1M0TA

Yeast glutathione synthase
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
487
structure length
454
Chain Sequence
PPSKDQLNELIQEVNQWAITNGLSMYPPKFEENPSNASVSPVTIYPTPIPRKCFDEAVQIQPVFNELYARITQDMAQPDSYLFTGKLWSLYLATLKSAQYKKQNFRLGIFRSDYLIDKKEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYNDQNMVISDSGYLLSKALAKAVESYKSQQSSSTTSDPIVAFIVQRNERNVFDQKVLELNLLEKFGTKSVRLTFDDVNDKLFIDDKTGKLFIRDTEQEIAVVYYRTGYTTTDYTSEKDWEARLFLEKSFAIKAPDLLTQLSGSKKIQQLLTDEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVLKPQGNNVYKENIPNFLKGIEERHWDAYILMELIEPELNENNIILRDNKSYNEPIISELGIYGCVLFNDEQVLSNEFSGSLLRSKGCLDSIILY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords glutathione synthetase
total genus 167
structure length 454
sequence length 487
chains with identical sequence B
ec nomenclature ec 6.3.2.3: Glutathione synthase.
pdb deposition date 2002-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03199 GSH_synthase Eukaryotic glutathione synthase
A PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1080.10 Mainly Alpha Orthogonal Bundle Glutathione Synthetase; Chain A, domain 3 Glutathione Synthetase; Chain A, domain 3 1m0tA03
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1m0tA02
3.30.1490.50 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0tA05
3.30.1490.80 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1m0tA01
3.40.50.1760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glutathione synthase, substrate-binding domain superfamily, eukaryotic 1m0tA04
2W71A 4O4IF 5JH7F 2NU7B 4EGJA 1Z2PX 2R84A 4WBNF 1W93A 3RUPA 4IZOA 4DIMA 2R7KA 2GLTA 2X0SA 3ORQA 2YS7A 4TV9F 4I50F 2GPSA 4RZQA 1JLLB 2Z02A 4DLKA 3WO0A 4C5AA 2YZGA 3I12A 2YZNA 3GLKA 2R86A 3K5IA 3MJFA 3Q2OA 1A9XA 4XZ3B 2PN1A 4I55F 3KAKA 1EHIA 2I80A 2ZDHA 1ULZA 1Z2OX 2I87A 2FPIB 3HB9A 3R5HA 4FFRA 4HR7A 1CQJB 4YB8B 5IYZF 1DV1A 4FE2A 2OLSA 5JQWA 3AX6A 2GQRA 4FFNA 4O4JF 2PVPA 4E4TA 2I8CA 4I4TF 5C1OA 1KC7A 5KX5F 4MA5A 3VMMA 4O86A 3JRWA 4ME6A 5J2UF 2HGSA 1Z2NX 2V59A 2R82A 5HBRB 3OUUA 4XX0B 1B6SA 4QSHA 2YL2A 2YZLA 1OBGA 3R9RA 1E4EA 3UFXB 4O2BF 2XCLA 4IHJF 2FP4B 2V5AA 2W6OA 3E5NA 4O7TA 5HV6A 1JKJB 5C1PA 1JDEA 2NU8B 3K5HA 4O81A 1M0TA 2R7MA 3NUAA 5J2TF 2P0AA 2W6NA 2QK4A 3U9TA 1GGOA 1KJIA 3ETJA 1CE8A 2PBZA 3N8DA 4MV9A 3TIGA 4ZI7F 2ZDQA 2YYAA 3RV3A 2GPWA 2FPPB 4FFMA 3ETHA 1KJ9A 2HJWA 4NYEA 4ZOLF 5C8YF 4O7LA 2DLNA 4HNUA 2NU6B 3SE7A 2CNVA 3KREA 3R5XA 3TIIA 4MA0A 2XD4A 1EUCB 1AUXA 1OBDA 4C5BA 4O83A 3ORRA 1IOWA 2DIKA 2W6ZA 4MV3A 4MV8A 1GSHA 2W6MA 4TUYF 4EG0A 4O7YA 5LOVF 1W96A 3Q1KA 4Y8VB 1EUDB 4M9UA 2R87A 3AW8A 1KJQA 3GIDA 2NU9B 3LWBA 1E4EB 1SCUB 2FPGB 2J9GA 4O82A 5JVDF 2ZDGA 1M0WA 1VBHA 3VA7A 4TV8F 4XYLB 3QFFA 4HQ6A 2CNUA 1AUVA 3RFCA 2W70A 1GLVA 5KKNB 4FU0A 4YAKB 1KEEA 2YW2A 2CZGA 3BG5A 1VKZA 4MV4A 3WO1A 3TW6A 5LYJF 4XYMB 4O2AF 5GONF 1T36A 1WR2A 2FB9A 4O4LF 3U9SA 1CS0A 3TQTA 1I7LA 5BMVF 4HNVA 2WYOA 4YJ2F 2R7LA 5JQGF 3DF7A 4O4HF 5H80A 5CB4F 1I7NA 1PK8A 2W6QA 3HO8A 3G8DA 1GSOA 2IP4A 1IOVA 5CAEB 4HNTA 4MV1A 3KALA 1DIKA 2W6PA 3VOTA 3JZFA 4MV7A 4O7WA 3RV4A 3R5FA 2SCUB 3R23A 2R7NA 3TINA 2VQDA 4MV6A 2Z04A 3N6RA 4FFPA 4MAMA 2VR1A 2VPQA 2YRXA 5BPFA 1DV2A 3HBLA 4IIJF 3K3PA 1JDBB 4YAJB 3VPBA 5JVLA 4FFOA 5FNVF 4YJ3F 4O7SA 4O7ZA 3V4ZA 1GSAA 4FGRA 1EYZA 1PX2A 5LA6F 1KUTA 5LXTF 3VPCA 2YWVA 4YBZB 3WNZA 2QF7A 4O7RA 5CA0F 2DZDA 3JZIA 1A48A 1KJJA 1VBGA 5LP6F 1EZ1A 1BNCA 4L1KA 1C3OA 5D8DA 2C00A 4ZQIA 1B6RA 2GQSA 2CNQA 4EGQA 5BPHA 2DWCA 2YS6A 1CQIB 1BXRA 1M6VA 3U54A 2V58A 3G8CA 2YZMA 3LP8A 3V4SA 5CA1F 1KJ8A 2YRWA 2R85A 3JRXA 3OUZA 1KBLA 3MWEA 4FFLA 3KAJA 4O84A 5EZYF 4O7NA 1C30A 4O7VA 5DMXA 2NUAB 3U55A 4C5CA 4ZHQF 3MWDA
chains in the Genus database with same CATH superfamily
1N9GA 3OQ1A 2RGDA 5J5AA 3TLGA 2W5UA 1QP4A 2QTVA 3MTEA 4NXNH 1Y6QA 2VYFA 5EZ5A 3JYLA 1XBTA 3W4KA 1TNDA 3K6SA 4CM5A 3K1TA 2ZGIA 5CCEA 3ED5A 1GTRA 1N4AA 3OESA 1I2CA 3OIGA 3IMCA 5H68A 1G8FA 1YCGA 3X44A 4OM8A 1K6MA 2D5IA 2FDXA 1T6NA 2VJLA 3MUNA 4I0WB 3AF6A 4IDGA 1VE3A 2BL4A 1YA4A 1FKAH 2Z8YA 4I66A 4F45A 4HLCA 5GM2A 3PHJA 4D46A 3GGPA 3AVOA 2GQRA 2F3QA 3MJHA 5E3IA 4B3TB 3E82A 3PICA 4E2YA 1ZJJA 3WWZA 5EJ7A 1A9QA 1GPYA 2QYOA 2DUWA 3SJCA 1H1DA 2XOKA 1XHLA 5DBFA 1WHTA 5LA6A 4EATA 4BATA 3B2NA 4A9AA 3R7NA 4ZCQA 3FIUA 1SB8A 1KPHA 1W5EA 4Z1OA 1GG2A 1JQJC 4FM9A 1W4ZA 3VSCA 5F7OA 2FPSA 1YZHA 3ETNA 1NSFA 1YQEA 3S2UA 3R3SA 1QF6A 4TLCA 3DOUA 2UYOA 4MUFA 1EVZA 4ZYUA 3ZX4A 5L6LB 2PIDA 1Y6FA 2QX8A 2JZNA 3GJ4A 3VV2A 4IR1A 1EUCB 2ERCA 1W36B 4ZK2A 2WY2D 5AOAA 1NP7A 1EE2A 4MV3A 1X9GA 1FVOA 5KOIA 1X7WB 4G5SA 2ZIFA 2GPBA 3DE4X 1AKMA 3ZY3A 4DYHA 2J59A 1MXFA 1OGIA 1UPBA 2PM8A 2PZ8A 5ADHA 1YACA 2QP3A 1BA3A 4MYHA 3W06A 1VPWA 2ZDGA 2CC2A 2BI7A 1ZZGA 1E2IA 2QM8A 1R8YA 1S4MA 2GB4A 3AUTA 3FA2A 1JWLA 2UU9B 4EFKA 3SNKA 5EQTA 1BWRA 1E7RA 3PWTA 3NDRA 1WZCA 2XDQB 4X44A 1WSWA 3O7MA 3WA7A 4D9FA 1XPUA 3GPLA 1CS0A 1TZJA 2XIGA 1G5TA 1SVKA 3KX2A 3X3HA 4B48A 3Q12A 3RTDA 3SWWA 5D86A 1J1UA 5CB4F 1UWCA 1YOVA 2F9MA 1NVMB 3ITEA 4YP0A 1IJBA 2ZI6A 4IYJA 3WYBA 4HMOA 4G56A 2V4ZA 2IHTA 3U62A 1E61A 2NSJA 2O4UX 5H5JA 1HDGO 4NV0A 5K05A 2DPHA 1IOLA 1PGOA 4EX7A 1A1VA 3N6XA 3S4YA 1I1LA 4QHTA 1W5SA 4LYHA 4YCJA 5BUZA 5LL6P 2FEMA 2YRXA 1LU9A 3M4ZA 2PXXA 4CLRB 2GTHA 3NGDA 1ZD5A 3E53A 3E3OA 4X90A 3AZPA 2PRKA 3FDIA 2AKEA 4UATA 3TZEA 4GC7A 3BWMA 3G85A 2P11A 1KI1A 2XIQA 4M1TA 4X8HA 4ND8B 4R31A 5GVSA 3WAKA 1QGUA 1Y34E 1YT5A 3ZWCA 4CR6A 4JEHA 4K86A 1XTJA 2PX3A 3E9DA 1XALA 1WRBA 4KZKA 4NCHA 3GXBA 4EBBA 1GJRA 2QYTA 3BDIA 3G0CA 2HR1A 4FJ1A 3UZOA 5I5WA 1G1MA 3UFBA 3M6IA 4DDMA 4JYAH 3L93A 4MVXA 4WZAA 1GLGA 4DUPA 1MR3F 1CNMA 1WH2A 2OFWA 5I7WA 2AR9A 4I99A 5BV1A 1QMGA 4E14A 2YR0A 1YMUA 3DO8A 1HOXA 1UBEA 4I4LA 4KNVA 1E9VA 3WNQA 1W93A 1IIRA 2VP0A 2YWBA 3DLIA 5EDWA 4DR3H 3CPSA 4RK4A 3WGYA 5C8ZA 3ROZA 1UPAA 1XK6A 2GVNA 2ZZKA 4HAZA 4XEUA 1O87A 1QXSA 3LULA 4J0FA 2SHKA 4NMMA 4R3WA 1N32H 5EP2A 5JCXA 3A3OA 2R6CA 3IVMA 4PXAA 1SUEA 1LZLA 1C29B 3RAGA 1GZ4A 3QXSA 5K6AA 4PW0A 4OHRA 4Q4AA 5F2NA 1ZG3A 2QTBA 3HMKA 2WAMA 3NLLA 4QECA 3AR6A 4Q1EA 1L5LA 1DV1A 1K7CA 3QI7A 4ZGBA 2ZIGA 3A4LA 4TLLB 2NAPA 4EUNA 3LV8A 4LV5B 1HKHA 5EFZA 4HRXA 1OE0A 1MRSA 3DCYA 4O6VA 5AW2A 3OSZA 1P2VA 1XKXA 1DQNA 2ZB2A 1BKYA 5FTJA 4JELA 1VI5A 2BDTA 5LXTA 2VI5A 3I76A 2FP4B 1E2JA 4RGBA 2B98A 3NBUA 3PNYA 2JEOA 3ZNQA 3DZBA 3EXG2 1XRLA 3EOAI 3CUEF 3E9EA 3JQ8B 3RF7A 1JFRA 2QS9A 4N03A 1VAJA 3EW9A 4BCCA 5CFPA 3QFRA 5YASA 4D3DA 3HO6A 2NG1A 3ODGA 2GF9A 5EWFA 3CNOA 4ZVOA 4ENPA 2QG9A 1IYDA 1IUOA 4PO3X 1HQKA 5M7EA 1EBBA 1S2DA 3ABOB 3K2IA 4G8BA 1DTEA 4U2FA 1YZLA 3ASVA 3WL7A 3D3KA 4EI8A 1EFVB 1P9OA 1Q7GA 1UIRA 2HSZA 2V6JA 2QLBA 5A6VA 1N2CA 2UVRA 2COKA 3L6DA 4IYRA 3U7QB 3DXZA 1A4XA 2HIGA 4G5XA 3LVQE 4HRAA 5HA5A 1C80A 4L4YA 5BMVA 3BSFA 3WNBA 2XGQA 3HU1A 2VDNB 5HZMA 4YT4A 1JBEA 3W34A 3ORFA 2ONKA 4O3RA 1C9NA 3HL0A 3ZDXB 2A0YA 2B4YA 5CDUA 4FMCF 3RYCB 3AF3A 1L7EA 2VTBA 5KFWA 1MA0A 2ZYDA 4S2UA 3WIVA 1D7OA 2HU5A 4AQYB 1UH5A 4NOLA 3IAM1 2Y3IA 3NAMA 3TFOA 1LPOA 1T6ZA 2PZGA 1COWD 2J87A 3U60B 2JHGA 4JI4B 4LN1A 1P44A 1TMKA 3OQHA 3UUGA 3T9DA 2GCGA 2WM2A 4GP7A 1KXZA 3IAM6 4BOYA 1PZXA 1U7XA 5D3QA 1BU8A 4NBVA 5CT8A 1TB4A 3IRUA 4IHAA 4MLPA 2FKLA 1MQAA 3EDRA 1C4WA 1AT1A 3F7TA 3VSBA 1F51E 1Q3HA 2VJOA 4PLPA 1RP7A 2C0QA 3JASA 4MKXA 4JBIA 4MQEB 4JQZA 4LDRA 1YVPA 2ISQA 3I6ZA 3KKLA 4AN4A 1M34A 3HI4A 4PCUA 1PUIA 3O8OA 5E6UA 2CBXA 2IWHA 1R8SA 2PX2A 4PU0A 1JEDA 2BH9A 3MJEA 1E2QA 6LDHA 1R1DA 1NR7A 5M2QA 5AVQA 3SI7A 3EVZA 1W88A 3LT5A 3DBIA 1NIJA 1G16A 4QBHA 3TW8B 2ECKA 3ZKWB 2VAVA 2Q8PA 4LJ9A 4GR5A 1E6MA 1KYXA 2HDHA 4BMZA 3MW8A 1D2HA 3A11A 4Y9SA 2JL1A 3INRA 4IS3A 2JIZD 3KHGA 2P79A 3DL4A 1WBBA 5AQEA 1N3LA 3CR8A 5FEUA 3UHFA 4P1ZA 3CTMA 1JHAA 4LQLA 3B3QA 1Z06A 3G9UA 1GCAA 2YRWA 1NVVQ 1R66A 2BBOA 3IHTA 4FOLA 5KTRA 4O2LA 3AKDA 1G41A 1NIPA 2GS9A 2TECE 3QYJA 4HPJB 3FY4A 5GAJA 3T1YH 3IERA 5J3JA 2GJ8A 3OTWA 2GN0A 1FVIA 5LJLA 2ZSUA 1H23A 4GC9A 1PFUA 2BFWA 2KPOA 3SFZA 4YJHB 4JLSA 1QIMA 4G5YA 3TE7A 2DHEA 3I2KA 3SXUA 3MCAA 1ZQ7A 2EL9A 3A05A 1E1QD 3EA5A 1DIBA 1IPHA 4TQGA 3W1EA 1VHLA 4LSAA 5AM4A 2YASA 3RSOA 4F8YA 2E4ZA 2O0KA 2YZ2A 2PSEA 3MJFA 5HNEA 4FN4A 1P0CA 4NDNE 4YRDA 5DNAA 5FIUA 2ZULA 1KHTA 3R8XA 3PD1A 3UC5A 4JI4H 4PRYA 1W87A 2AYXA 2I8AA 1QKIA 2RONA 4HEA6 1QQAA 1ZCFA 4FFNA 2FPLA 2FMIA 3AUAA 1Y8CA 1E3QA 1UJ4A 4P4LA 3TEJA 4G1FA 1PFYA 3HY3A 2X8LA 1QUEA 2GILA 1OFUA 4B1FA 1E9RA 2BEVA 2CMFA 2GN1A 4QPCA 1QIFA 1ODLA 1G20B 2VYVA 3ORYA 4GYWA 3UYKA 2CMDA 2ENWA 2ZVJA 4YCCA 3H9UA 4XLTA 2VTBB 3RJTA 3RR2A 2LNDA 3F7NA 4C0QC 1UKBA 5B7QA 3LXRA 3NT4A 1AK2A 2JJMA 3WICA 4RXMA 1A04A 1SOWA 2FPPB 1R3DA 5EVJA 2PSDA 2PZEA 3VYTB 5KQSA 1C3LA 1X92A 3N8HA 3V2IA 4DLLA 5KNBH 3CXUA 4BN4A 2OVBA 3HZRA 4V0ME 4X1IB 4OLAA 2BDEA 3IOEA 2W6ZA 3K0FA 4YASA 2OFFA 2FDCA 2C78A 3KJHA 1EFLA 1QMPA 5ALUA 1JH8A 1N3IA 4QGFA 3EJ6A 1Z5OA 2PAFA 4K9OA 1TVKA 1KC3A 3QOWA 4RW0A 2BGWA 5KI6A 2ZT8A 4N0MA 3T38A 1IBMH 1IM8A 1L4UA 1OFTA 1E4EB 1OTXA 1QB7A 2L42A 1KYZA 2W6JD 3UMRA 3ND5A 4FNOA 4CJXA 1NM5C 1PJZA 2G76A 2B3DA 3HU2A 3KG2A 4LJYA 5BVGA 3O31A 3BDVA 1NZFA 4ZCSA 1YU6A 2XNKA 2HSWA 3GCDA 4F46A 4AKHA 1E2NA 1WVGA 3VU8A 3EXFA 2ZJBA 2XVMA 4H7JA 3Q3IA 1ATZA 4FHGA 4D8XA 2BGRA 4FYKA 2AEMA 5IC6A 3NYIA 5DT2A 2WR8A 3BF8A 3KV3O 2C4TA 1JHQA 3OUTA 1A5AB 1V25A 2H5EA 4K9PA 3SYLA 3ZQ6A 5KG3A 2XD9A 4OX9H 1S3SA 3LXMA 4C7BA 3IDFA 5A4KA 3VHQA 5BSTA 3UJNA 2FOXA 5HM8A 3HGMA 2KLHA 3HR4A 4HYYA 4IS2A 4P35A 5C52B 3VBCA 5JT1A 4KPGA 1GPBA 3X1JA 5G1NA 1GNSA 3BSYA 5DX1A 1OB5A 1LK7A 1XF9A 1R0YA 4D7AA 5FOVA 4L16A 3IEVA 2YJTD 2AQHA 1UKVY 1NVEA 5FBRB 1CF2O 5EJEA 1G59A 4OQFA 3OQPA 1N92A 4U6SA 4ZCMA 4CV3A 2ZVDA 3OZIA 2IH5A 4BO4A 1NVKA 4AWBA 3SR0A 1L8QA 3PNVA 3A1WA 4MWCA 3GMDA 3B9BA 4D3YA 1P8LA 1AU9A 4JYBA 4NP6A 3GJ5A 2BFPA 3NKVA 4QQKA 4X3OA 4HFJA 4NPCA 3SX4A 1Y8ZA 4FONA 4M9XA 3TSWA 4A2PA 5JLJA 2OQRA 1DAKA 4EWLA 5IANA 2PMDA 4JI1B 2DB3A 1TYEB 1Q22A 1VJ1A 2I1QA 2DQSA 2Q4EA 2IYPA 2R8PA 1XF1A 5JHGB 1RYNA 5HDBB 4EG7A 3MQ4A 1IQPA 2IXAA 2G06A 4DBLE 4DUGD 1XG5A 2G6BA 1IHYA 3LJKA 4C0KA 4KO8A 7ABPA 4XSHA 2HJVA 2HQOA 4XR4A 3RB8A 5EEHA 3WE7A 5E9QA 4BN5A 4D4KA 1C0KA 1SD2A 5HPYB 4ENVA 5LQKA 1IUNA 9ATCA 3U61B 1I4WA 2J6CA 4FHZA 4XIJA 4OCZA 1W4RA 3F8WA 4QFDA 3WWPA 1KEKA 3ZU3A 5HOQA 1X7DA 1R9NA 3NT2A 3IBGA 4BGEA 5JRZA 2GRUA 3BIFA 2GJSA 4R2MA 2C2MA 5I6DA 2ZIXB 3PGVA 5JS8A 3D3WB 1PWXA 1QG0A 4L4RA 5I9MA 4A8PA 1VYHA 3ANTA 3AV0B 4KQFA 5D1NA 1TJPB 5A5EA 2G8NA 1WDLA 4BV2A 4RJ2A 3QUBA 4Q9AA 4JZKA 3KDAA 4E6EA 3JZAA 2E37A 2GEJA 2RB5A 3I9OA 1J56A 2NYAA 3VPHA 5I45A 1DT5A 5AVSA 4PSAA 4X94A 5EP1A 3M4NA 1ID8A 1KY2A 3FYHA 1IDOA 5IDXA 1HYQA 3ESQA 4I4NA 4IJWA 2BBWA 4GBMA 5HF8A 2IU4A 4KR7A 3HHPA 2B8JA 2FN4A 2AOWA 2MWMA 2Q3MA 1TRKA 1YC2A 5ERYA 3KZ1E 1QHEA 2JFNA 5DVZA 3KZCA 4MI3A 3LRPA 4GSKA 4QARA 4RCVA 5SYMA 1O6ZA 3ETDA 1KDVA 3S5JA 3VSAA 3ETLA 5J63A 2GMWA 2V4QA 4OIFA 4Y7CA 4K05A 4GWKA 1L1QA 1EBUA 1MX1A 2GK4A 2I4NA 1HWYA 3TR5A 2H52A 2YBEA 3F2IA 2W2NA 1BS1A 4AUNA 4W9RA 1J09A 2JLRA 2YXPX 3ZHOA 4JBGA 4RD4A 4YRIA 1GPH1 4J4TA 2VDLB 4MGYR 2I55A 2NO0A 2Z2YA 3ZLBA 3GTLA 3KT8A 4IFTA 4HYKA 2HK9A 3GRCA 4PC2A 1IBLB 5E2IA 3CLUC 5GZ6A 1PS9A 3UJPA 3WRWA 2MYNA 3QLUC 5LOVA 1DX6A 4MULA 1ZMOA 1B1AA 3NFRA 2QMYA 4PGGA 1P6QA 4UHBA 1PX0A 5KFZA 2ZJ3A 4CMKA 4RJIA 2REOA 2HKIA 3G9QA 1OLSA 1U0NA 1XZFA 3WG9A 2OOSA 2QY9A 2X5KO 5CFMA 1CKNA 4X84A 4G0YA 1G7TA 2JAQA 2AMYA 3MCUA 4G1UC 1KSHA 3WXMA 3E7PA 3GOHA 3PFIA 4D4HA 3M2PA 3D4NA 3LX6A 3MJVA 3OTQA 4PSDA 1SVMA 3GUUA 3B6EA 2BFFB 3CNBA 1XMQH 2IOFK 4ZV7A 2MYPA 3T4PA 3TVTA 5BRAA 3EMKA 4HWGA 4IICA 4INJA 4A92A 2D1YA 1L5SA 4CMCA 1VE7A 2QNIA 4URUR 3BHJA 1Z63A 4J2TA 4QT4A 1HPLA 5KC8A 2WIJA 3T7AA 2C9CA 2XE4A 3RANA 3RSLA 3DCNA 1PEDA 5A4DA 2ZB7A 3PYLA 1AHHA 1QTNA 2IE0A 4YRTA 2AGOA 4BGVA 1T4CB 4GRIA 1U9ZA 3A8TA 3WQBA 4YRCA 2J3DA 1PGQA 4H60A 4IIHA 3WVNA 1J5EH 1ZD1A 3AVPA 2V9ZA 1K4MA 5AI6A 3LQYA 2ZB3A 2QY6A 1JYEA 1Z8NA 2REQA 4KR6A 3HJTA 1PJ8A 4LZAA 2XYVA 3E8SA 3D3JA 1NJGA 5ALEA 1RACA 3VI4B 5CDYA 3X2SA 2PMWB 4AU1A 2K7ZA 1JKIA 1LRKA 1SMKA 1W2GA 1X8XA 2YWRA 3M1LA 1ADGA 1CUZA 4PINA 1X39A 3I2HA 4EYHB 5SZJA 4P22A 3UG6A 4YMHA 2FP3A 1JKMA 3JVUA 3KSUA 4D5EA 2X0FA 4TLBA 4K03A 5FLXA 4DLKA 1P81A 2C2YA 1IZ7A 1T9KA 2AIRA 1CU1A 4V0KA 3S8EA 3GLKA 4RTJA 3DM5A 2KE5A 2FSUA 1KEZA 3VC2A 4NQZA 1F6WA 1K4YA 1X86B 1ZUNA 2JIPA 1SWWA 8ATCA 4PO8A 4OHXA 4R2XA 5IJ0A 4FK8A 1QVVA 3UKJA 3JQPA 5JD5A 1U1GA 1FDSA 3A9VA 4IIBA 3ELWA 3RU2A 2IU3A 4BCBA 3ZXSA 4BZZA 4NE9A 4EAQA 4UXHA 1VKNA 1ZM3A 3SYKA 4CM8B 4X1OA 3OUUA 2QENA 1UC5B 1VOTA 3CZMA 3DPIA 3GJ3A 4I8IA 4XCVA 1H5UA 5KWIA 4KN9S 2P41A 2YFHA 4LVUA 2DR2A 3OIYA 4G1MB 4DLSA 1EAYA 1T8YA 1LY1A 3OU7A 2BJVA 4G1VA 3KS9A 2B69A 2FPGA 4RELA 2HH9A 2IU0A 2X8AA 5AHXA 1N5JA 5L1IA 4KE6A 5P21A 3ZNOA 4NK4A 3DLTA 5J23A 3WX0A 1IY0A 4GXTA 4O33A 4O3NA 3PVXA 1WO8A 2JGMA 4FBLA 4F6RA 1J49A 4R9SA 3OIDA 2C0PA 2WWFA 5LLSA 3RKUA 2LCFA 3D31A 4KPUB 4GYKA 4R2IA 2IIVA 2GN6A 4JVOA 4YTEA 3RVPA 1INLA 3L92A 3SS9X 2ZZNA 1KMCA 1J21A 1DJPA 2B30A 2BE7A 1T3NA 2HMYB 1V4BA 4P7KA 3F96A 4TUYB 2FZWA 3FHJA 1DWPA 1N9KA 3RJ0A 2ZSFA 5CGZA 1ZO8A 5AT1A 3SN6A 2XCPA 2VNIA 5DXAA 3VA7A 1QKJA 4GZ5A 4D96A 2JS7A 1W35A 5BN4A 2PEYA 4DFDA 4B2LA 2O6LA 1Z5PA 3QFFA 5CBKA 1W75A 2ZE6A 1MCZA 3PHBE 4DJEC 2D1QA 4YAUA 2P2ZA 1MD9A 1XJ0A 4Q44A 1WPXA 2H08A 2NXJA 3A1VA 3EB9A 3IQXA 6AT1A 1OC2A 1KO4A 3EIHA 3ZU6A 3IPCA 2A58A 1VMEA 3DLPX 4KTVE 2CLDX 1ST2A 2A0XA 5A0FA 4YJ2F 3GU3A 1LTQA 3R8FA 5COQA 4F96A 4FE4A 5LYYA 2PUEA 3T7SA 1UWVA 2GPJA 1A9PA 2JFOA 4DS3A 3OF5A 1LDEA 1TAHA 5ALTA 3II6X 3TKLA 4YI5A 3TECE 1CERA 4Q21A 4X60A 1JEYB 2PZKA 5C5EA 3T1VA 3B89A 4NU0A 2X7JA 1FLVA 3OC6A 5G0UA 3VR3D 3GRPA 3I6IA 1KDOA 5ERGB 4QVIA 4ARCA 2J3IA 1SRQA 3VXKA 2B8EA 4EFNA 5G2OA 4YMUA 5EJ8A 1LDGA 3OLXA 4R7ZA 4OHYA 3TQ1A 1NUUA 2X0IA 1TO1E 1YI1A 3VZSA 2BGGA 1OI7A 4N0PA 3HJGA 1MGOA 3CF4A 3IOMA 4PGMA 2RK4A 2ZJTA 5CX1A 4QWEA 3SG0A 5ECGC 1BC5A 4TYWA 3O75A 1XLUA 1KSJA 4CTJA 2Q5LA 5IKPA 2C5AA 3OU6A 2PL1A 4KKVA 4M7WA 1KJZA 4ECEA 3L0OA 5F3RA 4Z7QB 5IN4A 1KZGB 5LJIA 1GVNB 4JI2H 2CVHA 3E18A 1LC3A 3E3LA 4GO1A 4RSGA 2IBKA 2XA2A 1JMKC 1C3XA 4R8MA 1LS1A 3KOXA 3TFQA 2PUGA 5KQRA 3B6IA 4CTKA 1XJWA 2W6IA 3NJ4A 3FPHA 1XXHA 4GP6A 4RIEA 3NBMA 3QVXA 4HGZA 3MTJA 3AM1A 3PR1A 4MUGA 3FOEC 3DOOA 5CIYA 4RACA 2XF8A 3DCJA 3WZ2A 2RGCA 3N1UA 2VQFH 4OQNA 4XGQA 3HXTA 3EFBA 4HQOA 4FT2A 3WLJA 2WJPA 4JEIA 4XQGA 4XYEA 1UJNA 1I5OA 5COBA 3TMYA 1OH7A 4L50A 1WIWA 3INGA 1XDGA 1YZGA 5J1SB 4ICIA 4ECUA 1GN8A 1EINA 3UMJA 3K0SA 3MD0A 4ND8A 1BFKA 1U81A 4G5GA 4J3NA 1RWXA 3SHFA 1SBCA 4L2IA 3CNLA 2OA0A 4GKJH 1WU8A 1QHIA 3LX4A 2XOEA 1RYBA 1UKCA 2VZEA 3B8HA 4LYFA 2XNSA 1KIAA 1DO8A 1JWAB 2P78A 3FYUA 1HYBA 3S0JA 4XM0A 5EJ2A 5A2GA 3K1ZA 4MW7A 5FV4A 2QK4A 2PT6A 2QM7A 3T7DA 3PE4A 3H1FA 4HDQB 1YZVA 2M6RA 2UYGA 2YYZA 3GCXA 3Q7EA 2DHCA 3H84A 3B7WA 1Q7BA 2E49A 2UZ4A 4XD2A 1T2NA 3RNLA 3JQGB 1JDJA 2NU6B 3S99A 2QA5A 2V6FA 2GN4A 2EP7A 1S8FA 2NVBA 3CMMA 2EZUA 2G07A 1B3RA 4WY2A 3ESYA 3JQAD 3SQNA 5ALJA 3A1CA 3BFVA 4P81A 2EDAA 3A9SA 4J7XA 1B16A 1JLSA 1SCNE 4C6TA 3EZ6A 4EW2A 1HOTA 4WADA 2Q4RA 1SCUB 4C7XA 4ENSA 2PWYA 4QBFA 1VBHA 1TPYA 4HXEB 4XIYA 2F1RA 5J1TB 4B35A 1VI6A 5ICGA 1BMTA 2XR1A 2PVSA 2QM0A 3HBMA 3QPUA 4I4IA 3QGMA 3EH2A 4ZT2A 5FULA 3WLLA 4DJDC 3HTXA 3SEAA 2P9QA 1RXSA 5FUWA 4AL4A 1AJEA 2HXGA 2BHLA 2Z95A 4LXXA 4QELA 2FRXA 3TSAA 1WCMG 1P77A 4PX9A 3WGIA 4B3MB 4EQ6A 1OVMA 1JMVA 1C7ZA 2IOFA 3U5ZB 3MINB 5AM1A 2C54A 3KPVA 1K7YA 1UR5A 3HBNA 3PI7A 1XQ1A 4GPIB 2R7NA 1HSZA 2XGJA 4K0KB 2A4MA 3AETB 3DE5X 1SZJG 2O50A 1E59A 1QHXA 3GUHA 3F5QA 3P0IA 4PS1A 2QVYX 5JVLA 5L1LA 1FJGH 1M2OA 2YJGA 3RFXA 4ZN6A 3U44A 1LSUA 4OGWA 3QWHA 4OXIA 1F1JA 4O7ZA 1Z8DA 2QXYA 5JRJA 4M1WA 3QYFA 3TWOA 3HACA 3GPIA 3GLIA 2VRWA 4GZLA 4UXIA 1MJGA 2VP3A 3CEAA 3UMVA 1T3TA 3CRMA 3UAWA 4ZGGA 1E6CA 3PQ6A 3KUKA 1T4MA 2V0CA 2JRCA 1FJXA 4ZA2A 3BX1A 5DIFA 4A0SA 3I3OA 4EQ6B 2P2DA 4OHBA 3ML1A 1ZW6A 1KYTA 4AF6A 4AUKA 1AUQA 1M5TA 1QH8B 1Y5RA 1ZXLA 3MBKA 4YCSA 3ZWWA 2GASA 4XJSA 4URXR 4NU5A 2QRLA 3H8VA 5JJLA 5JNSA 1BIFA 1E4FT 2FZEA 3DMPA 1W2WB 4TLMB 3T7JA 1Z88A 4KRYA 4F5WA 5EKSA 3TD2A 4W63A 821PA 5AVKA 1FEZA 3O2JA 4EYKA 1IHUA 1L8XA 4O4IB 1ZINA 4Z86A 5EMNA 2QT1A 1DBRA 2YS7A 3BQ9A 3E9CA 3GGOA 4EL5A 2VA2A 1KOLA 5B5SA 1NW4A 1VJCA 1XRRA 1N2IA 1ZFNA 2EWMA 3ACCA 3FOAA 4FE7A 2PSFA 3GIMA 1QC5A 2OORA 2QUBA 2HSEA 2RJNA 2IV2X 1GZVA 1TRHA 3SKYA 4BBZA 2CJYA 5AUPB 5MHTA 3B3FA 4JAVC 3ST7A 4DG8A 5B7NA 4UUBA 1F0NA 2I76A 1MTZA 3NGMA 1MOZA 3T06B 4ESOA 1E32A 2VZ9A 5J2UF 2NVOA 3L8EA 3PSHA 4KVZA 4L3VA 4OAQA 3WL6A 4C29A 2JEIA 1VKOA 2QTFA 4D74A 1S9FA 2FE4A 1THZA 4OH1A 2JIZA 1V8FA 2DQYA 3IT3A 1P1KA 1Q7RA 2RI1A 1E1KA 4KH0A 3ZWKA 1XZJA 3VR5A 2OT3B 3A6HA 2YC2C 3EPPA 5FJIA 3D4OA 1QNFA 1O97D 1E5QA 1WKVA 4N7JA 2FLWA 4UD2A 1KS9A 4BQEA 4V0RA 4UBKA 3KOWA 2ZFUA 4HCJA 1NTOA 2D3TA 2HJWA 4YONB 3WWCA 5DSZA 1ZM7A 3RRZA 3UK7A 4MVJA 2MINB 4AULA 4CF6A 1GPMA 3L4BA 2F3RA 4D82A 1NDUA 1Q7EA 1SQ5A 2IHKA 2QQFA 3CX8A 4BBAA 1YVDA 1BEZA 1OZHA 2WU4A 2ZBRA 8ADHA 3QXHA 1XZNA 1N0HA 1TFRA 1FMLA 2CLIB 1PJRA 4XWKA 4FEYA 5IDQA 4YJ3A 3IAS6 2XLBA 1Z4OA 4GGOA 5A1JA 4UCTA 3KR2A 2PRIA 3M3HA 3HKCA 5KFYA 3VNAA 4K2AA 1E1CB 2P27A 3N2NA 3T4EA 4QG7A 2ROQA 3OJEA 5I7OA 3QKSB 1M75A 1V2HE 5ELLA 4DV1H 3CH6A 5KJFA 1IG3A 4OXKA 4PZEA 2Z9DA 2GFHA 4I1RA 3QLEA 4ZVKA 4HNHA 4H16A 3GGJA 3L4SO 2WJ4A 4HNRA 4ND2A 1ODKA 5FWXA 2CYCA 2V7EA 3K2BA 3WNVA 3DAGA 4HN9A 2W9XA 3PW0A 4DW8A 5CT5A 3H40A 5HFJA 1JHXA 4KV7A 1N2SA 1RQ2A 1PNRA 4O3QA 3SVLA 3VPBA 1XVIA 4V0MA 3D0OA 1VHTA 5G3YA 4M1YA 1NRJB 2AMFA 1RE0A 2PU5A 1FDTA 3U5TA 2JGIA 4JB3A 2O1XA 5EHGA 2JEYA 3LFHA 2VF2A 3KR9A 1J2RA 1JYSA 3K35A 4ZOLB 3RM3A 1N5IA 3FTFA 3BF7A 2VPIA 3HLTA 1Y82A 4WZBB 4BXOB 1NR1A 3IIMA 4HB2A 4KWIA 3VMFA 4OQLA 4BLUA 3WGKA 1VKHA 2B4TO 4AZVA 5FLMG 4U6PA 2I3ZA 2UV8A 3IXLA 1TU4A 1HEIA 1QQ6A 2Q1YA 4JCOA 1XRNA 5KS2A 4QPZA 2IPAB 5LB4A 1YNSA 1CEQA 2FZLA 1MT0A 4KYUA 3IBTA 1D7AA 1M72A 3BXZA 5HM6A 1ISSA 3MWDA 4MR9A 5EIBD 3DMYA 2YH2A 4C9BA 4EEKA 2H7VA 2A86A 2XWPA 5A03A 2POCA 1FYEA 1VE5A 2MSEB 1L5HB 1NN3A 1SBYA 2WWHA 3EE6A 3QYPA 3RJ5A 1GD1O 2EF0A 3MR6A 4UEWA 4DQNA 1G4HA 4LX8A 1I2BA 1I3MA 4LE1A 1QLJA 5KFUA 1L0BA 4TL6A 5ALXA 1S8OA 4Q1VA 1JHZA 2WSMA 4DXAA 4AJOA 1P17A 2ZS9A 3OLWA 4RHUA 4RWZA 4CMGA 2AZXA 1L4BA 3SC3A 1KKLA 1AV6A 3UJHA 5ULLA 3C39A 2JFWA 1R8XA 3P9YA 4BFYA 3WQQA 2HSDA 4Y6GB 3AU8A 2J6UA 2IHBA 3BFPA 1OAKA 2H65A 3HV0A 1L5WA 3WWJA 1ZQ1A 2CD9A 2E4VA 2JGDB 2NTEA 3HKCB 4LHVA 1WQ1R 3MOIA 3NBAA 2XWBF 1T25A 4WFIA 5CUQA 2YZLA 3OZEA 3REGA 4RPGA 4AJPA 1VMKA 2Z8XA 5KFCA 1GKIA 4L2IB 4ZVLA 3SHVA 4F5EA 3C1AA 4MRNA 4PLWA 4QFMA 3TR6A 4E5MA 3Q5DA 3BWVA 4B83A 1E9BA 4WBNB 1V8DA 5KHAA 4BGUA 1OZFA 5IASA 1HFEL 2CT8A 4MQ5A 1TD9A 4BFSA 4HDSA 4QXMA 4LMPA 5HHTA 1ULHA 2P2GA 1EDOA 4WUVA 3VKUA 4D6PA 3RBDA 1OLXA 4LV6A 4MVJP 4Q66C 5KEIA 1RC8A 1ZCBA 2ZGVA 3UC9A 1O75A 4WI1A 3F3SA 3SMQA 3WGOA 1G9TA 3VZBA 4CC6A 1GUDA 5EUBA 1LC0A 1T2FA 3IVGA 4FX2A 4BNYA 4R1OA 3D5QA 1JT2A 3ESXA 4YQEA 3T7TA 2JGKA 2WB2A 2RAVA 1VLLA 2EWWA 3D02A 3PE3A 3BILA 3E0QA 1OVGA 2DBVO 2QNBA 2Q5OA 1J2UA 4DQUA 3EISA 2K6GA 4AI6A 2ALJA 4EJMA 3SR4A 3OZWA 4GMDA 4AG5A 1WW8A 2V74B 3GJTA 3DPUA 5KNLA 3EIOA 1JQ3A 3HVJA 4EW6A 3TLAA 2YHUA 2JVKA 1BOOA 2B2XA 3RB0A 5AQ1A 1PZNA 4BNFA 4IJVA 1DAGA 2CFRA 3BHIA 4JI5B 5B3LA 1RI3A 3VJMA 4O2AF 1BTOA 4S1NA 1RTKA 4G8CA 1LRJA 3LIPA 3D4PA 4GT1A 5I5TA 1QJ4A 1FFDA 2QL7A 1KEWA 1C8KA 3FCOA 3QNWA 4P4SB 3AERB 2AEJA 3B6JA 2R44A 4K6OA 3JQRA 1TX4B 4X95A 1YIDA 4JCCA 1NQOA 3SNHA 3GWGA 3IEIA 4XSVA 4MR7A 2P65A 5DH9A 1I32A 3G79A 4R0VA 3JATA 3TZLA 4EA7A 4F1WA 2R5FA 1LK5A 4MV6A 4QQFA 2ZPAA 3O92A 2P0EA 1K8YB 2R62A 3LT2A 2G08A 2ZWMA 3WLEA 3KLBA 1PVVA 5TQ2B 1ETHA 4II3A 4M88A 2JD0A 1JJBA 7GPBA 5I4IA 1TM1E 5JLAA 3CB2A 1F4LA 3K71B 2OC9A 1TQ2A 3GEGA 1OFVA 1L4NA 2HRDA 5DP1A 3WS7A 2YXNA 3N2KB 4A15A 1XQ6A 2CFCA 4CEIB 4G0WA 1ISIA 2XOKD 1UKEA 2DGDA 2W0SA 1SU6A 5IEBA 5JROA 2CUTA 3BDAA 2R7ZA 5TGDA 3T61A 3DT8A 3W7BA 2XCSB 3V4SA 1SNYA 4WN9B 1H2HA 4F3YA 2OH2A 2ZUCA 1RU3A 4OQ4A 4IX1A 1MC5A 5CGQB 5C2JB 1K1QA 2BUBA 3RGGA 3TZHA 3U6BA 3D6UA 3VR4D 4RF2A 2J3QA 1LUAA 2JH8A 2Y0PA 3LOUA 4F71A 4APMA 2FLNA 2LD4A 4LZLA 3QH4A 3G2HA 3PT9A 1ZEJA 4LPSA 3UV6A 3PNPA 3VV3A 2BEJA 4C7OA 1PQWA 2V6BA 2AZMA 5ALOA 2WM3A 3U49A 3BMQB 3AVVA 4MUYA 3FGPA 3I9MA 1L2ZA 3DZJA 3HN7A 3OD1A 5AOVA 4MP8A 4ZJYA 2G9RA 3ZY6A 5JANA 1R5NA 1IQUA 1HFKA 3QFCA 4HDNB 2YZGA 4LWPA 3LPMA 4LVOA 4QJFA 4GOKA 4F2WA 2WT9A 5KYTA 1Z2OX 2CWDA 4LI3X 2D13A 4WLEA 4X20B 2WHYA 2R47A 4F5DA 2JFFA 3JAWB 1E1RD 2I2WA 1NUSA 1Q57A 1X7XA 1XMXA 2X7HA 4LRTB 4ZI3A 3NDBB 2WWYA 2DPGA 2Q6OA 5IVDA 2C5GA 4M86A 3COWA 5HNKA 2VP4A 2RKOA 1H2ZA 1YS7A 2P9FA 1UMBA 3YASA 4OX9B 1ZU4A 3N70A 3CX4A 2ZQ5A 5BN1A 2ZU6A 1KQ3A 1SFOA 1WXGA 2C9OA 3OFNA 1NMYA 1OI3A 3K70B 4EKDA 1I1MA 3L6BA 1JXQA 3WGNA 2YWDA 4UVGA 3N53A 3BFKA 4B3GA 2X40A 4IXMA 4OSPA 4P6VF 1HE5A 3I9V6 1W0KD 4UAJA 4LF9B 4MW2A 4WEOA 2ZRNA 4E03A 1NQWA 3PE6A 1RC1A 1BEEA 3TNYA 2ZP1A 1M1YB 4TX1A 3ZS9A 2IXGA 2P9TA 4Q7LA 2BKLA 3I30X 3I0ZA 4MIEA 4HDSB 2RJ3A 1KDZA 2VAXA 2EATA 1WCV1 2OP0A 1NLZA 3QG1A 1KZ1A 5TS3A 1YZFA 2WINI 1TC1A 3IR5A 3PUXA 4QXPA 4RXUA 5K8VA 1JJVA 3W3AA 1IAVA 1FS4A 2VRBA 2ID8A 4IQFA 2HN9A 5JAHA 3UMMA 3O3MB 4Z3OA 3MXTA 1FL9A 1OQAA 2UYYA 4TN1A 3W1BA 1NI5A 1V5IA 1Y1KE 2VUMG 2RARA 3AM5A 3A9RA 5EIEA 1G5QA 1LBHA 3GHYA 4MV4A 1T5HX 3GDFA 4AJLA 3QEAZ 1HDZA 4HBGA 1OZ0A 3DW1X 3HM2A 1ENPA 4AS3A 2O19A 4CV0A 3R3JA 5LYJB 3H8JA 2W6QA 3LSYA 2FK7A 1G18A 5A3QA 1KK1A 1T0UA 1JR3E 4KR9A 2GM4A 3GD5A 4IKEA 2PV0A 3A1FA 2POQX 4ZOCA 5H81A 3LUHA 4Y9UA 2ZRBA 1JSXA 1NOJA 3TSCA 4NFLA 5JJ5A 1ZDMA 3EX7C 4EYQA 2V7WA 4DF3A 1XE3A 3IV7A 1O0CA 2ZBQA 2ODPA 4WTOA 4UBLA 4YAKA 3OHSX 2NMVA 4PHCA 5CRIA 3K6SB 5A71A 2AEFA 2Q3LA 4AB1A 5KMGA 3VU9A 3IUBA 3L3BA 4A8JC 1MLDA 1ENYA 2ZSJA 3FWNA 3QVKA 4GR4A 5I3ZA 1H6BA 1ZSNA 2FMXA 4EUHA 4P9NA 3C85A 1V1RA 3QY0A 1U2ZA 4AQYH 2XCTB 3DP9A 4HTFB 4JR1A 2QSZA 4CLDA 2IHYA 1E89A 3DZDA 4MRPA 5BORA 1UBSB 2C29D 3MTBA 3ZWAA 3PT5A 3ILHA 5F78A 1WNTA 3FDFA 2P8SA 2EG9A 4I08A 3TRDA 3SYNA 4ZU6X 4OU5A 3E22B 1H65A 1XJCA 2HLPA 2XB2A 2JA1A 1ZUD1 2QRNA 3BEDA 3HFGA 3M0EA 3ZE8A 4GOMD 5CD9A 1RZ3A 2JLCA 3M4IA 4BMOB 5K3EA 1QRTA 4PHFA 5JALA 3CIOA 3KJFA 4WLVA 2VPWA 3G0BA 4PLCA 3MK31 2VNHA 4JT8A 3RUCA 3SZUA 3VZDA 1JN0A 2Z02A 2HBRA 3KSMA 4FILA 4HGQA 1CUYA 4MX8A 5D5PA 1U31A 9MHTA 5DYIA 2W7PA 4U1RA 1NV8A 1DC7A 1GFZA 1N5DA 1XD2B 5FPYA 2ZAIA 1NVGA 4CF5A 1N2HA 3CVZA 2C28A 4XCXA 3U3RA 2C92A 4RHTA 3SZRA 3LCVB 4H6XA 2OBFA 5K3CA 1ZAUA 2Y1OA 3NTUA 4X7RA 2C4KA 1PR3A 3BK2A 3CF4G 3L41A 1TXGA 2PTHA 2W9BB 2X3YA 1WM1A 4KWCA 1SR8A 3IAUA 2ZK7A 3SZOA 2YOHA 4W1QA 4QUGA 3GROA 3V48A 1NXTA 4PF1A 2AKAB 3L77A 2YVLA 4H6PA 1E62A 3HJBA 4RKQA 3KQNA 3LT4A 4EOGA 5CDFA 1E2EA 1F2TA 3HVHA 5ELXA 2PQ6A 2BKEA 3KQKA 2I6GA 5KTOA 4C4YA 4FFDA 1ICIA 5LQDA 1U7OA 3RADC 5BUCA 5FWYA 1ZM4A 5EXDA 3VUEA 5K8TA 4HF7A 3UHPA 3P9RA 2HA7A 3FVVA 2ZDQA 1YU9A 5HE9A 2UUCH 1S2OA 2WM9B 5CCDA 5FDFA 4B6FA 3JS5A 3VNQA 1TM2A 2P4QA 2I6FA 5AWFC 1XEXB 3UK0A 1QZZA 1JDZA 3L6CA 4U00A 5HCIA 2PCLA 1QYDA 4TMZA 2XB4A 1CR0A 4M0KA 4U2DA 4DJFC 4FJ2A 4EITA 5GMOA 1VSTA 1CIVA 1HDCA 1RPTA 3DT6A 4GMGA 1Q0SA 3WMEA 2OR3A 5BWBA 4Q19A 1VECA 5HGJA 2ZSEA 2OORC 1WTCA 3ELYA 4PX3A 4RVDA 1BRTA 3ROKA 4M1KA 3S29A 3ZV6A 1CY7A 4IIJA 1CJTC 2PJDA 2O7RA 4XM1A 4UTPA 4TWRA 4G65A 4Y8VA 4YJGB 4M0UA 3T0IA 5A9TA 1K88A 2C2KA 4ALIA 1X7WA 3BE5A 4QVKA 2CHUA 4D6YA 2CJXA 5JUWA 3Q41A 3UPTA 1G2IA 3F1KA 3KVVA 3F6RA 1ZW1A 3OIUA 1I7LA 5CPBA 4A73A 2HQBA 2M98A 1UDCA 4EPXA 2E6UX 5MFPA 1RMTA 3R9XA 2GAOA 4B71A 3VPXA 4P4SA 4MV1A 1JIKA 3GDOA 4PPNA 2Q0HA 3FF1A 1EXVA 2R1ZA 4L5BA 4UDYX 1O9BA 3C5WP 4GPD1 4XJVA 4PQEA 4F56A 5CDTA 3W4JA 2P6OA 5LP1A 1B23P 3V2GA 3ZI0A 4FBTA 1PUXA 2Z56A 1PVOA 1VPEA 1IN5A 2EL7A 1T9HA 3FAZA 3I39X 5HQJA 1J22A 4A2WA 2Q1XA 2WD7B 5KFKA 3VKWA 3ZE2B 2ATIA 2NSLA 4JODA 3BQ1A 1U7HA 1WF6A 5DB4A 4BFCA 5ICEA 4PAQA 2I7TA 3K0EA 4B43A 1AS0A 4ZT6A 2G7ZA 1RVDA 2B20A 3FCAA 4KMOA 3KXIA 3W6NA 4EF4A 2PUDA 2DFLA 1HEUA 2CY0A 1C9YA 1UPCA 3KJXA 4P4UA 4UM8B 5BN3A 2PMZE 2ZRKA 3EQ9A 4J1NA 3IT2A 1E8MA 2OP1A 4P7FA 3VUFA 1DRJA 1JDBC 4V0LA 4ZHSA 5ICCA 1PW7A 2QN3A 2OKGA 5EXEA 1S2GA 1V1RB 4KQ9A 5K8CA 2IYTA 1TEHA 1W25A 2I7VA 1Z3CA 1FRQA 3BIWA 3BD6A 3DXFA 3GDGA 2NT4A 2VWGA 1E4GT 1XROA 1UBHS 3PJGA 4PZLA 2QORA 4Q01A 3RI3A 1UIMA 4B17A 1T1EA 2RHJA 1A9TA 1GYQA 3KT6A 2DHDA 3JQ8A 5ALVA 3ROTA 1Q0LA 2O0JA 2A5FA 2JLYA 3O84A 2VSXA 5DOVA 5F3WB 2F8SA 4OY3A 3TLGB 1ABFA 3ELBA 4BCDA 1L5KA 2DLCX 3ILVA 1RBQA 3LQFA 3MC1A 4KUGA 5JQGB 3HLYA 1V3VA 1MFPA 1U3WA 2G5GX 2G88A 4F4WA 5BSHA 2BMFA 3LBIA 1S8NA 3ITNA 3O03A 1T24A 1Z15A 3FVQA 4MVJI 3JALA 4XE5A 5AJXA 5DYWA 1E7SA 3ERCA 3S2IA 4FI3F 1M1NA 4CQMA 1GGVA 1JPUA 3OCWA 4NDZA 5DCYA 5ARCA 1RIIA 4NH0A 2AG1A 2OCXA 4JV0A 4DM4A 5IXJA 4GOOD 4II7A 3T6KA 2V7BA 3Q8XB 3GI1A 3HR7A 4M1ZA 2B1IA 4MVJH 2XZTA 3ABSB 3CNEA 3FWHA 3LXUX 2FOIA 2A9RA 4A7PA 2YW9A 4U4AA 5ADWA 5J2TB 2ZRHA 5M3BA 4JXXA 2BIFA 1XLWA 1T2UA 1LF0A 5E2AA 3KL4A 1P91A 5E0OA 3ZHRA 1R64A 1Z16A 2CXRA 3QVJA 1YR3A 3KSBC 1OF1A 1YHNA 1TQDA 3G89A 1V5EA 3CNNA 2Q2QA 1H2WA 4KNWA 2UXDB 2OAEA 2D1TA 4JVMA 1NU8A 2ASJA 1V39A 1OBDA 2OHHA 1X14A 4L5JA 4N5IX 3QWUA 2HJHA 4PV7A 5ADUS 3GIIA 1ZRMA 3AGQA 2WP8J 3KJEA 2RCYA 3NTRA 3O4GA 3QPDA 4WFJA 3ET5A 5DCLA 3VYSB 5B36A 3QK7A 1O6CA 5DM0A 5C53B 1OWOA 3PKJA 3QU4A 2I7DA 3UJ7A 2P7HA 5CLJA 1C7QA 1BH6A 2QD2A 3RYHA 5IM4F 3DAYA 3M83A 5PGMA 3HKDB 3PRKE 1JE1A 3AFGA 3MD9A 1P1FA 4XWGA 5TGTA 3URKA 5EA2A 1SBIA 3WGHA 3ZIAD 3ZTWA 5C80A 1UPFA 2XTJA 3Q7RA 5DHAA 1QDEA 5E25A 3WWIA 4G01B 1DDGA 3R3XA 1V0JA 4G84A 5KNDA 2VUSA 2O8BA 3TOCA 4JXKA 4CR8A 1H2FA 3MSCA 4B8ZA 5C32A 1QANA 4QD3A 2GXSA 1HI9A 3NEPX 5KYWB 3EPRA 2DC1A 3UK1A 1B4DA 4BFXA 4NU6A 4B6SA 3VAYA 3R9IA 1AOXA 1YS4A 2OBLA 2HDKA 2AGQA 2ZBEA 3KYJB 2ZUVA 3MG9A 3MS4A 4JQCA 2H8KA 3V7YA 3EW7A 1IN8A 2XWQA 5E7MA 2R48A 1CBUA 2J9YB 3LQ1A 4MCIA 1HG1A 2V45A 3KJQA 4R0MA 2X1HA 2A67A 5JCPA 5KREA 4YUWA 3C3XA 2PL9A 3THOA 4BO7A 2D00A 3UCEA 1YBHA 3WMWA 1TUEA 3KPJA 1K4KA 2PQ0A 3GD7A 1QORA 3CSDA 2GDJA 5IJAA 5IC4A 2YWEA 2HI0A 1Q77A 1ECGA 2IIBA 3WJ1A 1PFWA 4S24A 5AHKA 4WBSA 1G8AA 5FBQB 1MZVA 4F86A 2YHAA 4FC7A 4ZC8A 1BQEA 2A84A 1PJ4A 2AEEA 3ANLA 4MEJA 3GV8B 3UMYA 3NDPA 2VH2A 4XZ3A 3ZHCA 2VYVD 3BRSA 3VPFA 3GLVA 3OPYA 2W2TA 5I8ZA 1XDZA 1Z17A 4K1LA 4RIFA 1BHO1 2GETA 3WP0A 4D2IA 1PYGA 2EKPA 3V8RA 2DUNA 2H0QA 3PXDA 3RRBA 1H6AA 1U9YA 3IURA 1UWLA 3DDCA 3PGMA 4R2KA 3INTA 1MX3A 3ESCA 5JNWA 4KRFA 5J9FA 2RGEA 1A8IA 3S24A 1D4OA 4FNAA 1U6KA 5DCWA 2AW5A 3S2SA 1ULZA 3KB8A 1A7UA 4CRWB 4N4AA 1V8ZA 1H6CA 3MILA 1CQJB 1UXHA 4XJTA 4KO2S 4U7GA 3W04A 4I1VA 4QXQA 2YDYA 4D02A 3AX6A 4H3KB 1KNXA 3GLTA 4OB7A 1UK7A 1KTAA 4I4TF 5AKYA 3X1DA 4AYBE 1YZQA 2Z98A 4MYDA 3V4LA 4YFYA 5IP5A 2HLDD 3IE0A 1RHMA 3BCUA 1LQTA 5EGNA 3NIGB 2FWRA 1E4EA 1AO3A 5IZCC 1WOMA 2NU9A 3KFVA 5JH7A 5HV6A 1Y6GA 1Q0TA 3TZCA 3A3PA 2JGAA 3DPSA 1VFNA 2IWRA 5IVPA 2FPRA 3EIXA 3PNMA 1KQPA 5AW0A 5TY0A 1NHWA 3C14C 4LSMA 5ALDA 3I8XA 2AMJA 1WSDA 1U2PA 5C8YF 1EGVB 2EIXA 3DVAA 3TB4A 4QGAA 4RF4A 5FRDA 2CK3A 2LVBA 3D6JA 4DQLA 4ZXPA 3E7FA 2AZ4A 2HIAA 2QGFA 3U4IA 4FNGA 1ILWA 1QTIA 5IAKA 5T4HA 3CF2A 1JALA 1RYMA 4ZOAA 4DR1B 3WMGA 1QO0D 1OXKB 5E9JA 5CPFA 2I9PA 2FFBA 4DT1A 1E2UA 5JS7A 3J81k 4QYSA 3TLEA 1W7AA 2CV0A 4NCXA 3JXEA 4G85A 2JI8A 4DDWA 5K3BA 2HTFA 4BX9A 7MDHA 3NDJA 2R8GA 4O82A 5BXYA 1TMGE 3UYLA 3BMCB 4HK4A 1DMSA 2C9ZA 1GL7A 4MAAA 1XZ8A 2JDID 9ABPA 2NP7A 1T13A 3JCZA 4DL9A 3L8HA 2JGDA 1XZPA 3F9RA 4IOKA 2M32A 1ADJA 2Q0SA 4RA6B 4G0QA 4G1BA 3H87A 1WZUA 3FNBA 1YJBA 4JT9A 2DPLA 1UFRA 4KPUA 4WV3A 4B6RA 4YMVA 1WOYA 1JIJA 2UVWA 2JATA 3B9RA 4MVJF 2DT8A 4DV0H 4NJMB 4BNMA 1LA2A 13PKA 2I65A 5DBEX 1XEWX 1PNQA 1U7UA 4L02A 2VCEA 3WYCA 1RYFA 1QAMA 1V16B 4ALLA 4N48A 4C76A 2GTIA 4LY3A 3P5BA 4LMAA 4QPPA 2KQUA 2V6GA 4HQFA 2FWAA 4I1IA 4LBVA 4S1WA 2QW0X 4DMCA 4I3FA 3WWDA 1Z38A 2ANBA 3MJDA 5C8VA 1UNNC 1LNZA 4JVLA 3SDBA 1JG4A 4NHEA 3LRXA 4NBNA 3HH8A 5J2UA 4W5TA 4WN9A 2BQ3A 4N5LA 2CXSA 1YQGA 2ASVA 1CVRA 3B53X 3NYQA 2VA8A 5K0ZA 3TW0A 1BXRA 4IPTA 3FJYA 4HAVA 1EWQA 1ZISA 3STHA 3I2YX 3U31A 3EZ9A 3A4VA 5K45A 4OGFA 3KAJA 3EXEA 3V4FA 2AS0A 5INTA 4J9NA 2IODA 2PFKA 2E82A 1PSWA 1JHUA 1PR6A 3AO0B 1C1YA 4KE7A 1PJSA 1FSFA 1LQUA 1WWKA 2HB6A 2I6XA 2HWYA 2WKRA 3OTGA 3OZCA 1X9IA 3ILSA 4RBNA 5G4KB 4AECA 4EJSB 1A9OA 1YASA 4HS4A 2C4WA 5SICE 1XCGB 3MHPA 1AGXA 4A3EG 1K8RA 3PL5A 3G8YA 4RZRA 1YRQA 4RZQA 4TTVA 4DSUA 2Z30A 3CZ9A 4OX9Y 3QE9Y 3IBSA 3WK9A 4HB0A 5EZYA 4PZ6A 1Q74A 4HGYA 4R1QA 3HNRA 2IF2A 3H2GA 4D0LB 1FSSA 4Z4QA 1UZAA 3MB8A 4TYYA 3X1ZA 3TZKA 2JJ8A 2WJAA 3L6RA 1MAAA 3MWFA 4FE2A 2YICA 4HVAA 1YJXA 1Z6XA 2EKBA 2OB1A 1XT6A 4JYMA 4KX5A 4GBJA 2PVCA 4Q3BA 3KETA 3DVAB 3I4CA 4NENB 1LJ8A 1RABA 4NCIA 2VF4X 1DLIA 4WW0A 4PC6A 4YPFA 2R7ZG 1G21A 2YL2A 4L0CA 4X8OA 4DTIA 2V0GA 2A78A 2FSHA 4GSLA 1NATA 3J80W 2Q6IA 3A14A 2R8RA 4PQGA 2BGMA 1YQXA 2XVYA 3R3ZA 4W5OA 1NKTA 4G0OA 2F8TA 5IUNC 1NLUA 2IFTA 3QJYA 2C98A 1E1RA 1AZLA 3CKMA 4QPJC 3RR5A 3L4BC 5AH0A 4TYPA 1TMYA 3RGZA 4W5JA 3SHQA 4QC2A 4LXQA 1ND6A 3LA6A 1LLCA 3ZJYA 1ZH2A 3VISA 4TKMA 3ZEAA 3RABA 1MG0A 3P9KA 1QH9A 1C9MA 1CR6A 1TZKA 3EJWA 3VTFA 4BKQA 3KQHA 1GR1A 3NM4A 3R6GA 5K0SA 2IBSA 4U7HA 4H1WA 4LFCB 1I3OA 4Y2VA 4LHSA 3B36A 1R15A 4RKFA 5JY6A 4AKIA 3NRBA 4TUYF 4LRWA 1QVAA 2GCOA 2ZWOA 3NHUA 4JLUA 1NN5A 1I94H 2ALZA 4Z4GA 2H54A 3F5SA 4TROA 1KDYA 3UWPA 1ZRNA 1UFKA 4LY9A 3TUJC 2YY5A 4YBZA 1QS0B 1MRZA 4UC0A 1DWUA 2AYYA 2GN8A 2OWDA 3VR4A 2CJFA 3N39C 4TXNA 3ZS8A 3KKKA 4P83A 1UC4B 2VJCA 1P75A 4XRGA 2O8FA 3FH0A 4HDKA 4Z4IA 1A72A 1Q0RA 4KXMA 4S1VA 1W36C 1Q83A 1EFRA 1FTSA 1RYZA 5FCDA 4QJ3A 1T26A 2B34A 4GBED 3UKOA 2ZQZA 2J41A 2VDPB 1DJQA 1I33A 1C1HA 1RHQA 2YIMA 4TVOA 3QTTA 5SV2A 5IAOA 3WP1B 3I5XA 4ALMA 4G63A 3JD0A 3V8MA 2NWQA 1B3BA 3MXOA 1QYRA 3Q4GA 1TCBA 1W6RA 3OTHA 3RFVA 3SICE 4C0AC 5TIIA 4HH1A 4P33A 4S0ZA 4AZTA 5F7ZA 5CMLA 2VPZA 5T6BA 2BAGA 2I2XB 3K72B 1YR7A 4G0VA 4U7CA 1DGSA 3A3KA 4IGKA 4R84A 2ZAGA 4EHHA 4D9GA 1Y98A 3H9CA 2XNDD 3BKXA 1HNXH 2PRZA 3HB0A 5CEEA 2QVCA 1P1JA 2EP8A 1ZWLA 4PO9A 4AJHA 3WLFA 2YUIA 2CFIA 4R83A 3OZAA 3K0CA 2CUZA 4QDZA 3WBKA 3RB3A 2BFCA 2D7CA 4UNSA 2Q6KA 1D2MA 1UPUA 2ZRQA 1PI3A 3PUZA 4FSXA 2WMOB 4TSFA 4EGAA 4M0DA 5BPHA 1ZYUA 2VHEA 4JKYA 2VSOA 3MQ2A 5BVHA 5CXQA 1NVFA 1N6NA 1SHTX 4DM3A 4IH9A 3I09A 4FYPA 3V55A 1H2RS 3N0WA 5DP2A 3X2FA 4U02A 1RK5A 1Y1RA 2WJVA 2AD1A 3AYZB 3WDSA 4I4CA 1PDVA 1WD5A 1VGQA 2QZ9A 2RBKA 3PFNA 4QOIA 5CVEA 5AKEA 10MHA 4O3OA 1DFIA 4MPRA 3MWDB 4LFCH 1HBJA 4IP0A 4IZOA 4XDZA 2PUCA 2P5TB 5ITSA 1Y42X 4QUAA 4X54A 4LV8B 1WVMA 1FYVA 2IMWP 3ZC3A 4D98A 5E4JA 2GYWA 4KXLA 4KPYA 2NPOA 3RASA 3K5IA 3WK8A 1CP2A 3GPBA 3LYUA 3OJ0A 3GL9A 3I9FA 4JJFA 2BR0A 4MRRA 2BWJA 3BVPA 3RS3A 1IWPB 3CT6A 4M8KA 1Z26A 3C8ZA 4BO6A 2VPSA 5LQUA 1ELOA 1UODA 2IT1A 4CXMA 3LM8A 2K5UA 1NZJA 2XT6A 3CIFA 4GLBA 4JR0A 1YTUA 1KI3A 2P91A 3S2YA 5FWYB 3JD1A 2UXDH 5MF6A 1QYXA 4H1VA 4XOUA 4WACA 3U4QA 2BMVA 5EWJA 2GZSA 3OHBA 4NJEB 1C8BA 1U02A 2A94A 2E87A 4PONA 3ZHQA 1KQGA 3I9NA 1EX7A 1NBMD 3NJRA 3UXHA 1SIOA 1DIOB 3L7KA 4QUDA 1Y9JA 5K8LA 2V4RA 3AUFA 1BSVA 3IDZA 5H3LA 3WLIA 4KNYA 2X8JB 2OE2A 4DKXA 1FP4B 1LVGA 2V4UA 5DYNA 5SYAA 3DMHA 2XD4A 3FR8A 3FYUC 1SG9A 2HX1A 5LZ7A 2PBLA 4DJAA 3UB4A 2G25A 1QK4A 4CG1A 1CUDA 2OHIA 3K2EA 4OOEA 1KL7A 1YONA 3GGSA 2Q1TA 3I64A 4JLWA 3F6YA 5ETJA 2J9GA 4WZ6A 1U8UA 4XIGS 4A3GG 3CVUA 3F67A 1HF3A 2W42A 4EFEA 5CXUA 1UBFA 2O7VA 5GZ1A 4PQRA 1HZJA 2FQWA 1T5TA 4EBCA 1BX3A 2ZRLA 4RYLA 1Z18A 1DZ3A 1C4KA 5E2BA 3BUSA 4YXFA 3KWMA 1SQ6A 4I3HA 4QFCA 1Z36A 4URVR 1YS6A 4Z9YA 2QJRA 3JRNA 1SCIA 4RVCA 3ZJVA 3D3QA 1NC1A 5DN6D 4AX8A 1NUPA 4CQNA 3EGDB 4BIIA 2ZCJA 1QIHA 3D8NA 3ODPA 3EMDA 1GEGA 5EYPA 3SLGA 4BWFB 4BASA 2FUEA 4HXYA 1RXEA 3N59A 4KO3S 3GZNB 1FQKA 1Q0QA 4JP1A 3F3MA 4L4SA 5LZ8A 4DSAA 4CKWA 3EY9A 3LX5A 5EJGA 3T4XA 3W2TA 3UY4A 1GRRA 3LUCA 2EBHX 3F4BA 3CRNA 3BRCA 3JVVA 4NY1A 1V9SA 1ZESA 1S02A 1X1TA 1JUDA 4ZAZA 1CJUC 3JZIA 1EUDA 4KQXA 9LDBA 4Z7NB 3UJ9A 3QU9A 2Q2NA 2NN3C 3LLVA 4YYEA 4B6EA 1B6RA 2HWKA 3D3WA 5C46F 1C14A 4ZT5A 4EKIA 4IKOA 4RU9A 2KS6A 3R24A 4TLEA 4E70A 2YQZA 1LX6A 3GJXC 3RRXA 4NONA 1NUTA 2CVOA 4RMIA 2WU0A 5EZYF 1XR3A 3IMFA 4LQDA 1E4VA 3CLUD 3M6UA 521PA 4NJEA 3UM9A 1YQTA 3BRWA 4KKXB 2W71A 3CKYA 4BRWA 1IQ0A 1PIWA 2A9JA 3HB5X 2WYHA 1DVRA 1TM3E 3LUBA 1TK9A 3FJOA 5DBGA 4MWSA 3NW9A 2P4SA 1N5MA 2R6R1 1M8KA 3E3NA 1B0AA 3Q6IA 2IYZA 3PHLA 1VLJA 4MW5A 5JZOA 5JSQA 2ZUEA 3QE3A 4RCZA 3DOIA 4F1JA 5FPOA 1VIMA 4M98A 3L84A 1ULTA 4IIYA 1P1CA 4F8EA 1N75A 1JT9A 1B76A 3RAJA 3L18A 1CQIA 2PT7A 1P62B 1S0UA 4MI1A 3VGJA 1AKNA 4LRQA 5JQWA 1YULA 5FLKA 3B7PA 3KD3A 3VR5D 3H2SA 1G6OA 4K40A 4EMUA 3VC7A 2HQRA 2PL3A 4ED2A 1Q91A 3AR4A 3G8BA 4RV5A 4F6CA 4D41A 1Z2NX 2C9YA 5DHRA 3Q8KA 4F92B 1D6JA 3DQPA 1OBGA 2XHZA 1CUAA 1OY1A 4X24A 4DMLA 4PWZA 2EYUA 1JDEA 4YMGA 2W37A 3ZWOA 3UMFA 4ASUA 2BR4A 1F8GA 1AV7A 2PS0A 1TLLA 4RVSA 5MFZA 1FPQA 3OWOA 4ZEOA 4IJ5A 1JRLA 1UKYA 2B99A 4PFJA 4XYBA 1XKQA 3RRMA 4TLDA 1G19A 2J5KA 3CBQA 4KQ6A 3Q5GA 1KJ9A 1QVWA 3PG5A 4RHCA 4IGFA 3WWHA 4PAWA 3DR3A 2VTKA 4GUAA 4W8HA 3NCTA 2X1LA 2QL6A 1C2TA 4H4EA 4JJZA 1RWKA 3KQSA 2RGAA 4UZEA 5F2OA 4HV4A 1E3WA 1U7PA 3KYHC 2J6IA 2C58A 4UOQA 3PXEA 5LQJA 1KYVA 2ZI7A 3MMXA 3PUVA 2JI6A 2YQ5A 4AK9A 4GRAA 5LNK1 2YKGA 2JFGA 3NVKI 1QE3A 2VF7A 1KJQA 1NXSA 1PNVA 1R4NA 3B85A 2BFEB 2FGKA 4DV0B 2AR0A 1M0WA 4F3KA 2F8LA 6GPBA 2I4OA 4NLLA 1T8SA 3RAQA 1HL7A 3G2PA 4KO4S 3C7AA 5BR1A 1MC1A 2GHQA 5FORA 1DO2A 1GRVA 4QEKA 5G02A 3IB6A 3A2NA 5GONB 4KPFC 4XASA 1B0ZA 3G6WA 5G40A 4RB2C 1ESDA 2CHGA 2FE3A 1T2CA 4E88A 1GO2A 4LTDA 4H08A 3Q10A 5JD4A 2GKOA 2NGRA 1Q16A 3MR2A 1ZI6A 4FZRA 3TRJA 2ZAMA 3PNBA 2ECPA 3DEJA 1VL6A 5G4LA 4RY0A 2VNSA 1E9FA 1Q3TA 1TZMA 3IT1A 1WB4A 4UNQA 1NV9A 2HLHA 2M1ZA 3C1OA 4NXMB 4Q9LA 4EGCB 4GD3Q 1FPMA 5D2CA 3IE1A 3IJEB 1UBNA 1L7QA 3HB7A 4HYEA 5B1EA 1Z2CA 4IAJA 1CHNA 5KFLA 2NO1A 2Q2VA 5EIOA 2D7JA 4TWIA 3AERA 3GLRA 1IFXA 4D8VA 4GG1A 1BO6A 2OZKA 5CYGA 4HUJA 1Z2AA 5AP9A 1HNWB 1SXJE 2PS9A 1XPRA 3BT7A 3CU5A 3KBBA 2C96A 1OV6A 1QFZA 1YE8A 4L8GA 4P3XA 5BMOA 1AA6A 1NBAA 1RNLA 3OPMA 1IY9A 1DJOA 4Q00A 3I4MG 2CJWB 4ACAA 5D7NA 2ZXEA 4M8NE 3H6KA 1IM5A 2EFYA 3ROEA 3JPWA 4QG3A 4MXDA 3JZDA 4IHJA 4K6HA 4D3XA 4DV5H 2H1IA 3I9JA 1IQRA 4JL6A 4OU4A 2J9XB 3C3EA 3IE2A 4RD1A 1KZ6A 3MMZA 1LBSA 3WRYC 1NW9B 3HB4X 3M1YA 5IWCA 2Q4TA 4I9UA 1J70A 4H7DA 2F7SA 4A3KG 3ADPA 3G7NA 1GPDG 2M6KA 1TW2A 3U4HA 1B8NA 4ZVNA 3E9ZA 4GKVA 2Y4OA 4JL5A 5T57A 4ALJA 4COKA 5JZSA 2CFOA 4ZP1A 1M2VA 4FXPA 3O2SB 1I4EB 1UXIA 3HXPA 4QKQA 3H2ZA 5FO0A 2I8CA 5KFRA 3ZLJA 3MPUA 4G4IA 4NZNA 3SXUB 4UCVA 1YKGA 4FR5A 1DQRA 4YC7A 2GK6A 4YRQA 3ZYZA 5IMSA 4PZUA 4PPQA 1K6JA 3OAAD 1RRGA 3K9NA 3BMQA 4M4SA 4E4RA 2OZLA 5HKAA 1WZEA 3NTVA 4QOHA 4RAQA 4CEJA 1NBEA 3NANA 4CKEA 3LQQA 4NCJA 3ZQJA 5LR6A 1PO7A 3D6VA 4OQYA 1N8SA 3LHSA 2HY7A 5ANRB 1GCOA 3J80A 1V5WA 4UM9B 3LC7O 2YYAA 5CCXA 2ZIWB 1ZVKA 1VCOA 1HR0H 2EZ9A 3DYIA 3IR6A 4YRLA 5TPWB 3SLRA 1TYAE 4CM4A 5IK2D 4QHSA 1MZPA 2CZQA 4DLUA 4BUJA 1PDWA 3DMGA 3BL5A 1DBPA 3QE4A 4QDOA 3U7GA 4EJSC 3OLCX 2QXUA 1E0AA 1QCDA 2W6MA 3WXBA 2WE7A 2JLQA 5HFAA 4PLGA 5BNWA 3ROPA 3I32A 3WHIA 3LHDA 4AZ3B 2FWMX 3Q3CA 1N7GA 1NNEA 1RPAA 2ZG6A 3P71T 4TVKA 1NXPA 3D64A 4P80A 4HVCA 1G6HA 2QP4A 2YFKA 1DLJA 5G4KA 1NASA 3M1IA 5FI5A 4FGJA 3O8QA 3U13A 1I1HA 4OFWA 4ZO7A 4A2QA 2QJWA 4WERA 4XX0A 1FXWA 4QTXA 3V6JA 2XYRA 3TSYA 3LG2A 5FD6A 1HFJA 3G2KA 2EJ0A 3NGLA 1A9YA 1JHDA 1ML3A 4ND4A 3SQLA 1IOVA 1X42A 3KEFA 3FETA 3DDWA 3GRZA 2G1JA 1SN7A 1LI7A 3FBWA 5ALSA 1E2MA 1JAYA 3TQSA 3PDHA 1ZIDA 1B04A 3L7DA 3NHJA 4BMNA 2DFPA 1YDMA 3H13A 3O83A 3UMBA 1EX6A 1WXEA 2IYLD 1SYXB 2XT9A 3EMVA 1OYVA 1GL9B 2F2TA 3C6QA 3M33A 2ZJZA 4OL0A 1L7VC 3C5VA 3IVCA 4XTRA 1KP9A 1P74A 2GXUA 3H9BA 4JMPA 4ABTA 1WB5A 3GQCA 2O2JA 5DRYA 1N8TA 3BXFA 3KPUA 1KS2A 2AJLI 3USZA 3RC9A 4DCOA 3JATB 1QU3A 1ZI9A 3W6ZA 1EWRA 1XTBA 4Q82A 4LPKA 3AGPA 3RFTA 2A35A 4RJKA 5IDWA 5LSAA 1YS2X 4P34A 5EMJA 2QR3A 3KOYA 2WPDA 3SJAA 1HY3A 2X8BA 3AJ9A 3BGDA 5F2KA 1PT8A 1Z7BA 3KSAC 4UCOA 3NHBA 4ARUA 1EUQA 1KI9A 2ATLA 1O4VA 2GDZA 3IEPA 3V4OA 1M0SA 1LPAB 2HA0A 5EKDA 3AF1A 3FFBA 4C20A 5JTUA 1VL5A 1I3KA 1SBQA 1S7GA 1VLQA 2UZ3A 3EZYA 5EOYA 2RDJA 1FY2A 2XZDA 2V54A 4DIOA 3DHWC 4JLKA 1UZNA 5IKEA 4JI8B 5FADA 1T5DX 2E4WA 3L8DA 4PZ8A 1M33A 1ESMA 3MBOA 2PKYX 4NYIQ 2FWIA 1F17A 1RYEA 5DLFA 3T0FA 2WFLB 2Y0SA 3VKVA 1FA9A 4CCYA 4QGBA 4UBIA 2GNOA 1E0SA 3PQCA 4YXWA 5L3QA 4LXIA 3STXA 2HJGA 2J0VA 1XZIA 4Q16A 5BYJA 4BNDA 1V71A 2O8EA 2CB0A 3M81A 4QJIA 5FPHA 3R3WA 4BNGA 4JN6B 5K0GA 1I1KA 1FQOA 2I4RA 5TGZA 2W43A 1VCIA 4R7GA 2Y0DA 1QV9A 2J4FA 3CONA 4DE5A 2HV8A 5DQGA 1Q15A 4KQKA 4DR2H 4MQ4A 1Y8QA 3L8CA 1KPIA 2C2OA 1Y4SA 2ET6A 1M0TA 5KFTA 2J0SA 1QK3A 2P0AA 4Q8FA 3H8WA 2GHIA 3R7FA 2JGLA 1AK9A 5I7FA 4UU8A 3C8DA 4RKRA 1AZWA 4RPLA 2RKBA 3PC7A 3SZLA 2NYVA 1CFJA 3ILXA 4DBZA 4IR7A 4I9GA 2CCKA 3JYNA 4PYIA 1N7JA 5E4TA 9LDTA 4NL4H 3H5RA 3PGJA 2R6HA 1FUYB 3ME5A 2J0QA 1M6HA 2IEGA 2V96A 3J7AK 1E9DA 2WIKA 3RU9A 4BPRA 1OREA 2HMTA 3LF1A 5H9VA 4D5GA 1MAWA 4OTZA 2VWHA 1DTWA 2W2KB 1DIAA 1ESCA 3JQ6A 4JBLA 2W70A 1VIYA 3KQTA 1KEEA 3FPFA 3QKUA 2W98A 2D4AA 2OTCA 2ZUSA 5EXTA 3TIFA 1GQRA 1C8VB 1DAIA 1Z7YA 1GKUB 2EX0A 1M6NA 2ZAOA 3O8BA 5JBQA 1CY6A 3PS9A 3L79A 5JY1A 4IO1A 2A88A 3ZBUA 2X1VA 2AQIA 3PX3A 1P5ZB 3HYTA 2ZYGA 1YK1A 1BGXT 4IDOA 4OG2A 4YXWD 5A05A 1R0CA 1XP8A 2HO5A 2Y0CA 1HRDA 5HVNA 5LQMA 2CWWA 5JZVA 4BWSC 1J2TA 2RHCA 2G9UA 4O08A 4A3SA 5AW8A 5M34A 1PFGA 3KLPX 2XMCA 5BPFA 3VPGA 3ZW9A 3PLRA 4QPNA 4GGMX 3ZCTA 3VR2D 1JU3A 2EIHA 1DIGA 2VH5R 4G0PA 4I1UA 4DYDA 3H75A 1ZI8A 4KHPB 1T9AA 3GUYA 4JT4A 5FI0B 4ZJUA 3NTXA 3X1KA 1T6BY 1Y4DE 4YP9A 4DBVO 2QMEA 2F1JA 3BD9A 4KGXA 3UQ8A 3OY7A 3HXQA 1N7IA 1NJ1A 2A1UA 3KQWA 3MIZA 2BR5A 2R4UA 3K32A 3M6FA 4N1AA 5KWVA 1OB2A 4E94A 1G2WA 3C3YA 3QFSA 2ZIXA 3O8DA 4LDPA 3T5PA 1EE1A 2YC4C 2I2DA 3W8RA 1IXKA 1SAYA 2XODA 2ZM5A 4PBRA 1VKRA 3V8VA 1S01A 5THQA 3VU9B 3RBEA 1UJBA 5KFQA 1Q0HA 1UPTA 5T3UA 4DA6A 2JCYA 3ZV5A 4LOIA 4ED0A 3UH1A 2FVYA 2P4EA 4UBJA 2XUHA 1A2OA 3M1AA 1V37A 4U2GA 1DCTA 2BR3A 2JZCA 4LF6H 2G9ZA 3IILA 4MGIR 3T5DA 1YK0A 1WBJB 1C81A 2ZE7A 4WFQA 4QBIA 4D9BA 5KPDA 4E11A 4BN0A 3PFCA 3UCFA 2IITA 2XH8A 2ZBDA 4HB3A 3DXYA 4NJMA 1EX1A 1SKBA 4YB8B 1U9JA 4EG4A 4B3JA 2FK1A 1PCXA 1SIUA 3I0NA 3TVDA 2WFLA 4CM6A 1RXWA 5IAGA 3OE4A 3RS5A 5IWAH 1PJTA 4BLPA 2WHPB 5HJ5A 3BA9A 5KYNA 3VKGA 3ZE1B 1A8QA 1UBTS 1WDMA 3NUGA 4O0LA 1P1IA 1F2DA 4J03A 4P5EA 3FZNA 4YRJA 2V5AA 3OWHA 1NG1A 4O4IA 3SJBA 3ZQUA 2D54A 4EKYA 3LFTA 1QZUA 1PNTA 1XC7A 3EXAA 4IRUB 2A9KA 3RVMA 3U81A 3V4PB 4XFJA 4OL9A 4V38A 2BYTA 5L4SA 1JTFA 3TKAA 3LMLA 3SE7A 3ONWA 2OBNA 1ZMTA 3RSZA 2GD6A 5WRFA 3EZGA 1ZIXA 3N7UA 2JCGA 2GSWA 2JGNA 1J4AA 1F4PA 2GWRA 1JXMA 2VCYA 2WUFA 1P3Y1 1UMDA 4GW3A 3ACBA 3DDZX 4UEKA 2H1LA 1F38A 1NVXQ 3EEQA 2AN4A 1W5FA 3SXJA 4OK3A 2GJ4A 4GPZA 4GPEA 2C8VA 4OMUA 1JQEA 1SBNE 1ZA1A 4ECQA 3WKEA 5FOSA 1KMHA 1ISJA 5DWDA 4G0XA 5CLQA 2PE5A 5DKFA 1U0GA 3PV0A 4TS9A 3UNXA 1GLVA 1RM4A 2JFQA 2O06A 2ZJAA 4M89A 5LLDA 4QASA 4QM7A 1MKYA 4QUKA 1U94A 2FV8A 1VGVA 4I1PA 4WDQA 1BWQA 1SULA 1XTUA 4O4LF 3RTXA 1HQDA 2C99A 3KSZO 3QX9A 4OAPA 5DTRA 4X62B 2ZLBA 2WU3A 4TZ6A 5JCOA 1HE3A 3USES 1Y1LA 1M9NA 4CL2A 4IUDS 1R6AA 1R7RA 4EB6A 4I5FA 1X2BA 1OKKD 1U5BB 5DG7A 1UBUS 3C5HA 3DW3X 4EIWA 2J3JA 4WGGA 5BSRA 2NVUA 4MS3A 1EGHA 2XCIA 3KUDA 3L9WA 5DI3B 4ED7A 3N2IA 4IIJF 2V65A 1P4GA 1RMYA 2WJ3A 2HCTA 5I5VA 1SFRA 3ESZA 2Q4DA 1P9WA 3EARA 3EUEA 2VATA 3D6NB 4DUGA 2G83A 4FFWA 5KVAA 4UNNA 3A1TA 1VPDA 5DBIA 3KM0A 5C3EG 1PTJA 2GUGA 1I5EA 2YXLA 3C3KA 3STUA 5HIKA 3EQ2A 4DUYH 1PFQA 3S2EA 2CLSA 4F50A 1RD4A 3ZH2A 2P5SA 4GLLA 1D03A 1FRNA 2Q29A 4HG2A 2ZUUA 3WGLA 3JRXA 3UOAB 3UPDA 1XA3A 2YN4A 3S2FA 5IULC 3DDHA 4KV9A 5FJ8G 2IZ1A 4B3MH 4KMSA 1FNNA 5BWCA 4O4IF 1C9JA 3RH0A 1H05A 1ISRA 2PSSA 4IG4A 2FWJA 2PYZA 1T8UA 4HDCA 2GCPA 2Y68A 3P0RA 1TADA 4IZHA 1UEJA 3ZUGA 4UHEA 3M9OB 3BXXA 4QL3A 5ITWA 3DT9A 3U7RA 4N3BA 3LT0A 4DWVA 3GYBA 2NM0A 1U0BB 3PZPA 1QLHA 1V48A 4IRDA 1VHWA 2PS3A 3GJXB 2J32A 2WSYB 2X5JO 3C5CA 1Q20A 4RMHA 4TPKA 2A4KA 4I36A 3TLXA 1YDWA 2JFVA 1IZZA 5KDLA 3F6CA 5FPKA 4DIUA 4MQLA 1I2DA 2ONZA 4ZQBA 1SXJD 4MA5A 1DC5A 3KT0A 1A2BA 3UH0A 2QIOA 6NULA 4WINA 1IUPA 1MO6A 4MQMA 3FSGD 5FV7A 3PHIA 3R6TA 2O8FB 3R3HA 2FRDC 1TQ4A 2AUMA 3C1TA 3NHRA 1NX9A 1S6YA 2VHJA 1CPYA 1JAZA 3GCZA 4G0ZA 3ZCRA 1TTPB 2FHSA 2QLTA 4PX5A 4BNTA 4CG2A 4KMMA 3N8DA 3T7IA 3QWIA 3LUGA 4M2LA 1RLIA 1GQSA 1HQYE 1XZLA 1PJ3A 1R0KA 3F7OA 1G2QA 1HM5A 1PYOA 2PLRA 2QRZA 2OCLA 3D6MA 2OCPA 4EB6B 1NHGA 1KAQA 2ZB8A 3DM9B 4LRXA 3W5BA 3HP7A 1RFLA 3FD8A 3QA3E 3R6WA 4FCVA 1DXQA 5FAXA 5KTYA 1XA0A 2B1JA 2I3BA 2WIAA 3A06A 1CKOA 4GLXA 2Y71A 4QLBA 3LTNC 4RB3C 2XRZA 1M5RA 1LFDB 2PKEA 5EHXA 1Z9BA 2QRPA 1L5MA 1E77A 2P9EA 4BC1A 5CDHA 2IQIA 5C8DA 5CCBA 1M2GA 4FSHA 1PD1A 5JH7B 1JIIA 3I1YA 2ZAYA 4M7RA 5JS6A 4IIXA 5IPFA 4ZRNA 4KFSA 5DCUA 3SHWA 4D80A 4LFBB 2QLJA 1EFDN 1FMCA 3HA5A 5E8JA 3KB6A 1B26A 3LYHA 3OQIA 2Q5QA 1XHEA 3BG5A 1P4AA 3AFMA 3ZD8A 1AXGA 3WO1A 1L4EA 1CZHA 4JEMA 5JG7A 5KKCA 1ZR2A 1J5PA 1RCUA 3O9VA 3SC2B 2W11A 3CUTA 3FCEA 5LMNH 2AXNA 4MV0A 5EKTA 3STTA 4D6XA 3KKMA 4OUDB 1XTKA 1TZ2A 4H15A 1EVYA 2B63A 1N1MA 1KBOA 4OFZA 1R2QA 4MW6A 3IKTA 3HYNA 3PC8C 1ZP6A 3VOTA 1JDNA 2X2EA 4BBSG 5LYJA 4RDCA 1GTZA 4YQFA 4JI2B 2O3SA 3V7NA 4LOLA 3G2QA 5LN1A 5K9ZA 1T5SA 1V35A 3EGWA 2ID7A 4OQXA 2COEA 2O1WA 4MI6A 5KTNA 3GLFE 2XSZA 2ASLA 1NBHA 2D1RA 1OTHA 1ZH6A 2F1KA 1NONA 1QRDA 2QGNA 3TIVA 1D09A 1MGPA 3IP1A 2FSIA 2I7XA 2B0JA 2QRUA 2OD7A 3CCBA 3JSNA 1FS6A 3GCWA 5B3KA 3BXGA 5TEWA 3WLNA 1J9GA 2ZIAA 2QYHA 1E79A 4C03A 5B57C 4IJ6A 2AOXA 1NU6A 2J0EA 3L1KA 4IX9A 4QU8A 4MH0R 3U80A 3T3OA 1HO3A 2IDKA 3OZBA 1TGYA 3Q7PA 1HDRA 3ZX5A 1FNMA 4DYVA 2C8LA 1I2LA 4MPTA 5KYVA 5IABA 1R5OA 5KDOA 1M8GA 3VNRA 5IVHA 1R12A 3MT8A 3VR6A 4C1BA 3CV3A 1NVDA 4OQZA 5CK4A 3RVKA 5JWHA 5HF6A 4PFSA 4C0SA 5HXAA 1Y3FE 1ESEA 2QRGA 3FOFC 3GLIB 2J9FA 1IJEA 1JIUA 4OD0A 1CUWA 4F4ZA 4DIDA 1LZKA 4D4MA 3T9BA 2QN9A 4QREA