1M18C

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
molecule keywords Palindromic 146 Base Pair DNA Fragment
molecule tags Structural protein/dna
source organism Xenopus laevis
total genus 30
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18C00
3LELB 3REKB 4J8VC 1P3GD 3NQJB 5B0YD 2YFVA 4XUJD 5B0YB 3REHA 3WAAA 3MGSD 3AYWA 4Z2MG 3W96A 3C1CC 5GSUC 3LJAD 3B0DB 4QLCD 5AV8D 1F66C 3WA9D 4R8PB 3LZ0A 3AZEA 1S32C 4NFTA 4M6BA 3A6NA 4AWLC 2F8NH 3AZFD 1P3KD 3W97C 4EO5B 5AVBC 1A7WA 1P3FA 5AV6A 2YFVB 5B40C 3B6FD 3WAAB 3REHB 3AYWB 5BNXA 2L5AA 3AZMA 3W96B 5B2JA 3X1UA 5CPJA 4WU8C 3X1SD 3MNNA 5BS7A 5DNNC 3KWQC 1P3ID 1BH9A 3LZ0B 3B6GC 2YFWA 3AZEB 3W98A 5JA4A 3TU4D 2CV5A 3AV1B 3A6NB 1KX4C 4J8XD 3V9RA 3W99A 4LD9D 4ZUXD 2JSSA 5B1LD 1P3FD 3AZHC 5AVCA 3AZJC 1U35A 1P3FB 5AV6B 5CHLB 2PYOA 2NZDA 4NE6A 3AZMD 5BNXB 3AZMB 3X1VC 5DNMD 5B2JB 5B24A 2F8ND 5B33A 3X1UB 5CPJB 5GXQD 3O62A 3MNNB 5E5AC 1BH9B 3KUYD 2YFWB 3W98B 5JA4B 3MVDA 4DRBA 2CV5B 3AZGC 5FUGA 2F8NK 3V9RB 3W99B 1HQ3A 4H9SA 3WTPC 4JJNA 1U35D 3AZNC 1P3LD 1U35B 5AVCB 2NZDB 1M19C 1ULYA 2PYOB 4J8WC 1WWSA 4G92C 3AZKA 5B2IC 3UTAC 1TZYA 5B24B 5B33B 5AY8C 3O62B 3MGRA 5CPKA 1KX5D 5CPIA 3VH6T 3MGPC 4CSRA 5GT3D 3MVDB 3X1TA 3VH6W 4XZQA 3REIC 3UT9D 5FUGB 1P3AA 1P3MA 1ID3A 1HQ3D 3C1BB 3KXBD 4JJNB 3AFAB 3UTBD 3VH5A 2NQBA 3LZ1D 4YM6D 1EQZD 3AZKB 1TZYD 1B6WA 1TZYB 4Z5TC 5CP6C 1KX3D 5B0ZA 3MGRB 5CPKB 5CPIB 1ZLAD 4CSRB 1P3GA 4J8UD 3AZID 4KUDC 4CAYA 3X1TB 4XZQB 1P3AB 1P3MB 4J8VD 4XUJA 1ID3B 5B32C 3AZLC 1P3BC 3MGSA 2F8NG 2FJ7B 3MGQC 3LJAA 4E44A 5BNVA 4QLCA 5AV8A 2NQBB 3C1CD 3WA9A 5GSUD 3AN2B 2HUEB 1F66D 1M1AC 2AROC 1S32D 5B0ZB 3C1BC 3AZFA 1P3KA 1P3GB 4CAYB 4WU9C 3B0BA 4H9NA 1P3PC 1Q9CA 3W97D 3B6FA 4XUJB 5AVBD 1P3OC 4Z66C 3MGSB 1P34C 5B40D 3REJC 3LJAB 4QLCB 5BNVB 5AV8B 3X1SA 5B31C 4HGAC 1P3IA 3WA9B 5AV9C 5AV5C 4WU8D 5DNND 3TU4A 4KGCC 3B6GD 4DRAA 5GT0C 5B1MC 4J8XA 5C3IB 3RELC 4YS3C 4LD9A 4ZUXA 1M18C 3AZFB 1P3KB 1KX4D 2FJ7C 5B1LA 4WV4B 5F99C 3AZGA 5JRGC 4H9NB 3B6FB 5G49A 3WKJC 3R45A 3AZHD 3AZJD 3AV2C 1H3OA 3WTPE 1JFIA 5DNMA 2F8NA 1AOIC 5GXQA 4X23C 3X1SB 3LELC 4H9PA 3REKC 3X1VD 1P3IB 3KUYA 3KSYA 5E5AD 3TU4B 5B0YC 4J8XB 4LD9B 5KDMA 4ZUXB 3AZGD 5B1LB 3B0DC 1P3LA 4R8PC 3WTPD 5G49B 3AZND 3R45B 1M19D 1H3OB 4J8WD 1JFIB 5DNMB 2F8NB 5GXQB 5B2ID 3UTAD 4EO5C 4H9PB 1KX5A 5GT3A 3KUYB 3WAAC 3REHC 3AYWC 3MGPD 2HIOA 1N1JA 3UT9A 2IO5B 3W96C 5KDMB 3KXBA 3REID 1P3LB 3UTBA 3LZ0C 5BT1C 3AZEC 3LZ1A 4YM6A 1EQZA 3AV1C 3A6NC 1KX3A 4Z5TD 1KX5B 1ZLAA 1BH8A 5GT3B 5CP6D 1P3FC 1WWIA 5AV6C 4J8UA 3AZIA 2HIOD 2HIOB 1N1JB 3UT9B 4J8VA 3AZMC 4KUDD 1HQ3B 5B2JC 3X1UC 5CPJC 3KXBB 5B32D 3MNNC 3AZLD 1P3BD 5BS7C 3UTBB 3W98C 1P34A 3LZ1B 3C1CA 4YM6B 1EQZB 5GSUA 2CV5C 4NE5A 3MGQD 1F66A 3W99C 4G91B 1S32A 1KX3B 1M1AD 1ZLAB 1BH8B 5AVCC 1U35C 2NZDC 4J8UB 3AZIB 2PYOC 4YS3A 3W97A 4J8VB 5AVBA 5B24C 5BO0A 4WU9D 5B33C 1P3PD 5B40A 4H9RA 3O62C 1P3OD 4Z66D 1P34D 3REJD 3C1CB 3MVDC 5GSUB 4WU8A 5B31D 3KWQA 5DNNA 1F66B 5AV9D 3B6GA 5AV5D 1HQ3C 1S32B 4H9SC 4JJNC 3AFAC 4KGCD 1KX4A 5GT0D 5B1MD 4AWLB 1BFMA 3RELD 4YS3D 1M18D 3AZKC 4E45A 3W97B 5AVBB 2RVQC 1TZYC 5JRGD 5BO0B 3AZJA 3AZHA 5B40B 4H9RB 2LY8A 3MGRC 5CPKC 3WKJD 5CPIC 3AV2D 3X1VA 1AOID 4H9QA 3X1TC 3KWQD 4WU8B 4XZQC 5E5AA 3LELD 3KWQB 5DNNB 2BYMA 3REKD 1P3AC 1P3MC 1ID3C 3B6GB 1R4VA 1KX4B 5B32G 2NQBC 3WTPA 3AN2C 2HUEC 3AZNA 3AZHB 3AZJB 4R8PD 1M19A 4J8WA 5B0ZC 5B2IA 3UTAA 3X1VB 1P3GC 3AV1A 5AY8A 4H9QB 4KHAA 5E5AB 1HTAA 4XUJC 2BYMB 3MGSC 3MGPA 3WAAD 3REHD 3AYWD 3REIA 3AZGB 3LJAC 4QLCC 3W96D 5AV8C 3WA9C 3WTPB 3AZNB 3LZ0D 5B31G 1M19B 4J8WB 5BT1D 3AZED 4G92B 5C3IC 2BYKA 2CWEA 5B2IB 3AZFC 3AV1D 5AY8D 4Z2MH 3A6ND 3UTAB 4Z5TA 1P3KC 1KU5A 5AY8B 4KHAB 5CP6A 3B6FC 3MGPB 5AV6D 4KUDA 3REIB 5B32A 3AZLA 3X1SC 5B2JD 1P3BA 1P3IC 3X1UD 5CPJD 3MNND 3TU4C 3MGQA 3W98D 4J8XC 4LD9C 2BYKB 2CV5D 4ZUXC 3VH5T 5B1LC 4Z5TB 3W99D 1M1AA 3VH5W 5CP6B 2AROA 3C1BA 2NZDD 5AVCD 3AFAA 2PYOD 4KUDB 5DNMC 4UUZA 4WU9A 1P3PA 5GXQC 1F1EA 5B32B 3AZLB 1P3BB 4Z66A 5B24D 1TAFA 5B33D 1P3OA 3REJA 3KUYC 3O62D 4WNNA 3MGQB 5B31A 2IO5C 3MVDD 5AV9A 5AV5A 3NQUA 2AROD 1M1AB 1P3LC 4KGCA 4ZBJB 3C1BD 2AROB 5B1MA 5GT0A 4JJND 3RELA 3AFAD 1M18A 2FJ7A 5F99A 3VH6A 4UUZB 5JRGA 4WU9B 1P3PB 3AZKD 4H9OA 2RVQD 1P3OB 4Z66B 3AN2A 1TAFB 1KX5C 3WKJA 3AV2A 1P34B 5GT3C 3REJB 1AOIA 4WNNB 3MGRD 5CPKD 5CPID 4X23A 1B67A 2HIOC 3LELA 3UT9C 5B31B 3REKA 4HGAB 3X1TD 5AV9B 3NQJA 5AV5B 3KXBC 4XZQD 1P3AD 1P3MD 1ID3D 3NQUB 5B0YA 4KGCB 5GT0B 5B1MB 3UTBC 3RELB 4YS3B 2FJ7D 3LZ1C 4YM6C 5F99D 1M18B 1EQZC 5F99B 2NQBD 3B0CT 5JRGB 4R8PA 4NE3A 4WZSB 4H9OB 3AN2D 4G91C 1KX3C 3B0CW 3WKJB 3AV2B 1ZLAC 4J8UC 5B0ZD 4X23D 4ZBJC 3AZIC 1AOIB 4X23B
chains in the Genus database with same CATH superfamily
3LELB 3REKB 4J8VC 1P3GD 3NQJB 5B0YD 2YFVA 4XUJD 5B0YB 3REHA 3WAAA 3MGSD 3AYWA 4Z2MG 3W96A 3C1CC 5GSUC 3LJAD 3B0DB 4QLCD 5AV8D 1F66C 3WA9D 4R8PB 3LZ0A 3AZEA 1S32C 4NFTA 2DQNC 2Y2MA 4M6BA 3A6NA 4AWLC 2F8NH 3AZFD 2Y2LA 1P3KD 3W97C 4EO5B 5AVBC 2XD5A 1A7WA 1P3FA 5AV6A 2YFVB 5B40C 3B6FD 3WAAB 3REHB 3AYWB 5BNXA 2L5AA 3AZMA 2G5HC 3W96B 5B2JA 3X1UA 5CPJA 2VQRA 4WU8C 3X1SD 3MNNA 5BS7A 5DNNC 3KWQC 1P3ID 1BH9A 3LZ0B 3B6GC 2YFWA 3AZEB 3W98A 5JA4A 3TU4D 2CV5A 3AV1B 3A6NB 1KX4C 4J8XD 3V9RA 3W99A 4LD9D 4ZUXD 2JSSA 5B1LD 1P3FD 3IP4C 3AZHC 5AVCA 3AZJC 1U35A 1P3FB 5AV6B 5CHLB 2PYOA 2NZDA 4NE6A 3AZMD 5BNXB 3AZMB 3X1VC 5DNMD 5B2JB 5B24A 2F8ND 5B33A 3X1UB 5CPJB 5GXQD 3O62A 3MNNB 5E5AC 1BH9B 3FDDA 3KUYD 2YFWB 3W98B 2DF4C 5JA4B 3MVDA 4DRBA 2CV5B 2Y2JA 3AZGC 5FUGA 2FFFB 2F8NK 3V9RB 3W99B 1HQ3A 4H9SA 3WTPC 4JJNA 1U35D 3AZNC 1P3LD 1U35B 5AVCB 2NZDB 1M19C 1ULYA 2PYOB 4J8WC 1WWSA 4G92C 2XD1A 3AZKA 5B2IC 3UTAC 1TZYA 5B24B 5B33B 5AY8C 3O62B 3MGRA 5CPKA 1KX5D 5CPIA 3VH6T 3MGPC 4CSRA 5GT3D 3MVDB 3X1TA 3VH6W 4XZQA 3REIC 3UT9D 5FUGB 1P3AA 1P3MA 1ID3A 1HQ3D 3C1BB 3KXBD 2W8SA 4JJNB 3AFAB 3UTBD 3VH5A 2NQBA 3LZ1D 4YM6D 1EQZD 3AZKB 1TZYD 1B6WA 1TZYB 4Z5TC 5CP6C 1KX3D 5B0ZA 3MGRB 5CPKB 2Y2OA 3EPJA 5CPIB 1ZLAD 4CSRB 1P3GA 4J8UD 3AZID 4KUDC 4CAYA 3X1TB 1PZRA 4XZQB 1P3AB 1P3MB 4J8VD 4XUJA 1ID3B 5B32C 3AZLC 1P3BC 3MGSA 3EPHA 2F8NG 2FJ7B 3MGQC 3LJAA 4E44A 5BNVA 4QLCA 3H0LC 5AV8A 2NQBB 3C1CD 3WA9A 5GSUD 3AN2B 2HUEB 1F66D 1M1AC 2AROC 1S32D 2G5IC 5B0ZB 3C1BC 3AZFA 1P3KA 1P3GB 4CAYB 4WU9C 3B0BA 4H9NA 1P3PC 1Q9CA 3W97D 3B6FA 4XUJB 5AVBD 1P3OC 4Z66C 3MGSB 3A1KA 5B40D 1P34C 3REJC 3LJAB 4QLCB 5BNVB 5AV8B 3X1SA 5B31C 4HGAC 1P3IA 3WA9B 5AV9C 5AV5C 4WU8D 5DNND 3TU4A 4KGCC 3B6GD 4DRAA 5GT0C 5B1MC 4J8XA 5C3IB 3RELC 4YS3C 4LD9A 4ZUXA 1M18C 3AZFB 1P3KB 1KX4D 2FJ7C 5B1LA 4WV4B 5F99C 3AZGA 2F2AC 5JRGC 4H9NB 3B6FB 5G49A 3WKJC 3R45A 3AZHD 3AZJD 3AV2C 1H3OA 3WTPE 1JFIA 5DNMA 2F8NA 1AOIC 3EG5B 5GXQA 4X23C 3X1SB 3LELC 4H9PA 3REKC 3X1VD 1P3IB 3KUYA 3KSYA 5E5AD 3TU4B 5B0YC 2BG1A 4J8XB 4LD9B 5KDMA 4ZUXB 3AZGD 5B1LB 3B0DC 1P3LA 4R8PC 3WTPD 5G49B 3AZND 3R45B 1M19D 1H3OB 4J8WD 1JFIB 5DNMB 2F8NB 2RIQA 5GXQB 5B2ID 3UTAD 4EO5C 4H9PB 1KX5A 3H0RC 5GT3A 3KUYB 3WAAC 3REHC 3AYWC 3MGPD 2HIOA 1N1JA 3UT9A 2IO5B 3W96C 5KDMB 3EPLA 3KXBA 3REID 1P3LB 3UTBA 3LZ0C 2Y2PA 5BT1C 3AZEC 3LZ1A 4YM6A 1EQZA 3AV1C 3A6NC 1KX3A 4Z5TD 1KX5B 1ZLAA 1BH8A 5GT3B 5CP6D 1P3FC 1WWIA 5AV6C 4J8UA 3AZIA 2HIOD 2HIOB 1N1JB 3UT9B 4J8VA 3AZMC 4KUDD 1HQ3B 5B2JC 3X1UC 5CPJC 3KXBB 5B32D 3MNNC 3AZLD 1P3BD 5BS7C 3UTBB 2ZY3A 3W98C 1P34A 3LZ1B 3C1CA 4YM6B 1EQZB 5GSUA 2CV5C 4NE5A 3MGQD 1F66A 3W99C 4G91B 1S32A 1KX3B 1M1AD 1ZLAB 1BH8B 2Y2NA 5AVCC 1U35C 2NZDC 4J8UB 3AZIB 2PYOC 4WJ3C 4YS3A 3W97A 4J8VB 5AVBA 3A1IA 5B24C 5BO0A 4WU9D 5B33C 1P3PD 5B40A 4H9RA 4UPKA 3O62C 1P3OD 4Z66D 1P34D 1Z2CB 3REJD 3C1CB 3MVDC 5GSUB 4WU8A 5B31D 3KWQA 5DNNA 1F66B 5AV9D 3B6GA 5AV5D 1HQ3C 1S32B 4H9SC 4JJNC 3AFAC 4KGCD 1KX4A 5GT0D 5B1MD 4AWLB 1BFMA 3RELD 4YS3D 1W2EA 1M18D 3AZKC 4E45A 3W97B 5AVBB 2RVQC 1TZYC 5JRGD 5BO0B 3AZJA 2JE5A 3AZHA 5B40B 4H9RB 1T3UA 2LY8A 3MGRC 5CPKC 3WKJD 5CPIC 2J8PA 3AV2D 3X1VA 1AOID 2Y2IA 4H9QA 3X1TC 3KWQD 3AL0C 4WU8B 4XZQC 5E5AA 3LELD 3KWQB 5DNNB 2BYMA 3REKD 1P3AC 1P3MC 1ID3C 3B6GB 1R4VA 1KX4B 5B32G 2NQBC 3WTPA 3AN2C 2HUEC 3AZNA 3AZHB 3AZJB 4R8PD 1M19A 4J8WA 3KFUG 5B0ZC 5B2IA 3UTAA 3X1VB 1P3GC 3EPKA 3AV1A 5AY8A 4H9QB 4KHAA 5E5AB 1HTAA 4XUJC 2BYMB 3MGSC 3MGPA 3WAAD 3REHD 3AYWD 3REIA 3AZGB 3LJAC 4QLCC 3W96D 5AV8C 2UWXA 3WA9C 3WTPB 3AZNB 3LZ0D 5B31G 1M19B 4J8WB 5BT1D 3AZED 4G92B 2Y2KA 5C3IC 2BYKA 2CWEA 5B2IB 3AZFC 3AV1D 5AY8D 4Z2MH 3A6ND 3UTAB 4Z5TA 1P3KC 1KU5A 5AY8B 4KHAB 5CP6A 3B6FC 3MGPB 5AV6D 4KUDA 3F6TA 3REIB 5B32A 3AZLA 3X1SC 5B2JD 1P3BA 1P3IC 3X1UD 5CPJD 3H0MC 3MNND 3TU4C 3MGQA 3W98D 4J8XC 4LD9C 2BYKB 2Y2QA 4DQYB 4ZUXC 3VH5T 2CV5D 5B1LC 4Z5TB 3W99D 1M1AA 3VH5W 5CP6B 2AROA 3C1BA 2NZDD 5AVCD 3AFAA 2PYOD 4KUDB 5DNMC 4UUZA 4WU9A 1P3PA 5GXQC 1F1EA 5B32B 3AZLB 1P3BB 4Z66A 5B24D 1TAFA 5B33D 1P3OA 3REJA 3KUYC 3O62D 4WNNA 2JCHA 3MGQB 5B31A 2IO5C 3MVDD 5AV9A 5AV5A 3NQUA 2AROD 1M1AB 1P3LC 4KGCA 4ZBJB 3C1BD 3P5JB 2AROB 5B1MA 5GT0A 4JJND 3RELA 3AFAD 2ZM5A 1M18A 2FJ7A 5F99A 3VH6A 4UUZB 5JRGA 4WU9B 1P3PB 3AZKD 4H9OA 2RVQD 1P3OB 4Z66B 3AN2A 1TAFB 1KX5C 2Y2HA 3WKJA 3AV2A 1P34B 5GT3C 3REJB 1AOIA 4WNNB 3MGRD 5CPKD 5CPID 2ZY4A 4X23A 1B67A 2HIOC 3LELA 3UT9C 5B31B 3REKA 4HGAB 3X1TD 5AV9B 3NQJA 5AV5B 3KXBC 4XZQD 1P3AD 1P3MD 1ID3D 3NQUB 5B0YA 4KGCB 5GT0B 5B1MB 3UTBC 3RELB 4YS3B 2FJ7D 3LZ1C 4YM6C 2Y2GA 5F99D 1M18B 1EQZC 2ZY5A 5F99B 2NQBD 3B0CT 5JRGB 4R8PA 4NE3A 4WZSB 4H9OB 3AN2D 4G91C 1KX3C 3B0CW 3WKJB 3AV2B 1ZLAC 4J8UC 2ZY2A 5B0ZD 4ZBJC 4X23D 3AZIC 1AOIB 4X23B
chains in the Genus database with same CATH topology
3LELB 3REKB 4J8VC 1P3GD 3NQJB 5B0YD 2YFVA 4XUJD 5B0YB 3REHA 3WAAA 3MGSD 3AYWA 4Z2MG 3W96A 3C1CC 5GSUC 3LJAD 3B0DB 4QLCD 5AV8D 1F66C 3WA9D 4R8PB 3LZ0A 3AZEA 1S32C 4NFTA 2DQNC 2Y2MA 4M6BA 3A6NA 4AWLC 2F8NH 3AZFD 2Y2LA 1P3KD 3W97C 4EO5B 5AVBC 2XD5A 1A7WA 1P3FA 5AV6A 2YFVB 5B40C 3B6FD 3WAAB 3REHB 3AYWB 5BNXA 2L5AA 3AZMA 2G5HC 3W96B 5B2JA 3X1UA 5CPJA 2VQRA 4WU8C 3X1SD 3MNNA 5BS7A 5DNNC 3KWQC 1P3ID 1BH9A 3LZ0B 3B6GC 2YFWA 3AZEB 3W98A 5JA4A 3TU4D 2CV5A 3AV1B 3A6NB 1KX4C 4J8XD 3V9RA 3W99A 4LD9D 4ZUXD 2JSSA 5B1LD 1P3FD 3IP4C 3AZHC 5AVCA 3AZJC 1U35A 1P3FB 5AV6B 5CHLB 2PYOA 2NZDA 4NE6A 3AZMD 5BNXB 3AZMB 3X1VC 5DNMD 5B2JB 5B24A 2F8ND 5B33A 3X1UB 5CPJB 5GXQD 3O62A 3MNNB 5E5AC 1BH9B 3FDDA 3KUYD 2YFWB 3W98B 2DF4C 5JA4B 3MVDA 4DRBA 2CV5B 2Y2JA 3AZGC 5FUGA 2FFFB 2F8NK 3V9RB 3W99B 1HQ3A 4H9SA 3WTPC 4JJNA 1U35D 3AZNC 1P3LD 1U35B 5AVCB 2NZDB 1M19C 1ULYA 2PYOB 4J8WC 1WWSA 4G92C 2XD1A 3AZKA 5B2IC 3UTAC 1TZYA 5B24B 5B33B 5AY8C 3O62B 3MGRA 5CPKA 1KX5D 5CPIA 3VH6T 3MGPC 4CSRA 5GT3D 3MVDB 3X1TA 3VH6W 4XZQA 3REIC 3UT9D 5FUGB 1P3AA 1P3MA 1ID3A 1HQ3D 3C1BB 3KXBD 2W8SA 4JJNB 3AFAB 3UTBD 3VH5A 2NQBA 3LZ1D 4YM6D 1EQZD 3AZKB 1TZYD 1B6WA 1TZYB 4Z5TC 5CP6C 1KX3D 5B0ZA 3MGRB 5CPKB 2Y2OA 3EPJA 5CPIB 1ZLAD 4CSRB 1P3GA 4J8UD 3AZID 4KUDC 4CAYA 3X1TB 1PZRA 4XZQB 1P3AB 1P3MB 4J8VD 4XUJA 1ID3B 5B32C 3AZLC 1P3BC 3MGSA 3EPHA 2F8NG 2FJ7B 3MGQC 3LJAA 4E44A 5BNVA 4QLCA 3H0LC 5AV8A 2NQBB 3C1CD 3WA9A 5GSUD 3AN2B 2HUEB 1F66D 1M1AC 2AROC 1S32D 2G5IC 5B0ZB 3C1BC 3AZFA 1P3KA 1P3GB 4CAYB 4WU9C 3B0BA 4H9NA 1P3PC 1Q9CA 3W97D 3B6FA 4XUJB 5AVBD 1P3OC 4Z66C 3MGSB 3A1KA 5B40D 1P34C 3REJC 3LJAB 4QLCB 5BNVB 5AV8B 3X1SA 5B31C 4HGAC 1P3IA 3WA9B 5AV9C 5AV5C 4WU8D 5DNND 3TU4A 4KGCC 3B6GD 4DRAA 5GT0C 5B1MC 4J8XA 5C3IB 3RELC 4YS3C 4LD9A 4ZUXA 1M18C 3AZFB 1P3KB 1KX4D 2FJ7C 5B1LA 4WV4B 5F99C 3AZGA 2F2AC 5JRGC 4H9NB 3B6FB 5G49A 3WKJC 3R45A 3AZHD 3AZJD 3AV2C 1H3OA 3WTPE 1JFIA 5DNMA 2F8NA 1AOIC 3EG5B 5GXQA 4X23C 3X1SB 3LELC 4H9PA 3REKC 3X1VD 1P3IB 3KUYA 3KSYA 5E5AD 3TU4B 5B0YC 2BG1A 4J8XB 4LD9B 5KDMA 4ZUXB 3AZGD 5B1LB 3B0DC 1P3LA 4R8PC 3WTPD 5G49B 3AZND 3R45B 1M19D 1H3OB 4J8WD 1JFIB 5DNMB 2F8NB 2RIQA 5GXQB 5B2ID 3UTAD 4EO5C 4H9PB 1KX5A 3H0RC 5GT3A 3KUYB 3WAAC 3REHC 3AYWC 3MGPD 2HIOA 1N1JA 3UT9A 2IO5B 3W96C 5KDMB 3EPLA 3KXBA 3REID 1P3LB 3UTBA 3LZ0C 2Y2PA 5BT1C 3AZEC 3LZ1A 4YM6A 1EQZA 3AV1C 3A6NC 1KX3A 4Z5TD 1KX5B 1ZLAA 1BH8A 5GT3B 5CP6D 1P3FC 1WWIA 5AV6C 4J8UA 3AZIA 2HIOD 2HIOB 1N1JB 3UT9B 4J8VA 3AZMC 4KUDD 1HQ3B 5B2JC 3X1UC 5CPJC 3KXBB 5B32D 3MNNC 3AZLD 1P3BD 5BS7C 3UTBB 2ZY3A 3W98C 1P34A 3LZ1B 3C1CA 4YM6B 1EQZB 5GSUA 2CV5C 4NE5A 3MGQD 1F66A 3W99C 4G91B 1S32A 1KX3B 1M1AD 1ZLAB 1BH8B 2Y2NA 5AVCC 1U35C 2NZDC 4J8UB 3AZIB 2PYOC 4WJ3C 4YS3A 3W97A 4J8VB 5AVBA 3A1IA 5B24C 5BO0A 4WU9D 5B33C 1P3PD 5B40A 4H9RA 4UPKA 3O62C 1P3OD 4Z66D 1P34D 1Z2CB 3REJD 3C1CB 3MVDC 5GSUB 4WU8A 5B31D 3KWQA 5DNNA 1F66B 5AV9D 3B6GA 5AV5D 1HQ3C 1S32B 4H9SC 4JJNC 3AFAC 4KGCD 1KX4A 5GT0D 5B1MD 4AWLB 1BFMA 3RELD 4YS3D 1W2EA 1M18D 3AZKC 4E45A 3W97B 5AVBB 2RVQC 1TZYC 5JRGD 5BO0B 3AZJA 2JE5A 3AZHA 5B40B 4H9RB 1T3UA 2LY8A 3MGRC 5CPKC 3WKJD 5CPIC 2J8PA 3AV2D 3X1VA 1AOID 2Y2IA 4H9QA 3X1TC 3KWQD 3AL0C 4WU8B 4XZQC 5E5AA 3LELD 3KWQB 5DNNB 2BYMA 3REKD 1P3AC 1P3MC 1ID3C 3B6GB 1R4VA 1KX4B 5B32G 2NQBC 3WTPA 3AN2C 2HUEC 3AZNA 3AZHB 3AZJB 4R8PD 1M19A 4J8WA 3KFUG 5B0ZC 5B2IA 3UTAA 3X1VB 1P3GC 3EPKA 3AV1A 5AY8A 4H9QB 4KHAA 5E5AB 1HTAA 4XUJC 2BYMB 3MGSC 3MGPA 3WAAD 3REHD 3AYWD 3REIA 3AZGB 3LJAC 4QLCC 3W96D 5AV8C 2UWXA 3WA9C 3WTPB 3AZNB 3LZ0D 5B31G 1M19B 4J8WB 5BT1D 3AZED 4G92B 2Y2KA 5C3IC 2BYKA 2CWEA 5B2IB 3AZFC 3AV1D 5AY8D 4Z2MH 3A6ND 3UTAB 4Z5TA 1P3KC 1KU5A 5AY8B 4KHAB 5CP6A 3B6FC 3MGPB 5AV6D 4KUDA 3F6TA 3REIB 5B32A 3AZLA 3X1SC 5B2JD 1P3BA 1P3IC 3X1UD 5CPJD 3H0MC 3MNND 3TU4C 3MGQA 3W98D 4J8XC 4LD9C 2BYKB 2Y2QA 4DQYB 4ZUXC 3VH5T 2CV5D 5B1LC 4Z5TB 3W99D 1M1AA 3VH5W 5CP6B 2AROA 3C1BA 2NZDD 5AVCD 3AFAA 2PYOD 4KUDB 5DNMC 4UUZA 4WU9A 1P3PA 5GXQC 1F1EA 5B32B 3AZLB 1P3BB 4Z66A 5B24D 1TAFA 5B33D 1P3OA 3REJA 3KUYC 3O62D 4WNNA 2JCHA 3MGQB 5B31A 2IO5C 3MVDD 5AV9A 5AV5A 3NQUA 2AROD 1M1AB 1P3LC 4KGCA 4ZBJB 3C1BD 3P5JB 2AROB 5B1MA 5GT0A 4JJND 3RELA 3AFAD 2ZM5A 1M18A 2FJ7A 5F99A 3VH6A 4UUZB 5JRGA 4WU9B 1P3PB 3AZKD 4H9OA 2RVQD 1P3OB 4Z66B 3AN2A 1TAFB 1KX5C 2Y2HA 3WKJA 3AV2A 1P34B 5GT3C 3REJB 1AOIA 4WNNB 3MGRD 5CPKD 5CPID 2ZY4A 4X23A 1B67A 2HIOC 3LELA 3UT9C 5B31B 3REKA 4HGAB 3X1TD 5AV9B 3NQJA 5AV5B 3KXBC 4XZQD 1P3AD 1P3MD 1ID3D 3NQUB 5B0YA 4KGCB 5GT0B 5B1MB 3UTBC 3RELB 4YS3B 2FJ7D 3LZ1C 4YM6C 2Y2GA 5F99D 1M18B 1EQZC 2ZY5A 5F99B 2NQBD 3B0CT 5JRGB 4R8PA 4NE3A 4WZSB 4H9OB 3AN2D 4G91C 1KX3C 3B0CW 3WKJB 3AV2B 1ZLAC 4J8UC 2ZY2A 5B0ZD 4ZBJC 4X23D 3AZIC 1AOIB 4X23B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL B;  3REK B;  4J8V C;  1P3G D;  3NQJ B;  5B0Y D;  2YFV A;  4XUJ D;  5B0Y B;  3REH A;  3WAA A;  3MGS D;  3AYW A;  4Z2M G;  3W96 A;  3C1C C;  5GSU C;  3LJA D;  3B0D B;  4QLC D;  5AV8 D;  1F66 C;  3WA9 D;  4R8P B;  3LZ0 A;  3AZE A;  1S32 C;  4NFT A;  4M6B A;  3A6N A;  4AWL C;  2F8N H;  3AZF D;  1P3K D;  3W97 C;  4EO5 B;  5AVB C;  1A7W A;  1P3F A;  5AV6 A;  2YFV B;  5B40 C;  3B6F D;  3WAA B;  3REH B;  3AYW B;  5BNX A;  2L5A A;  3AZM A;  3W96 B;  5B2J A;  3X1U A;  5CPJ A;  4WU8 C;  3X1S D;  3MNN A;  5BS7 A;  5DNN C;  3KWQ C;  1P3I D;  1BH9 A;  3LZ0 B;  3B6G C;  2YFW A;  3AZE B;  3W98 A;  5JA4 A;  3TU4 D;  2CV5 A;  3AV1 B;  3A6N B;  1KX4 C;  4J8X D;  3V9R A;  3W99 A;  4LD9 D;  4ZUX D;  2JSS A;  5B1L D;  1P3F D;  3AZH C;  5AVC A;  3AZJ C;  1U35 A;  1P3F B;  5AV6 B;  5CHL B;  2PYO A;  2NZD A;  4NE6 A;  3AZM D;  5BNX B;  3AZM B;  3X1V C;  5DNM D;  5B2J B;  5B24 A;  2F8N D;  5B33 A;  3X1U B;  5CPJ B;  5GXQ D;  3O62 A;  3MNN B;  5E5A C;  1BH9 B;  3KUY D;  2YFW B;  3W98 B;  5JA4 B;  3MVD A;  4DRB A;  2CV5 B;  3AZG C;  5FUG A;  2F8N K;  3V9R B;  3W99 B;  1HQ3 A;  4H9S A;  3WTP C;  4JJN A;  1U35 D;  3AZN C;  1P3L D;  1U35 B;  5AVC B;  2NZD B;  1M19 C;  1ULY A;  2PYO B;  4J8W C;  1WWS A;  4G92 C;  3AZK A;  5B2I C;  3UTA C;  1TZY A;  5B24 B;  5B33 B;  5AY8 C;  3O62 B;  3MGR A;  5CPK A;  1KX5 D;  5CPI A;  3VH6 T;  3MGP C;  4CSR A;  5GT3 D;  3MVD B;  3X1T A;  3VH6 W;  4XZQ A;  3REI C;  3UT9 D;  5FUG B;  1P3A A;  1P3M A;  1ID3 A;  1HQ3 D;  3C1B B;  3KXB D;  4JJN B;  3AFA B;  3UTB D;  3VH5 A;  2NQB A;  3LZ1 D;  4YM6 D;  1EQZ D;  3AZK B;  1TZY D;  1B6W A;  1TZY B;  4Z5T C;  5CP6 C;  1KX3 D;  5B0Z A;  3MGR B;  5CPK B;  5CPI B;  1ZLA D;  4CSR B;  1P3G A;  4J8U D;  3AZI D;  4KUD C;  4CAY A;  3X1T B;  4XZQ B;  1P3A B;  1P3M B;  4J8V D;  4XUJ A;  1ID3 B;  5B32 C;  3AZL C;  1P3B C;  3MGS A;  2F8N G;  2FJ7 B;  3MGQ C;  3LJA A;  4E44 A;  5BNV A;  4QLC A;  5AV8 A;  2NQB B;  3C1C D;  3WA9 A;  5GSU D;  3AN2 B;  2HUE B;  1F66 D;  1M1A C;  2ARO C;  1S32 D;  5B0Z B;  3C1B C;  3AZF A;  1P3K A;  1P3G B;  4CAY B;  4WU9 C;  3B0B A;  4H9N A;  1P3P C;  1Q9C A;  3W97 D;  3B6F A;  4XUJ B;  5AVB D;  1P3O C;  4Z66 C;  3MGS B;  1P34 C;  5B40 D;  3REJ C;  3LJA B;  4QLC B;  5BNV B;  5AV8 B;  3X1S A;  5B31 C;  4HGA C;  1P3I A;  3WA9 B;  5AV9 C;  5AV5 C;  4WU8 D;  5DNN D;  3TU4 A;  4KGC C;  3B6G D;  4DRA A;  5GT0 C;  5B1M C;  4J8X A;  5C3I B;  3REL C;  4YS3 C;  4LD9 A;  4ZUX A;  1M18 C;  3AZF B;  1P3K B;  1KX4 D;  2FJ7 C;  5B1L A;  4WV4 B;  5F99 C;  3AZG A;  5JRG C;  4H9N B;  3B6F B;  5G49 A;  3WKJ C;  3R45 A;  3AZH D;  3AZJ D;  3AV2 C;  1H3O A;  3WTP E;  1JFI A;  5DNM A;  2F8N A;  1AOI C;  5GXQ A;  4X23 C;  3X1S B;  3LEL C;  4H9P A;  3REK C;  3X1V D;  1P3I B;  3KUY A;  3KSY A;  5E5A D;  3TU4 B;  5B0Y C;  4J8X B;  4LD9 B;  5KDM A;  4ZUX B;  3AZG D;  5B1L B;  3B0D C;  1P3L A;  4R8P C;  3WTP D;  5G49 B;  3AZN D;  3R45 B;  1M19 D;  1H3O B;  4J8W D;  1JFI B;  5DNM B;  2F8N B;  5GXQ B;  5B2I D;  3UTA D;  4EO5 C;  4H9P B;  1KX5 A;  5GT3 A;  3KUY B;  3WAA C;  3REH C;  3AYW C;  3MGP D;  2HIO A;  1N1J A;  3UT9 A;  2IO5 B;  3W96 C;  5KDM B;  3KXB A;  3REI D;  1P3L B;  3UTB A;  3LZ0 C;  5BT1 C;  3AZE C;  3LZ1 A;  4YM6 A;  1EQZ A;  3AV1 C;  3A6N C;  1KX3 A;  4Z5T D;  1KX5 B;  1ZLA A;  1BH8 A;  5GT3 B;  5CP6 D;  1P3F C;  1WWI A;  5AV6 C;  4J8U A;  3AZI A;  2HIO D;  2HIO B;  1N1J B;  3UT9 B;  4J8V A;  3AZM C;  4KUD D;  1HQ3 B;  5B2J C;  3X1U C;  5CPJ C;  3KXB B;  5B32 D;  3MNN C;  3AZL D;  1P3B D;  5BS7 C;  3UTB B;  3W98 C;  1P34 A;  3LZ1 B;  3C1C A;  4YM6 B;  1EQZ B;  5GSU A;  2CV5 C;  4NE5 A;  3MGQ D;  1F66 A;  3W99 C;  4G91 B;  1S32 A;  1KX3 B;  1M1A D;  1ZLA B;  1BH8 B;  5AVC C;  1U35 C;  2NZD C;  4J8U B;  3AZI B;  2PYO C;  4YS3 A;  3W97 A;  4J8V B;  5AVB A;  5B24 C;  5BO0 A;  4WU9 D;  5B33 C;  1P3P D;  5B40 A;  4H9R A;  3O62 C;  1P3O D;  4Z66 D;  1P34 D;  3REJ D;  3C1C B;  3MVD C;  5GSU B;  4WU8 A;  5B31 D;  3KWQ A;  5DNN A;  1F66 B;  5AV9 D;  3B6G A;  5AV5 D;  1HQ3 C;  1S32 B;  4H9S C;  4JJN C;  3AFA C;  4KGC D;  1KX4 A;  5GT0 D;  5B1M D;  4AWL B;  1BFM A;  3REL D;  4YS3 D;  1M18 D;  3AZK C;  4E45 A;  3W97 B;  5AVB B;  2RVQ C;  1TZY C;  5JRG D;  5BO0 B;  3AZJ A;  3AZH A;  5B40 B;  4H9R B;  2LY8 A;  3MGR C;  5CPK C;  3WKJ D;  5CPI C;  3AV2 D;  3X1V A;  1AOI D;  4H9Q A;  3X1T C;  3KWQ D;  4WU8 B;  4XZQ C;  5E5A A;  3LEL D;  3KWQ B;  5DNN B;  2BYM A;  3REK D;  1P3A C;  1P3M C;  1ID3 C;  3B6G B;  1R4V A;  1KX4 B;  5B32 G;  2NQB C;  3WTP A;  3AN2 C;  2HUE C;  3AZN A;  3AZH B;  3AZJ B;  4R8P D;  1M19 A;  4J8W A;  5B0Z C;  5B2I A;  3UTA A;  3X1V B;  1P3G C;  3AV1 A;  5AY8 A;  4H9Q B;  4KHA A;  5E5A B;  1HTA A;  4XUJ C;  2BYM B;  3MGS C;  3MGP A;  3WAA D;  3REH D;  3AYW D;  3REI A;  3AZG B;  3LJA C;  4QLC C;  3W96 D;  5AV8 C;  3WA9 C;  3WTP B;  3AZN B;  3LZ0 D;  5B31 G;  1M19 B;  4J8W B;  5BT1 D;  3AZE D;  4G92 B;  5C3I C;  2BYK A;  2CWE A;  5B2I B;  3AZF C;  3AV1 D;  5AY8 D;  4Z2M H;  3A6N D;  3UTA B;  4Z5T A;  1P3K C;  1KU5 A;  5AY8 B;  4KHA B;  5CP6 A;  3B6F C;  3MGP B;  5AV6 D;  4KUD A;  3REI B;  5B32 A;  3AZL A;  3X1S C;  5B2J D;  1P3B A;  1P3I C;  3X1U D;  5CPJ D;  3MNN D;  3TU4 C;  3MGQ A;  3W98 D;  4J8X C;  4LD9 C;  2BYK B;  2CV5 D;  4ZUX C;  3VH5 T;  5B1L C;  4Z5T B;  3W99 D;  1M1A A;  3VH5 W;  5CP6 B;  2ARO A;  3C1B A;  2NZD D;  5AVC D;  3AFA A;  2PYO D;  4KUD B;  5DNM C;  4UUZ A;  4WU9 A;  1P3P A;  5GXQ C;  1F1E A;  5B32 B;  3AZL B;  1P3B B;  4Z66 A;  5B24 D;  1TAF A;  5B33 D;  1P3O A;  3REJ A;  3KUY C;  3O62 D;  4WNN A;  3MGQ B;  5B31 A;  2IO5 C;  3MVD D;  5AV9 A;  5AV5 A;  3NQU A;  2ARO D;  1M1A B;  1P3L C;  4KGC A;  4ZBJ B;  3C1B D;  2ARO B;  5B1M A;  5GT0 A;  4JJN D;  3REL A;  3AFA D;  1M18 A;  2FJ7 A;  5F99 A;  3VH6 A;  4UUZ B;  5JRG A;  4WU9 B;  1P3P B;  3AZK D;  4H9O A;  2RVQ D;  1P3O B;  4Z66 B;  3AN2 A;  1TAF B;  1KX5 C;  3WKJ A;  3AV2 A;  1P34 B;  5GT3 C;  3REJ B;  1AOI A;  4WNN B;  3MGR D;  5CPK D;  5CPI D;  4X23 A;  1B67 A;  2HIO C;  3LEL A;  3UT9 C;  5B31 B;  3REK A;  4HGA B;  3X1T D;  5AV9 B;  3NQJ A;  5AV5 B;  3KXB C;  4XZQ D;  1P3A D;  1P3M D;  1ID3 D;  3NQU B;  5B0Y A;  4KGC B;  5GT0 B;  5B1M B;  3UTB C;  3REL B;  4YS3 B;  2FJ7 D;  3LZ1 C;  4YM6 C;  5F99 D;  1M18 B;  1EQZ C;  5F99 B;  2NQB D;  3B0C T;  5JRG B;  4R8P A;  4NE3 A;  4WZS B;  4H9O B;  3AN2 D;  4G91 C;  1KX3 C;  3B0C W;  3WKJ B;  3AV2 B;  1ZLA C;  4J8U C;  5B0Z D;  4X23 D;  4ZBJ C;  3AZI C;  1AOI B;  4X23 B; 
#chains in the Genus database with same CATH topology
 3LEL B;  3REK B;  4J8V C;  1P3G D;  3NQJ B;  5B0Y D;  2YFV A;  4XUJ D;  5B0Y B;  3REH A;  3WAA A;  3MGS D;  3AYW A;  4Z2M G;  3W96 A;  3C1C C;  5GSU C;  3LJA D;  3B0D B;  4QLC D;  5AV8 D;  1F66 C;  3WA9 D;  4R8P B;  3LZ0 A;  3AZE A;  1S32 C;  4NFT A;  2DQN C;  2Y2M A;  4M6B A;  3A6N A;  4AWL C;  2F8N H;  3AZF D;  2Y2L A;  1P3K D;  3W97 C;  4EO5 B;  5AVB C;  2XD5 A;  1A7W A;  1P3F A;  5AV6 A;  2YFV B;  5B40 C;  3B6F D;  3WAA B;  3REH B;  3AYW B;  5BNX A;  2L5A A;  3AZM A;  2G5H C;  3W96 B;  5B2J A;  3X1U A;  5CPJ A;  2VQR A;  4WU8 C;  3X1S D;  3MNN A;  5BS7 A;  5DNN C;  3KWQ C;  1P3I D;  1BH9 A;  3LZ0 B;  3B6G C;  2YFW A;  3AZE B;  3W98 A;  5JA4 A;  3TU4 D;  2CV5 A;  3AV1 B;  3A6N B;  1KX4 C;  4J8X D;  3V9R A;  3W99 A;  4LD9 D;  4ZUX D;  2JSS A;  5B1L D;  1P3F D;  3IP4 C;  3AZH C;  5AVC A;  3AZJ C;  1U35 A;  1P3F B;  5AV6 B;  5CHL B;  2PYO A;  2NZD A;  4NE6 A;  3AZM D;  5BNX B;  3AZM B;  3X1V C;  5DNM D;  5B2J B;  5B24 A;  2F8N D;  5B33 A;  3X1U B;  5CPJ B;  5GXQ D;  3O62 A;  3MNN B;  5E5A C;  1BH9 B;  3FDD A;  3KUY D;  2YFW B;  3W98 B;  2DF4 C;  5JA4 B;  3MVD A;  4DRB A;  2CV5 B;  2Y2J A;  3AZG C;  5FUG A;  2FFF B;  2F8N K;  3V9R B;  3W99 B;  1HQ3 A;  4H9S A;  3WTP C;  4JJN A;  1U35 D;  3AZN C;  1P3L D;  1U35 B;  5AVC B;  2NZD B;  1M19 C;  1ULY A;  2PYO B;  4J8W C;  1WWS A;  4G92 C;  2XD1 A;  3AZK A;  5B2I C;  3UTA C;  1TZY A;  5B24 B;  5B33 B;  5AY8 C;  3O62 B;  3MGR A;  5CPK A;  1KX5 D;  5CPI A;  3VH6 T;  3MGP C;  4CSR A;  5GT3 D;  3MVD B;  3X1T A;  3VH6 W;  4XZQ A;  3REI C;  3UT9 D;  5FUG B;  1P3A A;  1P3M A;  1ID3 A;  1HQ3 D;  3C1B B;  3KXB D;  2W8S A;  4JJN B;  3AFA B;  3UTB D;  3VH5 A;  2NQB A;  3LZ1 D;  4YM6 D;  1EQZ D;  3AZK B;  1TZY D;  1B6W A;  1TZY B;  4Z5T C;  5CP6 C;  1KX3 D;  5B0Z A;  3MGR B;  5CPK B;  2Y2O A;  3EPJ A;  5CPI B;  1ZLA D;  4CSR B;  1P3G A;  4J8U D;  3AZI D;  4KUD C;  4CAY A;  3X1T B;  1PZR A;  4XZQ B;  1P3A B;  1P3M B;  4J8V D;  4XUJ A;  1ID3 B;  5B32 C;  3AZL C;  1P3B C;  3MGS A;  3EPH A;  2F8N G;  2FJ7 B;  3MGQ C;  3LJA A;  4E44 A;  5BNV A;  4QLC A;  3H0L C;  5AV8 A;  2NQB B;  3C1C D;  3WA9 A;  5GSU D;  3AN2 B;  2HUE B;  1F66 D;  1M1A C;  2ARO C;  1S32 D;  2G5I C;  5B0Z B;  3C1B C;  3AZF A;  1P3K A;  1P3G B;  4CAY B;  4WU9 C;  3B0B A;  4H9N A;  1P3P C;  1Q9C A;  3W97 D;  3B6F A;  4XUJ B;  5AVB D;  1P3O C;  4Z66 C;  3MGS B;  3A1K A;  5B40 D;  1P34 C;  3REJ C;  3LJA B;  4QLC B;  5BNV B;  5AV8 B;  3X1S A;  5B31 C;  4HGA C;  1P3I A;  3WA9 B;  5AV9 C;  5AV5 C;  4WU8 D;  5DNN D;  3TU4 A;  4KGC C;  3B6G D;  4DRA A;  5GT0 C;  5B1M C;  4J8X A;  5C3I B;  3REL C;  4YS3 C;  4LD9 A;  4ZUX A;  1M18 C;  3AZF B;  1P3K B;  1KX4 D;  2FJ7 C;  5B1L A;  4WV4 B;  5F99 C;  3AZG A;  2F2A C;  5JRG C;  4H9N B;  3B6F B;  5G49 A;  3WKJ C;  3R45 A;  3AZH D;  3AZJ D;  3AV2 C;  1H3O A;  3WTP E;  1JFI A;  5DNM A;  2F8N A;  1AOI C;  3EG5 B;  5GXQ A;  4X23 C;  3X1S B;  3LEL C;  4H9P A;  3REK C;  3X1V D;  1P3I B;  3KUY A;  3KSY A;  5E5A D;  3TU4 B;  5B0Y C;  2BG1 A;  4J8X B;  4LD9 B;  5KDM A;  4ZUX B;  3AZG D;  5B1L B;  3B0D C;  1P3L A;  4R8P C;  3WTP D;  5G49 B;  3AZN D;  3R45 B;  1M19 D;  1H3O B;  4J8W D;  1JFI B;  5DNM B;  2F8N B;  2RIQ A;  5GXQ B;  5B2I D;  3UTA D;  4EO5 C;  4H9P B;  1KX5 A;  3H0R C;  5GT3 A;  3KUY B;  3WAA C;  3REH C;  3AYW C;  3MGP D;  2HIO A;  1N1J A;  3UT9 A;  2IO5 B;  3W96 C;  5KDM B;  3EPL A;  3KXB A;  3REI D;  1P3L B;  3UTB A;  3LZ0 C;  2Y2P A;  5BT1 C;  3AZE C;  3LZ1 A;  4YM6 A;  1EQZ A;  3AV1 C;  3A6N C;  1KX3 A;  4Z5T D;  1KX5 B;  1ZLA A;  1BH8 A;  5GT3 B;  5CP6 D;  1P3F C;  1WWI A;  5AV6 C;  4J8U A;  3AZI A;  2HIO D;  2HIO B;  1N1J B;  3UT9 B;  4J8V A;  3AZM C;  4KUD D;  1HQ3 B;  5B2J C;  3X1U C;  5CPJ C;  3KXB B;  5B32 D;  3MNN C;  3AZL D;  1P3B D;  5BS7 C;  3UTB B;  2ZY3 A;  3W98 C;  1P34 A;  3LZ1 B;  3C1C A;  4YM6 B;  1EQZ B;  5GSU A;  2CV5 C;  4NE5 A;  3MGQ D;  1F66 A;  3W99 C;  4G91 B;  1S32 A;  1KX3 B;  1M1A D;  1ZLA B;  1BH8 B;  2Y2N A;  5AVC C;  1U35 C;  2NZD C;  4J8U B;  3AZI B;  2PYO C;  4WJ3 C;  4YS3 A;  3W97 A;  4J8V B;  5AVB A;  3A1I A;  5B24 C;  5BO0 A;  4WU9 D;  5B33 C;  1P3P D;  5B40 A;  4H9R A;  4UPK A;  3O62 C;  1P3O D;  4Z66 D;  1P34 D;  1Z2C B;  3REJ D;  3C1C B;  3MVD C;  5GSU B;  4WU8 A;  5B31 D;  3KWQ A;  5DNN A;  1F66 B;  5AV9 D;  3B6G A;  5AV5 D;  1HQ3 C;  1S32 B;  4H9S C;  4JJN C;  3AFA C;  4KGC D;  1KX4 A;  5GT0 D;  5B1M D;  4AWL B;  1BFM A;  3REL D;  4YS3 D;  1W2E A;  1M18 D;  3AZK C;  4E45 A;  3W97 B;  5AVB B;  2RVQ C;  1TZY C;  5JRG D;  5BO0 B;  3AZJ A;  2JE5 A;  3AZH A;  5B40 B;  4H9R B;  1T3U A;  2LY8 A;  3MGR C;  5CPK C;  3WKJ D;  5CPI C;  2J8P A;  3AV2 D;  3X1V A;  1AOI D;  2Y2I A;  4H9Q A;  3X1T C;  3KWQ D;  3AL0 C;  4WU8 B;  4XZQ C;  5E5A A;  3LEL D;  3KWQ B;  5DNN B;  2BYM A;  3REK D;  1P3A C;  1P3M C;  1ID3 C;  3B6G B;  1R4V A;  1KX4 B;  5B32 G;  2NQB C;  3WTP A;  3AN2 C;  2HUE C;  3AZN A;  3AZH B;  3AZJ B;  4R8P D;  1M19 A;  4J8W A;  3KFU G;  5B0Z C;  5B2I A;  3UTA A;  3X1V B;  1P3G C;  3EPK A;  3AV1 A;  5AY8 A;  4H9Q B;  4KHA A;  5E5A B;  1HTA A;  4XUJ C;  2BYM B;  3MGS C;  3MGP A;  3WAA D;  3REH D;  3AYW D;  3REI A;  3AZG B;  3LJA C;  4QLC C;  3W96 D;  5AV8 C;  2UWX A;  3WA9 C;  3WTP B;  3AZN B;  3LZ0 D;  5B31 G;  1M19 B;  4J8W B;  5BT1 D;  3AZE D;  4G92 B;  2Y2K A;  5C3I C;  2BYK A;  2CWE A;  5B2I B;  3AZF C;  3AV1 D;  5AY8 D;  4Z2M H;  3A6N D;  3UTA B;  4Z5T A;  1P3K C;  1KU5 A;  5AY8 B;  4KHA B;  5CP6 A;  3B6F C;  3MGP B;  5AV6 D;  4KUD A;  3F6T A;  3REI B;  5B32 A;  3AZL A;  3X1S C;  5B2J D;  1P3B A;  1P3I C;  3X1U D;  5CPJ D;  3H0M C;  3MNN D;  3TU4 C;  3MGQ A;  3W98 D;  4J8X C;  4LD9 C;  2BYK B;  2Y2Q A;  4DQY B;  4ZUX C;  3VH5 T;  2CV5 D;  5B1L C;  4Z5T B;  3W99 D;  1M1A A;  3VH5 W;  5CP6 B;  2ARO A;  3C1B A;  2NZD D;  5AVC D;  3AFA A;  2PYO D;  4KUD B;  5DNM C;  4UUZ A;  4WU9 A;  1P3P A;  5GXQ C;  1F1E A;  5B32 B;  3AZL B;  1P3B B;  4Z66 A;  5B24 D;  1TAF A;  5B33 D;  1P3O A;  3REJ A;  3KUY C;  3O62 D;  4WNN A;  2JCH A;  3MGQ B;  5B31 A;  2IO5 C;  3MVD D;  5AV9 A;  5AV5 A;  3NQU A;  2ARO D;  1M1A B;  1P3L C;  4KGC A;  4ZBJ B;  3C1B D;  3P5J B;  2ARO B;  5B1M A;  5GT0 A;  4JJN D;  3REL A;  3AFA D;  2ZM5 A;  1M18 A;  2FJ7 A;  5F99 A;  3VH6 A;  4UUZ B;  5JRG A;  4WU9 B;  1P3P B;  3AZK D;  4H9O A;  2RVQ D;  1P3O B;  4Z66 B;  3AN2 A;  1TAF B;  1KX5 C;  2Y2H A;  3WKJ A;  3AV2 A;  1P34 B;  5GT3 C;  3REJ B;  1AOI A;  4WNN B;  3MGR D;  5CPK D;  5CPI D;  2ZY4 A;  4X23 A;  1B67 A;  2HIO C;  3LEL A;  3UT9 C;  5B31 B;  3REK A;  4HGA B;  3X1T D;  5AV9 B;  3NQJ A;  5AV5 B;  3KXB C;  4XZQ D;  1P3A D;  1P3M D;  1ID3 D;  3NQU B;  5B0Y A;  4KGC B;  5GT0 B;  5B1M B;  3UTB C;  3REL B;  4YS3 B;  2FJ7 D;  3LZ1 C;  4YM6 C;  2Y2G A;  5F99 D;  1M18 B;  1EQZ C;  2ZY5 A;  5F99 B;  2NQB D;  3B0C T;  5JRG B;  4R8P A;  4NE3 A;  4WZS B;  4H9O B;  3AN2 D;  4G91 C;  1KX3 C;  3B0C W;  3WKJ B;  3AV2 B;  1ZLA C;  4J8U C;  2ZY2 A;  5B0Z D;  4ZBJ C;  4X23 D;  3AZI C;  1AOI B;  4X23 B; 
#chains in the Genus database with same CATH homology
 3LEL B;  3REK B;  4J8V C;  1P3G D;  3NQJ B;  5B0Y D;  2YFV A;  4XUJ D;  5B0Y B;  3REH A;  3WAA A;  3MGS D;  3AYW A;  4Z2M G;  3W96 A;  3C1C C;  5GSU C;  3LJA D;  3B0D B;  4QLC D;  5AV8 D;  1F66 C;  3WA9 D;  4R8P B;  3LZ0 A;  3AZE A;  1S32 C;  4NFT A;  2DQN C;  2Y2M A;  4M6B A;  3A6N A;  4AWL C;  2F8N H;  3AZF D;  2Y2L A;  1P3K D;  3W97 C;  4EO5 B;  5AVB C;  2XD5 A;  1A7W A;  1P3F A;  5AV6 A;  2YFV B;  5B40 C;  3B6F D;  3WAA B;  3REH B;  3AYW B;  5BNX A;  2L5A A;  3AZM A;  2G5H C;  3W96 B;  5B2J A;  3X1U A;  5CPJ A;  2VQR A;  4WU8 C;  3X1S D;  3MNN A;  5BS7 A;  5DNN C;  3KWQ C;  1P3I D;  1BH9 A;  3LZ0 B;  3B6G C;  2YFW A;  3AZE B;  3W98 A;  5JA4 A;  3TU4 D;  2CV5 A;  3AV1 B;  3A6N B;  1KX4 C;  4J8X D;  3V9R A;  3W99 A;  4LD9 D;  4ZUX D;  2JSS A;  5B1L D;  1P3F D;  3IP4 C;  3AZH C;  5AVC A;  3AZJ C;  1U35 A;  1P3F B;  5AV6 B;  5CHL B;  2PYO A;  2NZD A;  4NE6 A;  3AZM D;  5BNX B;  3AZM B;  3X1V C;  5DNM D;  5B2J B;  5B24 A;  2F8N D;  5B33 A;  3X1U B;  5CPJ B;  5GXQ D;  3O62 A;  3MNN B;  5E5A C;  1BH9 B;  3FDD A;  3KUY D;  2YFW B;  3W98 B;  2DF4 C;  5JA4 B;  3MVD A;  4DRB A;  2CV5 B;  2Y2J A;  3AZG C;  5FUG A;  2FFF B;  2F8N K;  3V9R B;  3W99 B;  1HQ3 A;  4H9S A;  3WTP C;  4JJN A;  1U35 D;  3AZN C;  1P3L D;  1U35 B;  5AVC B;  2NZD B;  1M19 C;  1ULY A;  2PYO B;  4J8W C;  1WWS A;  4G92 C;  2XD1 A;  3AZK A;  5B2I C;  3UTA C;  1TZY A;  5B24 B;  5B33 B;  5AY8 C;  3O62 B;  3MGR A;  5CPK A;  1KX5 D;  5CPI A;  3VH6 T;  3MGP C;  4CSR A;  5GT3 D;  3MVD B;  3X1T A;  3VH6 W;  4XZQ A;  3REI C;  3UT9 D;  5FUG B;  1P3A A;  1P3M A;  1ID3 A;  1HQ3 D;  3C1B B;  3KXB D;  2W8S A;  4JJN B;  3AFA B;  3UTB D;  3VH5 A;  2NQB A;  3LZ1 D;  4YM6 D;  1EQZ D;  3AZK B;  1TZY D;  1B6W A;  1TZY B;  4Z5T C;  5CP6 C;  1KX3 D;  5B0Z A;  3MGR B;  5CPK B;  2Y2O A;  3EPJ A;  5CPI B;  1ZLA D;  4CSR B;  1P3G A;  4J8U D;  3AZI D;  4KUD C;  4CAY A;  3X1T B;  1PZR A;  4XZQ B;  1P3A B;  1P3M B;  4J8V D;  4XUJ A;  1ID3 B;  5B32 C;  3AZL C;  1P3B C;  3MGS A;  3EPH A;  2F8N G;  2FJ7 B;  3MGQ C;  3LJA A;  4E44 A;  5BNV A;  4QLC A;  3H0L C;  5AV8 A;  2NQB B;  3C1C D;  3WA9 A;  5GSU D;  3AN2 B;  2HUE B;  1F66 D;  1M1A C;  2ARO C;  1S32 D;  2G5I C;  5B0Z B;  3C1B C;  3AZF A;  1P3K A;  1P3G B;  4CAY B;  4WU9 C;  3B0B A;  4H9N A;  1P3P C;  1Q9C A;  3W97 D;  3B6F A;  4XUJ B;  5AVB D;  1P3O C;  4Z66 C;  3MGS B;  3A1K A;  5B40 D;  1P34 C;  3REJ C;  3LJA B;  4QLC B;  5BNV B;  5AV8 B;  3X1S A;  5B31 C;  4HGA C;  1P3I A;  3WA9 B;  5AV9 C;  5AV5 C;  4WU8 D;  5DNN D;  3TU4 A;  4KGC C;  3B6G D;  4DRA A;  5GT0 C;  5B1M C;  4J8X A;  5C3I B;  3REL C;  4YS3 C;  4LD9 A;  4ZUX A;  1M18 C;  3AZF B;  1P3K B;  1KX4 D;  2FJ7 C;  5B1L A;  4WV4 B;  5F99 C;  3AZG A;  2F2A C;  5JRG C;  4H9N B;  3B6F B;  5G49 A;  3WKJ C;  3R45 A;  3AZH D;  3AZJ D;  3AV2 C;  1H3O A;  3WTP E;  1JFI A;  5DNM A;  2F8N A;  1AOI C;  3EG5 B;  5GXQ A;  4X23 C;  3X1S B;  3LEL C;  4H9P A;  3REK C;  3X1V D;  1P3I B;  3KUY A;  3KSY A;  5E5A D;  3TU4 B;  5B0Y C;  2BG1 A;  4J8X B;  4LD9 B;  5KDM A;  4ZUX B;  3AZG D;  5B1L B;  3B0D C;  1P3L A;  4R8P C;  3WTP D;  5G49 B;  3AZN D;  3R45 B;  1M19 D;  1H3O B;  4J8W D;  1JFI B;  5DNM B;  2F8N B;  2RIQ A;  5GXQ B;  5B2I D;  3UTA D;  4EO5 C;  4H9P B;  1KX5 A;  3H0R C;  5GT3 A;  3KUY B;  3WAA C;  3REH C;  3AYW C;  3MGP D;  2HIO A;  1N1J A;  3UT9 A;  2IO5 B;  3W96 C;  5KDM B;  3EPL A;  3KXB A;  3REI D;  1P3L B;  3UTB A;  3LZ0 C;  2Y2P A;  5BT1 C;  3AZE C;  3LZ1 A;  4YM6 A;  1EQZ A;  3AV1 C;  3A6N C;  1KX3 A;  4Z5T D;  1KX5 B;  1ZLA A;  1BH8 A;  5GT3 B;  5CP6 D;  1P3F C;  1WWI A;  5AV6 C;  4J8U A;  3AZI A;  2HIO D;  2HIO B;  1N1J B;  3UT9 B;  4J8V A;  3AZM C;  4KUD D;  1HQ3 B;  5B2J C;  3X1U C;  5CPJ C;  3KXB B;  5B32 D;  3MNN C;  3AZL D;  1P3B D;  5BS7 C;  3UTB B;  2ZY3 A;  3W98 C;  1P34 A;  3LZ1 B;  3C1C A;  4YM6 B;  1EQZ B;  5GSU A;  2CV5 C;  4NE5 A;  3MGQ D;  1F66 A;  3W99 C;  4G91 B;  1S32 A;  1KX3 B;  1M1A D;  1ZLA B;  1BH8 B;  2Y2N A;  5AVC C;  1U35 C;  2NZD C;  4J8U B;  3AZI B;  2PYO C;  4WJ3 C;  4YS3 A;  3W97 A;  4J8V B;  5AVB A;  3A1I A;  5B24 C;  5BO0 A;  4WU9 D;  5B33 C;  1P3P D;  5B40 A;  4H9R A;  4UPK A;  3O62 C;  1P3O D;  4Z66 D;  1P34 D;  1Z2C B;  3REJ D;  3C1C B;  3MVD C;  5GSU B;  4WU8 A;  5B31 D;  3KWQ A;  5DNN A;  1F66 B;  5AV9 D;  3B6G A;  5AV5 D;  1HQ3 C;  1S32 B;  4H9S C;  4JJN C;  3AFA C;  4KGC D;  1KX4 A;  5GT0 D;  5B1M D;  4AWL B;  1BFM A;  3REL D;  4YS3 D;  1W2E A;  1M18 D;  3AZK C;  4E45 A;  3W97 B;  5AVB B;  2RVQ C;  1TZY C;  5JRG D;  5BO0 B;  3AZJ A;  2JE5 A;  3AZH A;  5B40 B;  4H9R B;  1T3U A;  2LY8 A;  3MGR C;  5CPK C;  3WKJ D;  5CPI C;  2J8P A;  3AV2 D;  3X1V A;  1AOI D;  2Y2I A;  4H9Q A;  3X1T C;  3KWQ D;  3AL0 C;  4WU8 B;  4XZQ C;  5E5A A;  3LEL D;  3KWQ B;  5DNN B;  2BYM A;  3REK D;  1P3A C;  1P3M C;  1ID3 C;  3B6G B;  1R4V A;  1KX4 B;  5B32 G;  2NQB C;  3WTP A;  3AN2 C;  2HUE C;  3AZN A;  3AZH B;  3AZJ B;  4R8P D;  1M19 A;  4J8W A;  3KFU G;  5B0Z C;  5B2I A;  3UTA A;  3X1V B;  1P3G C;  3EPK A;  3AV1 A;  5AY8 A;  4H9Q B;  4KHA A;  5E5A B;  1HTA A;  4XUJ C;  2BYM B;  3MGS C;  3MGP A;  3WAA D;  3REH D;  3AYW D;  3REI A;  3AZG B;  3LJA C;  4QLC C;  3W96 D;  5AV8 C;  2UWX A;  3WA9 C;  3WTP B;  3AZN B;  3LZ0 D;  5B31 G;  1M19 B;  4J8W B;  5BT1 D;  3AZE D;  4G92 B;  2Y2K A;  5C3I C;  2BYK A;  2CWE A;  5B2I B;  3AZF C;  3AV1 D;  5AY8 D;  4Z2M H;  3A6N D;  3UTA B;  4Z5T A;  1P3K C;  1KU5 A;  5AY8 B;  4KHA B;  5CP6 A;  3B6F C;  3MGP B;  5AV6 D;  4KUD A;  3F6T A;  3REI B;  5B32 A;  3AZL A;  3X1S C;  5B2J D;  1P3B A;  1P3I C;  3X1U D;  5CPJ D;  3H0M C;  3MNN D;  3TU4 C;  3MGQ A;  3W98 D;  4J8X C;  4LD9 C;  2BYK B;  2Y2Q A;  4DQY B;  4ZUX C;  3VH5 T;  2CV5 D;  5B1L C;  4Z5T B;  3W99 D;  1M1A A;  3VH5 W;  5CP6 B;  2ARO A;  3C1B A;  2NZD D;  5AVC D;  3AFA A;  2PYO D;  4KUD B;  5DNM C;  4UUZ A;  4WU9 A;  1P3P A;  5GXQ C;  1F1E A;  5B32 B;  3AZL B;  1P3B B;  4Z66 A;  5B24 D;  1TAF A;  5B33 D;  1P3O A;  3REJ A;  3KUY C;  3O62 D;  4WNN A;  2JCH A;  3MGQ B;  5B31 A;  2IO5 C;  3MVD D;  5AV9 A;  5AV5 A;  3NQU A;  2ARO D;  1M1A B;  1P3L C;  4KGC A;  4ZBJ B;  3C1B D;  3P5J B;  2ARO B;  5B1M A;  5GT0 A;  4JJN D;  3REL A;  3AFA D;  2ZM5 A;  1M18 A;  2FJ7 A;  5F99 A;  3VH6 A;  4UUZ B;  5JRG A;  4WU9 B;  1P3P B;  3AZK D;  4H9O A;  2RVQ D;  1P3O B;  4Z66 B;  3AN2 A;  1TAF B;  1KX5 C;  2Y2H A;  3WKJ A;  3AV2 A;  1P34 B;  5GT3 C;  3REJ B;  1AOI A;  4WNN B;  3MGR D;  5CPK D;  5CPI D;  2ZY4 A;  4X23 A;  1B67 A;  2HIO C;  3LEL A;  3UT9 C;  5B31 B;  3REK A;  4HGA B;  3X1T D;  5AV9 B;  3NQJ A;  5AV5 B;  3KXB C;  4XZQ D;  1P3A D;  1P3M D;  1ID3 D;  3NQU B;  5B0Y A;  4KGC B;  5GT0 B;  5B1M B;  3UTB C;  3REL B;  4YS3 B;  2FJ7 D;  3LZ1 C;  4YM6 C;  2Y2G A;  5F99 D;  1M18 B;  1EQZ C;  2ZY5 A;  5F99 B;  2NQB D;  3B0C T;  5JRG B;  4R8P A;  4NE3 A;  4WZS B;  4H9O B;  3AN2 D;  4G91 C;  1KX3 C;  3B0C W;  3WKJ B;  3AV2 B;  1ZLA C;  4J8U C;  2ZY2 A;  5B0Z D;  4ZBJ C;  4X23 D;  3AZI C;  1AOI B;  4X23 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...