1M16A

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and leu 44 replaced with phe (l44f), leu 73 replaced with val (l73v), val 109 replaced with leu (v109l) and cys 117 replaced with val (c117v).
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
b'HHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLVYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFLGLKKNGSVKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acidic fibroblast growth factor
publication title Accommodation of a highly symmetric core within a symmetric protein superfold
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 35
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1m16A00
3CRGA 4OWLA 1RY7A 3V0AA 3OBTA 3BAOA 1M2TB 3BA7A 4A7YA 1FN0A 2FFVA 2Y9XE 4ZOTA 3O4BA 1S0FA 21BIA 3FJFA 3ZXGA 1W3FA 4KEJA 4IONA 2D1ZA 1XHBA 3BAQA 3UJ0A 1FMZA 4GP0A 1S0DA 1Z2VA 1AF9A 1G9DA 4I37A 5GAQA 3NBDA 3PG0A 4QKRA 2YUGA 3AJ6A 4JP0A 3RMYA 5BXPA 2J3PA 5BP5C 4J23B 4WBCA 4JQ0A 5B2HA 2RSTA 1JTCA 3E8LC 3I29B 4I1EA 1JLYA 3BA5A 3O5WB 4AN6A 3P53A 4JKQA 2K8RA 1YXWA 2VLCA 1DZDA 1Q04A 3ZC9A 4LO0A 4OW4A 1IHKA 4EB2B 4EEEB 4HA2A 3CA4A 1DFCA 2VXRA 4I4YA 2RG9B 3BAUA 2HZ9A 8I1BA 4FGFA 2F2FA 4D0TA 4G9MA 3ZX7A 3CA3A 4LO2A 4IZEA 3T8SA 3AH1A 1JT7A 3AZWA 2Q3NB 3IM7A 1BASA 3WMUA 4G9NA 3UD9A 3NBNA 1ONKB 3N0KA 1AVWB 4IYBA 3WO2A 2LIEA 1JLXA 3FJAA 5DVHA 3S8JA 4PC4A 3WINC 5FZYA 3BA4A 1HWMB 1TP0A 3A21A 4I0YA 3O4DA 3AKGA 1UPSA 1FGAA 1DJSB 3RTIB 4Q9GA 3H6RB 4JKXB 2D44A 3BTAA 5D61A 4OEEA 2HWAA 3FUQA 2AXMA 4IQPA 2WRYA 4DCKC 4QD2B 2D23A 2ZQOA 1IILA 1R8NA 3BRFA 1G9CA 4XKIA 1MC9A 2IHOA 1SR4C 2VSAA 1S0BA 2DS0A 2UUSA 3BX1C 1Z4SA 5DUYA 3NBEA 5BXSA 2AAIB 3HBWA 2P39A 3POKA 4TLPA 4H9WA 4P0KA 3AZVA 4GAFA 2F8XC 3BAVA 2GZBA 4HR6C 3N7JA 1F31A 1QQKA 4I4OA 5BP5A 1JQZA 3FGMA 3VUOA 4X3AA 2Q9XA 2NZ9A 3FJHA 1BA7A 3S8KA 5FZZA 4P0JA 31BIA 1IRPA 1IRAX 5D63A 2NTDA 1AVUA 2X2SA 1BFCA 5DSSB 1HIBA 3F1RA 1AVAC 9ILBA 4QBCA 4LO7B 5BVPI 1BLAA 4YOLA 4ENDA 1I1BA 2ET2A 4Z9WB 1T4QA 4G6JA 4I2SA 3CRHA 2E4MC 3BADA 1I1EA 3CQAA 4ZFYB 1ILR1 4QO3A 2P23A 3UD7A 7I1BA 1FMMS 2LIQA 2MLLB 3V79C 1BFGA 3BAHA 1JT4A 1JY0A 2D20A 1ABRB 1JT5A 3IM5A 1YYNA 1PZZA 1HWOB 1L2HA 4LO3C 3LTQA 5G00A 3AJ5A 4G1RA 1EV2A 3WINA 4ZLBB 4OUJA 1IJTA 3AKIA 3A07A 1XYFA 4OWKA 3JRRA 2HWMA 3BB2A 1CVSA 4LO8B 1Q1UA 1TOOA 3B9UA 3O44A 1NUNA 3ILAA 3ZC8A 2KI6B 5DZUA 5BXTA 5BQUC 3FJEA 3V0BA 3BAGA 4I3NA 3IM6A 3I2AA 3VSZA 1G9AA 4CJMA 4Z8SB 2XOAA 3H6QA 3OJ2A 4OEFA 4J2YA 1TWMA 3CRIA 2VU9A 3N7LA 4GOYA 3VSFA 3AKFA 1FWVA 4Q9PA 2NVHA 5FNXA 4F34A 1T9FA 1FV2A 5HPZA 1NZKA 4QD2C 3PHZA 4IHZA 4ZA3B 1V6VA 1IT0A 2ESUA 2QYIB 4I4VA 3C9ZA 1HWPB 2FFUA 4XFTA 1V6WA 2KLLA 1DIWA 3FJJA 1S0GA 4IY8A 1PUMB 4KBBA 5F8SA 3HN1A 2ZR1B 3FJBA 3AH4A 3PMEA 5EC5A 1EVTA 2NP0A 1E0OA 1BFBA 3O49A 4ZFWB 1KNMA 5F8YA 6I1BA 3OGGA 3V0AB 1W3GA 4USPA 2E4MA 3OJVA 3R4UA 3FFZA 2X2TA 1II4A 3O3QA 3WA1A 1PC8B 3NJ5A 4USOA 4KEKA 3UJ4A 4J2SA 3UD8A 1D0HA 4I4UA 4EFPA 3A23A 2Z48A 2NYYA 3QYDA 1DFQA 1RMLA 1V6UA 1BARA 1WBAA 3VWCA 1K5UA 4I1BA 2BEBA 1W3AA 4LO7C 3PUBA 3MALA 3HOMA 4EFRA 1HKNA 4LO3A 4D0ZA 2HW9A 3I2XA 1N4KA 3EF2A 1FWUA 5JLVA 1EYLA 4OWJA 3W9TA 3HSMA 2I1BA 5F8WA 2D22A 5BOWA 1A8DA 1GGPB 1FQ9A 1S0EA 2KKIA 1QXMA 3IIRA 1WBCA 4I4RA 3N7MA 2L5XA 4JAWA 2D24A 2FGFA 4I4PA 1G82A 4I7IA 5BQUA 3IAGC 1ISYA 2VUAA 4D8HA 3O4AA 3FJ9A 3V0BB 4HJJA 2VXTI 1V6XA 2IWTB 2MIBA 4I4XA 1DLLA 1DZCA 3H6RA 4ZBVB 1YF8B 3KMVA 3R4SA 3SNVA 3UDAA 1XZZA 1SZ6B 1R8OA 2ZQNA 1RG8A 1DQGA 3QR5A 3FJ8A 2R9KB 3N7KA 1QQLA 4I4QA 1TIEA 41BIA 3BRDA 3O4CA 4P6AA 5EG6C 3WMVA 2K43A 3HALA 3F62B 2AFGA 4DENA 4ZGRB 4GP3A 4R6UB 4JRAA 2M49A 1JT3A 4J2KA 3VT2A 1PWAA 3RMXA 1P63A 3RTJB 4LO1C 4QKSA 1ISVA 4EFQA 3AH2A 2KH2A 1VCLA 1YTOA 3AKHA 1XG6A 4L4IA 1SR4A 3RSJA 1Q03A 5EHAA 4J2XA 1S0LA 3FJCA 4ZKTB 3CA0A 1RZOB 3ZXDA 4G6MA 4ISRA 1M16A 1IOBA 1K5VA 4Q91A 3HMYA 3MPPG 3WO3A 2BEAA 1BFFA 1HCDA 1FV3A 3D7WB 4XFUA 2VSEA 2QN4A 2KI4A 4ZFUB 3Q7YA 3OBRA 4I6IA 2ERMA 1S0CA 3FUOA 3O4OA 4EKXB 3LLPA 4AN7B 2D7RA 1MD6A 1WD3A 3BRGC 4DEPA 3H6SE 2Y9FA 5E24E 3JUTA 2DREA 4I8MA 3Q7WA 4X39A 2RQ9A 4KEIA 4JPZA 3Q7XA 1TWEA 4GOVA 4ISQA 4X37A 1YBIA 3K1XA 3FJKA 1AFCA 5D62A 4XFSA 4GAIA 4QC4A 3TC2A 1EPWA 4L4HA 3CU1B 4OEGA 4I96A 3OJMA 4FVVA 2DRYA 1HCEA 4X38A 3OGFA 4II0A 2K4AB 5JMCA 4H04A 1J0SA 1Z0HA 4IZXA 3CA1A 2WBCA 3VT0A 4I4SA 2AQZA 1ISZA 3CA5A 1ISWA 2D7IA 1OQLB 4LO0C 3CA6A 3CAHA 1AXMA 3WO4A 3NBCA 2D43A 3P6JA 5FZUA 4KC3A 3FJDA 3VEQA 3P6IA 1HWNB 2GO2A 3A22A 2F2FC 1DQOA 5I1BA 2Z49A 2FDBM 4QBVA 4LO2C 2MC2A 1TFMB 5FNWA 2NM1A 4LO1A 4QALA 4A7ZA 4A7KA 1BLDA 1WD4A 2BFHA 2Y9WC 1AVXB 1CE7B 2FO1A 1G9BA 4F83A 1ISXA 3FJIA 1ITBA 4P0LA 4IY9A 1PUUB 3VT1A 2DRZA 1TTUA 2Y9GA 5BXRA 5F90A
chains in the Genus database with same CATH superfamily
3CRGA 4OWLA 1RY7A 3V0AA 3OBTA 3BAOA 1M2TB 3BA7A 4A7YA 1FN0A 2FFVA 2Y9XE 4ZOTA 3O4BA 1S0FA 21BIA 3FJFA 3ZXGA 1W3FA 4KEJA 4IONA 2D1ZA 1XHBA 3BAQA 3UJ0A 1FMZA 4GP0A 1S0DA 1Z2VA 4MZFB 1AF9A 1G9DA 4I37A 5GAQA 3NBDA 3PG0A 4QKRA 2YUGA 3AJ6A 4JP0A 3RMYA 5BXPA 2J3PA 5BP5C 4J23B 4WBCA 4JQ0A 5B2HA 2RSTA 1JTCA 3E8LC 3I29B 4I1EA 1JLYA 3BA5A 3O5WB 4AN6A 3P53A 4JKQA 2K8RA 1YXWA 2VLCA 1DZDA 1Q04A 3ZC9A 4LO0A 4OW4A 1IHKA 4EB2B 4EEEB 4HA2A 3CA4A 1DFCA 2VXRA 4I4YA 2RG9B 3BAUA 2HZ9A 8I1BA 4FGFA 2F2FA 4D0TA 4G9MA 3ZX7A 3CA3A 4LO2A 4IZEA 3T8SA 3AH1A 1JT7A 3AZWA 2Q3NB 3IM7A 1BASA 3WMUA 4G9NA 3UD9A 3NBNA 1ONKB 3N0KA 1AVWB 4IYBA 3WO2A 2LIEA 1JLXA 3FJAA 5DVHA 3S8JA 4PC4A 3WINC 5FZYA 3BA4A 1HWMB 1TP0A 3A21A 4I0YA 3O4DA 3AKGA 1UPSA 1FGAA 1DJSB 3RTIB 4Q9GA 3H6RB 4JKXB 2D44A 3BTAA 5D61A 4OEEA 2HWAA 3FUQA 2AXMA 4IQPA 2WRYA 4DCKC 4QD2B 2D23A 2ZQOA 1IILA 1R8NA 3BRFA 1G9CA 4XKIA 1MC9A 2IHOA 1SR4C 2VSAA 1S0BA 2DS0A 2UUSA 3BX1C 1Z4SA 5DUYA 3NBEA 5BXSA 4MZHA 2AAIB 3HBWA 2P39A 3POKA 4TLPA 4H9WA 4P0KA 3AZVA 4GAFA 2F8XC 3BAVA 2GZBA 4HR6C 3N7JA 1F31A 1QQKA 4I4OA 5BP5A 1JQZA 3FGMA 3VUOA 4X3AA 2Q9XA 2NZ9A 3FJHA 1BA7A 3S8KA 5FZZA 4P0JA 31BIA 1IRPA 1IRAX 5D63A 2NTDA 1AVUA 2X2SA 1BFCA 5DSSB 1HIBA 3F1RA 1AVAC 9ILBA 4QBCA 4LO7B 5BVPI 1BLAA 4YOLA 4ENDA 1I1BA 2ET2A 4Z9WB 1T4QA 4G6JA 4I2SA 3CRHA 2E4MC 3BADA 1I1EA 3CQAA 4ZFYB 1ILR1 4QO3A 4H75A 2P23A 3UD7A 7I1BA 1FMMS 2LIQA 2MLLB 3V79C 1BFGA 3BAHA 1JT4A 1JY0A 2D20A 1ABRB 1JT5A 3IM5A 1YYNA 1PZZA 1HWOB 1L2HA 4LO3C 3LTQA 5G00A 3AJ5A 4G1RA 1EV2A 3WINA 4ZLBB 4OUJA 1IJTA 3AKIA 3A07A 1XYFA 4OWKA 3JRRA 2HWMA 3BB2A 1CVSA 4LO8B 1Q1UA 1TOOA 3B9UA 3O44A 1NUNA 3ILAA 3ZC8A 2KI6B 5DZUA 5BXTA 5BQUC 3FJEA 3V0BA 3BAGA 4I3NA 3IM6A 3I2AA 3VSZA 1G9AA 4CJMA 4Z8SB 2XOAA 3H6QA 3OJ2A 4OEFA 4J2YA 1TWMA 3CRIA 2VU9A 3N7LA 4GOYA 3VSFA 3AKFA 1FWVA 4Q9PA 2NVHA 5FNXA 4F34A 1T9FA 1FV2A 5HPZA 1NZKA 4QD2C 3PHZA 4IHZA 4ZA3B 1V6VA 1IT0A 2ESUA 2QYIB 4I4VA 3C9ZA 1HWPB 2FFUA 4XFTA 1V6WA 2KLLA 1DIWA 3FJJA 1S0GA 4IY8A 1PUMB 4KBBA 4UY4A 5F8SA 3HN1A 2ZR1B 3FJBA 3AH4A 3PMEA 5EC5A 1EVTA 2NP0A 1E0OA 1BFBA 3O49A 4ZFWB 1KNMA 5F8YA 6I1BA 3OGGA 3V0AB 1W3GA 4USPA 2E4MA 3OJVA 3R4UA 3FFZA 2X2TA 1II4A 3O3QA 3WA1A 1PC8B 3NJ5A 4USOA 4KEKA 3UJ4A 4J2SA 3UD8A 1D0HA 4I4UA 4EFPA 3A23A 2Z48A 2NYYA 3QYDA 1DFQA 1RMLA 1V6UA 1BARA 1WBAA 3VWCA 1K5UA 4I1BA 2BEBA 1W3AA 4LO7C 3PUBA 3MALA 3HOMA 4EFRA 1HKNA 4LO3A 4D0ZA 2HW9A 3I2XA 1N4KA 3EF2A 1FWUA 5JLVA 2NS2A 1EYLA 4OWJA 3W9TA 3HSMA 2I1BA 5F8WA 2D22A 5BOWA 1A8DA 1GGPB 1FQ9A 1S0EA 2KKIA 1QXMA 3IIRA 1WBCA 4I4RA 3N7MA 2L5XA 4JAWA 2D24A 2FGFA 4I4PA 1G82A 4I7IA 5BQUA 3IAGC 1ISYA 2VUAA 4D8HA 3O4AA 3FJ9A 3V0BB 4HJJA 2VXTI 1V6XA 2IWTB 2MIBA 4I4XA 1DLLA 1DZCA 3H6RA 4ZBVB 1YF8B 3KMVA 3R4SA 3SNVA 3UDAA 1XZZA 1SZ6B 1R8OA 2ZQNA 1RG8A 1DQGA 3QR5A 3FJ8A 2R9KB 3N7KA 1QQLA 4I4QA 1TIEA 41BIA 3BRDA 3O4CA 4P6AA 5EG6C 3WMVA 2K43A 3HALA 3F62B 2AFGA 4DENA 4ZGRB 4GP3A 4R6UB 4JRAA 2M49A 1JT3A 4J2KA 3VT2A 1PWAA 3RMXA 1P63A 3RTJB 4LO1C 4QKSA 1ISVA 4EFQA 3AH2A 2KH2A 1VCLA 1YTOA 3AKHA 1XG6A 4L4IA 1SR4A 3RSJA 1Q03A 5EHAA 4J2XA 1S0LA 3FJCA 4ZKTB 3CA0A 1RZOB 3ZXDA 4G6MA 4ISRA 1M16A 1IOBA 1K5VA 4Q91A 3HMYA 3MPPG 3WO3A 2BEAA 1BFFA 1HCDA 1FV3A 3D7WB 4XFUA 2VSEA 2QN4A 2KI4A 4ZFUB 4MZGB 3Q7YA 3OBRA 4I6IA 2ERMA 1S0CA 3FUOA 3O4OA 4EKXB 3LLPA 4AN7B 2D7RA 1MD6A 1WD3A 3BRGC 4DEPA 3H6SE 2Y9FA 5E24E 3JUTA 2DREA 4I8MA 3Q7WA 4X39A 2RQ9A 4KEIA 4JPZA 3Q7XA 1TWEA 4GOVA 4ISQA 4X37A 1YBIA 3K1XA 3FJKA 1AFCA 5D62A 4XFSA 4GAIA 4QC4A 3TC2A 1EPWA 4L4HA 3CU1B 4OEGA 4I96A 3OJMA 4FVVA 2DRYA 1HCEA 4X38A 3OGFA 4II0A 2K4AB 5JMCA 4H04A 1J0SA 1Z0HA 4IZXA 3CA1A 2WBCA 3VT0A 4I4SA 2AQZA 1ISZA 3CA5A 1ISWA 2D7IA 1OQLB 4LO0C 3CA6A 3CAHA 1AXMA 3WO4A 3NBCA 2D43A 3P6JA 5FZUA 4KC3A 3FJDA 3VEQA 3P6IA 1HWNB 2GO2A 3A22A 2F2FC 1DQOA 5I1BA 2Z49A 2FDBM 4QBVA 4LO2C 2MC2A 1TFMB 5FNWA 2NM1A 4LO1A 4QALA 4A7ZA 4A7KA 1BLDA 1WD4A 2BFHA 2Y9WC 1AVXB 1CE7B 2FO1A 1G9BA 4F83A 1ISXA 3FJIA 1ITBA 4P0LA 4IY9A 1PUUB 3VT1A 2DRZA 1TTUA 2Y9GA 5BXRA 5F90A
chains in the Genus database with same CATH topology
3CRGA 4OWLA 1RY7A 3V0AA 3OBTA 3BAOA 1M2TB 3BA7A 4A7YA 1FN0A 2FFVA 2Y9XE 4ZOTA 3O4BA 1S0FA 21BIA 3FJFA 3ZXGA 1W3FA 4KEJA 4IONA 2D1ZA 1XHBA 3BAQA 3UJ0A 1FMZA 4GP0A 1S0DA 1Z2VA 4MZFB 1AF9A 1G9DA 4I37A 5GAQA 3NBDA 3PG0A 4QKRA 2YUGA 3AJ6A 4JP0A 3RMYA 5BXPA 2J3PA 5BP5C 4J23B 4WBCA 4JQ0A 5B2HA 2RSTA 1JTCA 3E8LC 3I29B 4I1EA 1JLYA 3BA5A 3O5WB 4AN6A 3P53A 4JKQA 2K8RA 1YXWA 2VLCA 1DZDA 1Q04A 3ZC9A 4LO0A 4OW4A 1IHKA 4EB2B 4EEEB 4HA2A 3CA4A 1DFCA 2VXRA 4I4YA 2RG9B 3BAUA 2HZ9A 8I1BA 4FGFA 2F2FA 4D0TA 4G9MA 3ZX7A 3CA3A 4LO2A 4IZEA 3T8SA 3AH1A 1JT7A 3AZWA 2Q3NB 3IM7A 1BASA 3WMUA 4G9NA 3UD9A 3NBNA 1ONKB 3N0KA 1AVWB 4IYBA 3WO2A 2LIEA 1JLXA 3FJAA 5DVHA 3S8JA 4PC4A 3WINC 5FZYA 3BA4A 1HWMB 1TP0A 3A21A 4I0YA 3O4DA 3AKGA 1UPSA 1FGAA 1DJSB 3RTIB 4Q9GA 3H6RB 4JKXB 2D44A 3BTAA 5D61A 4OEEA 2HWAA 3FUQA 2AXMA 4IQPA 2WRYA 4DCKC 4QD2B 2D23A 2ZQOA 1IILA 1R8NA 3BRFA 1G9CA 4XKIA 1MC9A 2IHOA 1SR4C 2VSAA 1S0BA 2DS0A 2UUSA 3BX1C 1Z4SA 5DUYA 3NBEA 5BXSA 4MZHA 2AAIB 3HBWA 2P39A 3POKA 4TLPA 4H9WA 4P0KA 3AZVA 4GAFA 2F8XC 3BAVA 2GZBA 4HR6C 3N7JA 1F31A 1QQKA 4I4OA 5BP5A 1JQZA 3FGMA 3VUOA 4X3AA 2Q9XA 2NZ9A 3FJHA 1BA7A 3S8KA 5FZZA 4P0JA 31BIA 1IRPA 1IRAX 5D63A 2NTDA 1AVUA 2X2SA 1BFCA 5DSSB 1HIBA 3F1RA 1AVAC 9ILBA 4QBCA 4LO7B 5BVPI 1BLAA 4YOLA 4ENDA 1I1BA 2ET2A 4Z9WB 1T4QA 4G6JA 4I2SA 3CRHA 2E4MC 3BADA 1I1EA 3CQAA 4ZFYB 1ILR1 4QO3A 4H75A 2P23A 3UD7A 7I1BA 1FMMS 2LIQA 2MLLB 3V79C 1BFGA 3BAHA 1JT4A 1JY0A 2D20A 1ABRB 1JT5A 3IM5A 1YYNA 1PZZA 1HWOB 1L2HA 4LO3C 3LTQA 5G00A 3AJ5A 4G1RA 1EV2A 3WINA 4ZLBB 4OUJA 1IJTA 3AKIA 3A07A 1XYFA 4OWKA 3JRRA 2HWMA 3BB2A 1CVSA 4LO8B 1Q1UA 1TOOA 3B9UA 3O44A 1NUNA 3ILAA 3ZC8A 2KI6B 5DZUA 5BXTA 5BQUC 3FJEA 3V0BA 3BAGA 4I3NA 3IM6A 3I2AA 3VSZA 1G9AA 4CJMA 4Z8SB 2XOAA 3H6QA 3OJ2A 4OEFA 4J2YA 1TWMA 3CRIA 2VU9A 3N7LA 4GOYA 3VSFA 3AKFA 1FWVA 4Q9PA 2NVHA 5FNXA 4F34A 1T9FA 1FV2A 5HPZA 1NZKA 4QD2C 3PHZA 4IHZA 4ZA3B 1V6VA 1IT0A 2ESUA 2QYIB 4I4VA 3C9ZA 1HWPB 2FFUA 4XFTA 1V6WA 2KLLA 1DIWA 3FJJA 1S0GA 4IY8A 1PUMB 4KBBA 4UY4A 5F8SA 3HN1A 2ZR1B 3FJBA 3AH4A 3PMEA 5EC5A 1EVTA 2NP0A 1E0OA 1BFBA 3O49A 4ZFWB 1KNMA 5F8YA 6I1BA 3OGGA 3V0AB 1W3GA 4USPA 2E4MA 3OJVA 3R4UA 3FFZA 2X2TA 1II4A 3O3QA 3WA1A 1PC8B 3NJ5A 4USOA 4KEKA 3UJ4A 4J2SA 3UD8A 1D0HA 4I4UA 4EFPA 3A23A 2Z48A 2NYYA 3QYDA 1DFQA 1RMLA 1V6UA 1BARA 1WBAA 3VWCA 1K5UA 4I1BA 2BEBA 1W3AA 4LO7C 3PUBA 3MALA 3HOMA 4EFRA 1HKNA 4LO3A 4D0ZA 2HW9A 3I2XA 1N4KA 3EF2A 1FWUA 5JLVA 2NS2A 1EYLA 4OWJA 3W9TA 3HSMA 2I1BA 5F8WA 2D22A 5BOWA 1A8DA 1GGPB 1FQ9A 1S0EA 2KKIA 1QXMA 3IIRA 1WBCA 4I4RA 3N7MA 2L5XA 4JAWA 2D24A 2FGFA 4I4PA 1G82A 4I7IA 5BQUA 3IAGC 1ISYA 2VUAA 4D8HA 3O4AA 3FJ9A 3V0BB 4HJJA 2VXTI 1V6XA 2IWTB 2MIBA 4I4XA 1DLLA 1DZCA 3H6RA 4ZBVB 1YF8B 3KMVA 3R4SA 3SNVA 3UDAA 1XZZA 1SZ6B 1R8OA 2ZQNA 1RG8A 1DQGA 3QR5A 3FJ8A 2R9KB 3N7KA 1QQLA 4I4QA 1TIEA 41BIA 3BRDA 3O4CA 4P6AA 5EG6C 3WMVA 2K43A 3HALA 3F62B 2AFGA 4DENA 4ZGRB 4GP3A 4R6UB 4JRAA 2M49A 1JT3A 4J2KA 3VT2A 1PWAA 3RMXA 1P63A 3RTJB 4LO1C 4QKSA 1ISVA 4EFQA 3AH2A 2KH2A 1VCLA 1YTOA 3AKHA 1XG6A 4L4IA 1SR4A 3RSJA 1Q03A 5EHAA 4J2XA 1S0LA 3FJCA 4ZKTB 3CA0A 1RZOB 3ZXDA 4G6MA 4ISRA 1M16A 1IOBA 1K5VA 4Q91A 3HMYA 3MPPG 3WO3A 2BEAA 1BFFA 1HCDA 1FV3A 3D7WB 4XFUA 2VSEA 2QN4A 2KI4A 4ZFUB 4MZGB 3Q7YA 3OBRA 4I6IA 2ERMA 1S0CA 3FUOA 3O4OA 4EKXB 3LLPA 4AN7B 2D7RA 1MD6A 1WD3A 3BRGC 4DEPA 3H6SE 2Y9FA 5E24E 3JUTA 2DREA 4I8MA 3Q7WA 4X39A 2RQ9A 4KEIA 4JPZA 3Q7XA 1TWEA 4GOVA 4ISQA 4X37A 1YBIA 3K1XA 3FJKA 1AFCA 5D62A 4XFSA 4GAIA 4QC4A 3TC2A 1EPWA 4L4HA 3CU1B 4OEGA 4I96A 3OJMA 4FVVA 2DRYA 1HCEA 4X38A 3OGFA 4II0A 2K4AB 5JMCA 4H04A 1J0SA 1Z0HA 4IZXA 3CA1A 2WBCA 3VT0A 4I4SA 2AQZA 1ISZA 3CA5A 1ISWA 2D7IA 1OQLB 4LO0C 3CA6A 3CAHA 1AXMA 3WO4A 3NBCA 2D43A 3P6JA 5FZUA 4KC3A 3FJDA 3VEQA 3P6IA 1HWNB 2GO2A 3A22A 2F2FC 1DQOA 5I1BA 2Z49A 2FDBM 4QBVA 4LO2C 2MC2A 1TFMB 5FNWA 2NM1A 4LO1A 4QALA 4A7ZA 4A7KA 1BLDA 1WD4A 2BFHA 2Y9WC 1AVXB 1CE7B 2FO1A 1G9BA 4F83A 1ISXA 3FJIA 1ITBA 4P0LA 4IY9A 1PUUB 3VT1A 2DRZA 1TTUA 2Y9GA 5BXRA 5F90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRG A;  4OWL A;  1RY7 A;  3V0A A;  3OBT A;  3BAO A;  1M2T B;  3BA7 A;  4A7Y A;  1FN0 A;  2FFV A;  2Y9X E;  4ZOT A;  3O4B A;  1S0F A;  21BI A;  3FJF A;  3ZXG A;  1W3F A;  4KEJ A;  4ION A;  2D1Z A;  1XHB A;  3BAQ A;  3UJ0 A;  1FMZ A;  4GP0 A;  1S0D A;  1Z2V A;  1AF9 A;  1G9D A;  4I37 A;  5GAQ A;  3NBD A;  3PG0 A;  4QKR A;  2YUG A;  3AJ6 A;  4JP0 A;  3RMY A;  5BXP A;  2J3P A;  5BP5 C;  4J23 B;  4WBC A;  4JQ0 A;  5B2H A;  2RST A;  1JTC A;  3E8L C;  3I29 B;  4I1E A;  1JLY A;  3BA5 A;  3O5W B;  4AN6 A;  3P53 A;  4JKQ A;  2K8R A;  1YXW A;  2VLC A;  1DZD A;  1Q04 A;  3ZC9 A;  4LO0 A;  4OW4 A;  1IHK A;  4EB2 B;  4EEE B;  4HA2 A;  3CA4 A;  1DFC A;  2VXR A;  4I4Y A;  2RG9 B;  3BAU A;  2HZ9 A;  8I1B A;  4FGF A;  2F2F A;  4D0T A;  4G9M A;  3ZX7 A;  3CA3 A;  4LO2 A;  4IZE A;  3T8S A;  3AH1 A;  1JT7 A;  3AZW A;  2Q3N B;  3IM7 A;  1BAS A;  3WMU A;  4G9N A;  3UD9 A;  3NBN A;  1ONK B;  3N0K A;  1AVW B;  4IYB A;  3WO2 A;  2LIE A;  1JLX A;  3FJA A;  5DVH A;  3S8J A;  4PC4 A;  3WIN C;  5FZY A;  3BA4 A;  1HWM B;  1TP0 A;  3A21 A;  4I0Y A;  3O4D A;  3AKG A;  1UPS A;  1FGA A;  1DJS B;  3RTI B;  4Q9G A;  3H6R B;  4JKX B;  2D44 A;  3BTA A;  5D61 A;  4OEE A;  2HWA A;  3FUQ A;  2AXM A;  4IQP A;  2WRY A;  4DCK C;  4QD2 B;  2D23 A;  2ZQO A;  1IIL A;  1R8N A;  3BRF A;  1G9C A;  4XKI A;  1MC9 A;  2IHO A;  1SR4 C;  2VSA A;  1S0B A;  2DS0 A;  2UUS A;  3BX1 C;  1Z4S A;  5DUY A;  3NBE A;  5BXS A;  2AAI B;  3HBW A;  2P39 A;  3POK A;  4TLP A;  4H9W A;  4P0K A;  3AZV A;  4GAF A;  2F8X C;  3BAV A;  2GZB A;  4HR6 C;  3N7J A;  1F31 A;  1QQK A;  4I4O A;  5BP5 A;  1JQZ A;  3FGM A;  3VUO A;  4X3A A;  2Q9X A;  2NZ9 A;  3FJH A;  1BA7 A;  3S8K A;  5FZZ A;  4P0J A;  31BI A;  1IRP A;  1IRA X;  5D63 A;  2NTD A;  1AVU A;  2X2S A;  1BFC A;  5DSS B;  1HIB A;  3F1R A;  1AVA C;  9ILB A;  4QBC A;  4LO7 B;  5BVP I;  1BLA A;  4YOL A;  4END A;  1I1B A;  2ET2 A;  4Z9W B;  1T4Q A;  4G6J A;  4I2S A;  3CRH A;  2E4M C;  3BAD A;  1I1E A;  3CQA A;  4ZFY B;  1ILR 1;  4QO3 A;  2P23 A;  3UD7 A;  7I1B A;  1FMM S;  2LIQ A;  2MLL B;  3V79 C;  1BFG A;  3BAH A;  1JT4 A;  1JY0 A;  2D20 A;  1ABR B;  1JT5 A;  3IM5 A;  1YYN A;  1PZZ A;  1HWO B;  1L2H A;  4LO3 C;  3LTQ A;  5G00 A;  3AJ5 A;  4G1R A;  1EV2 A;  3WIN A;  4ZLB B;  4OUJ A;  1IJT A;  3AKI A;  3A07 A;  1XYF A;  4OWK A;  3JRR A;  2HWM A;  3BB2 A;  1CVS A;  4LO8 B;  1Q1U A;  1TOO A;  3B9U A;  3O44 A;  1NUN A;  3ILA A;  3ZC8 A;  2KI6 B;  5DZU A;  5BXT A;  5BQU C;  3FJE A;  3V0B A;  3BAG A;  4I3N A;  3IM6 A;  3I2A A;  3VSZ A;  1G9A A;  4CJM A;  4Z8S B;  2XOA A;  3H6Q A;  3OJ2 A;  4OEF A;  4J2Y A;  1TWM A;  3CRI A;  2VU9 A;  3N7L A;  4GOY A;  3VSF A;  3AKF A;  1FWV A;  4Q9P A;  2NVH A;  5FNX A;  4F34 A;  1T9F A;  1FV2 A;  5HPZ A;  1NZK A;  4QD2 C;  3PHZ A;  4IHZ A;  4ZA3 B;  1V6V A;  1IT0 A;  2ESU A;  2QYI B;  4I4V A;  3C9Z A;  1HWP B;  2FFU A;  4XFT A;  1V6W A;  2KLL A;  1DIW A;  3FJJ A;  1S0G A;  4IY8 A;  1PUM B;  4KBB A;  5F8S A;  3HN1 A;  2ZR1 B;  3FJB A;  3AH4 A;  3PME A;  5EC5 A;  1EVT A;  2NP0 A;  1E0O A;  1BFB A;  3O49 A;  4ZFW B;  1KNM A;  5F8Y A;  6I1B A;  3OGG A;  3V0A B;  1W3G A;  4USP A;  2E4M A;  3OJV A;  3R4U A;  3FFZ A;  2X2T A;  1II4 A;  3O3Q A;  3WA1 A;  1PC8 B;  3NJ5 A;  4USO A;  4KEK A;  3UJ4 A;  4J2S A;  3UD8 A;  1D0H A;  4I4U A;  4EFP A;  3A23 A;  2Z48 A;  2NYY A;  3QYD A;  1DFQ A;  1RML A;  1V6U A;  1BAR A;  1WBA A;  3VWC A;  1K5U A;  4I1B A;  2BEB A;  1W3A A;  4LO7 C;  3PUB A;  3MAL A;  3HOM A;  4EFR A;  1HKN A;  4LO3 A;  4D0Z A;  2HW9 A;  3I2X A;  1N4K A;  3EF2 A;  1FWU A;  5JLV A;  1EYL A;  4OWJ A;  3W9T A;  3HSM A;  2I1B A;  5F8W A;  2D22 A;  5BOW A;  1A8D A;  1GGP B;  1FQ9 A;  1S0E A;  2KKI A;  1QXM A;  3IIR A;  1WBC A;  4I4R A;  3N7M A;  2L5X A;  4JAW A;  2D24 A;  2FGF A;  4I4P A;  1G82 A;  4I7I A;  5BQU A;  3IAG C;  1ISY A;  2VUA A;  4D8H A;  3O4A A;  3FJ9 A;  3V0B B;  4HJJ A;  2VXT I;  1V6X A;  2IWT B;  2MIB A;  4I4X A;  1DLL A;  1DZC A;  3H6R A;  4ZBV B;  1YF8 B;  3KMV A;  3R4S A;  3SNV A;  3UDA A;  1XZZ A;  1SZ6 B;  1R8O A;  2ZQN A;  1RG8 A;  1DQG A;  3QR5 A;  3FJ8 A;  2R9K B;  3N7K A;  1QQL A;  4I4Q A;  1TIE A;  41BI A;  3BRD A;  3O4C A;  4P6A A;  5EG6 C;  3WMV A;  2K43 A;  3HAL A;  3F62 B;  2AFG A;  4DEN A;  4ZGR B;  4GP3 A;  4R6U B;  4JRA A;  2M49 A;  1JT3 A;  4J2K A;  3VT2 A;  1PWA A;  3RMX A;  1P63 A;  3RTJ B;  4LO1 C;  4QKS A;  1ISV A;  4EFQ A;  3AH2 A;  2KH2 A;  1VCL A;  1YTO A;  3AKH A;  1XG6 A;  4L4I A;  1SR4 A;  3RSJ A;  1Q03 A;  5EHA A;  4J2X A;  1S0L A;  3FJC A;  4ZKT B;  3CA0 A;  1RZO B;  3ZXD A;  4G6M A;  4ISR A;  1M16 A;  1IOB A;  1K5V A;  4Q91 A;  3HMY A;  3MPP G;  3WO3 A;  2BEA A;  1BFF A;  1HCD A;  1FV3 A;  3D7W B;  4XFU A;  2VSE A;  2QN4 A;  2KI4 A;  4ZFU B;  3Q7Y A;  3OBR A;  4I6I A;  2ERM A;  1S0C A;  3FUO A;  3O4O A;  4EKX B;  3LLP A;  4AN7 B;  2D7R A;  1MD6 A;  1WD3 A;  3BRG C;  4DEP A;  3H6S E;  2Y9F A;  5E24 E;  3JUT A;  2DRE A;  4I8M A;  3Q7W A;  4X39 A;  2RQ9 A;  4KEI A;  4JPZ A;  3Q7X A;  1TWE A;  4GOV A;  4ISQ A;  4X37 A;  1YBI A;  3K1X A;  3FJK A;  1AFC A;  5D62 A;  4XFS A;  4GAI A;  4QC4 A;  3TC2 A;  1EPW A;  4L4H A;  3CU1 B;  4OEG A;  4I96 A;  3OJM A;  4FVV A;  2DRY A;  1HCE A;  4X38 A;  3OGF A;  4II0 A;  2K4A B;  5JMC A;  4H04 A;  1J0S A;  1Z0H A;  4IZX A;  3CA1 A;  2WBC A;  3VT0 A;  4I4S A;  2AQZ A;  1ISZ A;  3CA5 A;  1ISW A;  2D7I A;  1OQL B;  4LO0 C;  3CA6 A;  3CAH A;  1AXM A;  3WO4 A;  3NBC A;  2D43 A;  3P6J A;  5FZU A;  4KC3 A;  3FJD A;  3VEQ A;  3P6I A;  1HWN B;  2GO2 A;  3A22 A;  2F2F C;  1DQO A;  5I1B A;  2Z49 A;  2FDB M;  4QBV A;  4LO2 C;  2MC2 A;  1TFM B;  5FNW A;  2NM1 A;  4LO1 A;  4QAL A;  4A7Z A;  4A7K A;  1BLD A;  1WD4 A;  2BFH A;  2Y9W C;  1AVX B;  1CE7 B;  2FO1 A;  1G9B A;  4F83 A;  1ISX A;  3FJI A;  1ITB A;  4P0L A;  4IY9 A;  1PUU B;  3VT1 A;  2DRZ A;  1TTU A;  2Y9G A;  5BXR A;  5F90 A; 
#chains in the Genus database with same CATH topology
 3CRG A;  4OWL A;  1RY7 A;  3V0A A;  3OBT A;  3BAO A;  1M2T B;  3BA7 A;  4A7Y A;  1FN0 A;  2FFV A;  2Y9X E;  4ZOT A;  3O4B A;  1S0F A;  21BI A;  3FJF A;  3ZXG A;  1W3F A;  4KEJ A;  4ION A;  2D1Z A;  1XHB A;  3BAQ A;  3UJ0 A;  1FMZ A;  4GP0 A;  1S0D A;  1Z2V A;  4MZF B;  1AF9 A;  1G9D A;  4I37 A;  5GAQ A;  3NBD A;  3PG0 A;  4QKR A;  2YUG A;  3AJ6 A;  4JP0 A;  3RMY A;  5BXP A;  2J3P A;  5BP5 C;  4J23 B;  4WBC A;  4JQ0 A;  5B2H A;  2RST A;  1JTC A;  3E8L C;  3I29 B;  4I1E A;  1JLY A;  3BA5 A;  3O5W B;  4AN6 A;  3P53 A;  4JKQ A;  2K8R A;  1YXW A;  2VLC A;  1DZD A;  1Q04 A;  3ZC9 A;  4LO0 A;  4OW4 A;  1IHK A;  4EB2 B;  4EEE B;  4HA2 A;  3CA4 A;  1DFC A;  2VXR A;  4I4Y A;  2RG9 B;  3BAU A;  2HZ9 A;  8I1B A;  4FGF A;  2F2F A;  4D0T A;  4G9M A;  3ZX7 A;  3CA3 A;  4LO2 A;  4IZE A;  3T8S A;  3AH1 A;  1JT7 A;  3AZW A;  2Q3N B;  3IM7 A;  1BAS A;  3WMU A;  4G9N A;  3UD9 A;  3NBN A;  1ONK B;  3N0K A;  1AVW B;  4IYB A;  3WO2 A;  2LIE A;  1JLX A;  3FJA A;  5DVH A;  3S8J A;  4PC4 A;  3WIN C;  5FZY A;  3BA4 A;  1HWM B;  1TP0 A;  3A21 A;  4I0Y A;  3O4D A;  3AKG A;  1UPS A;  1FGA A;  1DJS B;  3RTI B;  4Q9G A;  3H6R B;  4JKX B;  2D44 A;  3BTA A;  5D61 A;  4OEE A;  2HWA A;  3FUQ A;  2AXM A;  4IQP A;  2WRY A;  4DCK C;  4QD2 B;  2D23 A;  2ZQO A;  1IIL A;  1R8N A;  3BRF A;  1G9C A;  4XKI A;  1MC9 A;  2IHO A;  1SR4 C;  2VSA A;  1S0B A;  2DS0 A;  2UUS A;  3BX1 C;  1Z4S A;  5DUY A;  3NBE A;  5BXS A;  4MZH A;  2AAI B;  3HBW A;  2P39 A;  3POK A;  4TLP A;  4H9W A;  4P0K A;  3AZV A;  4GAF A;  2F8X C;  3BAV A;  2GZB A;  4HR6 C;  3N7J A;  1F31 A;  1QQK A;  4I4O A;  5BP5 A;  1JQZ A;  3FGM A;  3VUO A;  4X3A A;  2Q9X A;  2NZ9 A;  3FJH A;  1BA7 A;  3S8K A;  5FZZ A;  4P0J A;  31BI A;  1IRP A;  1IRA X;  5D63 A;  2NTD A;  1AVU A;  2X2S A;  1BFC A;  5DSS B;  1HIB A;  3F1R A;  1AVA C;  9ILB A;  4QBC A;  4LO7 B;  5BVP I;  1BLA A;  4YOL A;  4END A;  1I1B A;  2ET2 A;  4Z9W B;  1T4Q A;  4G6J A;  4I2S A;  3CRH A;  2E4M C;  3BAD A;  1I1E A;  3CQA A;  4ZFY B;  1ILR 1;  4QO3 A;  4H75 A;  2P23 A;  3UD7 A;  7I1B A;  1FMM S;  2LIQ A;  2MLL B;  3V79 C;  1BFG A;  3BAH A;  1JT4 A;  1JY0 A;  2D20 A;  1ABR B;  1JT5 A;  3IM5 A;  1YYN A;  1PZZ A;  1HWO B;  1L2H A;  4LO3 C;  3LTQ A;  5G00 A;  3AJ5 A;  4G1R A;  1EV2 A;  3WIN A;  4ZLB B;  4OUJ A;  1IJT A;  3AKI A;  3A07 A;  1XYF A;  4OWK A;  3JRR A;  2HWM A;  3BB2 A;  1CVS A;  4LO8 B;  1Q1U A;  1TOO A;  3B9U A;  3O44 A;  1NUN A;  3ILA A;  3ZC8 A;  2KI6 B;  5DZU A;  5BXT A;  5BQU C;  3FJE A;  3V0B A;  3BAG A;  4I3N A;  3IM6 A;  3I2A A;  3VSZ A;  1G9A A;  4CJM A;  4Z8S B;  2XOA A;  3H6Q A;  3OJ2 A;  4OEF A;  4J2Y A;  1TWM A;  3CRI A;  2VU9 A;  3N7L A;  4GOY A;  3VSF A;  3AKF A;  1FWV A;  4Q9P A;  2NVH A;  5FNX A;  4F34 A;  1T9F A;  1FV2 A;  5HPZ A;  1NZK A;  4QD2 C;  3PHZ A;  4IHZ A;  4ZA3 B;  1V6V A;  1IT0 A;  2ESU A;  2QYI B;  4I4V A;  3C9Z A;  1HWP B;  2FFU A;  4XFT A;  1V6W A;  2KLL A;  1DIW A;  3FJJ A;  1S0G A;  4IY8 A;  1PUM B;  4KBB A;  4UY4 A;  5F8S A;  3HN1 A;  2ZR1 B;  3FJB A;  3AH4 A;  3PME A;  5EC5 A;  1EVT A;  2NP0 A;  1E0O A;  1BFB A;  3O49 A;  4ZFW B;  1KNM A;  5F8Y A;  6I1B A;  3OGG A;  3V0A B;  1W3G A;  4USP A;  2E4M A;  3OJV A;  3R4U A;  3FFZ A;  2X2T A;  1II4 A;  3O3Q A;  3WA1 A;  1PC8 B;  3NJ5 A;  4USO A;  4KEK A;  3UJ4 A;  4J2S A;  3UD8 A;  1D0H A;  4I4U A;  4EFP A;  3A23 A;  2Z48 A;  2NYY A;  3QYD A;  1DFQ A;  1RML A;  1V6U A;  1BAR A;  1WBA A;  3VWC A;  1K5U A;  4I1B A;  2BEB A;  1W3A A;  4LO7 C;  3PUB A;  3MAL A;  3HOM A;  4EFR A;  1HKN A;  4LO3 A;  4D0Z A;  2HW9 A;  3I2X A;  1N4K A;  3EF2 A;  1FWU A;  5JLV A;  2NS2 A;  1EYL A;  4OWJ A;  3W9T A;  3HSM A;  2I1B A;  5F8W A;  2D22 A;  5BOW A;  1A8D A;  1GGP B;  1FQ9 A;  1S0E A;  2KKI A;  1QXM A;  3IIR A;  1WBC A;  4I4R A;  3N7M A;  2L5X A;  4JAW A;  2D24 A;  2FGF A;  4I4P A;  1G82 A;  4I7I A;  5BQU A;  3IAG C;  1ISY A;  2VUA A;  4D8H A;  3O4A A;  3FJ9 A;  3V0B B;  4HJJ A;  2VXT I;  1V6X A;  2IWT B;  2MIB A;  4I4X A;  1DLL A;  1DZC A;  3H6R A;  4ZBV B;  1YF8 B;  3KMV A;  3R4S A;  3SNV A;  3UDA A;  1XZZ A;  1SZ6 B;  1R8O A;  2ZQN A;  1RG8 A;  1DQG A;  3QR5 A;  3FJ8 A;  2R9K B;  3N7K A;  1QQL A;  4I4Q A;  1TIE A;  41BI A;  3BRD A;  3O4C A;  4P6A A;  5EG6 C;  3WMV A;  2K43 A;  3HAL A;  3F62 B;  2AFG A;  4DEN A;  4ZGR B;  4GP3 A;  4R6U B;  4JRA A;  2M49 A;  1JT3 A;  4J2K A;  3VT2 A;  1PWA A;  3RMX A;  1P63 A;  3RTJ B;  4LO1 C;  4QKS A;  1ISV A;  4EFQ A;  3AH2 A;  2KH2 A;  1VCL A;  1YTO A;  3AKH A;  1XG6 A;  4L4I A;  1SR4 A;  3RSJ A;  1Q03 A;  5EHA A;  4J2X A;  1S0L A;  3FJC A;  4ZKT B;  3CA0 A;  1RZO B;  3ZXD A;  4G6M A;  4ISR A;  1M16 A;  1IOB A;  1K5V A;  4Q91 A;  3HMY A;  3MPP G;  3WO3 A;  2BEA A;  1BFF A;  1HCD A;  1FV3 A;  3D7W B;  4XFU A;  2VSE A;  2QN4 A;  2KI4 A;  4ZFU B;  4MZG B;  3Q7Y A;  3OBR A;  4I6I A;  2ERM A;  1S0C A;  3FUO A;  3O4O A;  4EKX B;  3LLP A;  4AN7 B;  2D7R A;  1MD6 A;  1WD3 A;  3BRG C;  4DEP A;  3H6S E;  2Y9F A;  5E24 E;  3JUT A;  2DRE A;  4I8M A;  3Q7W A;  4X39 A;  2RQ9 A;  4KEI A;  4JPZ A;  3Q7X A;  1TWE A;  4GOV A;  4ISQ A;  4X37 A;  1YBI A;  3K1X A;  3FJK A;  1AFC A;  5D62 A;  4XFS A;  4GAI A;  4QC4 A;  3TC2 A;  1EPW A;  4L4H A;  3CU1 B;  4OEG A;  4I96 A;  3OJM A;  4FVV A;  2DRY A;  1HCE A;  4X38 A;  3OGF A;  4II0 A;  2K4A B;  5JMC A;  4H04 A;  1J0S A;  1Z0H A;  4IZX A;  3CA1 A;  2WBC A;  3VT0 A;  4I4S A;  2AQZ A;  1ISZ A;  3CA5 A;  1ISW A;  2D7I A;  1OQL B;  4LO0 C;  3CA6 A;  3CAH A;  1AXM A;  3WO4 A;  3NBC A;  2D43 A;  3P6J A;  5FZU A;  4KC3 A;  3FJD A;  3VEQ A;  3P6I A;  1HWN B;  2GO2 A;  3A22 A;  2F2F C;  1DQO A;  5I1B A;  2Z49 A;  2FDB M;  4QBV A;  4LO2 C;  2MC2 A;  1TFM B;  5FNW A;  2NM1 A;  4LO1 A;  4QAL A;  4A7Z A;  4A7K A;  1BLD A;  1WD4 A;  2BFH A;  2Y9W C;  1AVX B;  1CE7 B;  2FO1 A;  1G9B A;  4F83 A;  1ISX A;  3FJI A;  1ITB A;  4P0L A;  4IY9 A;  1PUU B;  3VT1 A;  2DRZ A;  1TTU A;  2Y9G A;  5BXR A;  5F90 A; 
#chains in the Genus database with same CATH homology
 3CRG A;  4OWL A;  1RY7 A;  3V0A A;  3OBT A;  3BAO A;  1M2T B;  3BA7 A;  4A7Y A;  1FN0 A;  2FFV A;  2Y9X E;  4ZOT A;  3O4B A;  1S0F A;  21BI A;  3FJF A;  3ZXG A;  1W3F A;  4KEJ A;  4ION A;  2D1Z A;  1XHB A;  3BAQ A;  3UJ0 A;  1FMZ A;  4GP0 A;  1S0D A;  1Z2V A;  4MZF B;  1AF9 A;  1G9D A;  4I37 A;  5GAQ A;  3NBD A;  3PG0 A;  4QKR A;  2YUG A;  3AJ6 A;  4JP0 A;  3RMY A;  5BXP A;  2J3P A;  5BP5 C;  4J23 B;  4WBC A;  4JQ0 A;  5B2H A;  2RST A;  1JTC A;  3E8L C;  3I29 B;  4I1E A;  1JLY A;  3BA5 A;  3O5W B;  4AN6 A;  3P53 A;  4JKQ A;  2K8R A;  1YXW A;  2VLC A;  1DZD A;  1Q04 A;  3ZC9 A;  4LO0 A;  4OW4 A;  1IHK A;  4EB2 B;  4EEE B;  4HA2 A;  3CA4 A;  1DFC A;  2VXR A;  4I4Y A;  2RG9 B;  3BAU A;  2HZ9 A;  8I1B A;  4FGF A;  2F2F A;  4D0T A;  4G9M A;  3ZX7 A;  3CA3 A;  4LO2 A;  4IZE A;  3T8S A;  3AH1 A;  1JT7 A;  3AZW A;  2Q3N B;  3IM7 A;  1BAS A;  3WMU A;  4G9N A;  3UD9 A;  3NBN A;  1ONK B;  3N0K A;  1AVW B;  4IYB A;  3WO2 A;  2LIE A;  1JLX A;  3FJA A;  5DVH A;  3S8J A;  4PC4 A;  3WIN C;  5FZY A;  3BA4 A;  1HWM B;  1TP0 A;  3A21 A;  4I0Y A;  3O4D A;  3AKG A;  1UPS A;  1FGA A;  1DJS B;  3RTI B;  4Q9G A;  3H6R B;  4JKX B;  2D44 A;  3BTA A;  5D61 A;  4OEE A;  2HWA A;  3FUQ A;  2AXM A;  4IQP A;  2WRY A;  4DCK C;  4QD2 B;  2D23 A;  2ZQO A;  1IIL A;  1R8N A;  3BRF A;  1G9C A;  4XKI A;  1MC9 A;  2IHO A;  1SR4 C;  2VSA A;  1S0B A;  2DS0 A;  2UUS A;  3BX1 C;  1Z4S A;  5DUY A;  3NBE A;  5BXS A;  4MZH A;  2AAI B;  3HBW A;  2P39 A;  3POK A;  4TLP A;  4H9W A;  4P0K A;  3AZV A;  4GAF A;  2F8X C;  3BAV A;  2GZB A;  4HR6 C;  3N7J A;  1F31 A;  1QQK A;  4I4O A;  5BP5 A;  1JQZ A;  3FGM A;  3VUO A;  4X3A A;  2Q9X A;  2NZ9 A;  3FJH A;  1BA7 A;  3S8K A;  5FZZ A;  4P0J A;  31BI A;  1IRP A;  1IRA X;  5D63 A;  2NTD A;  1AVU A;  2X2S A;  1BFC A;  5DSS B;  1HIB A;  3F1R A;  1AVA C;  9ILB A;  4QBC A;  4LO7 B;  5BVP I;  1BLA A;  4YOL A;  4END A;  1I1B A;  2ET2 A;  4Z9W B;  1T4Q A;  4G6J A;  4I2S A;  3CRH A;  2E4M C;  3BAD A;  1I1E A;  3CQA A;  4ZFY B;  1ILR 1;  4QO3 A;  4H75 A;  2P23 A;  3UD7 A;  7I1B A;  1FMM S;  2LIQ A;  2MLL B;  3V79 C;  1BFG A;  3BAH A;  1JT4 A;  1JY0 A;  2D20 A;  1ABR B;  1JT5 A;  3IM5 A;  1YYN A;  1PZZ A;  1HWO B;  1L2H A;  4LO3 C;  3LTQ A;  5G00 A;  3AJ5 A;  4G1R A;  1EV2 A;  3WIN A;  4ZLB B;  4OUJ A;  1IJT A;  3AKI A;  3A07 A;  1XYF A;  4OWK A;  3JRR A;  2HWM A;  3BB2 A;  1CVS A;  4LO8 B;  1Q1U A;  1TOO A;  3B9U A;  3O44 A;  1NUN A;  3ILA A;  3ZC8 A;  2KI6 B;  5DZU A;  5BXT A;  5BQU C;  3FJE A;  3V0B A;  3BAG A;  4I3N A;  3IM6 A;  3I2A A;  3VSZ A;  1G9A A;  4CJM A;  4Z8S B;  2XOA A;  3H6Q A;  3OJ2 A;  4OEF A;  4J2Y A;  1TWM A;  3CRI A;  2VU9 A;  3N7L A;  4GOY A;  3VSF A;  3AKF A;  1FWV A;  4Q9P A;  2NVH A;  5FNX A;  4F34 A;  1T9F A;  1FV2 A;  5HPZ A;  1NZK A;  4QD2 C;  3PHZ A;  4IHZ A;  4ZA3 B;  1V6V A;  1IT0 A;  2ESU A;  2QYI B;  4I4V A;  3C9Z A;  1HWP B;  2FFU A;  4XFT A;  1V6W A;  2KLL A;  1DIW A;  3FJJ A;  1S0G A;  4IY8 A;  1PUM B;  4KBB A;  4UY4 A;  5F8S A;  3HN1 A;  2ZR1 B;  3FJB A;  3AH4 A;  3PME A;  5EC5 A;  1EVT A;  2NP0 A;  1E0O A;  1BFB A;  3O49 A;  4ZFW B;  1KNM A;  5F8Y A;  6I1B A;  3OGG A;  3V0A B;  1W3G A;  4USP A;  2E4M A;  3OJV A;  3R4U A;  3FFZ A;  2X2T A;  1II4 A;  3O3Q A;  3WA1 A;  1PC8 B;  3NJ5 A;  4USO A;  4KEK A;  3UJ4 A;  4J2S A;  3UD8 A;  1D0H A;  4I4U A;  4EFP A;  3A23 A;  2Z48 A;  2NYY A;  3QYD A;  1DFQ A;  1RML A;  1V6U A;  1BAR A;  1WBA A;  3VWC A;  1K5U A;  4I1B A;  2BEB A;  1W3A A;  4LO7 C;  3PUB A;  3MAL A;  3HOM A;  4EFR A;  1HKN A;  4LO3 A;  4D0Z A;  2HW9 A;  3I2X A;  1N4K A;  3EF2 A;  1FWU A;  5JLV A;  2NS2 A;  1EYL A;  4OWJ A;  3W9T A;  3HSM A;  2I1B A;  5F8W A;  2D22 A;  5BOW A;  1A8D A;  1GGP B;  1FQ9 A;  1S0E A;  2KKI A;  1QXM A;  3IIR A;  1WBC A;  4I4R A;  3N7M A;  2L5X A;  4JAW A;  2D24 A;  2FGF A;  4I4P A;  1G82 A;  4I7I A;  5BQU A;  3IAG C;  1ISY A;  2VUA A;  4D8H A;  3O4A A;  3FJ9 A;  3V0B B;  4HJJ A;  2VXT I;  1V6X A;  2IWT B;  2MIB A;  4I4X A;  1DLL A;  1DZC A;  3H6R A;  4ZBV B;  1YF8 B;  3KMV A;  3R4S A;  3SNV A;  3UDA A;  1XZZ A;  1SZ6 B;  1R8O A;  2ZQN A;  1RG8 A;  1DQG A;  3QR5 A;  3FJ8 A;  2R9K B;  3N7K A;  1QQL A;  4I4Q A;  1TIE A;  41BI A;  3BRD A;  3O4C A;  4P6A A;  5EG6 C;  3WMV A;  2K43 A;  3HAL A;  3F62 B;  2AFG A;  4DEN A;  4ZGR B;  4GP3 A;  4R6U B;  4JRA A;  2M49 A;  1JT3 A;  4J2K A;  3VT2 A;  1PWA A;  3RMX A;  1P63 A;  3RTJ B;  4LO1 C;  4QKS A;  1ISV A;  4EFQ A;  3AH2 A;  2KH2 A;  1VCL A;  1YTO A;  3AKH A;  1XG6 A;  4L4I A;  1SR4 A;  3RSJ A;  1Q03 A;  5EHA A;  4J2X A;  1S0L A;  3FJC A;  4ZKT B;  3CA0 A;  1RZO B;  3ZXD A;  4G6M A;  4ISR A;  1M16 A;  1IOB A;  1K5V A;  4Q91 A;  3HMY A;  3MPP G;  3WO3 A;  2BEA A;  1BFF A;  1HCD A;  1FV3 A;  3D7W B;  4XFU A;  2VSE A;  2QN4 A;  2KI4 A;  4ZFU B;  4MZG B;  3Q7Y A;  3OBR A;  4I6I A;  2ERM A;  1S0C A;  3FUO A;  3O4O A;  4EKX B;  3LLP A;  4AN7 B;  2D7R A;  1MD6 A;  1WD3 A;  3BRG C;  4DEP A;  3H6S E;  2Y9F A;  5E24 E;  3JUT A;  2DRE A;  4I8M A;  3Q7W A;  4X39 A;  2RQ9 A;  4KEI A;  4JPZ A;  3Q7X A;  1TWE A;  4GOV A;  4ISQ A;  4X37 A;  1YBI A;  3K1X A;  3FJK A;  1AFC A;  5D62 A;  4XFS A;  4GAI A;  4QC4 A;  3TC2 A;  1EPW A;  4L4H A;  3CU1 B;  4OEG A;  4I96 A;  3OJM A;  4FVV A;  2DRY A;  1HCE A;  4X38 A;  3OGF A;  4II0 A;  2K4A B;  5JMC A;  4H04 A;  1J0S A;  1Z0H A;  4IZX A;  3CA1 A;  2WBC A;  3VT0 A;  4I4S A;  2AQZ A;  1ISZ A;  3CA5 A;  1ISW A;  2D7I A;  1OQL B;  4LO0 C;  3CA6 A;  3CAH A;  1AXM A;  3WO4 A;  3NBC A;  2D43 A;  3P6J A;  5FZU A;  4KC3 A;  3FJD A;  3VEQ A;  3P6I A;  1HWN B;  2GO2 A;  3A22 A;  2F2F C;  1DQO A;  5I1B A;  2Z49 A;  2FDB M;  4QBV A;  4LO2 C;  2MC2 A;  1TFM B;  5FNW A;  2NM1 A;  4LO1 A;  4QAL A;  4A7Z A;  4A7K A;  1BLD A;  1WD4 A;  2BFH A;  2Y9W C;  1AVX B;  1CE7 B;  2FO1 A;  1G9B A;  4F83 A;  1ISX A;  3FJI A;  1ITB A;  4P0L A;  4IY9 A;  1PUU B;  3VT1 A;  2DRZ A;  1TTU A;  2Y9G A;  5BXR A;  5F90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...