1M0TA

Yeast glutathione synthase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
487
structure length
454
Chain Sequence
b'PPSKDQLNELIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYARITQDMAQPDSYLFTGKLWSLYLATLKSAQYKKQNFRLGIFRSDYLIDKKEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSGYLLSKALAKAVESYKSQQSSSTTSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRLTFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIKAPDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVLKPQGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKGCLDSIILY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione synthetase
publication title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 167
structure length 454
sequence length 487
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 1m0tA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1m0tA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0tA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0tA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 1m0tA04
4YB8B 3G8CA 1PX2A 2YL2A 2V5AA 4O7VA 2CZGA 4FFNA 4IHJF 2YRWA 2WYOA 1JKJB 4C5AA 1CQIB 4YJ2F 1Z2OX 4O7WA 3U9TA 4DIMA 3Q2OA 1JDBB 2J9GA 2FB9A 2FPPB 2FPIB 2QK4A 1VBHA 5JVDF 4Y8VB 3JRXA 4MV8A 2GQSA 1GSAA 1DV2A 1W96A 1GLVA 3TQTA 3ORRA 5JQGF 4O7NA 2SCUB 2R7LA 2W70A 2YWVA 2ZDGA 4TV9F 4MV1A 4HQ6A 1GGOA 4IIJF 5LXTF 3K5HA 5C1OA 4O7YA 3AX6A 1KJQA 4O7RA 2V58A 4I55F 1KEEA 4O4LF 2W6PA 5BPHA 1AUVA 4M9UA 4MV6A 1BXRA 1A48A 3VA7A 2I8CA 2YZMA 2GLTA 4FFPA 1B6RA 3BG5A 1A9XA 3JZFA 1EUDB 2R7MA 3JZIA 1OBGA 5H80A 5C1PA 2W6NA 5J2TF 2IP4A 1DIKA 3N8DA 5GONF 2C00A 2YZGA 3TIIA 3ETHA 2P0AA 4FU0A 1KC7A 2QF7A 2XCLA 4L1KA 1I7NA 3TINA 5HV6A 1M0WA 3VPCA 3GIDA 4ZHQF 1EUCB 3UFXB 4O7SA 2DWCA 2W6QA 5EZYF 4DLKA 4YJ3F 1SCUB 3R5XA 1T36A 1KBLA 1E4EB 2YW2A 4MV3A 1ULZA 2DLNA 2CNUA 3NUAA 2FPGB 3VOTA 4TV8F 3RFCA 3I12A 4FFRA 4RZQA 3RV4A 4YAKB 1PK8A 3HO8A 4HNTA 3R23A 3LWBA 2YZLA 3HBLA 3DF7A 2VR1A 1VBGA 5KX5F 4O2AF 4EGQA 3R5HA 4O7ZA 5J2UF 2CNVA 2R85A 3MJFA 5C8YF 2R7KA 1OBDA 5DMXA 3QFFA 1M0TA 3JRWA 2R86A 4C5CA 1IOVA 4MA5A 2NU9B 1CS0A 3KAKA 1EHIA 3WO0A 5D8DA 5CA1F 2W6OA 1BNCA 2GPSA 3OUZA 2FP4B 2HJWA 2Z04A 5LP6F 3ORQA 1EYZA 5JH7F 5LOVF 3KREA 2VPQA 4FFLA 5BMVF 4YBZB 4O4IF 3K3PA 4O7TA 4XYLB 4O4JF 1C30A 4FFOA 3U54A 3MWEA 4WBNF 2ZDQA 2ZDHA 5JVLA 1KJIA 1KJ8A 2I80A 3ETJA 3RV3A 1C3OA 2NU7B 1B6SA 2HGSA 1Z2NX 2I87A 3E5NA 1DV1A 4FGRA 4O7LA 4ZQIA 3V4ZA 4O4HF 4MA0A 3VMMA 2NUAB 4HNUA 2DIKA 4O82A 3R9RA 5JQWA 5HBRB 1GSHA 5CA0F 4MV9A 2OLSA 3MWDA 2R87A 3GLKA 1IOWA 5BPFA 2YZNA 4MAMA 4XX0B 1Z2PX 5LA6F 5CAEB 3RUPA 4MV4A 2R84A 3AW8A 4FFMA 2PN1A 1JDEA 3Q1KA 2X0SA 4O81A 3G8DA 2YS7A 2W71A 1EZ1A 3U9SA 1KJJA 4I50F 3R5FA 1M6VA 2NU8B 1JLLB 2YRXA 3HB9A 3LP8A 4MV7A 3V4SA 2GPWA 1E4EA 3WO1A 5CB4F 4ME6A 2CNQA 2R82A 4EG0A 2PBZA 3KAJA 2VQDA 4QSHA 2XD4A 2NU6B 4E4TA 4I4TF 1KJ9A 4NYEA 3SE7A 4ZOLF 3VPBA 2GQRA 4HR7A 1WR2A 3WNZA 1I7LA 1W93A 4IZOA 3KALA 4HNVA 5KKNB 3TIGA 3U55A 1VKZA 5LYJF 5IYZF 4XZ3B 3TW6A 4FE2A 4C5BA 4EGJA 4TUYF 1CQJB 2PVPA 2R7NA 2YYAA 2W6ZA 5FNVF 4O83A 4YAJB 2DZDA 4XYMB 4O84A 2Z02A 1AUXA 2YS6A 3OUUA 4ZI7F 1CE8A 3N6RA 4O86A 3K5IA 2V59A 4O2BF 1KUTA 2W6MA 1GSOA
chains in the Genus database with same CATH superfamily
3QIAA 2C4HA 2ZIZA 4DV7H 2YOFA 2Q45A 4M88A 1QQ5A 1MQAA 3ZLVA 5B1HA 1S4MA 1E0AA 1NSFA 3WFJA 1YZLA 3DYIA 4OA8A 3AF0A 1P2UA 5IRCD 5CH8A 4R2HA 1I24A 3VBCA 1IULA 5C8YA 3U62A 2FPIB 4PN3A 2HJ9A 3GTJA 2XRZA 1F6BA 5HA5A 2YWBA 4IGFA 2O8BA 4ZKDA 1X7ZB 1BS2A 2DKFA 3SFTA 3CRNA 2GJAA 4HDCA 1A69A 4NMXB 1XZBA 4EW2A 4ZAZA 3WK7A 4NENA 1T9DA 2I22A 5EINA 5LXTF 5IBPA 4MULA 3LP6A 3BJEA 2JS7A 4AKTA 2PSEA 4R98A 4HN9A 1UMCA 4EPTA 1YQ9A 4Y2TA 2ZITA 1CEEA 3GQVA 1KY4A 4BBPA 1XA3A 4N6GA 4NARA 4QO7A 2SCUA 1TKRA 1PGPA 1RFLA 2W43A 1YIDA 3RVBA 2I91A 2HD4A 5A3SA 1SG6A 4FS8A 1WHSB 3AEUA 4K88A 5A5GA 2XE8A 3UJ3X 1WMAA 5KC8A 5DRYA 1LJ8A 2ENWA 5HIAA 3DVQX 4U7CA 1RHUA 2Y9PB 1MX3A 3BYZA 4EBCA 2CLKB 4EUFA 5EJ8A 3WQRA 4AJ1A 4DA9A 4LMBA 5JCXA 3RVNA 3O3NB 2JIDA 2DQYA 1QP7A 3HXMA 2JEIA 1DIRA 4ZEOA 3OUTA 4M0JA 3DUFA 1E6LA 1BHO1 3Q8MA 2FLKA 3A3NA 3B6MA 4PYJA 5AVQA 4DV4B 2O57A 5IN4A 4O8ZA 2W6ID 2C9MA 3V4LA 3P94A 3I2HA 4RAYA 4KGXA 1KOFA 5FT9A 3LJKA 2NSHA 3E7WA 4TQSA 4W5JA 5IYBG 5A2QA 1OH5A 4WXHA 1U65A 4MEAA 1I2LA 4WKGA 1QO0A 3WKBA 4JA0A 4BFWA 5EJ6A 2VQFH 3AR2A 3FLAA 2XC9A 2HREA 1QRRA 1Y37A 2H85A 2BHRA 3WNDA 5JVLA 3M4NA 2AMLA 4KQ6A 3ETJA 3FGPA 2XB4A 1HEUA 1JXQA 2HJSA 2QN6A 5H1YA 3KLOA 1P72A 3NIGB 3FJ1A 2BKXA 1P18A 4Y6GB 4JENA 4DWOA 1J0DA 4JR2A 4WLNA 4D9CA 1G8FA 3ZJTA 4Z3DA 2UVRA 2TMYA 3IV6A 4LVCA 5CFLA 1PL0A 3GRVA 1IG0A 4XASA 4QECA 1JVSA 3DAFA 4X63A 1IQPA 4CQMB 1G59A 4B7UA 1YE8A 3TZHA 3MT8A 2FWMX 4CG3A 1JHZA 2JGJA 5IKMA 3ZCXA 2Z98A 1KI9A 4Y6RA 3AJEA 4ZCLA 4UCWA 3KZKA 1Z37A 2I3BA 2QE7D 4EJ0A 2W2OA 2ALZA 1OWOA 4U7HA 4X3CA 4D97A 4IDFA 1CR4A 2JA2A 2HRZA 1FTYA 2R4UA 3RIEA 4HEA6 1JFRA 4CWAA 3PIDA 4CEIA 4R1UA 1EEXB 1YVDA 1E6KA 3GH1A 1WVGA 2D59A 4BEJA 2G06A 3BKWA 4XPIA 3GVIA 3E7DA 2O8FB 3PFHA 3IALA 2OAP1 3KKQA 1EVYA 4FE4A 2O1WA 5KHAA 2C31A 3E27A 3BH0A 4JBHA 2PUVA 4IH4A 2BGNA 2R92A 4QXMA 1LFAA 1WBDA 2NYAA 1KEZA 1BX0A 4LISA 4FCTA 3IT3A 3KPUA 3D81A 4EMBA 3HVIA 3HFRA 5TS3A 1CUFA 1OREA 2W2KA 1N75A 1XUOA 4UQLA 2Q0QA 4RH3A 4BBAA 3IPAA 5AH0A 3BA6A 5BN4A 3ZCVA 3V34A 2YXBA 4C5AA 3ETEA 3VU3A 3VR4D 5FX2A 4WXMA 4RV4A 1RI5A 4BP9A 4RTMA 2CCJA 2M9MA 3SVLA 2W7PA 4R01A 4UDXX 2CVOA 2VDNB 3KZ1E 1QIJA 2W11A 4HB4A 4IX9A 3CBGA 2PIAA 1XVIA 4PY2A 4GKJB 4IRUB 1LPMA 4UAUA 1ZMOA 1Q44A 2ZT6A 4Y7DA 1JVNA 1WCIA 1T24A 3HH8A 1T0HB 5JSZB 5NLLA 2EFEB 3QVTA 1B43A 5D3QA 5TQVA 1PR6A 3DE5X 2B4KA 2NU8A 1VE9A 4CQLA 2UUOA 1KU6A 5HIJA 3DG9A 3FPSA 2OFXA 3UMRA 3D8BA 1XDBA 3G82C 1A7JA 1JP7A 1C9MA 3V32A 3WBFA 1H9AA 3JASA 2HIVA 4QEKA 2A5YB 5FOXA 3HJGA 1AN7A 1N0UA 4BMXA 1QPZA 4A0RA 1YJBA 1GNPA 4QGHA 3HZHA 1GRVA 2X2EA 3MMZA 2REXB 5JRDS 3RUIA 5AVJA 1S68A 1V8DA 5A1TA 1MJFA 3IR5A 1LLCA 3SR0A 1HDRA 4Z54A 4IIJB 1ZD8A 2YYSA 4YUZA 1BAPA 2WAQE 5TQ0B 2XDWA 4DMMA 3TY5A 1C9DB 3C43A 1OXTA 1GAQA 3BHJA 3SGIA 5JXJA 2WMDA 3S55A 3F71A 4RK6A 1MHTA 1XEWX 2B98A 3CZ9A 2GPTA 5KT4A 3GARA 4C2TA 2AJLI 3NCTA 5BOSA 2J0VA 3A1SA 1NYRA 3GFPA 2A30A 3CLSD 3ROFA 4XIGS 1KQOA 2ZSDA 1QF7A 1ZN8A 3LYHA 3W8FA 3CVYA 2XVZA 1K7EB 4G4SP 3A2MA 1M0TA 4AZSA 1YBHA 5ELLA 4JCCA 2DEUA 1X39A 4AK9A 3AF1A 4KKVA 1K8YB 4Z9AA 4JI4B 4U7GA 4A2PA 3HKBB 1CY1A 3VDQA 5A4AA 2EHJA 3U3OA 2OBFA 4S04A 2TMKA 4D45A 4RHCA 1KMHB 1J2TA 1S2DA 4AY3A 5KTMA 4F4WA 3P0JA 5A06A 4KQCA 1WV1A 4BMYA 1GZDA 2WC1A 1RCFA 4J9OA 3KJQA 3TL2A 2NUAB 3HUTA 5JTUA 1QX3A 4KVGA 4U3JA 1NLYA 3FWKA 5B1DA 3GLKA 2YY6A 3X1WA 4CDMA 4EOGA 3LY8A 3DZHA 3ZI0A 3GGGA 1JKMA 4D8XA 1ZJ5A 2ZZNA 3CUWA 3WGVA 1N7JA 2FSIA 3FUUA 3L46A 3RYIB 1LBSA 4AU1A 3UM9A 3QEMB 2X8AA 3G2IA 3ESQA 3LRTA 2EX4A 3LP8A 3S2FA 4RTLA 3A14A 1ZVQA 4NBRA 1KAHA 3UWMA 1SKMA 2P9CA 3V6HA 4J1TA 4BLQA 2CT8A 2C42A 5AJWA 5DBFA 4GI2A 3FCUB 2Y77A 1XRQA 5GM1A 4Q93A 4YNBA 4H6VA 4KWIA 3E9RA 1CR2A 5KFQA 1NN3A 1KWGA 1C7IA 2XGGA 1AO3A 1ILWA 1JU3A 5BQPA 1Z83A 2BLNA 4JLKA 2ZU6A 2YU9A 1NTOA 4C6SA 5ICFA 4YPFA 2IPOA 1QZXA 2O54A 2BZGA 3AVVA 4O1HA 5JYBA 3DEFA 5F7XA 3K71B 1RRMA 3CJQA 3RCBA 4BWFB 2HLHA 3WHKA 3PXGA 2HBYA 4B6SA 1ZAKA 2RF4A 5KINB 4M0UA 4KIUA 1T0JB 4UTZA 4MV5A 4HH3C 1JG3A 4V0NA 1MF7A 1JFFB 2EBUA 4B7CA 1Y6FA 1HTTA 4XUEA 2WKSA 5CBPB 3FOCA 2WUVA 2C77A 4C2MA 5JVDF 1PL7A 3RYCB 1MV8A 5HDBB 3G1WA 2UVQA 5EZ5A 2BM8A 2RHDA 3V7UA 3KOYA 3BFVA 3H75A 4GI5A 1KVUA 1P91A 1USVA 4MYRA 2FFRA 3HKDB 3WQQA 1OLSB 4TM5A 1HYQA 1NDHA 1L7XA 2DMRA 1WW8A 1J2RA 3HTXA 3OO1A 4G1EB 3ZBPA 3PQEA 2C9BA 3WIBA 3FPEA 1KNXA 2D2XA 1Z68A 2C8LA 1V95A 4TRMA 3VDRA 1GNSA 3WMXA 5KNLA 3O8CA 3MWKA 1C14A 3ZDZB 1X15A 2ZYSA 3KR9A 1JFSA 1C2YA 2J3MA 3N2GB 4MCJA 4MIYA 2AXEA 2QMHA 4ECYA 2RK4A 3IO5A 1JMYA 2WVGA 3EPPA 3MLEA 4F4ZA 4FOSA 1F60A 2FETA 1QV6A 4CM8B 4Q7EA 3QVSA 5G1PA 1H8EA 1U3GA 3R5XA 3GRUA 1EFPA 5ENZA 5HP4A 1DXYA 2XODA 3BXHA 5DM2A 4PHGA 4RL6A 1XEXA 2XYRA 1L4MA 1EHYA 3BCSA 2E4YA 2JI4A 4PC7A 2IZ5A 4IUDS 1G20A 5CVDA 1FPQA 3FSEA 2R47A 3RSHA 1SXPA 2QT9A 3W6OA 4D0GA 3AXTA 5BMOA 5FEMA 4F4UA 2I6FA 1KFCB 1U9YA 3O2NA 4I4NA 1M2OB 3H5NA 2AFRA 3RC7A 3A1UA 1TUEA 3PW0A 1KR5A 4DM7A 2KX7A 2WT9A 3S40A 4PPNA 1K1QA 1NMZA 4O6VA 4RBNA 4TSFA 1DHRA 2BR3A 2GEJA 3U7IA 1K6MA 3W9BA 4PO3X 3MEQA 4NZNA 3I4CA 3T4XA 3T0GA 1ZN7A 3CNNA 2PSHA 1D0VA 3OPXA 4Y1RB 2I6XA 4G07A 4D42A 1XZLA 2JEYA 4JWTA 4RTQA 1ZGHA 1RYYA 2YZ7A 4F38A 2OLEA 4FEAA 3I9LA 4OB7A 3O47A 2DVMA 2J0QA 2H4XA 4TVIA 5IM4A 2E37A 3UG7A 4XB2A 3ELYA 1VKJA 4KO3S 1G55A 4YACA 4LMPA 3WKEA 4LVUA 4QIWE 5LJIA 3CH4B 4S12A 3QYJA 4AJEA 3UVEA 1SVMA 2ONKA 3NYWA 4JEIA 5KJ1A 1ZGGA 3D5QA 5DM60 4NY1A 2W71A 4UD6A 3ROQA 2R8YA 3ZXSA 4S2UA 4KLZA 2OCDA 3ENVA 2JJ8A 5ERYA 3B3GA 2G40A 5C8ZA 5AOAA 1EK1A 1NVUQ 2F00A 5BT8A 3F8TA 3EZ9A 3SN6A 1U7HA 1J0CA 2O0MA 3H5WA 1SUBA 1XK7A 1PV1A 2YIVX 3Q40A 1KJ9A 1JG7A 4OI4A 1NP7A 1O77A 4NU6A 4CMJA 3MAJA 3L1KA 5KG2A 3VR4H 1MEOA 4OLBA 2XMDA 3ROXA 3E9ZA 1E4VA 3JQQA 4QO8A 3TSZA 2WWVD 4TL7A 4LF9H 4AURA 5K0GA 2GM3A 1USIA 2PLAA 5F5XA 5E4YA 3S2EA 3QKWA 2IBSA 4KQMA 4Z53A 4OAOA 3NRJA 3U6KA 3K20A 3DVAB 3F0TA 5K3OA 4KFSA 4CTMA 1G21E 1ZITA 5EUBA 1AU9A 2GX6A 2VHWA 3PVXA 4C4RA 1OASA 2XE6A 3IN5A 5EJ5A 4KIGA 5KMGB 3HOXG 1RM0A 3LI2A 3TOZA 4XUCA 2KHZA 3F7MA 3U17A 2D7CA 3JVDA 4E46A 4IV5A 4GOLD 4JI5B 1FL9A 4I4TA 5ERXA 2WP8J 2HO4A 1WW2A 4IIFA 4NZYA 4TPKA 5U1PA 4I1PA 4RZ2A 1E3JA 1QGED 2QPAA 3VC7A 4M7PA 2X5OA 4GL4A 4MQLA 3SC3A 2E21A 1CUBA 1GFSA 3QWHA 4KQFA 1DWUA 1TAEA 1ENPA 1A9ZA 1GUBA 3S99A 3A4LA 4GE3A 5FNZA 1YR1A 1VCNA 1SXIA 4EY4A 1XZ8A 1A2OA 3Q6IA 4UNQA 4D25A 3FKIG 4PW0A 2EJBA 4A6DA 2I62A 1W1UA 3CX7A 3RB4A 3B7GA 2XMRA 2BR5A 3N70A 4K40A 4L57A 5ARCA 1VBMA 2ZIEA 1RPZA 4J0CA 1ADJA 1Z08A 4B74A 3D31A 2OV1A 1Z9BA 4JQYA 1CQWA 3W2TA 4LJSA 1ZUIA 4NC9A 4QU0A 4Y3UA 2ZJ5A 4OBEA 2Z6VA 3MCVA 4ER3A 4IZ6A 1E58A 4UJ5A 1TYCA 3KETA 4EEZA 3GPIA 1YDMA 2NTJA 4ZRMA 1KI2A 3PN1A 4NEHB 3SEQA 3R76A 2RGUA 4DEVA 4RQBA 4EYQA 2C2BA 2O3JA 4YRNA 1UWLA 5AJTA 1DLIA 2FOXA 2XRFA 2R79A 3BAFA 2ZWVA 2CNOA 3U39A 2CNLA 3I9MA 1PJZA 3PRKE 2A9OA 1NMEA 4U7PB 1HETA 3T38A 2H0QA 5IG2A 2QP4A 3CURA 1PI3A 3F6CA 2P5YA 3TLMA 1UOOA 3UH0A 2YUIA 1W85B 4E33A 3JAKB 3K3VA 1GT91 3G0OA 3WWHA 1VRWA 2C04A 4RDIA 5JARA 4CL8A 2XRMA 1ZKMA 4JXXA 5J5VA 3G7NA 3CUKA 3FBGA 4MLCA 1FVIA 4GU5A 5IF3A 3ETNA 4GKAA 1YMVA 1QANA 1XQWA 1SBCA 1FOEB 3AP1A 5JW6A 4BN0A 3AFNA 3H19A 1Z4OA 3LC7O 1Z33A 2LWIA 3VZCA 1RAFA 3KQMA 3E1KA 3D7RA 5CDUA 1X7HA 3PI6A 5SZIA 2O8DA 4PAWA 1TJ5A 1OW3B 3OHMA 4CR7A 2WSMA 2ACWA 3NR2A 4IQ8A 3PPYA 5DYGA 5K3WA 3ZWWA 3KSMA 4HPWA 2FLNA 2PVCA 4G26A 2H1WA 1A7KA 1V6CA 1U9CA 1ZH0A 4FCVA 4FZRA 3H1FA 3V8BA 1WB4A 3UBTA 5HKKA 2EP8A 2NGRA 1W49A 3IQIX 2FSGA 1X92A 4LE0A 2R8JA 2PGXA 1FDUA 2Q2OA 2NX2A 2QQ5A 1ZD3A 4IR1A 4Q1DA 3QZ7A 1MCZA 2X0KA 4U2CA 4TMKA 1QPGA 2FE3A 1KBZA 5IVDA 3TD9A 1WCV1 5D1OB 4RUCA 1ZI9A 2I29A 3QVGB 3UWPA 4TUYF 1YR2A 1RHJA 3TI9A 5AW3A 3OMWA 2ZSAA 1C7ZA 5L51A 1U04A 3EC7A 5HFNA 4R7RA 5CXXA 4JUIA 3U16A 3G0BA 2VP3A 4QUAA 1O7JA 1NJGA 1FDWA 1Y3BE 4TVSA 4QDKA 3QOXA 5EIBD 3K1AB 2X1LA 3RFTA 5TVGA 1F2UB 3K0AB 3G8CA 2WNSA 3MTGA 4BLVA 4GVLA 3KIPA 4BNJA 5AD1A 4GXRA 4Q03A 2JLRA 1KEPA 3O94A 4A26A 2IV3A 4J9MA 2WRZA 1CQIB 4DJ5X 2XKBA 5IYZB 3W1EA 4U9HS 1B04A 4AW9A 3GLVA 4DZZA 2G72A 5KI6A 3T06B 1ZD4A 4R3NA 4IIGA 3J81k 2AOXA 3TSWA 2D5BA 3DOFA 2O20A 1NC3A 4OQEA 3RUDA 3HOVG 1MXHA 4HEA1 4NIMA 5EZ6B 3C14C 4EUNA 2P68A 3L8DA 3D6FA 1T43A 3Q4GA 2O07A 1C9YA 1W6UA 4I1RA 2UXBH 3MTAA 2VQ3A 2Y93A 1D5CA 4TWIA 4EL5A 3FWNA 1NQTA 2WZDA 4Y6QA 1D9XA 4P2GA 4KNWA 3HCCA 3BG5A 4CMHA 4GH5A 2M6RA 2B1GA 3GLFE 4WK6A 4CXMA 3UJDA 3L9XA 1RU3A 5INTA 3R7WA 5JNTA 2EZ9A 3W90A 2R62A 3NS7A 5B6PA 3V6JA 3TIFA 4ITUA 3QLEA 3GFBA 1BCRA 5ITZA 3G49A 4WERA 3TOSA 4I50A 1UC9A 1Z4KA 1U2QA 3CEPB 4ZCQA 5LBTA 4MRNA 3IVGA 2FN3A 4JD5A 3UT6A 3QWFA 3GO4A 4UTPA 2CLEB 1XZJA 4EX7A 1DQZA 1A9TA 1M8GA 4ZTBA 3HU1A 3O7MA 1VI2A 2IMWP 3GNLA 4J9NA 1ZM3A 4ZI3A 3IC5A 1I6UA 2JLXA 2FJZA 3B51X 3GPBA 2FVXA 2JFWA 4GS5A 1NZJA 4R3WA 3ITEA 8GPBA 1RM3A 1G8SA 3W6NA 4EJSC 3RRYA 4KN8A 1A2BA 3GIPA 2CDNA 4NQZA 4LW8A 2JFPA 2ZYUX 4X62H 5K8LA 2CHUA 2FRDC 2ATVA 5LQNA 3NNSA 3UENA 4CF7A 2WF9A 2ZJ4A 1JHAA 1UJ4A 2AZMA 4HH4A 2IYOA 4C0KA 3LULA 3V80A 5IT4A 5K0JA 2ADMA 1NKTA 1RYMA 2JAOA 4JLWA 2X14A 3WLKX 1F17A 4LF4B 4GC5A 3HYSA 3AJDA 4PIVA 3WK6A 3ZOKA 1VHJA 2MINB 2QTRA 1LA2A 1YULA 4WBNF 3C3MA 4AY2A 4GBGA 1O8BA 4MTDA 2B7LA 4M1ZA 1GUZA 3T4PA 1TWGA 1NUTA 1XTKA 3EAGA 4X6XA 2J3IA 1CT9A 2P77A 4HG2A 2Y0SA 3EODA 1QC5B 1RXSA 2O5VA 1QHHB 5SYMA 3IDAA 5T4BA 5BWOA 4LV8B 1QHEA 2FI1A 1U1FA 1XRRA 1PT7A 1A77A 4HVLA 4OREX 3GA0A 1CNMA 3K8OE 2ZATA 3AOEA 3WMGA 4HGQA 4L3WA 5ADWA 3WJAA 2ETXA 1W4BA 2GZHA 5AOVA 1EZ1A 3U9SA 2FF7A 2KPOA 3QUTA 2JFGA 4U8HA 2PRIA 3FDJA 2CJWA 3C0KA 5IT9A 4B8YA 3PR5B 2YX1A 2GF2A 4DS3A 4REQB 3QX8A 4HNHA 5HQJA 2E1RA 2OG1A 1N34H 4HHEA 5FUQA 2X8BA 1XTVA 1ZBDA 5AVOA 4QUEA 1NM5C 2XMBA 4OXIA 1QQ7A 2RBGA 4F1JA 3T9BA 1I7LA 4AKEA 3VVMA 3R6TA 3IR7A 5GAJA 3LWDA 1LPPA 3A26A 1AGXA 1QMGA 2ZSUA 5AKZA 2P1DA 3F4KA 3COWA 1ECJA 4G5OA 4DLXA 1BN7A 2AFHB 4RB0A 5KJEA 1OE0A 1TZJA 2Z2KA 2QRZA 4QASA 3K05A 3E5MA 1QYVA 1JU4A 2FJPA 4R5MA 3QBTA 3OVMA 4I8DA 3V2GA 4NQRA 3RROA 3COVA 1XC7A 1VSQA 1I9GA 1HXHA 3P71T 6GPBA 3I01A 2AOVA 4KV7A 3U44B 3ICQB 4FLMA 3TFWA 2HJHA 4X60A 2Z83A 5KYWA 3L0BA 5L3VA 3ETGA 3QLVA 4D3ZA 1QLWA 5I7EA 5IXJA 4WI1A 3OZSA 3P2OA 4KNVA 2CNWA 5HHTA 3PE6A 3H4DA 2F1HA 4ZANA 2WK1A 3RUEA 5IZCA 1XEFA 1VJCA 2E3JA 2NUTA 4EABA 3CKMA 5FD8A 1IJBA 4PPGA 1MOPA 3IODA 3ZDBA 4LWZA 3KWMA 3MCAA 4EELA 3OJEA 4KAJA 1DRUA 3X1MA 2PGAA 3NBMA 2XSZD 4OB6A 3RU7A 3A9SA 4YJ2B 4JI8B 1UT6A 5KYUA 3V46A 2YH2A 1BXRA 9GPBA 2Q3HA 1GRCA 2HU7A 1LPOA 5AXBA 2B4RO 4IVRA 4TWBA 2VDRB 1G7SA 1XBTA 1UEXC 1X6VA 2G5TA 1QGZA 2DPXA 3D1LA 1S0MA 1RWVA 2OYSA 5BN1A 1YBVA 2EEPA 2OC4A 5EWGA 4EB6A 4R8LA 1EVZA 5TNXA 1EE1A 3UMMA 3NATA 1Z5UA 2D62A 3E7XA 5JSQA 1QP8A 1ESDA 4I7EA 5DHFA 2HDNB 2C3UA 4MVJG 1JPVA 2NVUA 2IYQA 4GGMX 4PRLA 2W9AA 2AMFA 3EBLA 4KZPA 5LFAA 5DHAA 2ETVA 2QUZA 2FX2A 2AYZA 1CB0A 2REQA 1FJGH 2WJGA 1ZW6A 3PEYA 3IDZA 3EF3A 3EDMA 4M0FA 4F72A 2CD9A 2IUYA 1NVBA 3VJLA 2H7XA 4MRVA 3I12A 5DISC 1R6AA 1XCOA 5CTAA 2GJ9A 4OKSA 1KEKA 1DBSA 2IPXA 2OMKA 1VL0A 3Q72A 1C30B 3K2BA 4BQEA 1NHGA 4ZYZA 4DB4A 2F8MA 4R0MA 1T2DA 3VDXA 3BAAA 4DCOA 5ICEA 2B0JA 2GT1A 1NBHA 4HC4A 1MA3A 2GAJA 4DCPA 3ZLJA 3RHFA 5DGDA 5D6NA 3RVSA 3GLGE 2F8SA 1UJMA 2IYEA 6REQB 3DM9B 4RPHA 1SFRA 3GLUA 2X9NA 4TKVB 3WJ7A 3ZE2B 1U0SY 4FQ7A 4LRTB 1N7HA 5TGDA 1ZRMA 2BFEA 4YJDA 4GLOA 3TRDA 2NYUA 2OECA 4JV0A 2FMTA 2QQGA 3KSDO 2CMGA 2DG2A 2HMUA 1LRLA 2I6QA 2FK2A 2H51A 3NX4A 5JQWA 2YRFA 2YJZA 3K09A 3QUBA 4ED1A 3WSTA 1WUTA 3C48A 5EUMA 4WA8A 4DMRA 3SZMA 1F4PA 2NQ2C 4H15A 3ABSB 1DUVG 4DV2B 4M53A 2NM0A 5EWEA 3QWIA 2XA2A 4MZXA 1S2GA 2B21A 2QRUA 1M2JA 1XCJA 5K4GA 4O33A 3GEDA 5ALMA 1G6OA 5HBRA 3UV3A 3WNVA 3JD3A 3B6KA 4LDQA 5B2ZA 5CJ2A 1E2DA 2ZIWB 3EDCA 1RE0A 4O4HB 1Q6YA 5DGAA 1IWOA 1IN5A 2PYIA 2WD7B 4LQ4A 2Z6QA 4JL6A 1N56A 2NU6B 1MAUA 3CX6A 5IJ0A 2EWWA 4W63A 5ED4A 3EMKA 4KXFB 1AY0A 2QTVB 3Q3VA 5YASA 2YW9A 3TLKA 1LH0A 1UJNA 2EG9A 4ALKA 5EKTA 3H3VH 2ZB8A 2VNHA 4RMHA 4ACAA 1M1YB 3U3XA 4RGQA 1U5AA 1C4KA 4C0JA 3PUKA 1ESZA 4UARA 2JEGA 3DTGA 3GCXA 1COWD 4M83A 2JK1A 4BB6A 3VMFA 1QWOA 4AUMA 3CH5A 3HCPA 4I4IA 3IL2A 3GYGA 3LLVA 2OXRA 4MB0A 4AG6A 3ACDA 3EN0A 3SY8A 2PX6A 3MMNA 1M8KA 2V0CA 1JG2A 1S89A 3CLRD 1NLMA 3FGZA 3FUWA 3ROPA 3W3AD 4BVHA 1AKRA 1ZFNA 3CNEA 2Q28A 4B7AA 3UXMA 5F9NA 4FJ0A 4PSVA 5H70A 1DBWA 1X80A 5EOVA 4PHFA 3WB9A 1TRKA 1R6UA 5GPBA 2CJPA 2CB0A 2Y4NA 4YN3A 5D87A 3FUTA 1QX4A 2FG5A 2XT6A 1A8UA 2HI0A 4J1QA 3FYDA 2UUAB 5FD5A 1QM5A 4I4LA 2XOKD 4PM4A 5FPQA 1TB4A 2BIFA 4OK5A 2JVKA 3JWIA 5KAMA 1J8DA 4HWPA 4M8NE 3T0FA 1J09A 2BSXA 3AJ9A 3RSZA 2QD5A 4NZZA 4OFXA 2H00A 3CF4A 4P4UA 1QFXA 1XKLA 5LD2C 2H1HA 2PD3A 3OFNA 4FEEA 4DNOA 5IJAA 3CT6A 1PZGA 1EFHA 1J2UA 2FE1A 3H2ZA 4C88A 1NONA 3M4XA 3PJEA 1VS0A 4ND3A 3THXA 3KQSA 3AHDA 3B13B 5HK8A 3DEYX 3TS1A 4HAXA 4BGDA 4QAQA 2PEZA 4DZRA 4CKCB 2CXNA 3ZVMA 2Q8NA 1KI6A 5ESWA 3IG0A 4DQUA 3OX1A 1PDVA 3M4YA 5F7ZA 4AQ7A 3SQNA 4KAFA 3WC4A 1YJAA 3OOSA 4MRMA 3GDGA 3D6VA 1LJLA 4OXRA 3X0DA 1BZYA 1H93A 3DAPA 4QOGA 2OZPA 2X6TA 1QP4A 3R4CA 3UA4A 3FPBA 4DHEA 3U48A 3F5DA 3S2IA 1RAEA 2WWTA 2Z1MA 3TW8A 1EM6A 3I2GA 1XDUA 3A6FA 3CM0A 4LK2A 3QQ5A 1KHTA 2P4QA 4UM5A 3QZUA 2C92A 4ZGGA 3EJ6A 5L1LA 1ULSA 3DBRA 1I1LA 2OCIA 2JFOA 1NP3A 3GRRA 5JRZA 3M3HA 3Q3EA 1PR3A 2GEKA 1DT3A 3RS9A 4QBTA 5ENDA 3IVAA 4PO8A 4ENTA 4X6LA 3E1GA 2GCGA 9LDBA 2FPSA 4UUOA 5B1SA 4DR7B 1BX3A 1UR5A 2GPSA 3BEDA 1GUYA 4ICIA 4YQEA 3IELA 4NHOA 2EFJA 3I5UA 1XQXA 4UUQA 4A15A 3I4NG 4OYRA 4IIHA 4DA0A 5LDHA 4UCQA 3T1YB 1GIAA 3VTFA 4KXQA 4LGCA 4TKUB 3L1VA 1QAOA 3DT8A 2ID7A 3EARA 4FNGA 3UAYA 1PR9A 2CLDX 2VJQA 2E55A 3BL5A 1YR9A 1CG6A 4LFBB 4H1UA 4MAMA 1TCCA 4YRZA 4GEKA 2QW1A 3V4VB 2FV8A 4I6GA 4FFMA 4QPCA 1YVRA 5IAEA 1PO7A 4LZNA 3ZGOA 5TR9A 3BEOA 1GA6A 3W7VA 2PRSA 1I4LD 1P5HA 3ROEA 4QXPA 2J4FA 5AM3A 2D74A 5B7NA 2TECE 3ORYA 5AYVA 4X90A 3L2OB 1ELOA 4P4TA 1FFEA 3F73A 2FMHA 1RWPA 3C3AA 2PD6A 3F6EX 3DFFA 3K9NA 5B6JA 2Q50A 2JI9A 3G23A 4F92B 4A92A 2QLNA 5AHXA 1V6AA 1J42A 3EW9A 221PA 1V48A 3EPJA 4XZ3B 1UZAA 3SK0A 8LDHA 4KO8A 3PGA1 4JI6B 3GMIA 3GV8B 4RTKA 2QHXA 5HZKA 1NR7A 4X71A 1SA0B 1CDOA 4LSXA 3I8OA 2Z02A 1UDAA 1AUQA 1ZM2A 2QJFA 1Q0PA 2V6MA 4IQGA 1ECFA 2PNJA 4XVRA 3UT5A 3NTUA 4MQFA 3T7JA 1S2MA 1PP4A 3QXJA 3MAAC 5BWXA 1OD6A 2WYOA 4UCUA 1AGNA 4YRPA 4Q9IA 5G4KB 1MLDA 1ZEJA 1NFQA 4HH1A 2EV9A 4JP5A 4MIKA 4ND2A 5K05A 5DGCA 5FULA 2P9ZA 2WSSA 4YCAA 4JOCA 4YPOA 1UJCA 1I6MA 1MHPA 2ZAOA 2UVWA 4ZYTA 4C6TA 5CNMA 2CBGA 1GPUA 3C4QA 1S03G 1R10A 4YMWA 4DR2H 2R7LA 1B8VA 3SM3A 1HG1A 1P7WA 2FGJA 4XEHA 3RE1A 4HYKA 1ZZGA 3WGOA 5LOVA 5B7QA 2QUHA 1G3RA 3KC2A 1HR0B 2XJ4A 3CNQS 2QSZA 4I9FA 3N8GA 3OU2A 1MIOA 5JIBA 3NCHA 2JGNA 4G5QA 3ZDYB 1N3YA 3VSEA 4G4JA 5KJ6A 1E79A 1PLLA 4YHBA 4PO1A 5AJUA 1DXQA 3VR5D 1RQGA 4GZ3A 5CA0A 1AZTA 1N2HA 5GONF 1IAQA 1VG0B 3PGXA 5THKA 3QJ5A 2CW5A 4AMBA 1XQ1A 4PX5A 4A0SA 3OJFA 1JSCA 5DW0A 1DIAA 3IPLA 3TNJA 1A5TA 3FOZA 4IF6A 3NP7A 3EGIA 4AROA 4KITB 3HRHA 1T3ZA 3KPWA 1Y6QA 1H4SA 5JS1A 5D86A 4I0WB 4LBVA 1SCUB 4RV9A 4EECA 3LT1A 3BFJA 5ICCA 1KFBB 5AW1A 3ZDQA 3R9XA 3N53A 2ZYRA 1I2MA 5GTDA 1M34A 1KC1A 3TVYA 3EYAA 1VAJA 4K6HA 5BXQC 3BE8A 1Q57A 3IDFA 1SELA 1J39A 3F8WA 5CD9A 2BM1A 1SHJA 4QYMA 5L6LB 1NUSA 4I55A 4O4LA 4D56A 2EZTA 4I1UA 7AT1A 5CNKA 1EKVA 2COKA 4MMYB 1ETUA 3SZGA 3W6ZA 1U0NA 3SEFA 1R4NB 2O9JA 3QMMA 4L8VA 5C8DA 5AI4A 2QLTA 1OLXA 2C2OA 2QMZA 5LP6F 1GA4A 4LKRA 4AF6A 1GGNA 3QBJA 1SBNE 2HMAA 2JARA 3RODA 3JARB 3KYDB 2CMDA 3DV9A 1Y9AA 1DINA 3T1VA 4V02A 1KDVA 3PDWA 5A62A 2ZDQA 3ED1A 3RV3A 4ZK2A 2C61A 2ZRQA 3KJXA 4NBSA 3LLSA 3ADPA 3B8HA 4B4WA 2H4WA 1MRZA 3LUCA 2GZ2A 1QQ6A 3UK2A 4YJGB 2IUSA 4JSTA 4AZ0A 3W1BA 2JCYA 3N8NA 3QKSA 1U81A 3GJXB 1REQA 1QG6A 2NOAA 3HJCA 3KS9A 1MJNA 3K72B 2BD0A 3NHYA 1RPAA 3QPUA 4RD6A 1D0IA 2XUHA 2ZYVX 3PXDA 2DERA 3C8MA 3AESB 5IS2A 5ESRA 4EHAA 5TARA 3RTXA 4Z9YA 3RBXA 3OZWA 1V11A 1FDRA 4KGZA 4J9RA 1Q6ZA 3KHTA 5L1IA 1J22A 2C59A 3THRA 1OROA 5GM2A 4YXWA 1D2MA 3W3AH 2IITA 3BMOA 3H0EA 3IMKA 2O3TA 3T7DA 4PLTA 5LR6A 1PS9A 3LC1O 1NA5A 2XGPA 1ZNQO 5L40A 3TIGA 1WSCA 3UHAA 3PRHA 2GK4A 4H3SA 2XDQA 4PG4A 1TVMA 5K3SA 3TEMA 3ENNA 1UOEA 5SV2A 5JHGB 1BDBA 2LCQA 2FWJA 2NT4A 3RB6A 4Q7KA 2QMOA 2YINC 4XWKA 4WRRA 4O7VA 2GVZC 1W46A 4YBZA 1U1EA 4B2LA 5F64A 3AVQA 3ZOZA 2H1CA 3EDRA 2HA4A 1YR3A 3L0IB 3A28A 3HB7A 3FDZB 4RH0A 3DE7X 3ID6C 4G0YA 4KXXA 4D3XA 2PT5A 1JDBB 3U13A 3C1UA 2J9GA 3FCAA 4ZEXA 3QHPA 1KEWA 4LC9A 1OB5A 4JOQA 5DOZA 4C2BA 3FFTA 2VRCD 3DB1A 2PX5A 2VSNA 3ND6A 1ZOLA 4JUDX 1V51A 2YMLA 4XB1A 3UOAB 3EVGA 2XTMA 2J0UA 3R6WA 2QV0A 1BW9B 2WTMA 1XDDA 2PRKA 4LDPA 4R7GA 2Q2WA 1IEWA 3KKZA 3E22B 3OJCA 5D01A 3BJIC 3GJQA 2WOOA 5I51A 3IBCA 3F8NA 2C2YA 5A7FA 4MV0A 3OTOB 1TLLA 4YAIA 1QUFA 4UFOA 3CZQA 3EY4A 5KFLA 2J5QA 3H5VA 1ZGZA 1I2DA 1SCAA 3FPFA 1YZYA 2J6IA 4MW9A 2OCBA 5E9AA 3DFMA 2DH6A 3H4BA 3EK2A 3SMVA 4LFAB 3O4IA 3O5AA 4WSOA 3PZRA 1T3NA 4R8VA 4X6UA 3C8DA 3AR9A 3HCOA 2X9VA 4OQYA 3IRVA 1NRIA 3UWKA 3AVXA 4BDTA 4Q1VA 3IV7A 4QLOA 4RLFA 2WIKA 4FM9A 1A1VA 1QFZA 3RFXA 2CYBA 2QTAA 5AKGA 3ZS9A 3X1DA 2Q5CA 1RXEA 3R23A 2ORED 1WQ1R 1TMGE 5LQAA 4CLRB 3PDUA 4LRWA 1KWKA 1Q11A 4C0LA 1XRSB 5K3AA 3PFBA 1KO1A 1W94A 2JA1A 3M1IA 1FFYA 5GV8A 1KK3A 2PMZA 1ZRNA 1VIYA 3E03A 5I48A 1TFUA 4HF7A 1V3VA 4CIYA 2GXQA 1PAUA 4ZICA 4K0KB 1N25A 3I8XA 5T57A 3OIUA 4QFDA 1VL5A 2FWAA 4OMCA 3GJ8A 1MQ8B 3K6JA 4BFLA 4XJSA 4ZO6A 5CFRA 2FPUA 3LQFA 2V9WA 1P80A 2KE5A 3HO1A 4HY3A 5EPEA 4MQMA 2QN7A 1AE1A 5F9LA 3ZDDA 2AI1A 3PT5A 3K6SB 3LK6A 2N1MA 2GWHA 5TMEA 4RPLA 4UHKA 2DE0X 4D2IA 1NULA 3DSRA 3GDEA 5IDYA 1JLKA 3GP8A 3MWDA 1W73A 2PRZA 1QRSA 3B3AA 4A36A 3C97A 3FPKA 3ZGVA 4ZZ0A 2Y6VA 4RU9A 4RK7A 2H2IA 3NKVA 3GZ4A 3B3QA 3MZ0A 4LRQA 4GP7A 4V1CA 1I5EA 5FLXW 5CMLA 2M05A 2ERXA 4B6QA 3OU7A 2YDXA 1WY5A 3AGPA 4ZT6A 1Z5VA 2WHEA 2CVHA 3LUKA 1DQPA 4HOYA 5IJZA 4Z4QA 3GUVA 1E6WA 4V0RA 4UMDA 1HRKA 3ESZA 1QO0D 4LRXA 5EIXA 1PJLA 4G1UC 4YAGA 4UDOA 2B1RA 1N2CB 5BVHB 1X0VA 1OC4A 1GM5A 4YHHB 3VR3A 4FKMA 4LSWA 4J6FA 1FFCA 4EHDA 3WL5A 3H13A 1J70A 4UTRA 2CHQA 3JQ9C 5GJWC 1E2GA 3CCFA 3KZCA 1SJ9A 4L76A 2JLWA 1LSJA 2FLWA 2W0SA 3BXXA 1O54A 1BWPA 3FXAA 1M6NA 3ECCA 3CXUA 2P6NA 3RSLA 3UEOA 2I4MA 2HMTA 1EWVA 1E20A 1US8A 4TXHA 4Q24A 1FDTA 4M6WA 2PUEA 4MH0R 4L95C 1NVXQ 2UZ1A 1IEXA 1FFBA 4IGKA 2UUCH 2XCIA 2ZI9A 2H18A 5HM8A 2B34A 2FJ0A 1ZO8A 3KG2A 3IVMA 4AT1A 4ZAXA 3UW1A 3AF6A 3R7FA 3FPJA 1JIVA 2X4LA 2P0EA 1I9CA 4HBZA 3BX1A 1LZKA 3CTMA 2W48A 3S7ZA 2LUOA 4HGZA 1B23P 1ISRA 3OHAA 4EPWA 3A6ZA 3EXG2 5KFPA 2Z8XA 2YWGA 2DPHA 4JC0A 3VR5H 4UQPA 4BIIA 5CB4A 1R0ZA 2DQZA 1P45A 3F8SA 3CXRA 3W2GA 3AILA 4BFTA 1I94B 2P2ZA 5DG9A 4RVOA 2YIDA 2X8LA 5CNJA 1ZNXA 3L0ZA 1UOPA 3PIRA 3EOZA 5BWLA 2Z6AA 2GVDC 3D6TB 1HE8B 4GZLA 3MTBA 2I7VA 3C7CB 2FPPA 1KEEA 2QQFA 3L07A 4FPXA 3EDYA 1SBQA 4MV6A 1OBCA 4WXEA 4LJRA 4R1PA 1UFQA 1Z7YA 4D0LB 1U6IA 4KXVA 2VXCA 4RA6B 2ZS9A 5J5CA 1V71A 2RHWA 3RS3A 2VJOA 1SG9A 4Z8XA 3PO2G 5FWXA 3I1JA 3NHPA 5GZ3A 1HTBA 4OMDA 3FD8A 5IMSA 1LK0A 1X1EA 2B2NA 3JQ8B 3N1UA 2QF7A 1KAEA 2B5VA 2VLIA 1YK1A 4S2EA 3ZV4A 3H7AA 1P9NA 4NBNA 1N32B 4BO7A 3I4LA 3D3NA 4HRVA 4Y2HA 2F48A 5BSVA 2HIGA 4KGDA 2WDZA 1VBFA 1NMSA 1JDZA 3V8RA 1CUSA 3Q9UA 3LZDA 4O02B 2OEPA 4DILA 3LHFA 1M73E 1T6XA 3TB6A 4B71A 2E4WA 1L4YA 4P7KA 2ZPUA 4URFA 4MYCA 1SHZA 1BE1A 4FWBA 4ADSG 1IONA 5JAMA 5JD4A 1FYWA 2IDJA 3V8VA 3WBKA 4RKFA 2RFLA 2WPNA 4DUYH 2AKAB 4EG3A 4ZIRB 1CZRA 1R8YA 1QV7A 3O9VA 2R7KA 1G66A 2KJQA 2BCJQ 1T9GR 4M76B 2BFNA 5KAPA 3L3BA 3NC0C 5MN6A 1SVIA 1DO0A 5J40A 4FONA 3GMDA 3LX8A 5ES4B 3KR2A 1PFVA 3S8MA 3NO4A 3RJ5A 1U5BB 4BCBA 1OWLA 2XOEA 5ICMA 1K9SA 4OIFA 2EKLA 5GZ1A 4CKWB 3MS4A 3L49A 1OZAA 2EKPA 4QOEA 4Y6PA 2BAGA 3HWRA 1JKXA 1N8NA 4KW7A 1K92A 2Q0XA 2JLZA 3IUMA 4ZYUA 2OLKA 3ADBA 2CSUA 4PQYA 1MMFB 2IH4A 4ZEMA 1WZNA 4EKGA 4IF4A 1GTL1 4AMUA 1ZSYA 3EEFA 5MHTA 4EARA 4RIEA 3KP1A 1XXHB 1DG3A 2WVAA 4WPGA 2OPBA 2X41A 4G67A 3OLWA 4KE8A 1K6JA 2P2SA 3ZW9A 4JXZA 2F4NA 3QMWA 4ARVA 1TEXA 2AV6A 3IQFA 4W5OA 2AN9A 2ZSBA 1T9ZA 3CVJA 3TCKA 3ONNA 4E5KA 2QM8A 1KJJA 3NXKA 3AY0A 2WWRA 2PSJA 5IABA 4C78A 3DMHA 2HU2A 4RMGA 5IDQA 1WOYA 4FUTA 1MP0A 1FFWA 5B3LA 4ROSA 2WYVA 3L05A 5TLSA 2CNQA 2R8RA 2MSKA 4I6JA 3AR3A 4ZOLF 2OHXA 1SU8A 3OT5A 4PYRA 4MS3A 1GZ6A 4UBMA 3LHDA 1DUSA 1GRQA 4W1RA 1D2NA 1ISFA 3VXKA 5AKYA 3LYAA 5EYPB 1UMBA 1V43A 5E1BA 4Q7MB 4C0QC 2DT8A 2EBWA 4JN6B 2PVPA 1B42A 4FX2A 1OTXA 4FT4A 2YJ3A 4AF7A 3UPTA 2VQSA 4D6PA 5L4SA 3F74A 4ZI7F 1YH3A 4WZBA 1F8FA 2X6QA 1YMUA 5AXAA 3G02A 3AHFA 3HBMA 4F9GA 4AICA 2EC5A 1R5NA 1FVFA 5KFTA 4CEJB 2ZRJA 3TM4A 1DAEA 5IAJA 3GUHA 3NW9A 4GQIA 4RANA 5AKEA 1SKAA 4XWGA 3OM8A 3WWPA 5JJBA 1UJ6A 1XF9A 3MCWA 3S1AA 1L5SA 5HF6A 1PUIA 3AVWA 3CUSA 3EH1A 1Y89A 3LLCA 2PCLA 2FW6A 1A9XB 1MO3A 2J7PA 3DTYA 1Q7CA 2GESA 2NVWA 4KP7A 1RBQA 3MGAA 1A7UA 3RT7A 2F6RA 3ECAA 3FVWA 1TGVA 1TVCA 3TTSA 1JDNA 3QXCA 1GRRA 3W78A 3FVTA 3IP6A 4WQMA 2OQIA 2FX3A 3BICA 3TR0A 4X1YB 3PLNA 1DXOA 1XTZA 5AHRA 5ERGB 4D3YA 1AVTA 3WXBA 5FLMG 4O3NA 2XBUA 1OI4A 3R2JA 3V1LA 1BH6A 4QAJA 4HL6A 3JZIA 2J1LA 4U6NA 1XHFA 4EO7A 3WQSB 3KU4A 3K8YA 4YY3H 3T1HH 3ZDRA 1F8UA 2J9XB 3D8SA 3PUVA 4M8LA 5SYAA 1VQ1A 2GN8A 1NV9A 5IJWA 1KRWA 1XDZA 3A32A 3W1VA 4BGIA 1CRZA 1ZDMA 2C95A 4A8JB 4JP2A 1V7QA 3RRXA 4LX0A 1PJRA 3I4MG 1VPVA 2TSYB 2XMCA 3Q9NA 2R8XA 1L2TA 4HZUA 2AC7A 5ISMA 5AXDA 4BC0A 1XZAA 3DMTC 1X1DA 3D8HA 3LTEA 5HOEA 4HDNB 1PD0A 4W8OA 4PLVA 1VPWA 1FDOA 3M5WA 2VYQA 5CVVA 1E6MA 1N0IA 1PQPA 4LH6A 2YC4C 2HHHH 3RBDA 3U4QA 3TLBA 3QEAZ 5KREA 5BSHA 4WK0B 1GAJA 3HXKA 4DGSA 4NAVA 5B2FA 3UKOA 4JB8A 2P3QA 4ZPJA 3OPYA 4OQDA 1XJQA 3CVUA 4XRGA 4AWAA 1UKZA 3E6AA 4NYJR 3BB4A 2XMZA 2W6OA 1H8ED 1I1KA 4DA4A 3R20A 1Z7GA 1UPAA 4OATA 2A84A 3BZUA 3W9SA 4BN4A 4BUZA 1DIOB 2I80A 2D00A 4CMDA 4QPDA 2IXGA 3U5ZB 3EQ2A 2CUNA 1GN9A 1QOQB 3NBZC 1QO9A 1TAGA 1XDGA 3RF6A 3HCRA 5LQDA 2DECA 2VG8A 2CYCA 2PZGA 1AKTA 4CTOA 4DE5A 2Z3VA 2Y1GA 1X2BA 2ZT5A 3GEHA 1H2XA 5JO9A 4EJSA 1Z36A 1GDHA 4TSFD 3SX4A 3MBOA 3DAYA 2HFKA 2FRDA 3L8YA 4IRXA 1F7VA 2O0LA 5DSTA 3K0KA 1KK0A 2CKDA 3AL2A 4E2WA 3QP9A 5COAA 2W8ZA 1V3TA 1GL3A 4V3BA 4JJGA 3LKVA 1CUUA 1RYNA 2CKMA 4CMAA 1H2HA 4YYEA 3OE5A 1K8RA 1NKSA 2PGNA 1L5NA 1Z3CA 2BKEA 4R2MA 3MWMA 1YKSA 3P0FA 4D41A 2UVVA 5DNUA 4HADA 2JIQA 4OFWA 3A58B 3A4VA 1A0IA 1RK6A 1FVXA 4PZZA 3PHBE 1JTEA 3JQFA 5KPDA 4O2BF 3KYCA 1WLYA 1CUVA 4KL8S 2ZUEA 3MB8A 4U2GA 3NHRA 3L4BC 2PUWA 4BS9A 1P0MA 5JJ5A 3RGWS 4LXIA 1V1MB 2C9OA 1N2ZA 1P44A 2EKQA 1L4GA 1NP6A 3UCEA 2H2DA 1PEAA 3QOFA 1J07A 1NM5A 2VXOA 2VHQA 1ZUNB 1YUMA 2PZAA 5JNRA 4V1CI 1Y1PA 3TQTA 4MPDA 1YRHA 4DJJA 2VK8A 2ZDGA 2JCXA 5F7JA 1ZWLA 3FH0A 2XHEA 3V4OA 4J43A 1W36D 1JMKC 2WTFA 2WY2D 2J33A 1WCMG 2OFOA 1P62B 2UUBB 3KQQA 2V0GA 5DNVA 5CLQA 4JI7B 4G89A 4EHIA 1CJMA 4M54A 3DE0X 3O1IC 2OO3A 3E4CA 2XKJE 4KODA 2O2SA 2X7JA 4RGVA 4K6MA 3FETA 3G7UA 2PFKA 4RB2C 3MMXA 1QSGA 3UAZA 2P0AA 2Z58A 4GR9A 4YP3A 3HEAA 1K1SA 4QPJC 3G85A 1IBLH 3WYNA 1AGPA 4GW3A 4TYPA 3TINA 2FK1A 3GRPA 3HPQA 4YRGA 1U8EA 1JI3A 3ZN2A 2PZEA 1D07A 4BNKA 2OB1A 4OD0A 1E3EA 1T4DA 4AL4A 5JS8A 4GPIB 3PC7A 5BV7A 4EJ2A 1NJ2A 3CZAA 1RTTA 3R6LA 2IVFA 3EVFA 1VPLA 1IHXA 1WNTA 4B17A 4IY1A 4FFSA 4MB2A 3ZWXA 4YASA 5EHNA 1DAFA 3TNDA 2J0SA 3C3BA 2O03A 5HILA 2QVZX 3A7DA 3L9WA 3EG5A 1UPBA 2WJZB 4IBOA 2P7HA 3RJ0A 5BWUA 4X20A 1SOVA 3T52A 2BKAA 2LVBA 4D8WA 3GNQA 3ZE0B 1IBMH 4IGEA 2PUCA 2NXNA 5EQJB 2PXXA 3K1ZA 4F97A 3NTLA 1LPAB 1YV9A 1ADCA 1WZUA 1II8A 3G2KA 3LBAA 1HT0A 4HDSB 1R0CA 1OF1A 4D8VA 3U26A 2I6UA 3V42A 4Z2YA 1TE2A 1IK6A 2I66A 4Y2GA 1FPMA 3OZIA 5CP8A 3QH4A 2BP7B 1YL6A 1W5EA 1SK8A 2C9DA 3U09A 1E2EA 5EZYA 2NUPA 4HN2A 2XMSA 1DEHA 5IKEA 3SSAA 3PQCA 4ENWA 2HBZA 4BPBA 1MAHA 4LF6B 1HZJA 1AH2A 1YGPA 1KA9H 3THYA 1E9DA 1HT1E 1C50A 4PZYA 4MCAA 2Q3JA 3V4RA 2IHTA 3J81A 4CJXA 5ADUS 1KKLA 4NXMH 2QN9A 2GNOA 1RMQA 1XRLA 3EA5A 4NV3A 4UE3S 1YR8A 4E32A 1SD5A 4FFBB 4KRYA 1KSHA 2AFIE 2BTQB 3UGQA 5DH9A 1AMNA 5EJEA 1UM9A 1RC1A 4D92A 4Q16A 1Q95A 1NMQA 1NUAA 3T7EA 1YFKA 4RFSB 1KBQA 4LCEA 4OKIA 2QW8A 3AL0C 3VM6A 4EG0A 4PZ0A 4A3FG 3ILSA 3DE3X 2JA6A 5JNUA 1BX1A 3ZLBA 2VYNA 1V0JA 3NKLA 2GQ0A 4L4RA 1V8BA 4WKOA 4C3OB 3NV7A 5EJMA 4GR4A 1JHDA 4PSKA 3AG6A 4UBKA 4ZKEA 5ENVA 4AMZA 4P35A 5ELMA 4PFSA 2Z4TA 4RY8A 3VKWA 3KLBA 3OZVA 4DSNA 4O84A 4HGNA 1ZHFA 1YASA 3OOHA 2O05A 4Z4FA 3K9LA 2UYYA 4WKBA 4JI2H 4H1VA 3T3GA 3DCJA 5HKKD 2J09A 3A4YA 5KG7A 1L7RA 1HKHA 3WSWA 4HMQA 5J23A 4RF3A 2QI9C 3ZD8A 1QCZA 2C4WA 3F6SA 4D81A 2X40A 2AX3A 1H5NA 5EUCA 1RVV1 2N0SA 2JB9A 3FNBA 2B94A 1CXZA 4IP0A 3C45A 1KERA 1NBME 1T0UA 3L8HA 1CY0A 1J0BA 3KJZA 5JJCA 3JQAB 3DVSX 3A9TA 2SBTA 3IEKA 4Q3OA 2ZOSA 3D6MA 3A2LA 3SJBA 2HSWA 4CGZA 4QUJA 3TECE 3DCYA 2GM5A 4IMIB 4EYSA 1OZ0A 5AK3A 3ZDXB 4NBWA 3SWWA 1FFXB 4MS4B 4DR4H 3DE1X 3DYBA 4FW8A 4JT4A 2FP3A 3JR3A 2HHFA 4BYMA 4O3MA 2GPJA 3P4YA 4AWBA 1XEWY 1QRTA 2YDYA 1KDZA 3QFSA 2NO7A 1C3JA 3C0FB 3KOZA 3VNSA 4EPYA 3BWVA 4IHJA 3PHHA 3R5TA 2AGPA 3OE1A 4KBYA 2OBBA 1IIBA 1H1LA 1TDJA 1VHWA 3CR7A 1B00A 2D1FA 2AI2A 3BT7A 1EP2B 4WDRA 3CRVA 4Q3CA 4WV3A 3QVUA 4NYIQ 1ZEMA 1N4AA 5E1DA 4BO9A 1ZHOA 5F12A 1XYYA 4ND7A 1E9RA 1VC2A 4H60A 4JEMA 5JDIC 2UU9B 1DC5A 3QVMA 1FTWA 4CM4B 3LF1A 4ZP1A 4JU8A 3WGUA 2I76A 1EXDA 4H1WA 3IPRA 3W9UA 3GLHB 5F33A 2X9GA 1C8BA 2DOKA 1N4DA 4ON9A 2VFAA 1FUIA 2IE8A 1TA9A 5IBQA 4YRRA 1HQYE 1U11A 1IHYA 4BP3A 4B76A 3VV2A 2CC2A 3E23A 4R7ZA 5BV2P 2VJCA 3JQPA 5EWLA 1IN8A 3H1PA 4E3WA 4Z86A 1Z6TA 4Y67A 2I03A 3BTUA 3UMCA 5D5HA 3BERA 1IQUA 5I01A 2GKGA 4F2HA 4DR6B 2R6CA 1CZHA 1GPDG 5JNVA 1WHTA 3H2KA 5BNWA 2HC9A 1EJ2A 1C3LA 4TKLA 2ZI7A 1JHXA 1FDSA 5E8RA 3QPVA 1OTYA 3IVRA 2AOTA 1CZOA 3RYFB 3KJNA 4URZR 2CLOB 3A05A 4B85A 3HMKA 4J9UE 2VJNA 1Y9JA 2W57A 2V7PA 3GDHA 2QSUA 4GRIA 3I5YA 2C20A 3SXJA 3HJHA 1QF6A 3WV4A 4PE5B 2JZOA 3LWZA 3NDJA 1JDEA 3Q1KA 3R3HA 1HEYA 2ZR8A 3MRSA 3GGDA 3A6GA 5CFNA 3SQXA 4QDJA 1BRTA 1TJ3A 3GN2A 4TVBA 2VBGA 3DMYA 6PFKA 1N5OX 4U2EA 3A2KA 4BHTA 4C0SA 1IYZA 2EGGA 1KQPA 3OM0A 3UHFA 1Y1WA 3DHYA 1Y1SA 2PJUA 1E7YA 4PN7A 1PF7E 4HAOA 2YN2A 4RMJA 3HOZG 3PBKA 4B3IA 4FS3A 3SNKA 4MHTA 3W5DA 3FSGA 2NAPA 1SXQA 1GEEA 2AD5A 3OPYI 1RWBA 4QJFA 2RHGB 3LDHA 4WOCA 2AGQA 4CKEA 5DM0A 3SKXA 1V26A 1TA8A 2AB0A 2XIQA 2E5FA 1Y7HA 5EIWA 3TK1A 2BGTA 3L0PA 2WWYA 2C7RA 1I3NA 4XWAA 1PT9A 4C0HA 3H42B 5KYTA 3QF4A 5LUAA 2Q5HA 4CF3A 3OF5A 4ITRC 4TMZA 5LXTB 3W7BA 2BUBA 3KEMA 1J5PA 1VFPA 1PKXA 1ISMA 1CX9B 4QUGA 2J5BA 4MJXA 1Q1NA 4OJTA 1RXWA 4J0HA 4E6NA 2F7SA 1FLVA 4HT3B 2QAGB 4N5MA 1KMMA 4CDNA 4P54A 3DBHA 4HDQB 4IV0A 2EP7A 1WRVA 3UJPA 3TD6A 3L0OA 1V16A 1D1PA 3ORRA 3NDIA 2Y71A 1Y4UA 3O73A 2ADOA 2C4NA 2B61A 1M74A 3WOHA 3L7AA 2ESRA 3IHWA 1IBRA 2PGJA 2A33A 2HA7A 1LUAA 5F3DA 3T1QA 3BKXA 3UMJA 3N8KA 1EQAA 4BMPB 3NETA 4NESA 4NE7A 5EJ4A 3GTKA 3VA7A 1WCYA 4ASUA 4EF4A 3U6BA 3F90A 3G9UA 3GZTB 4AF8A 2I3ZA 2YV3A 2EYQA 3NIFB 1E3MA 5J2TF 1G4UR 2UXDB 1DKPA 3M0EA 2FRXA 2H92A 5HCUA 3VOAA 2ODTX 1YB5A 4MUYA 2CNWD 2X5NA 1T4GA 2HDHA 4Q4JB 3O4VA 1AKWA 1O75A 2ZZKA 1PJTA 3N74A 5BSGA 2HPVA 3EGDB 3KJIA 3RNOA 1SBHA 2HWKA 4LECA 2F3UA 5DEOA 2SKDA 4UUNA 2VJMB 4S24A 3ZHBA 1TK2A 1U8ZA 4ZT3A 1AKVA 2VH1A 3KYIB 3L1JA 1FNMA 4R05A 2XNHA 2NXWA 3QLTA 5JQGA 1Z0UA 1PK8A 3WP1B 4G4SO 2QX6A 2XUGA 5GONB 1N77A 4AJKA 1P7CA 4PZ7A 4Z9XA 1MZVA 4ZAYA 1NQXA 2Q6IA 4P83A 4K6NA 2BGLA 4EI8A 4YRAA 3K2IA 1TQHA 1S2OA 2XCAA 1LRJA 3OSZA 1GGHA 1SXGA 3FNQA 4I66A 5EXXA 5DGHA 5JV5A 2B63G 3VI4B 1RQLA 3PJGA 1ZVKA 1AHNA 1M2VA 3P4XA 4RTOA 4LK3A 1QZTA 3STTA 4CV0A 1KS2A 1YNSA 4KBFA 5ICSA 2ZRKA 4NDZA 4AULA 2EJUA 2FQYA 3F6PA 1LDBA 4O0LA 3DLPX 1GZSA 2K7FA 4IINA 1I3QA 5T3YA 3I45A 3Q7RA 4QD3A 1ECBA 4HYEA 4YXFA 5KVVA 2L42A 1V45E 2JEZA 3VMMA 1NVDA 2AOUA 3LPNA 3CZ4A 2NT3A 2PTGA 1SD2A 1AQLA 2IHYA 4EHBA 3PDIB 4TLCA 1MQSA 1UADA 4XX0B 3SHOA 1GKIA 3IBGA 1XJCA 4HTFA 4O3SA 4MXDA 5LP6B 2NQ8A 3OBBA 3P2MA 2DP4E 3N7UA 3EZ7A 1GTJ1 1RADA 1W0KA 4R6XA 3H87A 1SB9A 1NOKA 3DBOB 2DBZA 1E60A 2QP3A 3D1VA 3SJAA 3CB2A 3PLAE 1QTRA 4RC9A 2BEJA 2QSJA 2X0JA 2DGDA 3OCJA 2VQDA 4DLSA 3ZXXA 3H5IA 4ZVOA 1K7FB 4BLRA 1MA0A 3N3BC 3LUDA 4BKMA 4LOJA 4A16A 5KT2A 3Q2KA 4HZGA 1RJDA 3NGLA 1LQTA 5FIUA 1NAHA 3H0KA 5CCBA 3OMXA 3L7LA 1YRWA 3JQ7B 4N3NA 1YC2A 1OLUB 3IKTA 1VP3A 3RS4A 1L7BA 3K9BA 1O89A 4XR4A 5KSOA 3PE3A 4GL2A 4MDFA 4X3OA 4BQIA 3H6GA 3HRKA 5C8VA 1NKVA 1D7AA 3PQ4A 3ZGXA 1KZ1A 7REQB 3OFKA 5BWCA 4EF6A 1Z4PX 3AEYA 3NBXX 4J3NA 4PQFA 3SNHA 5C3MA 3NTRA 2YVLA 5JALA 1II9A 3PPWA 1XTUA 3IJ5A 3N8HA 4EHJA 4IFIA 4JC8A 2WHPA 4YQWA 1NVVQ 2I2CA 1ZVVA 4D46A 1UOQA 1RHKA 4IS3A 4Q1EA 2FEKA 4DV0B 5JHHB 4LZOA 2F62A 3NFRA 1ESCA 1FU7A 2Q3LA 3OTQA 5CCXA 2IYTA 4JH0A 5K99A 3BACA 2WV9A 3TNYA 1DP4A 2H1VA 4D44A 2J7KA 2YICA 4RDXA 2X2OA 3LBFA 1TMKA 2ZSEA 4JR1A 2ZI6A 2PUDA 3CGWA 1V4BA 1E69A 3G88A 5FO1A 1ZCZA 3GHHA 3RO7A 3QSYA 3BWCA 5KFFA 5H80A 2YCLA 3G8BA 5LC1A 1I50A 4UZFA 3NRBA 3A8TA 2FN7A 3ASUA 5LQKA 3AUYA 2PX0A 4E5MA 5G3YA 1GP2A 4RKRA 1G7RA 3HY4A 3OLQA 4B9AA 4D8TA 4FS2A 2MU1A 2BRUC 1P9OA 2GS9A 1AK9A 2HIXA 4R9VA 2LKCA 4F6CA 2HXSA 1KVSA 3FSGD 4M1KA 1E62A 3V48A 2QPTA 3F3SA 3OFND 1LF0A 4MWZA 1DFIA 5U4QA 3A2NA 4TV9A 3LNCA 3Q1LA 4ZI5A 3ZUPA 1S5PA 1RJFA 1TQ4A 5EEGA 5LMNH 3ZD6A 2IA6A 2DWUA 4IWYA 2XA9A 3HVKA 1XROA 2W2MA 4KQ1A 5JAQA 3E2PA 4H7HA 3EBOA 4TYQA 1DRWA 3IQEA 3NPMA 3VU8A 1YA6A 2YWDA 1JKFA 1SO8A 4NFHA 2QT1A 4MUMA 2EZ8A 2XCTB 3VUFA 3F4LA 5HTKA 1SXJE 1N5JA 2X76A 5ILOA 2DBVO 5BWMA 5BV8A 2Q2UA 2FUNB 2IZZA 3DFIA 2GSDA 1OFGA 4KPUB 3FZQA 2IWHA 1NZDA 3F2VA 3RS2A 1IK4A 4PZUA 2AFHE 2WVHA 1J5EH 2LV8A 1W2WB 1XYGA 2FMKA 2X8JA 2FW7A 4F8YA 4H3KB 1QTQA 2XYQA 4UATA 4JGGA 5HM6A 2YWRA 4L4XA 1QYIA 2ORIA 3M9LA 3LBNA 4O81A 3G5AA 5EA2A 3RK0A 4WHXA 1Z6ZA 2CYAA 3NV9A 1CQPA 5IC6A 4QYTA 1I33A 2IYXA 3FF4A 1DDIA 1TWCA 3W2FA 2O50A 5CFMA 4W5QA 1GTRA 1FVOA 3NALA 3R7SA 4OJYA 1NSYA 3HO6A 2PKWA 4QGBA 4AQYB 4LJ9A 1T2CA 5EP1A 1H4VB 1LSUA 4BY9E 5KHOC 2J45A 1WR2A 3CX3A 4R2KA 4F91B 3M6IA 2GN6A 2D5AA 1Z5ZA 5JUWA 2GK3A 1WSDA 4BNIA 2IIQA 3SP1A 5IP9G 3U60B 1VG9B 4BEWA 2CJFA 2V3CC 5JVDB 1RWKA 4P36A 4CYMA 5CCDA 4QVKA 3U7EB 1ISHA 1S3IA 1GFWA 2ZCVA 2C3MA 5TY0A 1YQWA 3WLTA 4ZVNA 3JYLA 4PZLA 4EGAA 3P45A 4HFJA 4BUCA 1OFVA 2UZIR 3CW2A 1WBJB 4Z0NA 2CNKA 5KNDA 1RKQA 4DLVA 5EKSA 2W4IA 1SCKA 2PK3A 3SQMA 2D1RA 2VDWB 1MFPA 4BMCA 2PUAA 4DAOA 1ECGA 3JQ9A 4DARA 2EKBA 2ZIXA 4FMPA 5G40A 2FW9A 1GNQA 1YF3A 1OX4B 3GI1A 3P4UA 1RTKA 2VHXA 1GG9A 3B7WA 2OT3B 4ND5A 4OH1A 1LBHA 2A2ZA 3UMFA 4QBGB 2OHVA 2P62A 4ZOEA 3DZCA 4CCAA 4BY7G 1JPUA 3G5UA 1OH7A 2OBMA 1G16A 2BFCA 1KI4A 2BISA 1A5BB 2FN9A 4KDRA 5KB3A 3KSRA 4P4SA 3S6JA 1JLHA 3U7FB 5BWRA 1X7YB 2PMFA 3N2KA 1AUVA 5FNVA 2BWJA 2Q99A 3T4EA 4J2HA 1JILA 4FYVA 1X70A 1XNJA 2IQ5A 5BY2A 1PUXA 2NIPA 3PJDA 4N6OA 4BMNA 2PWYA 1WCWA 4CMIB 1O0BA 1NR5A 3GD7A 3OQ1A 4FOLA 3UH1A 4D4GA 5K09A 4H1TA 1K5PA 2WSSD 5A71A 4FLEA 5BYJA 3JZMA 4FKZA 2YIJA 2WJIA 5LZ5A 2AN4A 2COEA 1H6DA 2X0NA 3RB8A 5I4IA 5ANRB 1PGQA 1CNFA 4DNQA 1E4EB 4MAFA 4M9XA 2IF2A 1VBNA 4PYKA 2OM2A 3I52A 4PANA 4D9GA 1UJBA 1XX6A 4WJZA 2OCKA 1QK4A 3RTBA 1NVWQ 3TTWA 1BJRE 4DR5H 4NK4A 1GZ5A 1E79D 3GEPA 2QORA 5A0VA 2G63A 5AXCA 2NSJA 3FYSA 1BOFA 1G5FA 4GRDA 3SKYA 4JFAA 4Z0TA 3ZCQA 4XQEA 5CX4A 1E1NA 3ZHOA 5EJAA 2P2CA 2JATA 3EXIB 1U2DC 3H9BA 4B8ZA 1WWKA 4UEJA 1FP4B 2C5HA 2Y92A 5AKXA 5H81A 3TQSA 4S1TA 5D85A 2R6AA 1KY2A 4P1ZA 1SWWA 3NM4A 3AVYA 2PZMA 2XJ9A 1TLFA 3RD5A 4YJHA 1M1YE 4RM3A 2O2IA 3BD9A 1QLHA 5IBRA 2P9EA 2CVPA 2I6GA 1XFAA 4ZYXA 1ZMBA 1TD9A 4R9NA 4BJHB 1NIJA 3I04M 1A3CA 3I1FA 4S35A 4WOBA 1JWLA 4JKOA 1RAGA 1V1JA 2Z5GA 3I2FA 1V6SA 4Q3DA 4JY7A 4LG1A 1MAWA 3EJWA 1IN1A 3OHBA 1KIAA 1YJCA 3DEAA 4ZALA 5DHSA 2QL5A 2GN2A 1AKUA 2VDJA 1JEDA 2IOYA 2QG9A 2OHIA 4QOIA 1U8CB 2UYGA 2P2DA 3I61A 4PHTA 3B1YA 2RIRA 2Z0MA 4PRZA 5HF9A 2R66A 1PE0A 1KXJA 2A58A 1RCTE 3U5TA 3DL4A 3EGEA 1PT8A 1UXGA 5E6SB 3O26A 3VPBA 3R6GA 4CFZA 5A2QW 1OI2A 3OICA 2GBCA 1IB6A 5BVGA 1I32A 4Y2YA 5IAGA 2MT9A 2VYFA 3DZJA 5HS4A 3OJXA 1R9MA 4WXPA 3UYKA 4AVYA 3HGQA 2BYTA 4CM7A 4JI0B 4F86A 4P84A 1DZ3A 4ND1A 1ONPA 2G4VA 3C1OA 2O8EA 4QTXA 2QMUA 5TJHA 5B57C 3QNUA 1EA7A 4DXAA 2RHJA 1W5BA 3NDPA 3PCTA 3G3EA 3EUWA 3FFXA 4ZOLB 2WB2A 4CDGA 3E9CA 1XCPA 1Z29A 4U2BA 3U1BA 1SC4A 1YL7A 4BKUA 1FXWA 2H17A 1G7TA 2E4XA 1GARA 4YXWD 2BUCA 5KFUA 2Z2IA 4US0R 5IYDG 4O3PA 2ZBUA 3O90A 4CQJA 2FB9A 2J3QA 2DWQA 2VUSA 1E5QA 1TAUA 1FU4A 4GOJA 1I6KA 2BGMA 2ZSJA 4A1OA 2GQSA 2QGZA 4MVJP 4W4TA 4OHYA 4CMBA 1DBQA 1AS3A 3Q7QA 2Y3IA 1XZIA 4ARAA 2IEAA 2XLBA 3IO3A 3L5OA 5EXTA 1POWA 5DM1A 1I4EB 4F1KA 4DV1B 1EXWA 5LL6P 5LYJA 4KK4A 1M10A 3WKAA 4BCDA 1GGKA 3ZCRA 4DWJA 1QRAA 3IERA 2VA3A 1N36B 2H9AA 4UBLA 1XR3A 5CU7A 1AXRA 3LFTA 5FQOA 1UFOA 5P8WA 3DH0A 4L85A 2FLPA 3ULKA 3OX3A 2I2WA 4YAOA 3IUBA 3F46A 2PM8A 2HTEA 3UJAA 5KT6A 5LIPA 4O7SA 4Q3NA 3I2IA 3QU7A 4B0PA 2G3YA 4CN9A 2NZJA 2WUDA 3RS8A 3VZQA 3RJTA 1I1OA 3QVVA 1I1MA 4DUPA 3VV3A 1ATZA 1DDGA 4HDKB 1JH9A 3CUTA 1J8QA 1Q1ZA 4JLJA 3K1JA 3QHAA 1N1GA 1WX1A 2FHPA 1RXIA 4QHSA 4RK1A 4F6LA 3UBMA 3AFIA 2EBHX 3D6HA 2RBEA 3NAZA 5KX5F 1LBEA 4LYGA 4O2AF 4B32A 3ZZ1A 1V47A 3LNTA 3NHSA 1NPYA 2YXLA 3CISA 4BFYA 1DRKA 3B3FA 4FOPA 3C3DA 3DOUA 4CEHA 4C22A 3FYUB 1PNVA 3LSYA 2Q9AA 4WOKA 2PH1A 4UTXA 3T5MA 3QE3A 1BDJA 4U02A 7ABPA 4ZMRA 2VQ6A 4XIJA 1SCBA 2IELA 3SS9X 2MDTA 3TSYA 4DRFA 5KNDD 1CRWG 2CW8A 3SYTA 5K2OA 2LIVA 4UU7A 2YN4A 2OZLA 3MB5A 4MPPA 1Z4MA 5CXSA 1LLFA 3IQWA 1S3GA 4CKZA 5AVSA 4NJOA 3DMTA 3C8UA 4DUZH 4K3UA 4ZT7A 1DB3A 4KNYA 1Y1VA 1P1BA 4ARZB 3VX4A 2F90A 4ZREA 2OWOA 3FDXA 3B52X 4I5EA 3Q8PB 3EFEA 2ZYHA 5DOVA 4A3JG 4OHWA 4OOFA 3TDKA 5AUQA 4IKPA 5SYNA 2P2YA 5CAEB 4BN5A 2QAIA 4OB8A 5LDDC 2O5RA 3FDSA 1LF5A 2ZIFA 4LBZA 4PBSA 3HFGA 4TUYB 2GPYA 3CA8A 2NPOA 1C29B 4ECAA 2PH5A 5FV4A 1G291 3BDVA 1H2EA 2J3JA 4MVJE 4F4XA 2F1RA 4ME6A 4XA8A 4F6RB 3RIYA 3IBTA 3F78A 1UK8A 4FSXA 5GGXA 1XCMA 1G0OA 1E8DA 3TAHA 3IEPA 4H59A 2W37A 4GI1A 1JA0A 2W9CB 2JFHA 4Y2RA 1XNQH 2R8IA 3IUQA 5C7IO 4ZOCA 4F4DA 3K0CC 1FRNA 4KVAA 3G5LA 3TW6A 1ZUWA 4JB2A 4LDRA 3WLNA 1G60A 1T8YA 3QYFA 2Q5EA 4Q4AA 4MUFA 1G19A 1TX4B 2PVSA 4FBLA 4EFEA 1FFSA 4EDHA 3ZD9A 3OUUA 3WL6A 5BR4A 1N6LA 2EJ3A 4OPMA 4GM4A 3HMQA 3GD5A 3RFUA 3HKCB 1NPDA 5DI3B 2VBFA 5CLIA 1I7DA 4JOBA 1ZUD1 1WG8A 1IPEA 3KKPA 3NFYA 3H40A 4BB0A 3VR3D 3WLSA 1APBA 5FR2A 4A3DG 1NYLA 3FOWA 5ADVA 1NPTO 4NOKA 4BVBA 4C03A 3HWSA 4PVCA 1TVEA 3SBXA 3UTCA 1CS0B 4A91A 2WAQA 4OQPA 2CCKA 5LMUH 2X6RA 1WD7A 1ZICA 3JQ6A 2CN1A 1LQ2A 5A5EA 3LDFA 1JQDA 2IYRA 5CM8B 1CDDA 4P4GA 2Q1WA 3ROGA 1KJQA 2F3PA 1YAJA 3UFBA 4RTRA 3BIOA 3V33A 3GHYA 4J3JA 1JIIA 1A48A 3TXYA 2GLTA 4EY5A 4FVTA 2CXQA 3OZRA 4L5BA 3DM5A 1DFGA 2P79A 5KU1A 4IPTA 2VWHA 2QQ0A 1UT5A 2GAOA 2BCGY 4GPTA 4HVTA 3URMA 2CUZA 1N3IA 1S8AA 2WJ6A 1VHTA 1S3FA 3U0GA 3CE6A 5HQ3B 4AP6A 1I4DD 1RPNA 2QLLA 3CINA 1Z82A 4LZPA 4C1BA 3DZFA 4F4FA 4M1MA 4AXXA 5ARBA 3PWZA 2IY9A 1JLSA 2QD4A 1YE3A 5JSYA 3UUEA 3PSAA 1SXJC 5KYKA 3QU9A 1V8OA 4OLJA 1OWNA 4CG1A 4JP3A 5FH9A 4W7SA 1MRNA 2Q1UA 4WBNB 1BS1A 4X24A 3PS9A 4B3JA 5L1JA 4K9NA 5LMZA 4Z49A 2YY7A 4QQKA 4AS2A 3DWEX 3OIWA 3QIVA 1MH1A 1KI7A 4NG5A 1FTNA 2EX0A 3JRWA 3SHTA 4NRDA 1F2TA 1AG9A 2V9ZA 4E2FA 4GGPA 2XA1A 3BQMB 2Z95A 1SPBS 3KLMX 4J7UA 3OFVA 1RP1A 4R0VA 2A9KA 2DR2A 5KTKA 3CKKA 4WNYA 1QIHA 3MIZA 4G09A 5BWNA 1SBYA 4LOIA 1W5FA 2OXFA 1JEYB 4RA9A 5JWRA 1JX6A 3GGPA 1MN6A 4MQEB 1P4JA 1RKVA 1IVNA 2HU8A 3L43A 4RAOA 1ESNA 1XO1A 2BTEA 4IRKA 1U8XX 5IP7G 2PX8A 1D6NA 4EPRA 5JMTA 3V2HA 3V4ZA 1UODA 1AGYA 2YIMA 2NVXA 1F12A 1MAAA 1OCEA 1VG1A 3UGTA 5HNEA 2PZFA 1RQ2A 2BHLA 3FA2A 4ZVMA 4A3CG 3KEFA 1TU3A 3FNHA 3ZY4A 4DR3H 2Q9UA 3QUQA 3QFTA 4JBIA 1P5RA 2IXBA 3LY7A 4XQ9A 4MW6A 4W9RA 3H3FA 1B8OA 4A3MG 4AIRA 2RHRA 2A9PA 2DAAA 2ZQZA 3QK7A 2Z9BA 3B1VA 4PAMA 1IU9A 3NG1A 3L06A 4ND4A 3PEWA 5I9MA 1NZFA 5KG5A 1CS4C 1PFQA 2JAXA 3RABA 2QUBA 3RGZA 821PA 1Q0SA 4ESEA 1E2HA 3TMKA 1EGAA 2GVNA 1KSJA 1QDEA 4ZCMA 1PTJC 2NQTA 1I3KA 2QW0X 3L7YA 3T3NA 1LSOA 1C1XB 3SVZA 4MR9A 2X0DA 1OV4A 4MP3A 1NF2A 3LPLA 4ECSA 2OENG 3P19A 3K9CA 5KPJA 1FE8A 1G3UA 4R1OA 3QUAA 2WD9A 2E1PA 1U9JA 3OZFA 6YASA 1M1UA 2WTBA 2ZBEA 4E31A 5GINE 5JXIA 4WBXC 2OXEA 4EFKA 4XTRA 4F3RA 5JEDA 4ENPA 1WSAA 1YB6A 4AS1A 1OSNA 2G77B 1ZHSA 4TS9A 2HHAA 2H16A 1HOXA 3TSAA 4UREA 3DWIA 1DTEA 3N2ZB 1Y1KE 2CQYA 2ZGVA 3OWOA 1HKUA 1JV2B 5AM4A 4XM0A 4NJMA 2AEFA 4L4SA 4XYMA 4DPKA 1EJ6A 4LJ5A 4A23A 4WN9A 1D8TA 3BHNA 3SU8A 1P6XA 3CBQA 2IWRA 4AFNA 2H4YA 4M7RA 1S2NA 1ODKA 4G9GA 2YYZA 4U4AA 5HJEA 2GD2A 1U5CA 4Y30A 4EQ6B 3W5CA 4O1IA 4EITA 1E5TA 4ANFA 4YJFA 3F7TA 1PJQA 3C7AA 1QGUA 1GGOA 1Z73A 2Q2TA 2WF8A 2FFJA 2LBPA 2ZJFA 2XV1A 2XB9A 3ORHA 1YOBA 2RC6A 4KH0A 5F2NA 1USGA 4FCCA 4ALJA 1QCYA 2PPVA 4H31A 4DMGA 3CRQA 4FYWA 2VA8A 5T5QA 2V6BA 1HT3A 1MJGA 1O96A 1JHOA 3V1UA 2QS9A 1P19A 3WIDA 3VH1A 3CF0A 4JLPA 3RWBA 2IP4A 4BFXA 1R9TA 2N42A 4KHPH 3GTMA 3DDNA 4PC6A 1HDCA 3DEZA 4FU0A 1U9IC 1WUYA 4RHFA 4MKGA 3OIYA 1FMJA 4KI7A 4M0MA 1Y1TA 3B5IA 1PJ8A 4CI0B 2J7PD 1R3DA 1GXSA 1XVLA 1YJ8A 3NTXA 3DBLB 2OO5C 1P8AA 1ODLA 3HR7A 3UJBA 2WJ3A 3EXHC 2DUNA 4PFJA 4UW9A 4RNNA 3HYCA 2HWXA 4KWCA 4TV8F 2EZUA 4E2YA 2Z3ZA 2XQIA 3JYHA 3IE1A 5KHLB 4HMPA 5EZSA 4I81A 2FUEA 3HBLA 1Y6RA 1OIVA 2VTDA 1W9MA 2QN3A 4QIWA 4WNCA 4QXQA 4DTCA 3VH2A 2C57A 4DSOA 2R97A 1KQNA 3P9YA 5LMCA 4JFRA 1SC9A 3LYUA 3T41A 2I9KA 4OX9H 5FRDA 2NU9B 1RLJA 4CG2A 3C6XA 4CQNA 5TF0A 5BUZA 5JSUA 4QG7A 3WI7A 1IC6A 2BBOA 3KREA 4A6XA 3ZE6A 1E9FA 1JDTA 1KSGA 3UK7A 3KWFA 3IRUA 2Q49A 4RYDA 4YT2A 4IXWA 2B78A 4C05A 3GQBB 1E9CA 1IBKB 2B25A 1B6SA 3LXXA 4OGWA 5HGXA 4MYDA 2Y67A 2G25A 3RUAA 3WWEA 1KAOA 1XQYA 3N05A 4HYTA 5JDIA 4BFSA 3PVCA 3H0GA 5K0SA 3JSNA 1BC5A 1ZI8A 3Q2IA 3NIBA 2PT7A 3D64A 5REQB 3M3DA 1P1RA 1NQAO 3DV0A 4D9FA 3O75A 1UBJS 4WK4B 5FPPA 3KCNA 1AUPA 4PNZA 1SBTA 2QRGA 1G21A 1ZJYA 3FKQA 3TKYA 5DU2A 3WQHA 4BBJA 2LCFA 1M2KA 3JWHA 4HYQA 5LLTA 2WWHA 4ECTA 1CRLA 1NUHA 1GA1A 3ANNA 4ZVVA 1P9LA 1OXVA 2CMHA 1RJ9B 2VQEB 3DULA 2XXAB 3RFFA 2GSWA 4DR1B 5A9TA 4KI0A 4G36A 5G3ZA 1H2WA 4DL7A 2QD1A 3MRXA 4OGLA 2WAYA 2VKTA 1O1YA 1C0LA 4EGJA 1QB7A 4R0NA 1R66A 3KQPA 4F2PA 4M0EA 2GRAA 5FOQA 2Z8YM 3EOAI 2B1QA 3GEEA 1T9KA 2XQVA 4YMHA 5LJLA 3JQGB 4RJ2A 3P0EA 4LDNA 4QGGA 4GMXA 3IAFA 4YX9A 1R16A 4MARA 1M8PA 2HRRA 2JEJA 4OL0A 1SQ5A 1F9AA 4DNPA 1RM4A 1GTSA 2VJKA 2YWFA 2VZ8A 3FHTA 4P3NA 4GPD1 4Q48A 3D2BA 3JSXA 2WIFA 4B80A 5BWWA 1RI4A 4XVCA 4M46A 4WACA 1TT5A 3K9GA 4IDGA 1KRXA 3THOA 5JWOA 3NTVA