWNA 4FX8A 1PHWA 3W1XA 3O63A 4TIMA 3FYPA 3T44A 1SQ7A 1SO6A 2CW6A 4MZ1A 4MLJA 4WXZA 3P80A 2G96A 1A5BA 5CZSA 5F1UA 2DZXA 3R5EA 3TMQA 1TJRA 4MPQA 1L6WA 1KV8A 1OJXA 1S5WA 4N4QA 4XBKA 3P8JA 2NUYA 4GWEA 3I65A 4A29A 1KFJA 1GYLA 4XQ6A 4M19A 3UYCA 3NM3A 3IRDA 1TV7A 3CM4A 1GTEA 4R33A 3W22A 3EX1A 1PS9A 2X1RA 4RR4A 3M0ZA 5L9FA 4O13A 1OFPA 1LYXA 2WSYA 5TQLA 2HS8A 1H7WA 2NXIA 2ZYFA 4GNJA 1UUOA 3QFEA 3IV3A 5IBXA 4KFPA 3KRZA 2J24A 1ME8A 5D04C 5FEZA 1TPVA 1TTPA 1MEIA 5HUPA 2QJIA 4MY1A 1H1ZA 3QSTA 3NZ1A 4JTSA 1XUZA 3SECA 4IX0A 5MHBA 3OVPA 1GOXA 4AWUA 5CPMA 3BARA 3NQ8A 3RK8A 5LHFA 4K8EA 3O8AA 4MYAA 3NOEA 2QCHA 1JCMP 3LHYA 4Z1DA 4JTLA 1V5XA 3O05A 2V2CA 3VCRA 1W5MA
chains in the Genus database with same CATH superfamily
3IGHX 4TR9A 3K4DA 4L56A 2Z7GA 3H2EA 3VNKA 5TAOA 5C2XA 3GXIA 3URNA 1XWYA 3UXDA 2OFJA 4QDPA 1TWSA 1LTDA 1WDDA 1SO3A 1TV4A 2Z24A 2ALRA 2VTFA 1PZ0A 3BLEA 3SJ3A 4NAEB 1PYMA 1MXDA 3IUDA 1Z48A 2V5DA 1HKJA 1V7AA 1WB0A 3R0UA 3SN4A 1OC6A 4LVGA 1FWAC 1NOFA 2CNCA 4GXMA 4I9TA 2PDHA 4MDOA 1FCQA 2OVLA 3WDJA 4K37A 4B3LA 3CPUA 4AEOA 5G5IA 3EDJA 1QMLA 1JDCA 1P6WA 2FHCA 3LV6A 3QF0A 4YVPA 2E1DA 2VWTA 4CD7A 1EHNA 4WUIA 2QJHA 4O1FA 1QATA 1B4EA 1FHVA 3CPRA 3URQA 3V5FA 2RDXA 1EOMA 4PMNA 4JZ5A 3BSHA 2PWUA 4KWWA 4K7YA 2OWXA 3KL5A 3H22A 3QPZA 3SADA 1I8JA 3HU7A 4QTGA 2RDTA 4S38A 1M5WA 1KCZA 5C2CA 3RDKA 3P67A 3KVLA 4KRZA 3W75A 1NQKA 5HNUA 4OHQA 1EDTA 4LC8A 4GO8A 4BI5A 3LCXA 2C71A 4YJ5A 3WMCA 1BQCA 2BY1A 5AC4A 1VYSX 3KBMA 3NL3A 3DYMA 1N2VA 2OQHA 5HJYA 2NWSA 2VFFA 4CU7A 1XQKA 3EXSA 3DYOA 4MUPA 4ZENA 1DHKA 3TNOA 1ZL1A 1O5RA 4DYEA 1A5AA 4OOUA 2WSKA 4XUGA 1FWNA 3RCYA 3GHTA 4G5DA 4JNYA 4TU1A 4UTLA 4QDMA 4WF7A 3C86A 4UFLA 5HNNA 4BK9A 3UXLA 1RJQA 5M03A 3G0UA 3C0JA 1VFFA 3BOFA 2E5DA 4LUTB 1LG1A 4RXFA 1VPXA 3GC2A 1QWGA 4IQJA 4BWLC 3V4BA 3UR7A 4HYVA 2NVCA 2I16A 3WNPA 1H7RA 2REQB 1AVAA 3GBEA 4TVCA 4XV0A 3VXGA 4XG1A 3AZTA 1P7TA 1ME7A 4K36A 2VD9A 1X8FA 3IAQA 5CPOA 2HRWA 2RGMA 3PJXA 2ZUMA 3NL2A 4KFNA 4HMDA 4MLRA 3CMGA 4XD3A 3LHUA 4IIGA 1B4KA 4B90A 1OB0A 3ATYA 5ABFB 2BV9A 3SCQA 1W17A 2A3AA 4RUBA 3UZYA 2GQ3A 3Q58A 4A3HA 3MBFA 3QKZA 2WK2A 1PWLA 2CLMA 4MAZA 2GK1B 4WKFA 3KRUA 4WD0A 5LGZA 3QHOA 4DQWA 3W7LA 3D46A 1H49A 3RFAA 2D24A 3VKDA 3NUKA 3AO0A 4XAGA 1R3SA 5HWNA 4O12A 3N13A 3T0CA 1MEHA 2I14A 3RR1A 5ABEA 3W7QA 2ZRUA 4OUEA 2HDJA 1JI1A 4UR8A 3AU2A 4D71A 1OINA 3RRXA 4PUEA 2CBJA 3WEZA 4FNPA 3M0LA 1XCWA 2XU2A 2BVWA 3CV1A 1B54A 4HOWA 1EZWA 2W4XA 2E5BA 4DN1A 3EYPA 1I2QA 2PODA 1XIEA 3N9RA 1PVNA 4F2TA 1KM0A 3BAIA 4WEVX 4ATWA 4M6VA 3MS8A 3AHTA 3U8GA 4JBRA 4LX4A 4PFMA 3IAPA 3GW3A 3T40A 2XPKA 5IHRA 1YPXA 2WKLA 1WOAA 3R6IA 3W1NA 4HJFA 3EB2A 2BVYA 4Q7IA 4CNTA 5H1WA 1X97A 3ES8A 1GOKA 1T8QA 2CZEA 4O0ZA 3B8WA 3W81A 1JRCA 5IOBA 2HS6A 2WW5A 4IMEA 5HJXA 3GXMA 5E0KA 2VR5A 3MCNA 3WH6A 3PTMA 5CJNA 2YBVA 1UR9A 3MSRA 1M7XA 4PMUA 3N6JA 4O54A 3FJNA 3W7CA 3GAYA 2E67A 2ZTKA 1J6OA 3C52A 3U9IA 4WZHA 3C2OA 4MVAA 2TPSA 1GJWA 3WNNA 3EA3A 4GX8A 4GQ0A 4BQ2A 7TAAA 4PN2A 1CDGA 4K8GA 1V4YA 4AMCA 3WFAA 5CZ0A 4V1XA 3SZ8A 2QGYA 3HGRA 1KRMA 3GDMA 4J3WA 1TSIA 5I3HA 3R8GA 4O8RA 1UZHA 4JX5A 3UZZA 1KFWA 2EPKX 3OZMA 4M7TA 1GJUA 2J7CA 2WMIA 2F2KA 2R1NA 3MYOA 1CNVA 3ORWA 3IIXA 1OCJA 5F2IA 3VAVA 1XRTA 5C9UA 3AMLA 1OT1A 1TPWA 2PGFA 4M80A 5FEPA 1NP0A 1EFZA 4PEEA 3LHZA 4JIHA 3UW6A 4ADUA 1G69A 2DFAA 4JQ2A 4UR7A 1SU5A 4WLCA 3VTRA 2GJNA 4FB7A 2PP3A 3G1YA 2C7FA 2VR2A 5FJIA 3B8DA 1QW7A 3V36A 4HCLA 4LWWA 4FMVA 3H26A 4Q6JA 4ZB0A 3FHAA 5A6BD 4L6OA 3PZGA 1SFSA 2GDVA 1X1ZA 3R11A 3W25A 1H0GA 2NX9A 1TKKA 2W63A 3BLIA 2O7SA 3PSVA 5HDRA 1CW2A 5CC3A 4NI3A 5K3VA 3ARQA 3MMWA 4ICMA 1HT6A 3TIMA 5F2LA 4LNCA 5EFDA 4C6NA 1IGSA 1W8GA 3KVMA 3L23A 3A64A 1QPOA 2QMKA 3CWNA 4QSFA 1BRLA 2Q01A 3CAKA 2NV9A 4HSNA 1KD0A 3RJYA 1EA0A 4XB3A 3WJWA 4M3PA 2AL2B 2PC8A 4K8HA 4S23A 1TRIA 1LOSA 1OIMA 4B3ZA 3ZIZA 2GUUA 1XBZA 4PC8A 4BI6A 4M8UA 3MI3A 4C5YA 5C6MA 1UWIA 3FXYA 4PE8A 3CHEA 3WN6A 4G7FA 2PDLA 4DEFA 1O6IA 5I3KA 1UYQA 2E40A 1H7PA 2PI6A 1WKYA 7ENLA 1BQGA 4NVTA 5AYZA 1W2VA 3AWNA 1IXQA 3G1HA 3MSYA 1P5BA 2NWRA 4KFOA 1KM6A 1PV8A 3SQLA 3IJIA 2V5CA 2Y7GA 4QJ1A 4U31A 1NOWA 5CG7A 4YIWA 1KM4A 1NF7A 2JFEX 4N7QA 1IXPA 3HV8A 4HP5A 2WC4A 5CC6A 5AHMA 2ZDSA 2O4QA 4JS3A 3M5XA 4CU6A 1OHLA 4PFHA 3M0MA 2VEMA 2VZUA 2JBMA 3UGRA 1P48A 5LYRA 2DW7A 3SCOA 3JRKA 1RALA 3DHPA 3W7DA 2XFWA 1W6TA 1LT7A 3T42A 3HZ3A 4AUBA 4RNIA 1UD6A 4M82A 2E9LA 3NO3A 4EXBA 4IT1A 3WUFA 5I3GA 1WV2A 4GA8A 1W91A 3LQGA 1UMLA 4GINA 3WD1A 1E9LA 2YIHA 1TWWA 3UETA 1G4PA 1M7PA 3L21A 4MOZA 1LQ2A 2WSRA 3TJXA 1B3YA 4A8LA 2F6XA 3H53A 4KWUA 3IUIA 5C7VA 1R3QA 2CHOA 3G6MA 3UZJA 4E2DA 1V3IA 3CB3A 3KAOA 5CKSA 4P61A 2R82A 3B4UA 2OJPA 3B8VA 1ZCOA 1EC8A 1GVIA 4MMWA 4MY9A 4H8HA 1TX2A 3LPPA 1KKOA 2CLFA 5BCAA 3PB2A 4PRRA 2PDGA 4AY1A 4UZSA 4O17A 3ENLA 2XM2A 3NPWA 1XS2A 5DCBA 4W86A 3GH4A 1T40A 3MUIA 3MMUA 4QITA 4M6PA 1FBAA 2JQXA 4IXXA 4DIAA 3NQ2A 4NX5A 4JKMA 1NWSA 4P7QA 4NXKA 2EG6A 4ZA0A 1EBGA 2RUSA 1RCXB 1QVBA 1QTWA 2F7FA 4KBXA 5A94A 1KM2A 5FA5A 1O94A 1JR1A 1FKWA 1N8IA 3MANA 3DFQA 3SCPA 4UQBA 1ZPTA 3W27A 3WX7A 3GKAA 1NF0A 2XVNA 3TP4A 1GEQA 2CERA 2VVSA 4GKLA 3IJQA 2HVNA 2AAMA 3TYDA 1V6XA 3EOUA 3OZOA 1R3RA 3TA6A 1DJHA 4EE9A 3GU2A 5CSYA 2E8ZA 3T55A 2PRLA 1HL8A 1Y5XA 4UFMA 3WJYA 4ZOEA 5XIMA 4HPGA 1VYPX 3FIGA 1PZ3A 4AC7C 1K02A 3WQVA 2V0TA 3AWOA 3ZXWA 3UJFA 1U33A 3USZA 5PTDA 1XJBA 4G7EB 3GDLA 4Y8EA 5GVJA 2DH2A 1DXFA 3A23A 1LL7A 4JTHA 4GIEA 3CTTA 3LI0A 1OBAA 4QG9A 4BS0A 2X42A 3B9EA 4AF0A 3NZPA 4X61A 4ZZ9A 3THQA 3T2OA 2DT3A 1VJIA 3TSMA 2F6UA 3PFMA 4G56A 4E2BA 4W88A 3NPVA 2HPMA 4RXGA 5K4XA 3TCSA 3AUJA 3NVDA 1UOKA 4AZBA 4GD0A 3RITA 1B57A 1MW3A 3OPSA 4A2SA 1H2JA 4A22A 4F8XA 3CUXA 3ONCA 1E73M 3WLKX 1TX0A 2BGNE 3WJZA 3IJDA 1S46A 3CL8A 1Q2SA 3M1ZA 1MNSA 4DUXA 1B30A 2D2OA 3T78A 5ENLA 3QV6A 3SY8A 1SSDA 2PWEA 4KCVA 3EMQA 3CT2A 3QPYA 1GCYA 3P81A 2CLIA 3QV8A 4CU8A 2YFOA 3V7PA 3LA4A 3A47A 2TMDA 3N12A 1DIKA 5AC5A 3BG3A 1UWAA 3VE9A 1CPUA 4Q4SA 4QS5A 1HJSA 3HG4A 3RAOA 3MP3A 3S42A 3W4RA 3JS3A 4AHPA 2VQUA 3PJTA 4GMEA 1EQCA 3QOKA 1EJXC 5DQPA 3OYXA 1VRDA 8XIMA 2XDFA 3TH6A 4MFDA 1H0IA 4D9PA 4I9MA 5BOEA 1JIBA 3W1TA 3MMTA 4ICNA 4JKKA 4JL2A 3HPZA 3ABOA 3NNTA 2Q3RA 5TBOA 2R9RA 4NJJA 3UG4A 5K9CA 4QLLA 3I7SA 3MCOA 6PTDA 2J6VA 4Q22A 2BTMA 2FHBA 4DZ5A 2PRMA 1Q6GA 2DUZA 3WLMA 4K7VA 5CZKA 4BF9A 2VDGA 1P6BA 3DH7A 3NGJA 2FVMA 3GAKA 3VOCA 3ES7A 4ZXLA 1NY1A 4D6DA 3B0UX 3P60A 3P93A 4MKSA 1SSGA 2ZRYA 1UZ4A 4LRTA 2BSLA 2ZA1A 3QOMA 4H83A 3LGDA 3UQNA 1DJWA 4TMBA 2X0YA 4OVXA 4XBSA 1PIGA 3LQLA 1J2WA 3LMYA 1EUAA 3GR8A 3IK4A 1UJPA 3WLSA 3FFSA 1AMYA 1V77A 1L2QA 1JF6A 3CV6A 2V2DA 2WKJA 4WXYA 5BRBA 4PTNA 1UR0A 5LNWA 1WKEA 1DJQA 3WQ8A 1OVDA 5A8NA 2HJPA 2YXGA 4PZVA 5DXXA 4HPHA 4Y8FA 2FLIA 1X8CA 5I3JA 4J3XA 4P7RA 4JTTA 2ZUWA 2WOQA 4XK2A 4O19A 1Q6CA 3AMGA 1B9BA 3BQ5A 4JYFA 4DVOA 2Z2AA 3QFWA 3POCA 4FX6M 1R85A 1OX6A 3CV7A 1MFVA 3VO0A 4UTMA 1E6NA 4YU1A 1LRQA 3OHMB 1W3HA 1KFCA 4TO8A 3VDAA 1W3TA 1RUSA 4FK9A 5TIMA 4AMAA 3WF0A 3T8LA 4CD5A 3WDRA 4E5TA 2QUVA 3ZVHA 4LF2A 2X30A 5HQEA 3NSXA 2VEKA 3TCEA 4KIEA 4OUIA 3FLUA 1YHTA 1HO1A 2OO6A 1F8MA 2DT0A 3F4CA 4A8RA 2OGJA 4B4FA 1L6YA 2OT1A 2PSNA 3T09A 1XLJA 3CHCA 1UKOA 4DZHA 3K13A 1ONRA 3ARUA 4WSHA 1DE6A 1MXSA 4R7WA 1E1CA 3AXKA 2D2HA 3QQWA 3AYSA 4O1EA 4EAYA 4OV9A 1UWRA 2YLLA 1FWWA 3PN8A 1IZCA 5D2VA 4UMBA 1KGXA 3KVKA 1RQHA 4R7JA 4XZNX 2HISA 3N2XA 1FFRA 4N9BA 4B2DD 1F2JA 1GORA 3MC5A 3PUGA 1LCOA 2PFHA 3ITTA 3SGGA 5HOSA 3PNUA 1UD2A 3A9BA 2VZSA 4AD3A 1H7NA 1XRVA 5FF3A 4FXRA 3BE7A 5TF0A 4DHGA 3DFNA 2NT1A 1S38A 3G1SA 4GBDA 2V8ZA 4RLIA 3UCQA 4LB4A 4LT9A 3TV8A 1G4TA 4QM1A 1V6TA 3NQAA 3V3WA 1TJPA 2X0HA 2ZXDA 3E0FA 3H23A 1XQLA 3VKCA 1K8XA 3R79A 3VVGA 4LTSA 5I03A 3FEMA 2HV5A 3CGTA 3PPFA 4I7UA 2R1MA 2YPIA 1GVSA 4W7WA 2IMRA 1X6LA 1US2A 1HIZA 4CNSA 3L2IA 1WPCA 1OT2A 3BCJA 2GSHA 2XIIA 4QJ3B 1XICA 4L65A 1G7UA 4M29A 4JTKA 3AUOA 1UH3A 3K5XA 3NO1A 3DENA 1AW2A 4FOKA 3KCLA 1YX1A 4V15A 4WHBA 3W7HA 3NQGA 3L4VA 5BOOA 1TCMA 2L5HA 4DM2A 1KQYA 4I5XA 3H12A 3VCNA 3HQ1A 3CWOX 4HK6A 1JYVA 4MYXA 2XISA 3FKRA 3O16A 3GU9A 3L2MA 4NY2A 4EAMA 1VHCA 1PO9A 5LIWX 1RLDA 1PTGA 5CLWA 1C8VA 4YMZA 3VD7A 1YKWA 4PMOA 1DVJA 1P0DA 1L6FA 1HTIA 4MPKA 4C7GA 1B90A 2D20A 2J25A 3C6CA 3RM9A 4R7OA 3A22A 5A8OA 4JCLA 4YPJA 1YXCA 1FVPA 4ML9A 3IPWA 3SCNA 3SRFA 4X9SA 3TUUA 3DUGA 4FEZA 3PBMA 2NX1A 3UXIA 2G3FA 3PG8A 1EZ2A 3PS7A 2DZUA 1GHSA 2HBVA 3OEXA 5G2WA 1W0MA 1MQQA 2IQDA 3WZ0E 1I9CB 4I90A 1DE5A 4GVGA 2HNEA 1Z9AA 4HYWA 4LAOA 3TQKA 3TJ4A 3WQ4A 1ELSA 4H6RA 1AFSA 1WUEA 3KDOA 3QMSA 4FPSA 3VZYA 1J4EA 3GM8A 1XLEA 4IMAA 1A5OC 2NQ9A 5D03A 2NZLA 4L9ZA 3DFSA 1XIFA 3M0VA 4A3UA 3A4JA 1C7SA 2TSYA 2BS9A 1QOQA 1IXOA 1C90A 1QNRA 3PBUA 2PAJA 3CZKA 4CCCA 4H6KA 3COTA 1KGUA 3NFUA 2MUCA 4UFIA 4ZVJA 2FVKA 4A3YA 3UJRA 4QAIA 3B0PA 4NJGA 1UKTA 2YCIX 1EF3A 4LF1A 3WQFA 4DJEA 2GQAA 4JN6A 1X39A 5LKYA 1IWAA 2GDQA 2W92A 2H9AB 4R9XA 4HQVA 1SR9A 3F4WA 3GTXA 3HO8A 4K38A 5T26A 3N2BA 1P1MA 1HP4A 1NSJA 3RCMA 1WBJA 2ABAA 5B80A 2DZBA 3V1HA 1BVNP 4FXFA 3SCTA 1ISVA 3GX9A 1LORA 1J0JA 1JYXA 4AZCA 3UR2A 1NWTA 1JZ7A 4S3DA 1U2YA 2HSAA 3RUBL 1R3YA 3VOIA 5CXPA 3OJGA 4GFIA 4EXAA 3G0XA 1EPXA 2QJMA 3CYJA 3U4AA 3WH9A 2GQ8A 3MJYA 1BWVA 1XIBA 5G2HA 3AXHA 3IIOA 1QK0A 4YXGA 4CKQA 4AD5A 1T7LA 1XI3A 5B7ZA 4KESA 7PTDA 3VC6A 3FVDA 1S3TC 1L6GA 4CQ9A 3KTCA 3C0QA 2CBIA 4RV3A 1UQYA 3WLHA 4NXSA 1FA2A 1WXZA 4DYKA 2BGQA 3BLOA 1POJA 5A2BA 5F1VA 4EKJA 3LLFA 2QUTA 2JF7A 1JYWA 4KGJA 3MMDA 2WAGA 1H41A 6ENLA 5BMXA 3WQCA 1CGVA 3BOLA 4Z1BA 2AAAA 1VS1A 2X1TA 1Q85A 3FHQA 3SRKA 2BHYA 4JX6A 2W27A 3HGJA 4HZ6A 3HQOA 4O18A 1R47A 3JW7A 3CO4A 3HG3A 5AHFA 2EG8A 5JH1A 3DFOA 2O55A 3LCWA 2VENA 1FWJC 2ZOXA 1REQB 4M1RA 4ZODA 4HZ8A 1KM3A 1JD9A 3BW4A 3T4WA 4R88A 4DXXA 4QE4A 3E0IA 1F5ZA 4IMGA 2OYMA 1KR1A 3F4NA 2VOTA 1RJPA 1W1ZA 1YW1A 4MB1A 3UNDA 4DJDD 4B5UA 1DXEA 4UTFA 3VPLA 3C0LA 1JGIA 4PGLA 3GBDA 2J62A 4UTWA 5GJPA 1AW1A 4L4MA 3I3DA 3P6LA 2DUXA 2BVDA 3W7IA 3CAWA 1GZJA 1UR2A 3NWRA 2VRJA 2J7DA 3E6EA 1XIDA 3BO9A 4WDWA 1WZKA 1YXDA 3FEQA 2F8QA 4OIFA 1OSEA 4DPPA 1H62A 2OEMA 4IMCA 1V08A 2YA0A 1TPFA 5JVLA 1QAPA 3RRAA 1S2TA 4EPBC 5CPLA 5E09A 1NVMA 4MKVA 3QBUA 4LANA 3OGSA 1OX4A 1H4PA 3A4XA 3TVAA 3KOZA 9XIAA 3OVRA 4H9YA 3VGBA 4OWGA 2VGBA 1RP8A 2W62A 2TODA 1ZAIA 1W2PA 2NT0A 2QMJA 3S5SA 4QJ5B 4IPNB 1B9ZA 1YNPA 2PBOA 2ZZ5A 5EMUA 1J6PA 2PTXA 4H3DA 1J96A 1RAKA 3F5LA 1R46A 1AZ1A 1VB9A 1V3MA 2EPHA 4MSSA 1CXLA 1RK6A 3FDGA 3KXQA 1OZMA 1W1IE 3WUBA 5I02A 1HJWA 3W37A 3BICA 4PUNA 3H2FA 4NNCA 3V75A 3E96A 4KWSA 4Z2GA 3EWCA 2Z1SA 5DLCA 2ANUA 4JR5A 4B4HA 1XIGA 2A2IA 4GUFA 3KZSA 4WJEA 5I78A 2XFYA 3B8UA 3OBKA 1TTIA 3VOJA 4JIQA 3WQPA 1BD0A 2R94A 3GK0A 3UG3A 3VGFA 1MUCA 3M6DA 3PZOA 1VFHA 1TUFA 2ISWA 2VDIA 4O53A 3KM8A 4RPQA 1WP6A 4FNSA 4QHRA 3BV4A 3Q4DA 4NU7A 3W07A 3DX5A 2DUAA 1ZAJA 2PU1A 1O5XA 1U83A 2KZHA 2OXNA 4DWSA 4IMFA 1JFXA 3WH5A 3LI1A 2POZA 2CZVA 5LIYX 4XWUA 3VD4A 1E56A 3VDGA 3RPDA 3TDFA 2WYSA 2J8GA 3J7HA 4LVDA 5HK4A 4YTRA 1ZBWA 3VUPA 1S2AA 3V0SA 2Y8UA 1A5LC 1W3IA 2JALA 1XPGA 3IIZA 4JIEA 1KWKA 3E49A 3VOFA 2FDSA 3S6OA 3VGEA 5BXTA 1D3HA 4ZFCA 4WDXA 1D3GA 5H6HA 3BAXA 1O1HA 1EC7A 1OC5A 1Q6FA 3U6WA 3O63A 1JG9A 3K1DA 2B31A 3FYPA 3W6MA 3QGVA 1SO6A 3SY1A 3TMQA 1OCNA 2WHMA 1KV8A 4NHVA 4W93A 2DQXA 2HXUA 2HK1A 3I65A 4XQ6A 4OTKA 2IUZA 1BYDA 2GWGA 4BEUA 2IXVA 1TV7A 4RW3A 1RSCA 4MWAD 5IXEA 4C65A 1D8CA 1UWSA 4I8DA 4BF7A 1UZDA 2X1IA 1US0A 2NVDA 2ACUA 2NXIA 3EDKA 2ZYFA 1QHPA 3CZJA 5AVHA 3IV3A 2GJXA 5EMYA 4M56A 4EX4A 3KRZA 1KBBA 3U2EA 2OEKA 3V5OA 3QSTA 1E6RA 4BQ3A 3OVPA 3NQ8A 1K77A 4K8EA 4ASTA 3GHUA 5HAOA 2VC5A 3LHYA 4XUYA 4DI8A 3VCRA 5FCZA 4HNCA 1NELA 4OBRA 3LHTA 4NZ1A 3W2LA 3QV7A 1P7TB 2YOCA 3EWDA 4Z1CA 4H2HA 4Z0JA 3G5EA 4PCPA 5H8PA 3II1A 3DG7A 4UOQA 4AZ6A 2E1WA 4D6CA 2C8NA 2WMFA 2QZRA 4G2DA 1ECEA 1HJXA 1XYZA 1E71M 1H5YA 3KCOA 3WF4A 4ZQOA 4QISA 4DB7A 4NJKA 1C8XA 2ZUTA 1Y0EA 4GNVA 2XVKA 4JYEA 5CBBA 3WQ6A 3PM6A 3WBYA 2DH3A 3KWXA 2BY2A 3EKLA 3DBNA 2YDSA 3G18A 3CXOA 1JNDA 1KCLA 4K39A 2WJFA 1UR3M 5HR7A 3CQ0A 3T9PA 3EOOA 4LFYA 3AJXA 5DO8A 1M41A 3FAWA 3F2BA 2EPNA 3H2OA 4I3GA 3N73A 1YQ2A 3W72A 2EG7A 4YCOA 3QC0A 1D8WA 3R7MA 3M0XA 3FA5A 4JTAA 1BEUA 3GDTA 4PTWA 5I3FA 3W73A 8XIAA 3NQFA 2QJNA 2PDKA 3L4ZA 3C2EA 4HNTA 2ZZ2A 3UP8A 2QS8A 4EPEC 2Z2BA 5HJLA 4FF5A 4JTRA 1EXBA 4BEQA 6A3HA 5I5RA 1XIMA 3FKKA 3S8HA 3SIZA 3MWAA 1NWUA 5LA2A 2BOEX 4UTTA 4GGBA 3UNTA 3W2MA 3OO2A 2FZDA 2Z1VA 1UR4A 2E0PA 4H9MA 3LTSA 1PZ1A 3IJ7A 1XPYA 2H3BA 3PK7A 1XFBA 3S2LA 1MYRA 1W1VA 3P74A 2VQTA 1AZ2A 3GZAA 3CBWA 2E77A 3M44A 4GOAA 2E8YA 3MUXA 3GIYA 4JY9A 4D1JA 4NZ5A 1CT5A 2RFGA 2Q8XA 4ACZA 3A3XA 4Q33A 1WDQA 5A8GA 3WF1A 1THFD 1YPFA 1FTXA 3STCA 4AISA 4DBWA 3BVJA 2JE8A 3NQDA 3UZWA 1BHGA 3LMZA 4NKCA 2FKPA 5EL1A 4LY4A 4CQDA 4CN4A 3AMKA 4L64A 3KX6A 1YBQA 3GNPA 3N04A 3UWQA 2BLEA 1ITXA 3VZZA 1H51A 3ZJ6A 2E7FA 3NQCA 1RCQA 2WMIB 2X40A 2NV2A 2W91A 1GKQA 1U5JA 1F6KA 4J7RA 1E6ZA 1G9HA 2WHJA 4Y9NA 2ZUNA 4PRTA 4TUFA 2NQZA 3NQMA 1TMQA 2R8WA 4CNNA 2OQLA 5EFFA 4K1WA 1DWJM 5FJJA 2CYGA 2OX4A 5JBFA 3VINA 3TX9A 1W1TA 3LRKA 3DKLA 5G2IA 1PXGA 6ALDA 2OT0A 2IPJA 3FNDA 4OKDA 4Y7EA 3PUOA 3PWIA 1UASA 1SW3A 5M17A 4MZYA 1AK5A 2Z1BA 1KBLA 1R8LA 4IIFA 1A47A 2CU0A 4MJMA 4C7DA 3IRSA 2VC9A 3BLLA 1DWGM 4C7FA 5FSEC 1V93A 1DYSA 3G3DA 3MYPA 1CLVA 1BRLB 4JD4A 3ZJKA 4IL0A 2ZFAA 5T9CE 2FMNA 3LNPA 4E38A 2D0HA 1W3LA 4GY1A 4N9EA 4P8UA 4DWDA 2JKEA 4A35A 4GGHA 1ZY9A 3TONA 1V7YA 4GCAA 3MVIA 1R3WA 4XX6A 4GK8A 1OFOA 1UZ1A 1XIIA 2CETA 3BPWA 3TYUA 1AL8A 3VIKA 1EX5A 2E3ZA 3LLXA 5C2GA 3VU2A 1PJ9A 1FDYA 2QUNA 3F4DA 4JFSA 4UTWC 4C1LA 4DJFD 3EXTA 2EPLX 1LL6A 1LRNA 5A8PA 1EOKA 1QPKA 1W32A 2DZSA 3WK0A 5JBDA 3M0IA 3DHUA 2J9XA 2DZWA 1V6UA 1F07A 2OO0A 2V68A 2OX1A 3KTXA 1UMYA 3B9DA 3G1AA 3OA5A 3G0SA 3UESA 1K7EA 1UWTA 1MRQA 1QASA 3URBA 4AWEA 3OVQA 1VLIA 3LCLA 5AYXA 1I2OA 2GLKA 1X6UA 3N14A 1PTAA 1R9YA 3IV8A 4XZBA 4I7VA 4HNUA 2GFTA 3OU8A 3FSTA 3WLQA 2XTKA 3FDKA 3QHMA 3N3MA 1X1OA 5A95A 2FZMA 3RMJA 3IIPA 1QI0A 1QPNA 4AEFA 3T0AA 5ABTA 4E4PA 1E6QM 4HNOA 3LXAA 3EBVA 3AZSA 2HTMA 3NO5A 2DSUA 1Z7AA 5DCEA 3WNMA 1E4MM 1FQ0A 5D32A 4NASA 2VZOA 1YADA 1F76A 1GYMA 2RJGA 1KRBC 4XZMX 3DC8A 3HBLA 1TE1A 1KXVA 5I00A 4AVOA 4F48A 2ZX7A 5C55A 3SQMA 1WAUA 1QNSA 1EHAA 3B0VC 3UWVA 1UP2A 4KETA 4QRNA 1DJYA 2WSPA 2VCBA 3TTYA 1XDJA 1I2RA 4HA1A 2CCRA 1DJGA 3CK5A 5RUBA 4J28A 1S2CA 2RHGA 4B5NA 2G3NA 3U2CA 4KS0A 1XG4A 1QUMA 5I3DA 3RNDA 3WK1A 1ML1A 1E0UA 1W8SA 1NFBA 2PBGA 3TR2A 4UTIA 3F2DA 2ZWZA 4G1NA 1XRSA 1VEMA 1ADSA 2P10A 2WXDM 4B5XA 3EKGA 4GQQA 1PCWA 4R34A 3SUWA 1C9WA 3KZPA 2GDUA 3K8LA 4GX9A 3ITGA 4LBRA 1XBYA 4OBTA 2GYIA 4NZCA 1XINA 1AQHA 1WDSA 4UFKA 2QUUA 4B9YA 5HPOA 1G5AA 5KSWA 2VX7A 4IFKA 1VD6A 2XIMA 2JKPA 4GXWA 3XISA 9XIMA 1UUMA 2HVOA 2ZA3A 1M3UA 2PLJA 4QS6A 2DT2A 3WDIA 5F2MA 1E6SM 1TZ7A 4XSMA 3CASA 1J0HA 1CXIA 4P2VA 2R24A 3SW6A 3KW3A 4X3ZA 4ZO8A 2XM1A 5BZAA 4AD0A 4O57A 1BFNA 2HNHA 1OZQA 1MDRA 2P3EA 1J5SA 1JULA 5AZ0A 5DY2A 4W8LA 4UMCA 3FOKA 4MB4A 2ISVA 4ADTA 1L0PA 4IPLA 2V30A 1TRDA 5ECVA 4L80A 1U1UA 4WVXA 3QW4B 4Y90A 3P5ZA 3KBJA 4V33A 5AOUA 3PAOA 3LPGA 4O4WA 3W1PA 2G4FA 3AS2A 5JIPA 4BJHA 2XSAA 3N19B 4ZSTA 4CNUA 2C3ZA 1BG9A 3WJSA 2CZ5A 1OC7A 2WZTA 3PB0A 1QRQA 4ICCX 3VNMA 1LDCA 5H2ZA 2QUMA 2ABBA 4PCNA 4QJ4B 1EYWA 1XBVA 4AF0B 3N9KA 3O6CA 4WY0B 3MZNA 4ILSA 2CC0A 1PE1A 2Z6IA 2PDUA 3B03A 5HMDA 4TX8A 4NZ3A 1J2BA 2P88A 4O15A 2WNWA 3GTFA 4LUYA 5AVNA 4DO6A 3S2MA 1IV8A 4NRRA 1LJYA 2XZ7A 3UXAA 2E9BA 3G8EA 1LWJA 1L6SA 1G4EA 2PF8A 1XW8A 1RCOB 2PPGA 2YCLA 4CEUC 3K30A 1K6AA 2A6NA 1MQPA 4POCA 2OSYA 4A4AA 2W3ZA 3AYVA 5AC6A 3ITCA 1LQAA 4H8NA 1JQVA 4P7OA 4ORIA 4Q8NA 3VM7A 4L4LA 4JXCA 4DF1A 1UIOA 4GC4A 3AHYA 1X98A 4OZOA 6REQA 4ZQCA 4AIUA 3EMCA 6XIMA 2IQ0A 1XIHA 1EDGA 4KKXA 2NXHA 5HWJA 4A21A 1XL9A 1PKYA 4NUWA 1KLYA 4I7WA 3G24A 2E9MA 1V0NA 4KF1A 1XD0A 2TAAA 3LDVA 3ZSTA 3PZVA 2PB1A 1WYIA 3C2YA 5EBUA 5G1YA 5JU6A 3L65A 5CJ5A 2ZZ3A 3W7KA 1IWBA 2GUYA 3H24A 3CZEA 5TD4A 3R0KA 1TPC1 4GLEA 3NDZA 3P84A 3IACA 4KW2A 1MVYA 3MU7A 3PP7A 3HPSA 1KCXA 3STPA 4PMRA 3NZQA 1EGZA 4AY8A 1VBUA 1KBKA 1UG6A 2W79A 1LP6A 4RZ6A 2Y7FA 2WVUA 5AYYA 2QIIA 4BFAA 1U5VA 1KW1A 2BWGA 4HNNA 3WL1A 2CXGA 1OFBA 1XLAA 1MDLA 1KNWA 3C61A 3MHGA 4IIBA 3M0HA 1J9YA 3ARXA 1V0LA 1TPH1 2BDQA 1BTMA 1PKMA 2CEQA 2E25A 2XGIA 4BCEA 1FFQA 3NG3A 1HQTA 4PL1A 2XVGA 4QX4A 3DFPA 3VNZA 3UF9A 2YLAA 4GFSA 2V9DA 3FCPA 4UQCA 3N34A 4GUGA 4TTUA 1EDQA 3CUJA 1G01A 3I3EA 4B16A 2Y70A 2Z1KA 3G6LA 3LLDA 2R91A 4CD4A 1J0IA 1ICQA 2OU4A 6TAAA 4HA4A 3KP1A 3ZT6A 5D02A 5FF0A 3HPXA 1GPFA 4JHOA 3E9AA 3D3FA 3R25A 4N2YA 3INPA 3OG3A 1E9IA 3LTPA 4WQ6A 3UPBA 3W85A 1TREA 3CHFA 4C6DA 1JF5A 4KT2A 4P7NA 2JEPA 3SSJA 4C6KA 2PWVA 1UD4A 4Q32A 4L4PA 5EMMA 4HYRA 3JUGA 5JMUA 3AISA 4PMJA 4LY8A 4AVFA 1U1HA 3NPUA 4FIQA 2X7VA 5CAHA 1KFBA 3VIFA 3ABXA 5GQBA 2WZHA 4HBKA 3SBFA 4HMNA 2PMQA 1JUEA 4JTQA 3MB9A 1UPPA 2O56A 2WVVB 4QDWA 1S2WA 3IARA 3T1GA 2ATSA 1VFLA 3EA2A 3V0TA 1EGMA 1HW6A 1T5AA 1OY0A 1R86A 4GY7A 3GVRA 3D0CA 3PVFA 3UXKA 3ARRA 3BCDA 3I4EA 2B4GA 1TTQA 3ZVHB 2NUWA 4JNMA 2OWWA 4PCSA 3WUEA 2IQTA 2VGGA 3OP2A 1DJNA 4J3TA 2YB4A 2ZCGA 5A6SA 3UWWA 1RPXA 4HB7A 2VO5A 4F66A 2VX4A 3EX3A 2XG9A 4ZOCA 3MTWA 2QDGA 3GNOA 3NYZA 1E1CB 2OLSA 4CVWA 1EO5A 4QAWA 1EBHA 1Q6LA 2DV0A 4QQ3A 3IK2A 2A21A 4O14A 4WOQA 3WDPP 3NDOA 3OZPA 4EF8A 4WIWA 3S1VA 3MO4A 3TWAA 1BAGA 3ZT7A 2FIQA 5JXQA 3BAWA 3TTEA 1UP3A 5CG0A 2CBVA 2QHAA 4XZLX 4F0LA 1S1PA 2YFNA 3LBOA 3QH2A 2VHLA 4HD5A 2C13A 1SPQA 2WNZA 2VCAA 3MBDA 1R9XA 1IHIA 2OZTA 4URIA 2YXXA 1F3TA 4IWWA 3DDMA 1TO3A 3B0XA 3E1F1 4JAWA 4S3KA 3I6RA 3RHGA 1RQBA 2INZA 4PR4A 3URAA 5JBEA 1XLMA 1WXJA 3CNYA 1A5MC 2ZUVA 1XH0A 4BF5A 3S6TA 4FAMA 1TUXA 4XTDA 5A6BA 6XIAA 3IS4A 4G6CA 4JQAA 4LSBA 3OIHA 1VR6A 3CH9A 1SJCA 1ZAHA 5HMFA 3BK0A 2HEJA 2WNNA 1KRCC 5D09A 3TSDA 3TAOA 5C70A 3QY8A 4FA3A 1JZ3A 2GGJA 5CPSA 2O9TA 4ALDA 5CCZA 2WANA 4GY0A 5BYWA 1EQPA 5G4EA 3SRHA 3DECA 4NYUA 3DAQA 3GTNA 4KERA 3R58A 2PUZA 3ALFA 1YRRA 5HA7A 1ICPA 4ATDA 4HT3A 4GZEA 4IPIA 3VIJA 3W9ZA 4WOZA 3OQEA 4Q8UA 2G3MA 4O16A 3DGRA 2X2YA 4H6QA 4WR3A 2QCDA 2Q71A 2G0WA 3LB0A 5CH9A 3VFCA 4S2BA 2E68A 5LNRA 1W9VA 2NQHA 1NEYA 1OYAA 4XKMA 4GIYA 4EWJA 5FJUA 3ANVA 1UD8A 1M03A 1WO2A 4GQBA 3UWYA 2O9PA 4WJXA 2BNJA 4S3CA 1YE4A 1J0YA 4TMCA 4KRUA 1VZWA 3FJ4A 1DJIA 3G1DA 5D8ZA 3SCRA 3E3HA 4GISA 4KCTA 3DC0A 4J35A 1CECA 1OX5A 3DZ1A 2ZQ0A 3W01A 2PWGA 1XDMA 5CGQA 4IX2A 3M46A 4NAFA 1G7VA 5AYIA 1CXKA 5J8LA 4U4MA 8RUCA 5EB8A 1HL2A 3WQEA 4GHRA 3LBCA 1GOOA 3E02A 2Y61A 3UG8A 2OQYA 1UWUA 3S1UA 1EP1A 1JI2A 1QNPA 4J2MA 3RXZA 3B9OA 3BAJA 3L4YA 3LENA 2QIWA 4DBSA 1XX1A 4KH2A 4WY0F 4AD4A 4X0VA 1SFTA 4JQ1A 3EWXA 4PB3A 1E51A 5K7JA 3APTA 2IW0A 3S6DA 3T81A 5CPNA 4IJBA 3MP5A 4NNAA 1C8QA 5CAKA 3IANA 1EIXA 3LG3A 1LOLA 1VC4A 1OK4A 1V3KA 3SCVA 5SWUA 1JCXA 4LS0A 4GUIA 1KC7A 2V6AA 1TE6A 5EU9A 3VKAA 1QPQA 2A0NA 3K4AA 2DGAA 1CYGA 3GXDA 4NRSA 4LJ3A 3VCCA 2VJXA 3CUFA 3H7VA 1MO0A 1PYFA 1W37A 3O6AA 4ERIA 4AQLA 3FJLA 4PSPA 2XFRA 4A8IA 4E6MA 2EXOA 3SIMA 3P5YA 1GOMA 2DJXA 1NWRA 3SN1A 4ADSA 4LV9A 4K3ZA 1IT7A 1A50A 4AZCB 4QR6A 2FZ9A 4O50A 3JZUA 3EDDA 3SGZA 3UR8A 2H90A 2XYLA 5D05A 2VEIA 4UFHA 4C6FA 3UZ5A 4MADA 3WLLA 4U2ZA 2X8RA 1VH7A 2UZ9A 4O8AA 1OFRA 2GGIA 1ZCCA 1K9TA 2ESCA 4I9JA 2YZ5A 3JR2A 1E9YB 5CSUA 1EYEA 4PTMA 3FY1A 2O9OA 2A3BA 3WNLA 1C93A 1QHZA 1GG1A 4FLOA 2PWDA 1WUFA 3WK3A 3IUHA 5CSRA 1FOBA 1O12A 5I7GA 3AICA 3GO2A 4HU0A 3CHDA 3C2VA 4P8XA 4XAYA 1S5NA 1XG3A 3GNDA 1X7FA 4QLKA 4R3UA 3W24A 3UFYA 3EX2A 2QPXA 5EMJA 1CTNA 2P0OA 3CUHA 4E8DA 1GW9A 3BG5A 3GXNA 2AL2A 4UCGA 4CVUA 1DIDA 4DAIA 1FX6A 4ZCWA 4NNBA 1JGMA 3GUWA 1QDSA 5LNSA 2Z7KA 2I7GA 1F7BA 5FOOA 3GWQA 3PZMA 1EB3A 4UWMA 2GJRA 1ODZA 2CZFA 2YL8A 4D2JA 5D2TA 4A2RA 1GG0A 3K2GA 1R30A 3HFTA 3LU2A 3VE7A 1O95A 3SUTA 3W02A 4BA0A 2J7HA 1FH9A 2ZZ7A 2Y6ZA 4WSJA 3MPGA 3DXIA 3OOQA 5C9WA 4XIAA 4X63A 5LSMA 2V2HA 4UNLA 3MQTA 2I5IA 4JL1A 4JHMA 1CGUA 3CYVA 1RLCL 1MRAA 4HA3A 2UV8G 3TK7A 1AH0A 2F38A 4IXHA 1XLHA 4LVFA 2C91A 4PRWA 4H7VA 3SFKA 4C90A 5KZEA 3GFZA 4ZMGA 1TQXA 5FESA 4GZIA 4GYPA 3WQ5A 4DXVA 5D2WA 4W5ZA 3GR7A 4DYJA 1UBSA 1XYLA 1EX1A 3TW7A 4B92A 1EPVA 1OX4B 2QAPA 4XZWA 4WDTA 3QRHA 5DT7A 1VKFA 4CGTA 2C16A 4D6JA 4H9XA 5LIUX 1JXJA 1HUVA 1IEQA 1OD8A 3GZ3A 1VLWA 2G37A 4DM1A 4AVNA 3L2LA 1EKOA 1SVDA 4PUWA 1E1FA 1FHUA 3LTYA 4JTFA 4CN1A 2RGLA 5BU9A 4AX7A 2E09A 3GG1A 3D6NA 3SGUA 1W56A 3RLVA 4MZ8A 2C19A 4KMQA 4WDUA 4W8BA 4JEQA 3RLGA 4H00A 3ABRA 4FNRA 4ES4A 4CN6A 2PF0A 4JNZA 3SO7A 2DEPA 2Y88A 5FSDC 4Q4KA 2Z2UA 1R7OA 3KLKA 3E5PA 2FFIA 3SEPA 5AY7A 3AIUA 1VFUA 3FAXA 5HQLA 2HMCA 2Y89A 3UA3A 2NVAA 4NG3A 1PUDA 4KEMA 2QCGA 1VIWA 5REQA 4O1DA 3IIVA 3ARZA 4W89A 2GVJA 4DWSB 1VGAA 1TA3A 2NX3A 4G9PA 1ZTVA 4O10A 3C56A 3GVQA 1LZOA 3W2NA 3ZR6A 3MUY1 4Y96A 5H8MA 1FWTA 1MUMA 1TYGA 2VC6A 1TWIA 4PB4A 4UFJA 3DN5A 3B8TA 1R87A 3WY1A 1B5TA 4H8VA 4IP7A 1KM5A 1Q66A 3S2JA 1VQTA 3A24A 4MY8A 3E0LA 3UY8A 1EWEA 2Z0IA 4UQAA 1FKXA 4A05A 3RJXA 2H3DA 3BJFA 4GIRA 2D2GA 1IXNA 3IWPA 4X60A 2JKAA 2DPEA 1Z89A 2VNCA 1XLLA 4G7EA 2MNRA 1R3VA 3A4WA 3TWBA 1DPMA 3F03K 4U28A 3R2GA 3W38A 5I79A 4U5KA 2IKJA 4GPNA 3UJ2A 4OJYA 2GVGA 4XSLA 3AAMA 5A8QA 4ZXOA 3H70A 1NP2A 2FHFA 3A5FA 4DO5A 4N0RA 2ZZ1A 2V63A 5KZMA 3MSDA 3TXZA 1QI3A 3WH8A 4DUWA 3SDOA 1Q3NA 2PDNA 2FTWA 3QHNA 2G3JA 3PWAA 3W26A 1EXPA 4H6EA 4JIIX 1SW7A 4C1NB 2E28A 2FVLA 4ZQMA 2ASHA 1S2VA 1UR8A 2PLKA 4B3KA 1J0KA 1CBGA 3NQ6A 3W87A 1SMDA 1W9XA 3ID7A 4C6EA 1S2UA 1E72M 1AG1O 2INFA 4NSBA 3WO8A 3TU9A 4B2DA 2I9EA 3AHZA 4QG8A 2CWXA 2QT3A 1TPDA 4MNJA 4LU0A 3W7OA 5HANA 4UTHA 3UJSA 3H2MA 1RK5A 1IZKA 3QSRA 3I68A 2GUBA 1Q7QA 3BGJA 3AIRA 3GDKA 1HKKA 3DEQA 3TQ0A 1HKWA 4MAVA 2QV4A 4ZBCA 1NDWA 5A6JA 3LSBA 2O0TA 3D3AA 3L0NA 1KRAC 4GJIA 1PBGA 2LLEA 1F05A 3UY7A 3EPNA 1D3CA 4HMEA 4RDVA 1ZBCA 3U7BA 4C6LA 3O07A 2X2GA 4QE1A 5F2GA 1LUCB 1VBRA 3E2SA 5CJMA 3QY6A 3DIPA 4JDYA 4XD4A 4MFEA 4LYQA 4LQ1A 4UOZA 3S3GA 1OGBA 3LEPA 2WJDA 1K7XA 1T96A 2X05A 4L6DA 3OODA 4IP4A 4C91A 2X1SA 2YGYA 1DP0A 5AHLA 2Q8LA 1KFLA 3VD3A 2Z4GA 2X0SA 1SJDA 2PZ0A 3W1XA 1VFSA 5FL0A 3IJ9A 4TIMA 1AQFA 2WZMA 3T44A 4DLMA 1SQ7A 3EAUA 1M7JA 4MLJA 2I57A 3PZNA 4MPQA 1X6NA 1OJXA 3ZOAA 1S5WA 4XBKA 3P8JA 2VRKA 1IWPA 4A29A 1KFJA 4W7VA 3A12A 1E1EA 1SYTA 1GZ1A 3NZGA 3CL7A 1T6MA 2OWCA 3NM3A 5IDZA 1I75A 3BANA 3RCNA 2X1RA 5XINA 4RR4A 4Y9PA 3M0ZA 5L9FA 2ZE0A 3QTPA 4O13A 1OFPA 2WSYA 5M1TA 3PTKA 1CENA 3WBWA 1ONXA 1BVWA 2OTDA 4GNJA 1UUOA 1J93A 1PIFA 2F9RA 5IBXA 1Q8AA 4KFPA 5D04C 4ACZB 1EH9A 1H11A 1TPVA 3GG7A 1MEIA 3ZR5A 1GOQA 4MY1A 1LT8A 4QCEA 3NZ1A 4ZB2A 4YN5A 4JTSA 3AYTA 5MHBA 3H2AA 1GOXA 3AS3A 3VIGA 4IHCA 4Z1DA 4JTLA 4U3CA 5A6KA 5I06A 2WVTA 2FJKA 2CIPA 3QV9A 4J9JA 1YBQB 5AB3A 2DDXA 3QGKC 5F7UA 1JJKA 2QLYA 2YW4A 2JEQA 5M5DA 1RD5A 2CXEA 4DNHA 2VT0A 1KBJA 3LSCA 3GG8A 1XXXA 3VIPA 1O5KA 3NQVA 3D47A 3HURA 3NOYA 1DKWA 1QO5A 4LNYA 4Q4QA 4Z17A 2Y4SA 1KTCA 1GUVA 2EGZA 1WA3A 2XN0A 1AA1B 4XVDA 1RVGA 2XVLA 5DMNA 4HSOA 4A3RA 1P0BA 2WMHA 4UUIA 1PX3A 3L67A 3WH7A 5JUVA 4L6HA 2ZUUA 2Y7DA 4FLRA 4Q7NA 1S5MA 2DORA 1BYCA 1EP3A 3VC5A 3I10A 2BHUA 3S0CA 4NT0A 3GRIA 1EA9C 1XLBA 1NU5A 5BOFA 1UC4A 3CAVA 2IKIA 4GI6A 3P3BA 1F4AA 4JTGA 1B31A 3AIBA 4DF2A 2XVPA 3OQ8A 4D6EA 4Q8VA 1SUXA 1RD6A 1W9UA 4Z2JA 3KOFA 1JCTA 1JUKA 5BXRA 3ECQA 1TELA 3WDHA 3GIPA 5CBIA 4JYDA 3KL3A 1GNXA 3E0VA 3R1ZA 2YDAA 2NLYA 4H9VA 1V6VA 1H61A 3CZ8A 1YNQA 5FIPA 4Z2IA 1GJPA 2J8TA 1TV5A 1JDAA 2PDMA 1RJRA 1ZJHA 2Y24A 1CXFA 3CQKA 4HHMA 3W00A 5TNVA 1P1XA 3ZJ7A 2TRSA 2ZZ6A 3KHJA 1EGVA 2VFGA 4F0MA 4JFUA 3UPMA 5A6TC 3TJIA 4LH8A 3QMTA 3VUSA 1NQ6A 3KDNA 1Z44A 3N25A 4JIRA 2YJQA 1MMFA 4QNWA 1E43A 1N82A 1XLDA 1CB2A 2AGKA 4HHPA 3W53A 1VJZA 5LA0A 1TG7A 3I6TA 2XH7A 2PE4A 1HVQA 4GYPC 4DBDA 3TXVA 1VBGA 4Q4PA 3WQDA 1BKSA 4KRTA 2OEJA 5C9ZA 4JX4A 3W7MA 3F5JA 5FD0A 4FX7A 3O3RA 5LA1A 3ZT5A 1RR2A 3UBPC 2BVTA 3KHDA 7REQA 2ZXQA 3U2OA 2D23A 4HOXA 3H21A 3LPFA 1E55A 1FY6A 1XSJA 1JZ5A 3LHVA 1JZ4A 3WBXA 4RKAA 3P8IA 1BGAA 4F9JA 1H60A 3KOYA 1F61A 4DJDA 1A3HA 4F0RA 4H7CA 3BL3A 4GYJA 1GWJA 2GJPA 2YL5A 1TB3A 1NARA 2DW6A 4FNUA 4TXEA 4IIHA 2NXGA 4XAZA 6CGTA 5D37A 3THDA 1E40A 1UW9A 4F9DA 1PZ2A 1QBBA 1LROA 2XH4A 1ZBVA 4C6QA 4DBUA 1I2NA 1AQMA 2D73A 5H91A 2C18A 1MW2A 3VDBA 2B7QA 2YW3A 4RE2A 2G97A 2PCQA 4N9CA 5DRCA 2UY3A 4L61A 3GNNA 3HG2A 3USBA 2OSXA 1NOUA 3TLLA 3B4YA 1W3JA 3MO7A 3I3BA 3WSUA 2QCNA 2C1GA 4LGXA 1EEXA 4RDZA 1XBXA 4V27A 3A6OA 1GVRA 2GOUA 1MZHA 1QOXA 2E4TA 2QGHA 3WCZA 4M7SA 4Q3MA 5E70A 4R53A 8CGTA 2OCZA 4IFKB 4IICA 5HATA 1DIOA 1VYRA 3ZMRA 4XAPA 1PKLA 5GPRA 4BI7A 2VD8A 3LCIA 3EDFA 1JXKA 3RGTA 4QCFA 1H1YA 1OFDA 3N6QA 4YTUA 2XSXA 2Q8ZA 2QCCA 1PHQA 1R2SA 3PJWA 3SCUA 4TX6A 3LS9A 1GKPA 2V3FA 5D2XA 1IT8A 3TE9A 2ALDA 1K9EA 2OPJA 5H8UA 3A4AA 1SZEA 3QXBA 1E0VA 3WK2A 2A7PA 1YDNA 2Y62A 3ABZA 1J0ZA 1WKFA 2ZDRA 4Q8OA 4KQNA 3UWEA 3W23A 3W83A 2KAUC 2WMJA 3QR1A 3B8IA 3U48A 3R43A 2VZVA 1Z42A 1UROA 4ZFMA 3WD0A 5C71A 1QFEA 3MCMA 3NZRA 5FF4A 4IGSA 1VAHA 5FEWA 4LRSA 2OOFA 3A5VA 3M0YA 3VX1A 2OELA 4LEQA 2PZNA 1K1DA 2UY2A 4FALA 1GZGA 4PYSA 4UZUA 2Y0FA 3E2RA 1JAEA 4L9YA 1IE7C 3GTIA 4QBXA 5C8BB 4MF4A 1O60A 1PCKA 3H7UA 2BXYA 3SQSA 3ZM8A 1F74A 4WGHA 1RBAA 3V18A 3MUZ1 1TIWA 4UOJA 2PWHA 5FAGA 1X7IA 4IL2A 3MI2A 3KLLA 1XIJA 3GVWA 5B7YA 2YCLB 4HNLA 1A80A 2QCMA 4S3EA 3OW1A 4I6KA 5J5RA 2QAFA 4HNVA 4GQGA 3PTDA 3LY0A 1QW8A 1SR0A 2WC7A 1IF2A 2GGHA 1MQRA 2CLEA 2RDWA 1ZU8A 4NQ1A 1GPWA 4QE5A 4UBPC 3VM5A 6REQB 3APGA 1REQA 2WHKA 3KOXA 4ZL1A 4MWAA 5A2AA 2DU2A 3AHVA 4V1YA 3IJ6A 1J01A 4IGNA 1Q2RA 3XIMA 4AXKA 3GS6A 4FOUA 4NZJA 1ALDA 3DG6A 2E6DA 4GQRA 2FJUB 9RUBA 4IGHA 4RV8A 1DTUA 1QK2A 1RHCA 1CEOA 4MKNA 4BR1A 3EB4A 1YYAA 3GUGA 1CB7B 3M43A 3AMCA 1OCQA 2ZICA 3W29A 1OQFA 4HGXA 4PH6A 1OFAA 4RK8A 5DBUA 5A8MA 1NDZA 4GJJA 5EBAA 3CAQA 2YSWA 2VUYA 1K6WA 1YIXA 1FH7A 1W5NA 5K4ZA 1SMAA 1TR9A 1V3JA 4IOTA 4TQTA 2YZRA 3U4FA 3N29A 1DXIA 2Z00A 3UEQA 5A5WA 1CGWA 4AZHA 1V03A 3SFWA 4LAMA 3WEOA 1SW0A 3QVQA 4XKYA 5FF2A 3S5OA 2VX6A 3NYDA 3ATZA 1XRFA 3R0DA 5HWMA 1A4LA 4REQA 5KMYA 2FZNA 4ZTYA 1LRTA 2BHZA 1J12A 1XISA 2Y1HA 3ITYA 5EPDA 3VK5A 2GWNA 4JQ4A 4EANA 3BLPX 1KV5A 2W61A 3GC5A 5I09A 1P43A 3BLFA 3DFTA 4IP5A 4MB5A 2G3IA 1I45A 5A2CA 4D1IA 3V1PA 1E3ZA 5IBXC 3HQNA 3ME3A 3HF3A 2EHHA 3M7SA 3C3NA 3P62A 1JAKA 1VIZA 2J66A 5FF7A 5GNXA 4BHYA 2J7GA 1CX9A 4H8UA 2JK2A 3PZ9A 4PULA 4WGXA 4H9ZA 2FYMA 2CLLA 2FTPA 1G94A 3TW9A 3EEGA 2YCEA 1PKNA 2GVLA 1VP5A 1Z69A 1BXNA 1EJWC 4E2OA 2BX7A 5DCDA 2FH8A 3LZ3A 4IQLA 1TWZA 1QI5A 3WLJA 1ZJBA 1Y5WA 3R8HA 3MUAA 3RILA 7A3HA 2WM1A 4F3HA 2MANA 2DSZA 3DYPA 4RCXA 1XHGA 1R6WA 4HN4A 3LHWA 5DXYA 5HUOA 4A3QA 1K3UA 3STFA 1RBLA 1XFCA 5IHSA 3P0XA 1UBPC 1VEOA 4JFTA 4ZTXA 2GSJA 4Q8TA 2EKGA 1CLXA 3RN6A 4HPNA 1IYXA 2ZRZA 2ZTJA 3CJPA 3BW2A 5DFAA 3H4GA 4Z42C 3Q65A 4UR9A 3HPAA 3W7RA 4UIOA 1WAWA 1M65A 2ZRXA 2QCFA 2A7RA 1WX0A 3MA8A 2QDDA 4MM1A 2J4GA 4DXKA 3EWWA 3I6EA 3TJLA 1Q6OA 3RR4A 4P8VA 1XR2A 2F2HA 4RZBA 2FPYA 3E74A 3CH0A 1B3XA 3GH7A 2PDWA 5ABGA 3QMRA 2J8FA 3EWBX 2ZC1A 5D9NA 2QKFA 2WHLA 2WJEA 2VX5A 2QXWA 4DI9A 2BBFA 4CEXC 3SI9A 1EL3A 2OZ0A 1A5SA 3CIXA 4HZ7A 3E0WA 4YHEA 3V16A 3TAKA 3C8NA 4RPPA 4PUKA 4IISA 3MKVA 5I6SA 5BWFA 1FXQA 5BNKA 3QLDA 1F8IA 5C5YA 3MP4A 3MT1A 1C7TA 3U0HA 1T99A 4MUZA 1E9ZB 5C9RA 5ECUA 4DO7A 4B5VA 3JZEA 5CGMA 2FZBA 2Z29A 1IIGA 3BJTA 1L8NA 4D72A 4GJ1A 1BXCA 4O1BA 3W82A 4LBSA 5CLTA 3GY1A 3C8FA 5F4XA 3GFYA 1E5JA 3N1AA 1LQ0A 1GVFA 5GNZA 3CC1A 3TEVA 3PSWA 1Q45A 3VMNA 3W1QA 1ITUA 2W0UA 3Q67A 4MNKA 4Z2KA 3HM7A 2EPMX 5E1QA 4AIOA 2EO7A 4X2PA 1F3XA 3H7RA 4AFYA 4HOZA 3LN3A 5DT5A 5D9PA 2WVSA 1ISYA 3AXIA 2PC4A 3QC3A 1SO5A 2A79A 4ZO9A 1D2KA 2Q09A 1L9WA 4C6OA 1BGGA 2E5CA 4H2CA 3STGA 1RV8A 2I56A 2ZE3A 1P0NA 4L5ZA 4C6CA 3Q45A 2R1PA