1M18C

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18C00
5B0ZB 4NE6A 4G91C 1P34B 1S32C 4KUDA 5B24B 5CP6B 3MNNC 5BNXA 1ID3D 4H9RB 2PYOB 5JA4A 1P3LC 1M19C 3WKJB 3C1CD 2F8ND 1HTAA 3AZFA 4UUZB 5B1LD 3W99D 4WZSB 4E44A 4XZQB 5AVBC 1P3GC 1AOIA 3REIA 3LZ1C 2HIOB 3AZIA 4H9PA 3UTAC 1EQZC 1ID3B 4H9SA 5B2JA 3LELA 1WWIA 1A7WA 5F99C 4J8UD 3AFAD 4Z5TD 3C1CB 3AZGB 1P3KB 1P3PC 3REJA 4WU9A 3X1UC 3RELB 4M6BA 3WTPC 3A6NB 3MGRC 3AZEA 5B32C 1P3MB 1P3BB 3VH5A 1P3IC 4Z66C 5AV6D 3C1BD 1ULYA 3NQUA 5GT3A 1B6WA 4J8UB 3AFAB 3TU4D 3AN2A 5E5AD 4CAYB 2CV5D 3AYWA 3UT9D 4LD9D 2FJ7D 4J8WC 4J8XA 4ZUXD 5AV6B 3C1BB 3WTPE 5B2IC 4HGAC 5B0ZC 3MGPA 3WAAB 3B0CT 1ZLAB 5B24C 5CP6C 2CV5B 2PYOC 3WKJC 4QLCD 1P3AD 5G49A 1HQ3C 5BO0B 1JFIB 5AV8B 3KSYA 2NQBC 1KX4D 2HIOC 3AZFB 4J8VA 3AV1B 4Z2MG 3KWQA 5AV9A 3MNND 3X1UA 1P3LD 3X1SA 1ID3C 1KX5B 3W98B 3C1CC 4X23D 5GT0B 2CWEA 4AWLB 3AZGC 3AZIB 4XUJD 5B1MA 1Q9CA 3AZJB 1P3IA 4R8PB 5CPKB 5B1LC 5AVBD 5BS7C 5DNMD 3B6FA 3REHB 1KX4B 5B31G 4WNNA 1EQZD 5AV5D 5DNND 4YM6A 3AV2B 4J8UC 3AFAC 4Z5TC 1P3PD 3B6GD 5CPID 3AZMD 3WTPD 5DNMB 3LZ0B 3REKA 4WU8D 5B0YD 5AV6C 3C1BC 4KGCA 3MGSA 1BH9B 1N1JA 5JRGD 3WAAC 3WA9D 3AZMB 3TU4C 4H9NB 4H9QB 5E5AC 4H9OA 1P3OA 2CV5C 4LD9C 2FJ7C 3X1TD 5B31B 4ZUXC 3W96B 5AVCB 5AY8A 2F8NA 3V9RA 5JRGB 1P34D 5G49B 5B40B 5B24D 1H3OB 3W99A 3AZLD 4JJNA 3X1VD 4G92B 2YFVB 4NE5A 1KX5C 3W98C 2NQBD 5GXQD 1F66A 3KUYD 1U35D 4AWLC 3W97B 3MVDA 5AV9B 4QLCC 1P3AC 4XZQD 2HIOD 3AZNA 4Z5TA 1KX4C 2NZDB 3AZHB 5B1MB 3UTBB 2LY8A 3AZLB 1BH8A 3R45A 3X1VB 5CPJA 1M18A 3AZGD 1P3KD 2F8NK 5GXQB 4X23C 3O62B 3KUYB 1U35B 4XUJC 5B33A 3RELD 3A6ND 1P3MD 1P3BD 5DNMC 2BYMB 3MGQD 3KXBA 3LJAA 1KX3D 3UT9A 2YFWB 1BFMA 3VH6W 5DNNC 5AV5C 2RVQC 3VH5W 3B6GC 5CPIC 3AZMC 2AROA 4KGCB 1TZYD 4KHAA 3MGQB 5FUGA 5B0YC 4WU8C 4YS3B 3W96C 1P3FB 4EO5C 1KX3B 5GSUA 3WAAD 5JRGC 1M1AB 1ZLAD 4QLCA 1P3AA 3AZKB 3WA9C 4CSRA 4G92C 1F1EA 1TZYB 3X1TC 1S32A 1TAFA 5AV8D 3MNNA 4JJNB 1P3LA 1M19A 3AZFD 4X23A 3AV1D 1P34C 5AVBA 3REID 5KDMA 3AZLC 1P3GA 1KX5D 3X1VC 3LZ1A 3W98D 5GT0D 3AZID 3AZJD 5GXQC 3O62C 3KUYC 1U35C 4R8PD 4KUDB 5CPKD 3UTAA 1EQZA 5BNXB 5B2JD 4XZQC 1M18B 3REHD 5JA4B 5F99A 5DNNA 3B6GA 3REJD 1P3PA 3WTPA 3MGRA 1AOIB 5B32A 3REIB 3AV2D 4Z66A 1P3KC 4WU8A 5B0YA 3KXBB 4H9PB 3LJAB 3NQJA 3RELC 5B2JB 3LELB 3A6NC 3LZ0D 1P3MC 1P3BC 3MGQC 3REJB 4WU9B 3AYWD 3AZEB 1P3FC 1KX3C 2RVQD 4J8WA 3X1TA 2HUEB 4J8XD 3NQUB 3VH6T 5GT3B 5B2IA 5B0ZA 5GSUB 1TZYC 3MGPD 5B31D 3AN2B 5B24A 5CP6A 5B32G 3W96D 4H9RA 5AVCD 3AYWB 2PYOA 3WKJA 4UUZA 5B40D 1HQ3A 5BT1D 1TAFB 4J8XB 1S32B 1ZLAC 4NFTA 1M19B 2NQBA 2HIOA 4J8VD 3W97D 3KWQD 4DRAA 3MGPB 5AV9D 2JSSA 5AV8C 3X1SD 1ID3A 3LZ1B 2NZDA 3C1CA 2NZDD 3AZGA 3AZHD 1P3KA 5B1MD 3UTBD 3AZFC 3AV1C 5CHLB 5B1LA 3RELA 5BS7A 3UTAB 3A6NA 3REIC 3O62D 5GT0C 3AZJC 3AZIC 5BNVA 4J8VB 3KWQB 4R8PC 3X1UB 5CPKC 3X1SB 4H9SC 5B2JC 4YM6D 3REHC 4J8UA 3AFAA 1P3IB 3B0BA 3REJC 4WU9C 4CAYA 3B6FB 3B0CW 3AV2C 4WNNB 2HUEC 4DRBA 5AV6A 3C1BA 4KGCD 2IO5B 1R4VA 2F8NG 4YM6B 3LZ0C 3WAAA 5C3IB 1ZLAA 3AN2C 4YS3D 3TU4A 5E5AA 1P3FD 4HGAB 3AYWC 2CV5A 4LD9A 2L5AA 3REKB 2FJ7A 1M1AD 3AZKD 5BO0A 4J8XC 1JFIA 4ZUXA 5AV8A 3MGSB 5AY8D 1N1JB 3MGPC 1HQ3B 3AV1A 5B31C 4JJND 1P3OB 4H9OB 2NQBB 1KX5A 5AVCC 3W98A 1F66D 5GT0A 3AZJA 3MVDD 4R8PA 5B40C 5BT1C 5CPKA 3REHA 3AZND 5AY8B 1KX4A 3V9RB 2F8NB 4J8VC 3W97C 3KWQC 4KUDD 5AV9C 5B1LB 3W99B 1M18D 5CPJD 3X1SC 3VH6A 3AV2A 1F66B 2NZDC 5BNVB 3MVDB 3AZHC 5B1MC 4XUJA 3UTBC 5B33D 1AOID 1WWSA 3B6FC 5DNMA 3LZ0A 3AZNB 4Z5TB 4Z2MH 3KXBD 3LJAD 3LELD 2IO5C 1BH8B 3R45B 5CPJB 1BH9A 4YM6C 5AV5A 5CPIA 5C3IC 4WU9D 3AZMA 2AROD 5B33B 4H9QA 4H9NA 3AZED 3REKC 5B31A 3TU4B 4ZBJB 5E5AB 5GT3D 4KGCC 3W96A 4NE3A 5AVCA 3MGSC 5GSUD 3UT9B 4LD9B 2FJ7B 5JRGA 3AN2D 5B40A 1H3OA 4ZUXB 3WA9A 2AROB 2BYKA 4YS3C 1P3OC 2YFVA 1KU5A 4KHAB 3W97A 1S32D 1M1AC 5FUGB 3AZKC 1M19D 3VH5T 5AY8C 3B0DC 3AZHA 3UTBA 4QLCB 1P3AB 1P34A 4CSRB 1P3GD 3W99C 3B0DB 4JJNC 3AZLA 3LZ1D 3X1VA 1F66C 5GXQA 3O62A 4G91B 3KUYA 3MVDC 1U35A 3UTAD 1B67A 3MNNB 4XZQA 1P3LB 5F99D 2BYMA 3AZNC 4X23B 4XUJB 3X1UD 4KUDC 3MGRD 5AVBB 5B32D 5KDMB 1P3GB 1M18C 5CPJC 2YFWA 1P3ID 4Z66D 5B33C 1EQZB 3B6FD 1AOIC 1P3MA 5F99B 1P3BA 5AV5B 5DNNB 3MGQA 3B6GB 1P3PB 5CPIB 3KXBC 4WV4B 3LJAC 4ZBJC 4YS3A 3WTPB 3MGRB 5B32B 3LELC 1P3FA 1KX3A 3UT9C 4J8WD 4Z66B 1M1AA 4WU8B 5B0YB 3AZKA 2AROC 3NQJB 5B2ID 2F8NH 4EO5B 5B0ZD 3AZEC 3REKD 1TZYA 5CP6D 3WA9B 2BYKB 2PYOD 3MGSD 5GT3C 3WKJD 5GSUC 4J8WB 1HQ3D 3X1TB 1P3OD 4E45A 5B2IB
chains in the Genus database with same CATH superfamily
5B0ZB 4NE6A 4G91C 3EPKA 1S32C 1P34B 4KUDA 5B24B 5CP6B 3MNNC 5BNXA 1ID3D 4H9RB 2PYOB 5JA4A 1P3LC 1M19C 3WKJB 3C1CD 2F8ND 2ZY3A 1HTAA 3AZFA 4UUZB 2Y2MA 5B1LD 3W99D 4WZSB 4E44A 4XZQB 5AVBC 1P3GC 1AOIA 3REIA 3LZ1C 2HIOB 3AZIA 4H9PA 3UTAC 1EQZC 1ID3B 4H9SA 5B2JA 3LELA 1WWIA 1A7WA 5F99C 4J8UD 3AFAD 4Z5TD 3C1CB 3AZGB 1P3KB 1P3PC 3REJA 4WU9A 3X1UC 3RELB 4M6BA 3WTPC 3A6NB 3MGRC 3AZEA 5B32C 1P3MB 1P3BB 3VH5A 1P3IC 4Z66C 2ZY4A 5AV6D 3C1BD 1Z2CB 1ULYA 3NQUA 5GT3A 1B6WA 4J8UB 3AFAB 3TU4D 3AN2A 5E5AD 4CAYB 2CV5D 3AYWA 3EPJA 3UT9D 4LD9D 2FJ7D 4J8WC 4J8XA 4ZUXD 5AV6B 3C1BB 3WTPE 5B2IC 4HGAC 5B0ZC 3MGPA 3WAAB 3B0CT 1ZLAB 5B24C 5CP6C 2CV5B 2PYOC 3WKJC 4QLCD 1P3AD 5G49A 1HQ3C 5BO0B 1JFIB 5AV8B 3KSYA 2Y2OA 2NQBC 1KX4D 2HIOC 3AZFB 4J8VA 3AV1B 4Z2MG 3KWQA 5AV9A 3MNND 3X1UA 1P3LD 3X1SA 1ID3C 1KX5B 3W98B 2Y2JA 3C1CC 4X23D 5GT0B 2CWEA 4AWLB 3AZGC 3AZIB 4XUJD 5B1MA 1Q9CA 3AZJB 1P3IA 4R8PB 5CPKB 5B1LC 5AVBD 5BS7C 5DNMD 3B6FA 3REHB 1KX4B 5B31G 3EG5B 4WNNA 1EQZD 2Y2LA 2DQNC 5AV5D 5DNND 4YM6A 3AV2B 4J8UC 2G5HC 4Z5TC 3AFAC 1P3PD 5CPID 3B6GD 3AZMD 3WTPD 5DNMB 3LZ0B 3REKA 2JCHA 4WU8D 5B0YD 5AV6C 3C1BC 4KGCA 3MGSA 1BH9B 1N1JA 5JRGD 3WAAC 3WA9D 3AZMB 3TU4C 4H9NB 4H9QB 5E5AC 4H9OA 1P3OA 2Y2IA 2CV5C 4LD9C 2FJ7C 3X1TD 5B31B 4ZUXC 3W96B 5AVCB 5AY8A 2F8NA 3V9RA 5JRGB 1P34D 5G49B 5B40B 5B24D 1H3OB 2Y2NA 3W99A 3AZLD 4JJNA 3EPHA 3X1VD 4G92B 2YFVB 4NE5A 1KX5C 3W98C 2NQBD 5GXQD 1F66A 3KUYD 1U35D 4AWLC 3W97B 3MVDA 5AV9B 4QLCC 1P3AC 2Y2QA 4XZQD 2HIOD 3AZNA 4Z5TA 1KX4C 2NZDB 3AZHB 5B1MB 3UTBB 2LY8A 3AZLB 1BH8A 3R45A 3X1VB 3H0MC 5CPJA 1M18A 3AZGD 1P3KD 2F8NK 5GXQB 4X23C 3O62B 3KUYB 1U35B 4XUJC 5B33A 3RELD 3A6ND 1P3MD 1P3BD 5DNMC 2BYMB 3MGQD 2Y2HA 3KXBA 3LJAA 1KX3D 3UT9A 2YFWB 1BFMA 5AV5C 3VH6W 5DNNC 2RVQC 3VH5W 3B6GC 5CPIC 3AZMC 2AROA 4KGCB 1TZYD 4KHAA 3MGQB 5FUGA 5B0YC 4WU8C 4YS3B 3W96C 1P3FB 4EO5C 1KX3B 5GSUA 3WAAD 5JRGC 1M1AB 1ZLAD 4QLCA 1P3AA 3AZKB 3WA9C 4CSRA 4G92C 1F1EA 1TZYB 3X1TC 1S32A 1TAFA 5AV8D 3MNNA 4JJNB 1P3LA 1M19A 3AZFD 4X23A 3AV1D 1P34C 4UPKA 5AVBA 3A1KA 5KDMA 3REID 3AZLC 1P3GA 3X1VC 3LZ1A 1KX5D 3W98D 5GT0D 3AZID 3AZJD 5GXQC 3O62C 3KUYC 1U35C 4R8PD 4KUDB 5CPKD 3UTAA 1EQZA 5BNXB 5B2JD 4XZQC 2ZY5A 3REHD 5JA4B 1M18B 5F99A 5DNNA 3B6GA 3REJD 1P3PA 2BG1A 3WTPA 3MGRA 1AOIB 5B32A 3REIB 2JE5A 3AV2D 4Z66A 1P3KC 4WU8A 5B0YA 3KXBB 4H9PB 3LJAB 3NQJA 3RELC 5B2JB 3LELB 3A6NC 3LZ0D 1P3MC 1P3BC 3MGQC 3REJB 4WU9B 3AYWD 3AZEB 1P3FC 1KX3C 2RVQD 4J8WA 3X1TA 2HUEB 4J8XD 3NQUB 3VH6T 5GT3B 2G5IC 5B2IA 3P5JB 5B0ZA 5GSUB 2FFFB 1TZYC 3MGPD 5B31D 3AN2B 5B24A 5CP6A 5B32G 3W96D 4H9RA 5AVCD 3AYWB 2PYOA 3WKJA 1PZRA 3FDDA 4UUZA 5B40D 1HQ3A 5BT1D 1TAFB 4J8XB 1S32B 1ZLAC 4NFTA 2ZY2A 1M19B 2NQBA 2HIOA 4J8VD 3W97D 3KWQD 4DRAA 3MGPB 5AV9D 2JSSA 5AV8C 3X1SD 1ID3A 3LZ1B 2NZDA 3C1CA 2NZDD 3AZGA 3AZHD 1P3KA 5B1MD 3UTBD 3AZFC 3AV1C 5CHLB 5B1LA 3RELA 5BS7A 3UTAB 3A6NA 3REIC 2W8SA 3O62D 5GT0C 2F2AC 3AZJC 5BNVA 4J8VB 3KWQB 3AZIC 2XD5A 4R8PC 3X1UB 5CPKC 3X1SB 4H9SC 5B2JC 2Y2KA 4YM6D 3REHC 4J8UA 3AFAA 1P3IB 3B0BA 3REJC 1T3UA 4WU9C 4CAYA 3B6FB 3B0CW 2ZM5A 3AV2C 4WNNB 2HUEC 3KFUG 4DRBA 5AV6A 3C1BA 4KGCD 2IO5B 1R4VA 2F8NG 4YM6B 3LZ0C 3WAAA 5C3IB 1ZLAA 3AN2C 4YS3D 3TU4A 5E5AA 1P3FD 4HGAB 3AYWC 2CV5A 4LD9A 2L5AA 3REKB 2FJ7A 1M1AD 3AZKD 5BO0A 4J8XC 1JFIA 4ZUXA 5AV8A 3MGSB 2VQRA 5AY8D 1N1JB 3MGPC 1HQ3B 3AV1A 5B31C 4JJND 1P3OB 4H9OB 2NQBB 1KX5A 5AVCC 3W98A 1F66D 5GT0A 3AZJA 3MVDD 4R8PA 5B40C 5BT1C 5CPKA 2J8PA 3REHA 3AZND 5AY8B 1KX4A 3V9RB 2F8NB 4J8VC 3W97C 3KWQC 4KUDD 5AV9C 5B1LB 3W99B 1M18D 5CPJD 3X1SC 3VH6A 3AV2A 1F66B 2NZDC 2Y2GA 5BNVB 3MVDB 3AZHC 5B1MC 4XUJA 3UTBC 5B33D 1AOID 1WWSA 1W2EA 3B6FC 5DNMA 3LZ0A 3AZNB 3F6TA 4Z5TB 4Z2MH 3KXBD 3LJAD 3LELD 2IO5C 1BH8B 3R45B 5CPJB 2Y2PA 1BH9A 4YM6C 5AV5A 5CPIA 5C3IC 4WU9D 3AZMA 2AROD 3H0RC 5B33B 4H9QA 4H9NA 3AZED 3REKC 5B31A 3TU4B 4ZBJB 5GT3D 5E5AB 4KGCC 3W96A 4NE3A 3AL0C 5AVCA 3MGSC 5GSUD 3UT9B 4LD9B 2FJ7B 5JRGA 3AN2D 5B40A 1H3OA 4ZUXB 3WA9A 2AROB 2BYKA 4YS3C 1P3OC 2YFVA 1KU5A 4KHAB 3W97A 1S32D 1M1AC 2DF4C 5FUGB 3AZKC 1M19D 3VH5T 5AY8C 3B0DC 3AZHA 3UTBA 4QLCB 1P3AB 1P34A 4CSRB 1P3GD 3W99C 3B0DB 4JJNC 3AZLA 3LZ1D 3X1VA 1F66C 5GXQA 3O62A 4G91B 3KUYA 3MVDC 1U35A 2UWXA 3UTAD 1B67A 3MNNB 4XZQA 1P3LB 5F99D 4WJ3C 2BYMA 3IP4C 3AZNC 4X23B 4DQYB 4XUJB 3X1UD 4KUDC 3MGRD 5AVBB 5B32D 5KDMB 1P3GB 1M18C 5CPJC 2YFWA 1P3ID 4Z66D 5B33C 1EQZB 3B6FD 1AOIC 1P3MA 5F99B 1P3BA 3EPLA 5AV5B 5DNNB 3MGQA 3B6GB 1P3PB 5CPIB 3KXBC 4WV4B 3LJAC 4ZBJC 4YS3A 3WTPB 3MGRB 2RIQA 5B32B 3LELC 1P3FA 1KX3A 3UT9C 4J8WD 4Z66B 1M1AA 4WU8B 5B0YB 3AZKA 2AROC 3NQJB 5B2ID 2F8NH 4EO5B 5B0ZD 2XD1A 3AZEC 3REKD 1TZYA 3A1IA 5CP6D 3H0LC 3WA9B 2BYKB 2PYOD 3MGSD 5GT3C 3WKJD 5GSUC 4J8WB 1HQ3D 3X1TB 1P3OD 4E45A 5B2IB
chains in the Genus database with same CATH topology
5B0ZB 4NE6A 4G91C 3EPKA 1S32C 1P34B 4KUDA 5B24B 5CP6B 3MNNC 5BNXA 1ID3D 4H9RB 2PYOB 5JA4A 1P3LC 1M19C 3WKJB 3C1CD 2F8ND 2ZY3A 1HTAA 3AZFA 4UUZB 2Y2MA 5B1LD 3W99D 4WZSB 4E44A 4XZQB 5AVBC 1P3GC 1AOIA 3REIA 3LZ1C 2HIOB 3AZIA 4H9PA 3UTAC 1EQZC 1ID3B 4H9SA 5B2JA 3LELA 1WWIA 1A7WA 5F99C 4J8UD 3AFAD 4Z5TD 3C1CB 3AZGB 1P3KB 1P3PC 3REJA 4WU9A 3X1UC 3RELB 4M6BA 3WTPC 3A6NB 3MGRC 3AZEA 5B32C 1P3MB 1P3BB 3VH5A 1P3IC 4Z66C 2ZY4A 5AV6D 3C1BD 1Z2CB 1ULYA 3NQUA 5GT3A 1B6WA 4J8UB 3AFAB 3TU4D 3AN2A 5E5AD 4CAYB 2CV5D 3AYWA 3EPJA 3UT9D 4LD9D 2FJ7D 4J8WC 4J8XA 4ZUXD 5AV6B 3C1BB 3WTPE 5B2IC 4HGAC 5B0ZC 3MGPA 3WAAB 3B0CT 1ZLAB 5B24C 5CP6C 2CV5B 2PYOC 3WKJC 4QLCD 1P3AD 5G49A 1HQ3C 5BO0B 1JFIB 5AV8B 3KSYA 2Y2OA 2NQBC 1KX4D 2HIOC 3AZFB 4J8VA 3AV1B 4Z2MG 3KWQA 5AV9A 3MNND 3X1UA 1P3LD 3X1SA 1ID3C 1KX5B 3W98B 2Y2JA 3C1CC 4X23D 5GT0B 2CWEA 4AWLB 3AZGC 3AZIB 4XUJD 5B1MA 1Q9CA 3AZJB 1P3IA 4R8PB 5CPKB 5B1LC 5AVBD 5BS7C 5DNMD 3B6FA 3REHB 1KX4B 5B31G 3EG5B 4WNNA 1EQZD 2Y2LA 2DQNC 5AV5D 5DNND 4YM6A 3AV2B 4J8UC 2G5HC 4Z5TC 3AFAC 1P3PD 5CPID 3B6GD 3AZMD 3WTPD 5DNMB 3LZ0B 3REKA 2JCHA 4WU8D 5B0YD 5AV6C 3C1BC 4KGCA 3MGSA 1BH9B 1N1JA 5JRGD 3WAAC 3WA9D 3AZMB 3TU4C 4H9NB 4H9QB 5E5AC 4H9OA 1P3OA 2Y2IA 2CV5C 4LD9C 2FJ7C 3X1TD 5B31B 4ZUXC 3W96B 5AVCB 5AY8A 2F8NA 3V9RA 5JRGB 1P34D 5G49B 5B40B 5B24D 1H3OB 2Y2NA 3W99A 3AZLD 4JJNA 3EPHA 3X1VD 4G92B 2YFVB 4NE5A 1KX5C 3W98C 2NQBD 5GXQD 1F66A 3KUYD 1U35D 4AWLC 3W97B 3MVDA 5AV9B 4QLCC 1P3AC 2Y2QA 4XZQD 2HIOD 3AZNA 4Z5TA 1KX4C 2NZDB 3AZHB 5B1MB 3UTBB 2LY8A 3AZLB 1BH8A 3R45A 3X1VB 3H0MC 5CPJA 1M18A 3AZGD 1P3KD 2F8NK 5GXQB 4X23C 3O62B 3KUYB 1U35B 4XUJC 5B33A 3RELD 3A6ND 1P3MD 1P3BD 5DNMC 2BYMB 3MGQD 2Y2HA 3KXBA 3LJAA 1KX3D 3UT9A 2YFWB 1BFMA 5AV5C 3VH6W 5DNNC 2RVQC 3VH5W 3B6GC 5CPIC 3AZMC 2AROA 4KGCB 1TZYD 4KHAA 3MGQB 5FUGA 5B0YC 4WU8C 4YS3B 3W96C 1P3FB 4EO5C 1KX3B 5GSUA 3WAAD 5JRGC 1M1AB 1ZLAD 4QLCA 1P3AA 3AZKB 3WA9C 4CSRA 4G92C 1F1EA 1TZYB 3X1TC 1S32A 1TAFA 5AV8D 3MNNA 4JJNB 1P3LA 1M19A 3AZFD 4X23A 3AV1D 1P34C 4UPKA 5AVBA 3A1KA 5KDMA 3REID 3AZLC 1P3GA 3X1VC 3LZ1A 1KX5D 3W98D 5GT0D 3AZID 3AZJD 5GXQC 3O62C 3KUYC 1U35C 4R8PD 4KUDB 5CPKD 3UTAA 1EQZA 5BNXB 5B2JD 4XZQC 2ZY5A 3REHD 5JA4B 1M18B 5F99A 5DNNA 3B6GA 3REJD 1P3PA 2BG1A 3WTPA 3MGRA 1AOIB 5B32A 3REIB 2JE5A 3AV2D 4Z66A 1P3KC 4WU8A 5B0YA 3KXBB 4H9PB 3LJAB 3NQJA 3RELC 5B2JB 3LELB 3A6NC 3LZ0D 1P3MC 1P3BC 3MGQC 3REJB 4WU9B 3AYWD 3AZEB 1P3FC 1KX3C 2RVQD 4J8WA 3X1TA 2HUEB 4J8XD 3NQUB 3VH6T 5GT3B 2G5IC 5B2IA 3P5JB 5B0ZA 5GSUB 2FFFB 1TZYC 3MGPD 5B31D 3AN2B 5B24A 5CP6A 5B32G 3W96D 4H9RA 5AVCD 3AYWB 2PYOA 3WKJA 1PZRA 3FDDA 4UUZA 5B40D 1HQ3A 5BT1D 1TAFB 4J8XB 1S32B 1ZLAC 4NFTA 2ZY2A 1M19B 2NQBA 2HIOA 4J8VD 3W97D 3KWQD 4DRAA 3MGPB 5AV9D 2JSSA 5AV8C 3X1SD 1ID3A 3LZ1B 2NZDA 3C1CA 2NZDD 3AZGA 3AZHD 1P3KA 5B1MD 3UTBD 3AZFC 3AV1C 5CHLB 5B1LA 3RELA 5BS7A 3UTAB 3A6NA 3REIC 2W8SA 3O62D 5GT0C 2F2AC 3AZJC 5BNVA 4J8VB 3KWQB 3AZIC 2XD5A 4R8PC 3X1UB 5CPKC 3X1SB 4H9SC 5B2JC 2Y2KA 4YM6D 3REHC 4J8UA 3AFAA 1P3IB 3B0BA 3REJC 1T3UA 4WU9C 4CAYA 3B6FB 3B0CW 2ZM5A 3AV2C 4WNNB 2HUEC 3KFUG 4DRBA 5AV6A 3C1BA 4KGCD 2IO5B 1R4VA 2F8NG 4YM6B 3LZ0C 3WAAA 5C3IB 1ZLAA 3AN2C 4YS3D 3TU4A 5E5AA 1P3FD 4HGAB 3AYWC 2CV5A 4LD9A 2L5AA 3REKB 2FJ7A 1M1AD 3AZKD 5BO0A 4J8XC 1JFIA 4ZUXA 5AV8A 3MGSB 2VQRA 5AY8D 1N1JB 3MGPC 1HQ3B 3AV1A 5B31C 4JJND 1P3OB 4H9OB 2NQBB 1KX5A 5AVCC 3W98A 1F66D 5GT0A 3AZJA 3MVDD 4R8PA 5B40C 5BT1C 5CPKA 2J8PA 3REHA 3AZND 5AY8B 1KX4A 3V9RB 2F8NB 4J8VC 3W97C 3KWQC 4KUDD 5AV9C 5B1LB 3W99B 1M18D 5CPJD 3X1SC 3VH6A 3AV2A 1F66B 2NZDC 2Y2GA 5BNVB 3MVDB 3AZHC 5B1MC 4XUJA 3UTBC 5B33D 1AOID 1WWSA 1W2EA 3B6FC 5DNMA 3LZ0A 3AZNB 3F6TA 4Z5TB 4Z2MH 3KXBD 3LJAD 3LELD 2IO5C 1BH8B 3R45B 5CPJB 2Y2PA 1BH9A 4YM6C 5AV5A 5CPIA 5C3IC 4WU9D 3AZMA 2AROD 3H0RC 5B33B 4H9QA 4H9NA 3AZED 3REKC 5B31A 3TU4B 4ZBJB 5GT3D 5E5AB 4KGCC 3W96A 4NE3A 3AL0C 5AVCA 3MGSC 5GSUD 3UT9B 4LD9B 2FJ7B 5JRGA 3AN2D 5B40A 1H3OA 4ZUXB 3WA9A 2AROB 2BYKA 4YS3C 1P3OC 2YFVA 1KU5A 4KHAB 3W97A 1S32D 1M1AC 2DF4C 5FUGB 3AZKC 1M19D 3VH5T 5AY8C 3B0DC 3AZHA 3UTBA 4QLCB 1P3AB 1P34A 4CSRB 1P3GD 3W99C 3B0DB 4JJNC 3AZLA 3LZ1D 3X1VA 1F66C 5GXQA 3O62A 4G91B 3KUYA 3MVDC 1U35A 2UWXA 3UTAD 1B67A 3MNNB 4XZQA 1P3LB 5F99D 4WJ3C 2BYMA 3IP4C 3AZNC 4X23B 4DQYB 4XUJB 3X1UD 4KUDC 3MGRD 5AVBB 5B32D 5KDMB 1P3GB 1M18C 5CPJC 2YFWA 1P3ID 4Z66D 5B33C 1EQZB 3B6FD 1AOIC 1P3MA 5F99B 1P3BA 3EPLA 5AV5B 5DNNB 3MGQA 3B6GB 1P3PB 5CPIB 3KXBC 4WV4B 3LJAC 4ZBJC 4YS3A 3WTPB 3MGRB 2RIQA 5B32B 3LELC 1P3FA 1KX3A 3UT9C 4J8WD 4Z66B 1M1AA 4WU8B 5B0YB 3AZKA 2AROC 3NQJB 5B2ID 2F8NH 4EO5B 5B0ZD 2XD1A 3AZEC 3REKD 1TZYA 3A1IA 5CP6D 3H0LC 3WA9B 2BYKB 2PYOD 3MGSD 5GT3C 3WKJD 5GSUC 4J8WB 1HQ3D 3X1TB 1P3OD 4E45A 5B2IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z B;  4NE6 A;  4G91 C;  1P34 B;  1S32 C;  4KUD A;  5B24 B;  5CP6 B;  3MNN C;  5BNX A;  1ID3 D;  4H9R B;  2PYO B;  5JA4 A;  1P3L C;  1M19 C;  3WKJ B;  3C1C D;  2F8N D;  1HTA A;  3AZF A;  4UUZ B;  5B1L D;  3W99 D;  4WZS B;  4E44 A;  4XZQ B;  5AVB C;  1P3G C;  1AOI A;  3REI A;  3LZ1 C;  2HIO B;  3AZI A;  4H9P A;  3UTA C;  1EQZ C;  1ID3 B;  4H9S A;  5B2J A;  3LEL A;  1WWI A;  1A7W A;  5F99 C;  4J8U D;  3AFA D;  4Z5T D;  3C1C B;  3AZG B;  1P3K B;  1P3P C;  3REJ A;  4WU9 A;  3X1U C;  3REL B;  4M6B A;  3WTP C;  3A6N B;  3MGR C;  3AZE A;  5B32 C;  1P3M B;  1P3B B;  3VH5 A;  1P3I C;  4Z66 C;  5AV6 D;  3C1B D;  1ULY A;  3NQU A;  5GT3 A;  1B6W A;  4J8U B;  3AFA B;  3TU4 D;  3AN2 A;  5E5A D;  4CAY B;  2CV5 D;  3AYW A;  3UT9 D;  4LD9 D;  2FJ7 D;  4J8W C;  4J8X A;  4ZUX D;  5AV6 B;  3C1B B;  3WTP E;  5B2I C;  4HGA C;  5B0Z C;  3MGP A;  3WAA B;  3B0C T;  1ZLA B;  5B24 C;  5CP6 C;  2CV5 B;  2PYO C;  3WKJ C;  4QLC D;  1P3A D;  5G49 A;  1HQ3 C;  5BO0 B;  1JFI B;  5AV8 B;  3KSY A;  2NQB C;  1KX4 D;  2HIO C;  3AZF B;  4J8V A;  3AV1 B;  4Z2M G;  3KWQ A;  5AV9 A;  3MNN D;  3X1U A;  1P3L D;  3X1S A;  1ID3 C;  1KX5 B;  3W98 B;  3C1C C;  4X23 D;  5GT0 B;  2CWE A;  4AWL B;  3AZG C;  3AZI B;  4XUJ D;  5B1M A;  1Q9C A;  3AZJ B;  1P3I A;  4R8P B;  5CPK B;  5B1L C;  5AVB D;  5BS7 C;  5DNM D;  3B6F A;  3REH B;  1KX4 B;  5B31 G;  4WNN A;  1EQZ D;  5AV5 D;  5DNN D;  4YM6 A;  3AV2 B;  4J8U C;  3AFA C;  4Z5T C;  1P3P D;  3B6G D;  5CPI D;  3AZM D;  3WTP D;  5DNM B;  3LZ0 B;  3REK A;  4WU8 D;  5B0Y D;  5AV6 C;  3C1B C;  4KGC A;  3MGS A;  1BH9 B;  1N1J A;  5JRG D;  3WAA C;  3WA9 D;  3AZM B;  3TU4 C;  4H9N B;  4H9Q B;  5E5A C;  4H9O A;  1P3O A;  2CV5 C;  4LD9 C;  2FJ7 C;  3X1T D;  5B31 B;  4ZUX C;  3W96 B;  5AVC B;  5AY8 A;  2F8N A;  3V9R A;  5JRG B;  1P34 D;  5G49 B;  5B40 B;  5B24 D;  1H3O B;  3W99 A;  3AZL D;  4JJN A;  3X1V D;  4G92 B;  2YFV B;  4NE5 A;  1KX5 C;  3W98 C;  2NQB D;  5GXQ D;  1F66 A;  3KUY D;  1U35 D;  4AWL C;  3W97 B;  3MVD A;  5AV9 B;  4QLC C;  1P3A C;  4XZQ D;  2HIO D;  3AZN A;  4Z5T A;  1KX4 C;  2NZD B;  3AZH B;  5B1M B;  3UTB B;  2LY8 A;  3AZL B;  1BH8 A;  3R45 A;  3X1V B;  5CPJ A;  1M18 A;  3AZG D;  1P3K D;  2F8N K;  5GXQ B;  4X23 C;  3O62 B;  3KUY B;  1U35 B;  4XUJ C;  5B33 A;  3REL D;  3A6N D;  1P3M D;  1P3B D;  5DNM C;  2BYM B;  3MGQ D;  3KXB A;  3LJA A;  1KX3 D;  3UT9 A;  2YFW B;  1BFM A;  3VH6 W;  5DNN C;  5AV5 C;  2RVQ C;  3VH5 W;  3B6G C;  5CPI C;  3AZM C;  2ARO A;  4KGC B;  1TZY D;  4KHA A;  3MGQ B;  5FUG A;  5B0Y C;  4WU8 C;  4YS3 B;  3W96 C;  1P3F B;  4EO5 C;  1KX3 B;  5GSU A;  3WAA D;  5JRG C;  1M1A B;  1ZLA D;  4QLC A;  1P3A A;  3AZK B;  3WA9 C;  4CSR A;  4G92 C;  1F1E A;  1TZY B;  3X1T C;  1S32 A;  1TAF A;  5AV8 D;  3MNN A;  4JJN B;  1P3L A;  1M19 A;  3AZF D;  4X23 A;  3AV1 D;  1P34 C;  5AVB A;  3REI D;  5KDM A;  3AZL C;  1P3G A;  1KX5 D;  3X1V C;  3LZ1 A;  3W98 D;  5GT0 D;  3AZI D;  3AZJ D;  5GXQ C;  3O62 C;  3KUY C;  1U35 C;  4R8P D;  4KUD B;  5CPK D;  3UTA A;  1EQZ A;  5BNX B;  5B2J D;  4XZQ C;  1M18 B;  3REH D;  5JA4 B;  5F99 A;  5DNN A;  3B6G A;  3REJ D;  1P3P A;  3WTP A;  3MGR A;  1AOI B;  5B32 A;  3REI B;  3AV2 D;  4Z66 A;  1P3K C;  4WU8 A;  5B0Y A;  3KXB B;  4H9P B;  3LJA B;  3NQJ A;  3REL C;  5B2J B;  3LEL B;  3A6N C;  3LZ0 D;  1P3M C;  1P3B C;  3MGQ C;  3REJ B;  4WU9 B;  3AYW D;  3AZE B;  1P3F C;  1KX3 C;  2RVQ D;  4J8W A;  3X1T A;  2HUE B;  4J8X D;  3NQU B;  3VH6 T;  5GT3 B;  5B2I A;  5B0Z A;  5GSU B;  1TZY C;  3MGP D;  5B31 D;  3AN2 B;  5B24 A;  5CP6 A;  5B32 G;  3W96 D;  4H9R A;  5AVC D;  3AYW B;  2PYO A;  3WKJ A;  4UUZ A;  5B40 D;  1HQ3 A;  5BT1 D;  1TAF B;  4J8X B;  1S32 B;  1ZLA C;  4NFT A;  1M19 B;  2NQB A;  2HIO A;  4J8V D;  3W97 D;  3KWQ D;  4DRA A;  3MGP B;  5AV9 D;  2JSS A;  5AV8 C;  3X1S D;  1ID3 A;  3LZ1 B;  2NZD A;  3C1C A;  2NZD D;  3AZG A;  3AZH D;  1P3K A;  5B1M D;  3UTB D;  3AZF C;  3AV1 C;  5CHL B;  5B1L A;  3REL A;  5BS7 A;  3UTA B;  3A6N A;  3REI C;  3O62 D;  5GT0 C;  3AZJ C;  3AZI C;  5BNV A;  4J8V B;  3KWQ B;  4R8P C;  3X1U B;  5CPK C;  3X1S B;  4H9S C;  5B2J C;  4YM6 D;  3REH C;  4J8U A;  3AFA A;  1P3I B;  3B0B A;  3REJ C;  4WU9 C;  4CAY A;  3B6F B;  3B0C W;  3AV2 C;  4WNN B;  2HUE C;  4DRB A;  5AV6 A;  3C1B A;  4KGC D;  2IO5 B;  1R4V A;  2F8N G;  4YM6 B;  3LZ0 C;  3WAA A;  5C3I B;  1ZLA A;  3AN2 C;  4YS3 D;  3TU4 A;  5E5A A;  1P3F D;  4HGA B;  3AYW C;  2CV5 A;  4LD9 A;  2L5A A;  3REK B;  2FJ7 A;  1M1A D;  3AZK D;  5BO0 A;  4J8X C;  1JFI A;  4ZUX A;  5AV8 A;  3MGS B;  5AY8 D;  1N1J B;  3MGP C;  1HQ3 B;  3AV1 A;  5B31 C;  4JJN D;  1P3O B;  4H9O B;  2NQB B;  1KX5 A;  5AVC C;  3W98 A;  1F66 D;  5GT0 A;  3AZJ A;  3MVD D;  4R8P A;  5B40 C;  5BT1 C;  5CPK A;  3REH A;  3AZN D;  5AY8 B;  1KX4 A;  3V9R B;  2F8N B;  4J8V C;  3W97 C;  3KWQ C;  4KUD D;  5AV9 C;  5B1L B;  3W99 B;  1M18 D;  5CPJ D;  3X1S C;  3VH6 A;  3AV2 A;  1F66 B;  2NZD C;  5BNV B;  3MVD B;  3AZH C;  5B1M C;  4XUJ A;  3UTB C;  5B33 D;  1AOI D;  1WWS A;  3B6F C;  5DNM A;  3LZ0 A;  3AZN B;  4Z5T B;  4Z2M H;  3KXB D;  3LJA D;  3LEL D;  2IO5 C;  1BH8 B;  3R45 B;  5CPJ B;  1BH9 A;  4YM6 C;  5AV5 A;  5CPI A;  5C3I C;  4WU9 D;  3AZM A;  2ARO D;  5B33 B;  4H9Q A;  4H9N A;  3AZE D;  3REK C;  5B31 A;  3TU4 B;  4ZBJ B;  5E5A B;  5GT3 D;  4KGC C;  3W96 A;  4NE3 A;  5AVC A;  3MGS C;  5GSU D;  3UT9 B;  4LD9 B;  2FJ7 B;  5JRG A;  3AN2 D;  5B40 A;  1H3O A;  4ZUX B;  3WA9 A;  2ARO B;  2BYK A;  4YS3 C;  1P3O C;  2YFV A;  1KU5 A;  4KHA B;  3W97 A;  1S32 D;  1M1A C;  5FUG B;  3AZK C;  1M19 D;  3VH5 T;  5AY8 C;  3B0D C;  3AZH A;  3UTB A;  4QLC B;  1P3A B;  1P34 A;  4CSR B;  1P3G D;  3W99 C;  3B0D B;  4JJN C;  3AZL A;  3LZ1 D;  3X1V A;  1F66 C;  5GXQ A;  3O62 A;  4G91 B;  3KUY A;  3MVD C;  1U35 A;  3UTA D;  1B67 A;  3MNN B;  4XZQ A;  1P3L B;  5F99 D;  2BYM A;  3AZN C;  4X23 B;  4XUJ B;  3X1U D;  4KUD C;  3MGR D;  5AVB B;  5B32 D;  5KDM B;  1P3G B;  1M18 C;  5CPJ C;  2YFW A;  1P3I D;  4Z66 D;  5B33 C;  1EQZ B;  3B6F D;  1AOI C;  1P3M A;  5F99 B;  1P3B A;  5AV5 B;  5DNN B;  3MGQ A;  3B6G B;  1P3P B;  5CPI B;  3KXB C;  4WV4 B;  3LJA C;  4ZBJ C;  4YS3 A;  3WTP B;  3MGR B;  5B32 B;  3LEL C;  1P3F A;  1KX3 A;  3UT9 C;  4J8W D;  4Z66 B;  1M1A A;  4WU8 B;  5B0Y B;  3AZK A;  2ARO C;  3NQJ B;  5B2I D;  2F8N H;  4EO5 B;  5B0Z D;  3AZE C;  3REK D;  1TZY A;  5CP6 D;  3WA9 B;  2BYK B;  2PYO D;  3MGS D;  5GT3 C;  3WKJ D;  5GSU C;  4J8W B;  1HQ3 D;  3X1T B;  1P3O D;  4E45 A;  5B2I B; 
#chains in the Genus database with same CATH topology
 5B0Z B;  4NE6 A;  4G91 C;  3EPK A;  1S32 C;  1P34 B;  4KUD A;  5B24 B;  5CP6 B;  3MNN C;  5BNX A;  1ID3 D;  4H9R B;  2PYO B;  5JA4 A;  1P3L C;  1M19 C;  3WKJ B;  3C1C D;  2F8N D;  2ZY3 A;  1HTA A;  3AZF A;  4UUZ B;  2Y2M A;  5B1L D;  3W99 D;  4WZS B;  4E44 A;  4XZQ B;  5AVB C;  1P3G C;  1AOI A;  3REI A;  3LZ1 C;  2HIO B;  3AZI A;  4H9P A;  3UTA C;  1EQZ C;  1ID3 B;  4H9S A;  5B2J A;  3LEL A;  1WWI A;  1A7W A;  5F99 C;  4J8U D;  3AFA D;  4Z5T D;  3C1C B;  3AZG B;  1P3K B;  1P3P C;  3REJ A;  4WU9 A;  3X1U C;  3REL B;  4M6B A;  3WTP C;  3A6N B;  3MGR C;  3AZE A;  5B32 C;  1P3M B;  1P3B B;  3VH5 A;  1P3I C;  4Z66 C;  2ZY4 A;  5AV6 D;  3C1B D;  1Z2C B;  1ULY A;  3NQU A;  5GT3 A;  1B6W A;  4J8U B;  3AFA B;  3TU4 D;  3AN2 A;  5E5A D;  4CAY B;  2CV5 D;  3AYW A;  3EPJ A;  3UT9 D;  4LD9 D;  2FJ7 D;  4J8W C;  4J8X A;  4ZUX D;  5AV6 B;  3C1B B;  3WTP E;  5B2I C;  4HGA C;  5B0Z C;  3MGP A;  3WAA B;  3B0C T;  1ZLA B;  5B24 C;  5CP6 C;  2CV5 B;  2PYO C;  3WKJ C;  4QLC D;  1P3A D;  5G49 A;  1HQ3 C;  5BO0 B;  1JFI B;  5AV8 B;  3KSY A;  2Y2O A;  2NQB C;  1KX4 D;  2HIO C;  3AZF B;  4J8V A;  3AV1 B;  4Z2M G;  3KWQ A;  5AV9 A;  3MNN D;  3X1U A;  1P3L D;  3X1S A;  1ID3 C;  1KX5 B;  3W98 B;  2Y2J A;  3C1C C;  4X23 D;  5GT0 B;  2CWE A;  4AWL B;  3AZG C;  3AZI B;  4XUJ D;  5B1M A;  1Q9C A;  3AZJ B;  1P3I A;  4R8P B;  5CPK B;  5B1L C;  5AVB D;  5BS7 C;  5DNM D;  3B6F A;  3REH B;  1KX4 B;  5B31 G;  3EG5 B;  4WNN A;  1EQZ D;  2Y2L A;  2DQN C;  5AV5 D;  5DNN D;  4YM6 A;  3AV2 B;  4J8U C;  2G5H C;  4Z5T C;  3AFA C;  1P3P D;  5CPI D;  3B6G D;  3AZM D;  3WTP D;  5DNM B;  3LZ0 B;  3REK A;  2JCH A;  4WU8 D;  5B0Y D;  5AV6 C;  3C1B C;  4KGC A;  3MGS A;  1BH9 B;  1N1J A;  5JRG D;  3WAA C;  3WA9 D;  3AZM B;  3TU4 C;  4H9N B;  4H9Q B;  5E5A C;  4H9O A;  1P3O A;  2Y2I A;  2CV5 C;  4LD9 C;  2FJ7 C;  3X1T D;  5B31 B;  4ZUX C;  3W96 B;  5AVC B;  5AY8 A;  2F8N A;  3V9R A;  5JRG B;  1P34 D;  5G49 B;  5B40 B;  5B24 D;  1H3O B;  2Y2N A;  3W99 A;  3AZL D;  4JJN A;  3EPH A;  3X1V D;  4G92 B;  2YFV B;  4NE5 A;  1KX5 C;  3W98 C;  2NQB D;  5GXQ D;  1F66 A;  3KUY D;  1U35 D;  4AWL C;  3W97 B;  3MVD A;  5AV9 B;  4QLC C;  1P3A C;  2Y2Q A;  4XZQ D;  2HIO D;  3AZN A;  4Z5T A;  1KX4 C;  2NZD B;  3AZH B;  5B1M B;  3UTB B;  2LY8 A;  3AZL B;  1BH8 A;  3R45 A;  3X1V B;  3H0M C;  5CPJ A;  1M18 A;  3AZG D;  1P3K D;  2F8N K;  5GXQ B;  4X23 C;  3O62 B;  3KUY B;  1U35 B;  4XUJ C;  5B33 A;  3REL D;  3A6N D;  1P3M D;  1P3B D;  5DNM C;  2BYM B;  3MGQ D;  2Y2H A;  3KXB A;  3LJA A;  1KX3 D;  3UT9 A;  2YFW B;  1BFM A;  5AV5 C;  3VH6 W;  5DNN C;  2RVQ C;  3VH5 W;  3B6G C;  5CPI C;  3AZM C;  2ARO A;  4KGC B;  1TZY D;  4KHA A;  3MGQ B;  5FUG A;  5B0Y C;  4WU8 C;  4YS3 B;  3W96 C;  1P3F B;  4EO5 C;  1KX3 B;  5GSU A;  3WAA D;  5JRG C;  1M1A B;  1ZLA D;  4QLC A;  1P3A A;  3AZK B;  3WA9 C;  4CSR A;  4G92 C;  1F1E A;  1TZY B;  3X1T C;  1S32 A;  1TAF A;  5AV8 D;  3MNN A;  4JJN B;  1P3L A;  1M19 A;  3AZF D;  4X23 A;  3AV1 D;  1P34 C;  4UPK A;  5AVB A;  3A1K A;  5KDM A;  3REI D;  3AZL C;  1P3G A;  3X1V C;  3LZ1 A;  1KX5 D;  3W98 D;  5GT0 D;  3AZI D;  3AZJ D;  5GXQ C;  3O62 C;  3KUY C;  1U35 C;  4R8P D;  4KUD B;  5CPK D;  3UTA A;  1EQZ A;  5BNX B;  5B2J D;  4XZQ C;  2ZY5 A;  3REH D;  5JA4 B;  1M18 B;  5F99 A;  5DNN A;  3B6G A;  3REJ D;  1P3P A;  2BG1 A;  3WTP A;  3MGR A;  1AOI B;  5B32 A;  3REI B;  2JE5 A;  3AV2 D;  4Z66 A;  1P3K C;  4WU8 A;  5B0Y A;  3KXB B;  4H9P B;  3LJA B;  3NQJ A;  3REL C;  5B2J B;  3LEL B;  3A6N C;  3LZ0 D;  1P3M C;  1P3B C;  3MGQ C;  3REJ B;  4WU9 B;  3AYW D;  3AZE B;  1P3F C;  1KX3 C;  2RVQ D;  4J8W A;  3X1T A;  2HUE B;  4J8X D;  3NQU B;  3VH6 T;  5GT3 B;  2G5I C;  5B2I A;  3P5J B;  5B0Z A;  5GSU B;  2FFF B;  1TZY C;  3MGP D;  5B31 D;  3AN2 B;  5B24 A;  5CP6 A;  5B32 G;  3W96 D;  4H9R A;  5AVC D;  3AYW B;  2PYO A;  3WKJ A;  1PZR A;  3FDD A;  4UUZ A;  5B40 D;  1HQ3 A;  5BT1 D;  1TAF B;  4J8X B;  1S32 B;  1ZLA C;  4NFT A;  2ZY2 A;  1M19 B;  2NQB A;  2HIO A;  4J8V D;  3W97 D;  3KWQ D;  4DRA A;  3MGP B;  5AV9 D;  2JSS A;  5AV8 C;  3X1S D;  1ID3 A;  3LZ1 B;  2NZD A;  3C1C A;  2NZD D;  3AZG A;  3AZH D;  1P3K A;  5B1M D;  3UTB D;  3AZF C;  3AV1 C;  5CHL B;  5B1L A;  3REL A;  5BS7 A;  3UTA B;  3A6N A;  3REI C;  2W8S A;  3O62 D;  5GT0 C;  2F2A C;  3AZJ C;  5BNV A;  4J8V B;  3KWQ B;  3AZI C;  2XD5 A;  4R8P C;  3X1U B;  5CPK C;  3X1S B;  4H9S C;  5B2J C;  2Y2K A;  4YM6 D;  3REH C;  4J8U A;  3AFA A;  1P3I B;  3B0B A;  3REJ C;  1T3U A;  4WU9 C;  4CAY A;  3B6F B;  3B0C W;  2ZM5 A;  3AV2 C;  4WNN B;  2HUE C;  3KFU G;  4DRB A;  5AV6 A;  3C1B A;  4KGC D;  2IO5 B;  1R4V A;  2F8N G;  4YM6 B;  3LZ0 C;  3WAA A;  5C3I B;  1ZLA A;  3AN2 C;  4YS3 D;  3TU4 A;  5E5A A;  1P3F D;  4HGA B;  3AYW C;  2CV5 A;  4LD9 A;  2L5A A;  3REK B;  2FJ7 A;  1M1A D;  3AZK D;  5BO0 A;  4J8X C;  1JFI A;  4ZUX A;  5AV8 A;  3MGS B;  2VQR A;  5AY8 D;  1N1J B;  3MGP C;  1HQ3 B;  3AV1 A;  5B31 C;  4JJN D;  1P3O B;  4H9O B;  2NQB B;  1KX5 A;  5AVC C;  3W98 A;  1F66 D;  5GT0 A;  3AZJ A;  3MVD D;  4R8P A;  5B40 C;  5BT1 C;  5CPK A;  2J8P A;  3REH A;  3AZN D;  5AY8 B;  1KX4 A;  3V9R B;  2F8N B;  4J8V C;  3W97 C;  3KWQ C;  4KUD D;  5AV9 C;  5B1L B;  3W99 B;  1M18 D;  5CPJ D;  3X1S C;  3VH6 A;  3AV2 A;  1F66 B;  2NZD C;  2Y2G A;  5BNV B;  3MVD B;  3AZH C;  5B1M C;  4XUJ A;  3UTB C;  5B33 D;  1AOI D;  1WWS A;  1W2E A;  3B6F C;  5DNM A;  3LZ0 A;  3AZN B;  3F6T A;  4Z5T B;  4Z2M H;  3KXB D;  3LJA D;  3LEL D;  2IO5 C;  1BH8 B;  3R45 B;  5CPJ B;  2Y2P A;  1BH9 A;  4YM6 C;  5AV5 A;  5CPI A;  5C3I C;  4WU9 D;  3AZM A;  2ARO D;  3H0R C;  5B33 B;  4H9Q A;  4H9N A;  3AZE D;  3REK C;  5B31 A;  3TU4 B;  4ZBJ B;  5GT3 D;  5E5A B;  4KGC C;  3W96 A;  4NE3 A;  3AL0 C;  5AVC A;  3MGS C;  5GSU D;  3UT9 B;  4LD9 B;  2FJ7 B;  5JRG A;  3AN2 D;  5B40 A;  1H3O A;  4ZUX B;  3WA9 A;  2ARO B;  2BYK A;  4YS3 C;  1P3O C;  2YFV A;  1KU5 A;  4KHA B;  3W97 A;  1S32 D;  1M1A C;  2DF4 C;  5FUG B;  3AZK C;  1M19 D;  3VH5 T;  5AY8 C;  3B0D C;  3AZH A;  3UTB A;  4QLC B;  1P3A B;  1P34 A;  4CSR B;  1P3G D;  3W99 C;  3B0D B;  4JJN C;  3AZL A;  3LZ1 D;  3X1V A;  1F66 C;  5GXQ A;  3O62 A;  4G91 B;  3KUY A;  3MVD C;  1U35 A;  2UWX A;  3UTA D;  1B67 A;  3MNN B;  4XZQ A;  1P3L B;  5F99 D;  4WJ3 C;  2BYM A;  3IP4 C;  3AZN C;  4X23 B;  4DQY B;  4XUJ B;  3X1U D;  4KUD C;  3MGR D;  5AVB B;  5B32 D;  5KDM B;  1P3G B;  1M18 C;  5CPJ C;  2YFW A;  1P3I D;  4Z66 D;  5B33 C;  1EQZ B;  3B6F D;  1AOI C;  1P3M A;  5F99 B;  1P3B A;  3EPL A;  5AV5 B;  5DNN B;  3MGQ A;  3B6G B;  1P3P B;  5CPI B;  3KXB C;  4WV4 B;  3LJA C;  4ZBJ C;  4YS3 A;  3WTP B;  3MGR B;  2RIQ A;  5B32 B;  3LEL C;  1P3F A;  1KX3 A;  3UT9 C;  4J8W D;  4Z66 B;  1M1A A;  4WU8 B;  5B0Y B;  3AZK A;  2ARO C;  3NQJ B;  5B2I D;  2F8N H;  4EO5 B;  5B0Z D;  2XD1 A;  3AZE C;  3REK D;  1TZY A;  3A1I A;  5CP6 D;  3H0L C;  3WA9 B;  2BYK B;  2PYO D;  3MGS D;  5GT3 C;  3WKJ D;  5GSU C;  4J8W B;  1HQ3 D;  3X1T B;  1P3O D;  4E45 A;  5B2I B; 
#chains in the Genus database with same CATH homology
 5B0Z B;  4NE6 A;  4G91 C;  3EPK A;  1S32 C;  1P34 B;  4KUD A;  5B24 B;  5CP6 B;  3MNN C;  5BNX A;  1ID3 D;  4H9R B;  2PYO B;  5JA4 A;  1P3L C;  1M19 C;  3WKJ B;  3C1C D;  2F8N D;  2ZY3 A;  1HTA A;  3AZF A;  4UUZ B;  2Y2M A;  5B1L D;  3W99 D;  4WZS B;  4E44 A;  4XZQ B;  5AVB C;  1P3G C;  1AOI A;  3REI A;  3LZ1 C;  2HIO B;  3AZI A;  4H9P A;  3UTA C;  1EQZ C;  1ID3 B;  4H9S A;  5B2J A;  3LEL A;  1WWI A;  1A7W A;  5F99 C;  4J8U D;  3AFA D;  4Z5T D;  3C1C B;  3AZG B;  1P3K B;  1P3P C;  3REJ A;  4WU9 A;  3X1U C;  3REL B;  4M6B A;  3WTP C;  3A6N B;  3MGR C;  3AZE A;  5B32 C;  1P3M B;  1P3B B;  3VH5 A;  1P3I C;  4Z66 C;  2ZY4 A;  5AV6 D;  3C1B D;  1Z2C B;  1ULY A;  3NQU A;  5GT3 A;  1B6W A;  4J8U B;  3AFA B;  3TU4 D;  3AN2 A;  5E5A D;  4CAY B;  2CV5 D;  3AYW A;  3EPJ A;  3UT9 D;  4LD9 D;  2FJ7 D;  4J8W C;  4J8X A;  4ZUX D;  5AV6 B;  3C1B B;  3WTP E;  5B2I C;  4HGA C;  5B0Z C;  3MGP A;  3WAA B;  3B0C T;  1ZLA B;  5B24 C;  5CP6 C;  2CV5 B;  2PYO C;  3WKJ C;  4QLC D;  1P3A D;  5G49 A;  1HQ3 C;  5BO0 B;  1JFI B;  5AV8 B;  3KSY A;  2Y2O A;  2NQB C;  1KX4 D;  2HIO C;  3AZF B;  4J8V A;  3AV1 B;  4Z2M G;  3KWQ A;  5AV9 A;  3MNN D;  3X1U A;  1P3L D;  3X1S A;  1ID3 C;  1KX5 B;  3W98 B;  2Y2J A;  3C1C C;  4X23 D;  5GT0 B;  2CWE A;  4AWL B;  3AZG C;  3AZI B;  4XUJ D;  5B1M A;  1Q9C A;  3AZJ B;  1P3I A;  4R8P B;  5CPK B;  5B1L C;  5AVB D;  5BS7 C;  5DNM D;  3B6F A;  3REH B;  1KX4 B;  5B31 G;  3EG5 B;  4WNN A;  1EQZ D;  2Y2L A;  2DQN C;  5AV5 D;  5DNN D;  4YM6 A;  3AV2 B;  4J8U C;  2G5H C;  4Z5T C;  3AFA C;  1P3P D;  5CPI D;  3B6G D;  3AZM D;  3WTP D;  5DNM B;  3LZ0 B;  3REK A;  2JCH A;  4WU8 D;  5B0Y D;  5AV6 C;  3C1B C;  4KGC A;  3MGS A;  1BH9 B;  1N1J A;  5JRG D;  3WAA C;  3WA9 D;  3AZM B;  3TU4 C;  4H9N B;  4H9Q B;  5E5A C;  4H9O A;  1P3O A;  2Y2I A;  2CV5 C;  4LD9 C;  2FJ7 C;  3X1T D;  5B31 B;  4ZUX C;  3W96 B;  5AVC B;  5AY8 A;  2F8N A;  3V9R A;  5JRG B;  1P34 D;  5G49 B;  5B40 B;  5B24 D;  1H3O B;  2Y2N A;  3W99 A;  3AZL D;  4JJN A;  3EPH A;  3X1V D;  4G92 B;  2YFV B;  4NE5 A;  1KX5 C;  3W98 C;  2NQB D;  5GXQ D;  1F66 A;  3KUY D;  1U35 D;  4AWL C;  3W97 B;  3MVD A;  5AV9 B;  4QLC C;  1P3A C;  2Y2Q A;  4XZQ D;  2HIO D;  3AZN A;  4Z5T A;  1KX4 C;  2NZD B;  3AZH B;  5B1M B;  3UTB B;  2LY8 A;  3AZL B;  1BH8 A;  3R45 A;  3X1V B;  3H0M C;  5CPJ A;  1M18 A;  3AZG D;  1P3K D;  2F8N K;  5GXQ B;  4X23 C;  3O62 B;  3KUY B;  1U35 B;  4XUJ C;  5B33 A;  3REL D;  3A6N D;  1P3M D;  1P3B D;  5DNM C;  2BYM B;  3MGQ D;  2Y2H A;  3KXB A;  3LJA A;  1KX3 D;  3UT9 A;  2YFW B;  1BFM A;  5AV5 C;  3VH6 W;  5DNN C;  2RVQ C;  3VH5 W;  3B6G C;  5CPI C;  3AZM C;  2ARO A;  4KGC B;  1TZY D;  4KHA A;  3MGQ B;  5FUG A;  5B0Y C;  4WU8 C;  4YS3 B;  3W96 C;  1P3F B;  4EO5 C;  1KX3 B;  5GSU A;  3WAA D;  5JRG C;  1M1A B;  1ZLA D;  4QLC A;  1P3A A;  3AZK B;  3WA9 C;  4CSR A;  4G92 C;  1F1E A;  1TZY B;  3X1T C;  1S32 A;  1TAF A;  5AV8 D;  3MNN A;  4JJN B;  1P3L A;  1M19 A;  3AZF D;  4X23 A;  3AV1 D;  1P34 C;  4UPK A;  5AVB A;  3A1K A;  5KDM A;  3REI D;  3AZL C;  1P3G A;  3X1V C;  3LZ1 A;  1KX5 D;  3W98 D;  5GT0 D;  3AZI D;  3AZJ D;  5GXQ C;  3O62 C;  3KUY C;  1U35 C;  4R8P D;  4KUD B;  5CPK D;  3UTA A;  1EQZ A;  5BNX B;  5B2J D;  4XZQ C;  2ZY5 A;  3REH D;  5JA4 B;  1M18 B;  5F99 A;  5DNN A;  3B6G A;  3REJ D;  1P3P A;  2BG1 A;  3WTP A;  3MGR A;  1AOI B;  5B32 A;  3REI B;  2JE5 A;  3AV2 D;  4Z66 A;  1P3K C;  4WU8 A;  5B0Y A;  3KXB B;  4H9P B;  3LJA B;  3NQJ A;  3REL C;  5B2J B;  3LEL B;  3A6N C;  3LZ0 D;  1P3M C;  1P3B C;  3MGQ C;  3REJ B;  4WU9 B;  3AYW D;  3AZE B;  1P3F C;  1KX3 C;  2RVQ D;  4J8W A;  3X1T A;  2HUE B;  4J8X D;  3NQU B;  3VH6 T;  5GT3 B;  2G5I C;  5B2I A;  3P5J B;  5B0Z A;  5GSU B;  2FFF B;  1TZY C;  3MGP D;  5B31 D;  3AN2 B;  5B24 A;  5CP6 A;  5B32 G;  3W96 D;  4H9R A;  5AVC D;  3AYW B;  2PYO A;  3WKJ A;  1PZR A;  3FDD A;  4UUZ A;  5B40 D;  1HQ3 A;  5BT1 D;  1TAF B;  4J8X B;  1S32 B;  1ZLA C;  4NFT A;  2ZY2 A;  1M19 B;  2NQB A;  2HIO A;  4J8V D;  3W97 D;  3KWQ D;  4DRA A;  3MGP B;  5AV9 D;  2JSS A;  5AV8 C;  3X1S D;  1ID3 A;  3LZ1 B;  2NZD A;  3C1C A;  2NZD D;  3AZG A;  3AZH D;  1P3K A;  5B1M D;  3UTB D;  3AZF C;  3AV1 C;  5CHL B;  5B1L A;  3REL A;  5BS7 A;  3UTA B;  3A6N A;  3REI C;  2W8S A;  3O62 D;  5GT0 C;  2F2A C;  3AZJ C;  5BNV A;  4J8V B;  3KWQ B;  3AZI C;  2XD5 A;  4R8P C;  3X1U B;  5CPK C;  3X1S B;  4H9S C;  5B2J C;  2Y2K A;  4YM6 D;  3REH C;  4J8U A;  3AFA A;  1P3I B;  3B0B A;  3REJ C;  1T3U A;  4WU9 C;  4CAY A;  3B6F B;  3B0C W;  2ZM5 A;  3AV2 C;  4WNN B;  2HUE C;  3KFU G;  4DRB A;  5AV6 A;  3C1B A;  4KGC D;  2IO5 B;  1R4V A;  2F8N G;  4YM6 B;  3LZ0 C;  3WAA A;  5C3I B;  1ZLA A;  3AN2 C;  4YS3 D;  3TU4 A;  5E5A A;  1P3F D;  4HGA B;  3AYW C;  2CV5 A;  4LD9 A;  2L5A A;  3REK B;  2FJ7 A;  1M1A D;  3AZK D;  5BO0 A;  4J8X C;  1JFI A;  4ZUX A;  5AV8 A;  3MGS B;  2VQR A;  5AY8 D;  1N1J B;  3MGP C;  1HQ3 B;  3AV1 A;  5B31 C;  4JJN D;  1P3O B;  4H9O B;  2NQB B;  1KX5 A;  5AVC C;  3W98 A;  1F66 D;  5GT0 A;  3AZJ A;  3MVD D;  4R8P A;  5B40 C;  5BT1 C;  5CPK A;  2J8P A;  3REH A;  3AZN D;  5AY8 B;  1KX4 A;  3V9R B;  2F8N B;  4J8V C;  3W97 C;  3KWQ C;  4KUD D;  5AV9 C;  5B1L B;  3W99 B;  1M18 D;  5CPJ D;  3X1S C;  3VH6 A;  3AV2 A;  1F66 B;  2NZD C;  2Y2G A;  5BNV B;  3MVD B;  3AZH C;  5B1M C;  4XUJ A;  3UTB C;  5B33 D;  1AOI D;  1WWS A;  1W2E A;  3B6F C;  5DNM A;  3LZ0 A;  3AZN B;  3F6T A;  4Z5T B;  4Z2M H;  3KXB D;  3LJA D;  3LEL D;  2IO5 C;  1BH8 B;  3R45 B;  5CPJ B;  2Y2P A;  1BH9 A;  4YM6 C;  5AV5 A;  5CPI A;  5C3I C;  4WU9 D;  3AZM A;  2ARO D;  3H0R C;  5B33 B;  4H9Q A;  4H9N A;  3AZE D;  3REK C;  5B31 A;  3TU4 B;  4ZBJ B;  5GT3 D;  5E5A B;  4KGC C;  3W96 A;  4NE3 A;  3AL0 C;  5AVC A;  3MGS C;  5GSU D;  3UT9 B;  4LD9 B;  2FJ7 B;  5JRG A;  3AN2 D;  5B40 A;  1H3O A;  4ZUX B;  3WA9 A;  2ARO B;  2BYK A;  4YS3 C;  1P3O C;  2YFV A;  1KU5 A;  4KHA B;  3W97 A;  1S32 D;  1M1A C;  2DF4 C;  5FUG B;  3AZK C;  1M19 D;  3VH5 T;  5AY8 C;  3B0D C;  3AZH A;  3UTB A;  4QLC B;  1P3A B;  1P34 A;  4CSR B;  1P3G D;  3W99 C;  3B0D B;  4JJN C;  3AZL A;  3LZ1 D;  3X1V A;  1F66 C;  5GXQ A;  3O62 A;  4G91 B;  3KUY A;  3MVD C;  1U35 A;  2UWX A;  3UTA D;  1B67 A;  3MNN B;  4XZQ A;  1P3L B;  5F99 D;  4WJ3 C;  2BYM A;  3IP4 C;  3AZN C;  4X23 B;  4DQY B;  4XUJ B;  3X1U D;  4KUD C;  3MGR D;  5AVB B;  5B32 D;  5KDM B;  1P3G B;  1M18 C;  5CPJ C;  2YFW A;  1P3I D;  4Z66 D;  5B33 C;  1EQZ B;  3B6F D;  1AOI C;  1P3M A;  5F99 B;  1P3B A;  3EPL A;  5AV5 B;  5DNN B;  3MGQ A;  3B6G B;  1P3P B;  5CPI B;  3KXB C;  4WV4 B;  3LJA C;  4ZBJ C;  4YS3 A;  3WTP B;  3MGR B;  2RIQ A;  5B32 B;  3LEL C;  1P3F A;  1KX3 A;  3UT9 C;  4J8W D;  4Z66 B;  1M1A A;  4WU8 B;  5B0Y B;  3AZK A;  2ARO C;  3NQJ B;  5B2I D;  2F8N H;  4EO5 B;  5B0Z D;  2XD1 A;  3AZE C;  3REK D;  1TZY A;  3A1I A;  5CP6 D;  3H0L C;  3WA9 B;  2BYK B;  2PYO D;  3MGS D;  5GT3 C;  3WKJ D;  5GSU C;  4J8W B;  1HQ3 D;  3X1T B;  1P3O D;  4E45 A;  5B2I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...