1M19B

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19B00
4G91C 3KWQA 5CPID 5KDMB 3REKA 3MVDB 3B0CT 4E45A 3LZ0A 3X1TD 5GT0C 3X1UA 3REIA 4WU8B 5CPJD 5B33C 3AZED 1P3KA 5F99D 4J8UC 2FJ7B 5GXQD 4Z2MG 5CPIB 1KX4A 2F8NH 1ZLAA 3REHA 1EQZA 3MGPC 3AN2D 2JSSA 5CPJB 3AYWA 2YFVB 4ZUXD 2F8ND 4QLCC 4WV4B 5B24D 2L5AA 1M18C 3C1BC 1P3PA 1AOIA 3AZGA 4JJNA 3W96D 3MGRC 4UUZA 4H9NB 5AV6D 4KUDC 2NQBC 3AN2B 1P3AD 1P3GC 5FUGA 4ZBJC 3X1VD 5AVCB 5CPKD 4ZUXB 5BNVA 5E5AC 5B31D 5AV9B 3TU4D 1KX5D 3AZHD 3B0DB 1KX3D 5GT0A 2PYOD 4EO5C 3W99C 3B6GD 3KXBD 1P3BD 3V9RB 3AFAB 5AVBA 5B2JD 5B31B 3TU4B 1ID3C 5GT3D 5CP6C 2HUEC 4Z66C 3MGPA 1KX3B 5B1LB 5AY8B 2PYOB 1P3MC 4LD9D 1M18A 1JFIB 3B6GB 3C1BA 3A6NB 3KWQD 1P3BB 5B24C 3MGRA 3REKD 5B2JB 3WA9A 2HIOC 5GT3B 3LZ0D 1P3FC 3AZFC 3X1UD 2NQBA 3REID 4WU9A 1P3GA 5AV6C 1M19C 5DNMC 5E5AA 1P3KD 3X1VC 3KWQB 2NZDC 3VH6T 3REKB 3KUYC 3X1TA 3W99A 1HQ3C 4KGCD 3LZ0B 3RELB 3AZJC 3X1UB 3REIB 3MGSC 4HGAB 3WAAC 3AZMD 1R4VA 5GXQA 4Z66A 1F1EA 1P34C 4KUDA 1AOID 3AZGD 1KX4B 3VH5W 3AZLC 1P3MA 1ZLAB 3REHB 1EQZB 3WKJC 3MGQC 4H9QA 4NE6A 1P3IC 2F8NA 5B24A 3AYWB 5C3IC 2HIOA 1P3FA 5GT0D 3W96A 1P3PB 3AV2C 1AOIB 5AV6A 2AROC 4JJNB 1M19A 4YM6C 5DNMA 1ULYA 5B33D 4UUZB 1P3AA 4J8UD 4G91B 4AWLC 3X1VA 5CPKA 1KX5A 5FUGB 1P3OC 3KUYA 5BNVB 2RVQC 3MGPD 3AZJA 5GT0B 3MGSA 5BNXA 5GSUC 1S32D 3WAAA 4KGCC 3KXBA 4QLCD 3MNNC 1M18D 3C1BD 1P34A 3AZMC 3WTPB 1BFMA 5AVBB 3MGRD 4YS3D 3AZIC 5JA4A 3WKJA 5AV8C 3MGQA 1A7WA 4KUDD 1P3GD 4J8WC 4H9RA 3W97C 4Z5TC 5E5AD 1M18B 3LZ1D 3AV2A 4J8XC 2AROA 3O62C 4YM6A 1M1AC 3VH6A 4J8VC 4CSRA 3W99D 3WA9B 3LELC 1WWSA 3W98C 2NQBB 4WU9B 1P3GB 4H9PA 4ZBJB 3AZNC 1P3OA 5E5AB 1ID3D 5CP6D 4Z66D 5GSUA 4EO5B 4KGCA 1P3MD 3X1TB 3MNNA 3LJAD 3W99B 1S32C 3AZMA 3AZEB 5F99B 3AZIA 3C1CC 5GXQB 5AV8A 2HIOD 4Z66B 2HUEB 1P3FD 3AZFD 2F8NG 4J8WA 4YS3C 3W97A 1M19D 4Z5TA 5DNMD 1P3MB 5B1MC 5BS7C 4J8XA 2F8NB 2NZDD 5B24B 2BYMA 4J8VA 2IO5B 3KUYD 3LZ1C 1HQ3D 2HIOB 1P3FB 3AZJD 5B31G 3W96B 5B33A 3MGSD 4XZQC 5AV6B 1M19B 4J8UA 5G49B 5DNMB 3WAAD 1P3AB 1P34D 5B0ZC 3X1VB 3AZKC 1H3OA 3MVDC 5B32C 5CPKB 1KX5B 3AZHB 3AZLD 3KUYB 3WKJD 3MGQD 1S32A 3AZJB 3MGSB 5BNXB 1P3ID 4QLCA 3LJAC 2FJ7C 3KXBB 3C1CA 1TAFB 1P34B 5B2ID 2BYKB 3AV2D 4YS3A 4NE5A 2AROD 4YM6D 5DNND 3NQUA 5B1MA 5JA4B 3WKJB 3MGQB 5BS7A 1Q9CA 1F66D 3B0CW 4H9RB 4LD9B 1P3OD 5C3IB 3LZ1A 2RVQD 4WNNA 4XZQA 5GSUD 2AROB 4YM6B 1HTAA 4CSRB 3MNND 2F8NK 5B0ZA 3AZKA 3R45A 3MVDA 5B32A 5AV9C 1P3KB 1ID3A 4H9PB 5CP6A 3AZID 1P3OB 5AV8D 1P3LC 4J8WD 3W97D 3LJAA 4X23C 4Z5TD 4KGCB 1N1JA 4DRAA 3MNNB 3AZMB 4J8XD 3O62D 1M1AD 4J8VD 5B1LC 5B2IC 3AZIB 3AZFA 5AY8C 5AV8B 3AZGB 4E44A 4R8PD 3LELD 3W98D 5DNNC 4G92B 4J8WB 3W97B 4Z5TB 3AZND 3A6NC 1F66C 2NZDA 3B6FC 4H9NA 2CV5C 2LY8A 4J8XB 3REJC 1WWIA 5AV5C 3NQJA 1HQ3A 2BYMB 4J8VB 5B0YC 3AV1C 1B67A 5B33B 5AV9A 4J8UB 3C1CD 1P3LA 3KSYA 3AZLA 1H3OB 2CWEA 4X23A 3UTAD 4XUJC 3RELC 3MGPB 3X1SC 5B1MD 4HGAC 1P3IA 1S32B 4QLCB 4H9OA 3C1BB 5B2IA 3C1CB 3UTBC 1KX4C 3WTPE 5DNNA 3MGRB 3REHC 4YS3B 4H9SC 4XZQD 1EQZC 5B40C 3NQUB 4R8PC 4KUDB 5BO0A 1F66A 4M6BA 4CAYA 3B6FA 5B0ZD 3AYWC 1U35C 2CV5A 3AZKD 3REJA 3MVDD 5B32D 5AV5A 1P3PC 5B0YA 3LZ1B 4JJNC 4WNNB 3AV1A 4XZQB 2FJ7D 4Z2MH 5B0ZB 1TZYC 3R45B 5JRGC 5B32B 3AZKB 1ID3B 4XUJA 3RELA 3X1SA 5CP6B 1BH8A 5BT1C 3UTAC 3UT9C 3LJAB 1N1JB 3UTBA 3WTPC 4H9QB 3O62A 5AVBC 1M1AA 4H9SA 5B40A 4R8PA 3LELA 3W98A 3AZFB 4NE3A 5AVCD 3AZNA 1U35A 3VH5T 5AV9D 2NZDB 1P3LD 3WA9C 4WU8C 4X23D 3NQJB 1HQ3B 1B6WA 4WU9C 3AFAD 3WAAB 1TZYA 5JRGA 5CHLB 5CPIC 1BH9A 5B1LD 5AY8D 1P3LB 3UTAA 3AZLB 3X1TC 3UT9A 4X23B 5CPJC 3A6ND 3WTPA 3AZEC 1P3IB 3B6FD 5F99C 2CV5D 2YFWA 4KHAA 3REJD 5GXQC 5AV5D 4H9OB 1KU5A 5B2IB 5B0YD 3AV2B 5DNNB 3AV1D 3AN2C 4AWLB 5AVCC 5KDMA 4ZUXC 5BO0B 1F66B 4CAYB 3B6FB 3B0DC 2CV5B 2IO5C 3REJB 5AV5B 4WU8A 4XUJD 3RELD 3X1SD 3W96C 5B0YB 5GSUB 3AV1B 2FJ7A 1P3AC 5CPIA 3AFAC 3UTBD 5CPKC 1KX4D 5B31C 3TU4C 4WZSB 1KX5C 3AZHC 1KX3C 1ZLAD 3REHD 1EQZD 5B40D 4XUJB 5CPJA 2PYOC 3X1SB 1BH8B 2YFVA 3AZEA 3B6GC 5F99A 3AYWD 1U35D 3KXBC 3VH5A 1P3BC 1P3PD 3UTBB 4JJND 5B2JC 3O62B 5GT3C 1M1AB 3AN2A 5B40B 4R8PB 3LELB 5AVCA 3W98B 4ZUXA 4LD9C 3AZNB 1U35B 1TZYD 5JRGD 3KWQC 5BT1D 3REKC 5G49A 3LZ0C 3X1UC 3UT9D 3REIC 3V9RA 3AFAA 3WTPD 1P3KC 5B31A 5AVBD 3TU4A 3AZHA 1KX3A 1TZYB 5JRGB 5B1LA 5AY8A 2PYOA 1BH9B 1ZLAC 1JFIA 3B6GA 3UTAB 3A6NA 1TAFA 3UT9B 5B1MB 1P3BA 3VH6W 4DRBA 2BYKA 3B0BA 5B2JA 5GT3A 2YFWB 4KHAB 3WA9D 4WU8D 1AOIC 3AZGC 2NQBD 5B32G 4NFTA 4G92C 4WU9D 4LD9A
chains in the Genus database with same CATH superfamily
4G91C 3KWQA 5CPID 5KDMB 3REKA 3MVDB 3B0CT 4E45A 3LZ0A 4WJ3C 3X1TD 5GT0C 3X1UA 2W8SA 3REIA 4WU8B 5CPJD 5B33C 3AZED 1P3KA 5F99D 4J8UC 2FJ7B 5GXQD 4Z2MG 5CPIB 1KX4A 2F8NH 1ZLAA 3REHA 1EQZA 3MGPC 3AN2D 2JSSA 5CPJB 3AYWA 2YFVB 4ZUXD 2F8ND 4QLCC 4WV4B 5B24D 2L5AA 1M18C 3C1BC 1P3PA 1AOIA 3AZGA 4JJNA 3W96D 3MGRC 2ZY5A 4UUZA 4H9NB 5AV6D 2XD1A 4KUDC 2NQBC 3AN2B 1P3AD 1P3GC 5FUGA 4ZBJC 3X1VD 3KFUG 5AVCB 5CPKD 4ZUXB 5BNVA 5E5AC 5B31D 5AV9B 3TU4D 1KX5D 3AZHD 3B0DB 1KX3D 5GT0A 2PYOD 4EO5C 3W99C 3B6GD 3EPKA 3KXBD 1P3BD 3V9RB 3AFAB 5AVBA 5B2JD 5B31B 3TU4B 2VQRA 1ID3C 5GT3D 5CP6C 2HUEC 4Z66C 3MGPA 1KX3B 5B1LB 5AY8B 2PYOB 1P3MC 4LD9D 1M18A 1JFIB 3B6GB 3C1BA 3A6NB 3KWQD 1P3BB 5B24C 3MGRA 3REKD 5B2JB 3WA9A 2Y2HA 2HIOC 5GT3B 3LZ0D 1P3FC 3AZFC 3X1UD 2NQBA 3REID 4WU9A 1P3GA 5AV6C 1M19C 5DNMC 5E5AA 1P3KD 3X1VC 3KWQB 2NZDC 3VH6T 3REKB 3KUYC 3X1TA 3W99A 1HQ3C 4KGCD 3LZ0B 3RELB 3AZJC 3X1UB 3REIB 3MGSC 4HGAB 3WAAC 3AZMD 3AL0C 1R4VA 5GXQA 4Z66A 1F1EA 1P34C 4KUDA 1AOID 3AZGD 1KX4B 3VH5W 3AZLC 1P3MA 1ZLAB 3REHB 1EQZB 3WKJC 3MGQC 4H9QA 4NE6A 1P3IC 2FFFB 2F8NA 5B24A 3AYWB 5C3IC 2HIOA 1P3FA 5GT0D 3W96A 1P3PB 3A1KA 3AV2C 1AOIB 5AV6A 2AROC 4JJNB 1M19A 4YM6C 5DNMA 1ULYA 5B33D 4UUZB 1P3AA 4J8UD 4G91B 4AWLC 3X1VA 5CPKA 1KX5A 5FUGB 1P3OC 3KUYA 5BNVB 2RVQC 3MGPD 3AZJA 5GT0B 3MGSA 5BNXA 5GSUC 1S32D 3WAAA 4KGCC 2DF4C 3KXBA 4QLCD 3MNNC 1M18D 2UWXA 3C1BD 1P34A 3AZMC 3WTPB 1BFMA 5AVBB 3MGRD 4YS3D 3AZIC 5JA4A 3WKJA 5AV8C 3MGQA 1A7WA 4KUDD 1P3GD 2ZY2A 4J8WC 4H9RA 3W97C 4Z5TC 2G5IC 5E5AD 1M18B 2RIQA 3LZ1D 3AV2A 4J8XC 2AROA 3O62C 4YM6A 1M1AC 3VH6A 4J8VC 4CSRA 3W99D 3WA9B 3LELC 1WWSA 3W98C 2NQBB 4WU9B 1P3GB 4H9PA 4ZBJB 3AZNC 1P3OA 2DQNC 5E5AB 1ID3D 5CP6D 4Z66D 5GSUA 4EO5B 4KGCA 1P3MD 3X1TB 3MNNA 3LJAD 3W99B 1S32C 3F6TA 3AZMA 3AZEB 5F99B 3AZIA 2Y2GA 2Y2OA 3C1CC 5GXQB 5AV8A 2HIOD 4Z66B 2HUEB 1P3FD 3AZFD 2F8NG 4J8WA 4YS3C 3W97A 1M19D 4Z5TA 5DNMD 1P3MB 5B1MC 5BS7C 4J8XA 2F8NB 2NZDD 5B24B 2BYMA 4J8VA 2IO5B 3KUYD 3LZ1C 1HQ3D 2HIOB 1P3FB 3AZJD 5B31G 3W96B 5B33A 3MGSD 4XZQC 5AV6B 1M19B 4J8UA 5G49B 5DNMB 3WAAD 1P3AB 2Y2QA 1P34D 5B0ZC 3X1VB 3AZKC 1H3OA 3MVDC 5B32C 5CPKB 1KX5B 3AZHB 3AZLD 3KUYB 3WKJD 3MGQD 1PZRA 1S32A 3AZJB 2Y2LA 5BNXB 3MGSB 1P3ID 3IP4C 4QLCA 3LJAC 2FJ7C 3KXBB 3C1CA 2Y2MA 1TAFB 1P34B 5B2ID 2BYKB 3AV2D 4YS3A 4NE5A 2AROD 4YM6D 5DNND 3NQUA 5B1MA 5JA4B 3WKJB 3MGQB 3EPLA 5BS7A 1Q9CA 1F66D 3B0CW 4H9RB 4LD9B 1P3OD 5C3IB 3LZ1A 2RVQD 4WNNA 4XZQA 5GSUD 2AROB 4YM6B 2G5HC 1HTAA 4CSRB 3MNND 2F8NK 5B0ZA 3AZKA 3R45A 3MVDA 5B32A 2F2AC 2ZY4A 5AV9C 2Y2JA 4H9PB 1P3KB 1ID3A 2JE5A 5CP6A 3AZID 1P3OB 5AV8D 1P3LC 4J8WD 3W97D 3LJAA 4X23C 4Z5TD 4KGCB 1N1JA 3A1IA 4DRAA 3MNNB 3FDDA 3AZMB 4J8XD 3O62D 1M1AD 4J8VD 5B1LC 5B2IC 3AZIB 3AZFA 1T3UA 5AY8C 5AV8B 3AZGB 4E44A 4R8PD 3LELD 3W98D 5DNNC 4G92B 2Y2IA 4J8WB 3W97B 4Z5TB 3AZND 3A6NC 1F66C 2NZDA 3B6FC 4H9NA 2CV5C 2LY8A 4J8XB 3REJC 1WWIA 5AV5C 3NQJA 1HQ3A 2BYMB 4J8VB 3P5JB 5B0YC 3AV1C 1B67A 5B33B 5AV9A 4J8UB 3C1CD 1P3LA 3KSYA 3AZLA 1H3OB 2CWEA 2ZY3A 4X23A 3UTAD 4XUJC 3RELC 3MGPB 3X1SC 5B1MD 4HGAC 1P3IA 1S32B 4QLCB 2Y2KA 4H9OA 5B2IA 3C1BB 3C1CB 3UTBC 1KX4C 3WTPE 5DNNA 3MGRB 3REHC 4YS3B 4H9SC 4XZQD 1EQZC 2JCHA 5B40C 3NQUB 4R8PC 4KUDB 5BO0A 1F66A 4M6BA 4CAYA 3B6FA 5B0ZD 3AYWC 1U35C 2CV5A 3AZKD 3REJA 3MVDD 5B32D 5AV5A 1P3PC 4DQYB 5B0YA 3LZ1B 2ZM5A 4JJNC 4WNNB 3H0RC 3AV1A 4XZQB 2FJ7D 4Z2MH 2Y2PA 5B0ZB 1TZYC 3R45B 5JRGC 5B32B 3AZKB 1ID3B 4XUJA 3RELA 5CP6B 3X1SA 1BH8A 5BT1C 3UTAC 3UT9C 3LJAB 1N1JB 3UTBA 3WTPC 4H9QB 1W2EA 3O62A 5AVBC 1M1AA 4H9SA 5B40A 4R8PA 3LELA 3W98A 3AZFB 2J8PA 4NE3A 5AVCD 3AZNA 1U35A 3VH5T 5AV9D 2NZDB 1P3LD 2Y2NA 3WA9C 3EPJA 4WU8C 4X23D 3NQJB 1HQ3B 1B6WA 4WU9C 3AFAD 3WAAB 1TZYA 5JRGA 5CHLB 5CPIC 1BH9A 5B1LD 5AY8D 1P3LB 3UTAA 3AZLB 3X1TC 3UT9A 1Z2CB 4X23B 5CPJC 3A6ND 3WTPA 3AZEC 1P3IB 3H0MC 3B6FD 5F99C 2CV5D 2YFWA 4KHAA 3REJD 5GXQC 5AV5D 4H9OB 1KU5A 5B2IB 5B0YD 3AV2B 2BG1A 5DNNB 3AV1D 3EPHA 3AN2C 4AWLB 5AVCC 5KDMA 4ZUXC 5BO0B 1F66B 4CAYB 3B6FB 3B0DC 2CV5B 2IO5C 3REJB 5AV5B 4WU8A 4XUJD 3RELD 3X1SD 3W96C 5B0YB 5GSUB 3AV1B 2FJ7A 1P3AC 5CPIA 3AFAC 3UTBD 5CPKC 1KX4D 5B31C 3TU4C 4WZSB 1KX5C 3AZHC 1KX3C 1ZLAD 3REHD 1EQZD 5B40D 4XUJB 5CPJA 2PYOC 3X1SB 1BH8B 2YFVA 3AZEA 3B6GC 5F99A 3AYWD 1U35D 3KXBC 3VH5A 1P3BC 1P3PD 3UTBB 4JJND 5B2JC 3O62B 5GT3C 1M1AB 3AN2A 5B40B 4R8PB 3LELB 5AVCA 3W98B 4ZUXA 4LD9C 3AZNB 1U35B 1TZYD 5JRGD 3KWQC 5BT1D 3REKC 3EG5B 5G49A 3LZ0C 3X1UC 3UT9D 3REIC 3H0LC 4UPKA 3V9RA 3AFAA 3WTPD 1P3KC 5B31A 5AVBD 3TU4A 3AZHA 1KX3A 1TZYB 5JRGB 5B1LA 5AY8A 2PYOA 1BH9B 1ZLAC 1JFIA 3B6GA 3UTAB 3A6NA 1TAFA 3UT9B 5B1MB 1P3BA 3VH6W 4DRBA 2BYKA 3B0BA 5B2JA 5GT3A 2YFWB 4KHAB 3WA9D 4WU8D 1AOIC 3AZGC 2NQBD 5B32G 4NFTA 4G92C 4WU9D 2XD5A 4LD9A
chains in the Genus database with same CATH topology
4G91C 3KWQA 5CPID 5KDMB 3REKA 3MVDB 3B0CT 4E45A 3LZ0A 4WJ3C 3X1TD 5GT0C 3X1UA 2W8SA 3REIA 4WU8B 5CPJD 5B33C 3AZED 1P3KA 5F99D 4J8UC 2FJ7B 5GXQD 4Z2MG 5CPIB 1KX4A 2F8NH 1ZLAA 3REHA 1EQZA 3MGPC 3AN2D 2JSSA 5CPJB 3AYWA 2YFVB 4ZUXD 2F8ND 4QLCC 4WV4B 5B24D 2L5AA 1M18C 3C1BC 1P3PA 1AOIA 3AZGA 4JJNA 3W96D 3MGRC 2ZY5A 4UUZA 4H9NB 5AV6D 2XD1A 4KUDC 2NQBC 3AN2B 1P3AD 1P3GC 5FUGA 4ZBJC 3X1VD 3KFUG 5AVCB 5CPKD 4ZUXB 5BNVA 5E5AC 5B31D 5AV9B 3TU4D 1KX5D 3AZHD 3B0DB 1KX3D 5GT0A 2PYOD 4EO5C 3W99C 3B6GD 3EPKA 3KXBD 1P3BD 3V9RB 3AFAB 5AVBA 5B2JD 5B31B 3TU4B 2VQRA 1ID3C 5GT3D 5CP6C 2HUEC 4Z66C 3MGPA 1KX3B 5B1LB 5AY8B 2PYOB 1P3MC 4LD9D 1M18A 1JFIB 3B6GB 3C1BA 3A6NB 3KWQD 1P3BB 5B24C 3MGRA 3REKD 5B2JB 3WA9A 2Y2HA 2HIOC 5GT3B 3LZ0D 1P3FC 3AZFC 3X1UD 2NQBA 3REID 4WU9A 1P3GA 5AV6C 1M19C 5DNMC 5E5AA 1P3KD 3X1VC 3KWQB 2NZDC 3VH6T 3REKB 3KUYC 3X1TA 3W99A 1HQ3C 4KGCD 3LZ0B 3RELB 3AZJC 3X1UB 3REIB 3MGSC 4HGAB 3WAAC 3AZMD 3AL0C 1R4VA 5GXQA 4Z66A 1F1EA 1P34C 4KUDA 1AOID 3AZGD 1KX4B 3VH5W 3AZLC 1P3MA 1ZLAB 3REHB 1EQZB 3WKJC 3MGQC 4H9QA 4NE6A 1P3IC 2FFFB 2F8NA 5B24A 3AYWB 5C3IC 2HIOA 1P3FA 5GT0D 3W96A 1P3PB 3A1KA 3AV2C 1AOIB 5AV6A 2AROC 4JJNB 1M19A 4YM6C 5DNMA 1ULYA 5B33D 4UUZB 1P3AA 4J8UD 4G91B 4AWLC 3X1VA 5CPKA 1KX5A 5FUGB 1P3OC 3KUYA 5BNVB 2RVQC 3MGPD 3AZJA 5GT0B 3MGSA 5BNXA 5GSUC 1S32D 3WAAA 4KGCC 2DF4C 3KXBA 4QLCD 3MNNC 1M18D 2UWXA 3C1BD 1P34A 3AZMC 3WTPB 1BFMA 5AVBB 3MGRD 4YS3D 3AZIC 5JA4A 3WKJA 5AV8C 3MGQA 1A7WA 4KUDD 1P3GD 2ZY2A 4J8WC 4H9RA 3W97C 4Z5TC 2G5IC 5E5AD 1M18B 2RIQA 3LZ1D 3AV2A 4J8XC 2AROA 3O62C 4YM6A 1M1AC 3VH6A 4J8VC 4CSRA 3W99D 3WA9B 3LELC 1WWSA 3W98C 2NQBB 4WU9B 1P3GB 4H9PA 4ZBJB 3AZNC 1P3OA 2DQNC 5E5AB 1ID3D 5CP6D 4Z66D 5GSUA 4EO5B 4KGCA 1P3MD 3X1TB 3MNNA 3LJAD 3W99B 1S32C 3F6TA 3AZMA 3AZEB 5F99B 3AZIA 2Y2GA 2Y2OA 3C1CC 5GXQB 5AV8A 2HIOD 4Z66B 2HUEB 1P3FD 3AZFD 2F8NG 4J8WA 4YS3C 3W97A 1M19D 4Z5TA 5DNMD 1P3MB 5B1MC 5BS7C 4J8XA 2F8NB 2NZDD 5B24B 2BYMA 4J8VA 2IO5B 3KUYD 3LZ1C 1HQ3D 2HIOB 1P3FB 3AZJD 5B31G 3W96B 5B33A 3MGSD 4XZQC 5AV6B 1M19B 4J8UA 5G49B 5DNMB 3WAAD 1P3AB 2Y2QA 1P34D 5B0ZC 3X1VB 3AZKC 1H3OA 3MVDC 5B32C 5CPKB 1KX5B 3AZHB 3AZLD 3KUYB 3WKJD 3MGQD 1PZRA 1S32A 3AZJB 2Y2LA 5BNXB 3MGSB 1P3ID 3IP4C 4QLCA 3LJAC 2FJ7C 3KXBB 3C1CA 2Y2MA 1TAFB 1P34B 5B2ID 2BYKB 3AV2D 4YS3A 4NE5A 2AROD 4YM6D 5DNND 3NQUA 5B1MA 5JA4B 3WKJB 3MGQB 3EPLA 5BS7A 1Q9CA 1F66D 3B0CW 4H9RB 4LD9B 1P3OD 5C3IB 3LZ1A 2RVQD 4WNNA 4XZQA 5GSUD 2AROB 4YM6B 2G5HC 1HTAA 4CSRB 3MNND 2F8NK 5B0ZA 3AZKA 3R45A 3MVDA 5B32A 2F2AC 2ZY4A 5AV9C 2Y2JA 4H9PB 1P3KB 1ID3A 2JE5A 5CP6A 3AZID 1P3OB 5AV8D 1P3LC 4J8WD 3W97D 3LJAA 4X23C 4Z5TD 4KGCB 1N1JA 3A1IA 4DRAA 3MNNB 3FDDA 3AZMB 4J8XD 3O62D 1M1AD 4J8VD 5B1LC 5B2IC 3AZIB 3AZFA 1T3UA 5AY8C 5AV8B 3AZGB 4E44A 4R8PD 3LELD 3W98D 5DNNC 4G92B 2Y2IA 4J8WB 3W97B 4Z5TB 3AZND 3A6NC 1F66C 2NZDA 3B6FC 4H9NA 2CV5C 2LY8A 4J8XB 3REJC 1WWIA 5AV5C 3NQJA 1HQ3A 2BYMB 4J8VB 3P5JB 5B0YC 3AV1C 1B67A 5B33B 5AV9A 4J8UB 3C1CD 1P3LA 3KSYA 3AZLA 1H3OB 2CWEA 2ZY3A 4X23A 3UTAD 4XUJC 3RELC 3MGPB 3X1SC 5B1MD 4HGAC 1P3IA 1S32B 4QLCB 2Y2KA 4H9OA 5B2IA 3C1BB 3C1CB 3UTBC 1KX4C 3WTPE 5DNNA 3MGRB 3REHC 4YS3B 4H9SC 4XZQD 1EQZC 2JCHA 5B40C 3NQUB 4R8PC 4KUDB 5BO0A 1F66A 4M6BA 4CAYA 3B6FA 5B0ZD 3AYWC 1U35C 2CV5A 3AZKD 3REJA 3MVDD 5B32D 5AV5A 1P3PC 4DQYB 5B0YA 3LZ1B 2ZM5A 4JJNC 4WNNB 3H0RC 3AV1A 4XZQB 2FJ7D 4Z2MH 2Y2PA 5B0ZB 1TZYC 3R45B 5JRGC 5B32B 3AZKB 1ID3B 4XUJA 3RELA 5CP6B 3X1SA 1BH8A 5BT1C 3UTAC 3UT9C 3LJAB 1N1JB 3UTBA 3WTPC 4H9QB 1W2EA 3O62A 5AVBC 1M1AA 4H9SA 5B40A 4R8PA 3LELA 3W98A 3AZFB 2J8PA 4NE3A 5AVCD 3AZNA 1U35A 3VH5T 5AV9D 2NZDB 1P3LD 2Y2NA 3WA9C 3EPJA 4WU8C 4X23D 3NQJB 1HQ3B 1B6WA 4WU9C 3AFAD 3WAAB 1TZYA 5JRGA 5CHLB 5CPIC 1BH9A 5B1LD 5AY8D 1P3LB 3UTAA 3AZLB 3X1TC 3UT9A 1Z2CB 4X23B 5CPJC 3A6ND 3WTPA 3AZEC 1P3IB 3H0MC 3B6FD 5F99C 2CV5D 2YFWA 4KHAA 3REJD 5GXQC 5AV5D 4H9OB 1KU5A 5B2IB 5B0YD 3AV2B 2BG1A 5DNNB 3AV1D 3EPHA 3AN2C 4AWLB 5AVCC 5KDMA 4ZUXC 5BO0B 1F66B 4CAYB 3B6FB 3B0DC 2CV5B 2IO5C 3REJB 5AV5B 4WU8A 4XUJD 3RELD 3X1SD 3W96C 5B0YB 5GSUB 3AV1B 2FJ7A 1P3AC 5CPIA 3AFAC 3UTBD 5CPKC 1KX4D 5B31C 3TU4C 4WZSB 1KX5C 3AZHC 1KX3C 1ZLAD 3REHD 1EQZD 5B40D 4XUJB 5CPJA 2PYOC 3X1SB 1BH8B 2YFVA 3AZEA 3B6GC 5F99A 3AYWD 1U35D 3KXBC 3VH5A 1P3BC 1P3PD 3UTBB 4JJND 5B2JC 3O62B 5GT3C 1M1AB 3AN2A 5B40B 4R8PB 3LELB 5AVCA 3W98B 4ZUXA 4LD9C 3AZNB 1U35B 1TZYD 5JRGD 3KWQC 5BT1D 3REKC 3EG5B 5G49A 3LZ0C 3X1UC 3UT9D 3REIC 3H0LC 4UPKA 3V9RA 3AFAA 3WTPD 1P3KC 5B31A 5AVBD 3TU4A 3AZHA 1KX3A 1TZYB 5JRGB 5B1LA 5AY8A 2PYOA 1BH9B 1ZLAC 1JFIA 3B6GA 3UTAB 3A6NA 1TAFA 3UT9B 5B1MB 1P3BA 3VH6W 4DRBA 2BYKA 3B0BA 5B2JA 5GT3A 2YFWB 4KHAB 3WA9D 4WU8D 1AOIC 3AZGC 2NQBD 5B32G 4NFTA 4G92C 4WU9D 2XD5A 4LD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G91 C;  3KWQ A;  5CPI D;  5KDM B;  3REK A;  3MVD B;  3B0C T;  4E45 A;  3LZ0 A;  3X1T D;  5GT0 C;  3X1U A;  3REI A;  4WU8 B;  5CPJ D;  5B33 C;  3AZE D;  1P3K A;  5F99 D;  4J8U C;  2FJ7 B;  5GXQ D;  4Z2M G;  5CPI B;  1KX4 A;  2F8N H;  1ZLA A;  3REH A;  1EQZ A;  3MGP C;  3AN2 D;  2JSS A;  5CPJ B;  3AYW A;  2YFV B;  4ZUX D;  2F8N D;  4QLC C;  4WV4 B;  5B24 D;  2L5A A;  1M18 C;  3C1B C;  1P3P A;  1AOI A;  3AZG A;  4JJN A;  3W96 D;  3MGR C;  4UUZ A;  4H9N B;  5AV6 D;  4KUD C;  2NQB C;  3AN2 B;  1P3A D;  1P3G C;  5FUG A;  4ZBJ C;  3X1V D;  5AVC B;  5CPK D;  4ZUX B;  5BNV A;  5E5A C;  5B31 D;  5AV9 B;  3TU4 D;  1KX5 D;  3AZH D;  3B0D B;  1KX3 D;  5GT0 A;  2PYO D;  4EO5 C;  3W99 C;  3B6G D;  3KXB D;  1P3B D;  3V9R B;  3AFA B;  5AVB A;  5B2J D;  5B31 B;  3TU4 B;  1ID3 C;  5GT3 D;  5CP6 C;  2HUE C;  4Z66 C;  3MGP A;  1KX3 B;  5B1L B;  5AY8 B;  2PYO B;  1P3M C;  4LD9 D;  1M18 A;  1JFI B;  3B6G B;  3C1B A;  3A6N B;  3KWQ D;  1P3B B;  5B24 C;  3MGR A;  3REK D;  5B2J B;  3WA9 A;  2HIO C;  5GT3 B;  3LZ0 D;  1P3F C;  3AZF C;  3X1U D;  2NQB A;  3REI D;  4WU9 A;  1P3G A;  5AV6 C;  1M19 C;  5DNM C;  5E5A A;  1P3K D;  3X1V C;  3KWQ B;  2NZD C;  3VH6 T;  3REK B;  3KUY C;  3X1T A;  3W99 A;  1HQ3 C;  4KGC D;  3LZ0 B;  3REL B;  3AZJ C;  3X1U B;  3REI B;  3MGS C;  4HGA B;  3WAA C;  3AZM D;  1R4V A;  5GXQ A;  4Z66 A;  1F1E A;  1P34 C;  4KUD A;  1AOI D;  3AZG D;  1KX4 B;  3VH5 W;  3AZL C;  1P3M A;  1ZLA B;  3REH B;  1EQZ B;  3WKJ C;  3MGQ C;  4H9Q A;  4NE6 A;  1P3I C;  2F8N A;  5B24 A;  3AYW B;  5C3I C;  2HIO A;  1P3F A;  5GT0 D;  3W96 A;  1P3P B;  3AV2 C;  1AOI B;  5AV6 A;  2ARO C;  4JJN B;  1M19 A;  4YM6 C;  5DNM A;  1ULY A;  5B33 D;  4UUZ B;  1P3A A;  4J8U D;  4G91 B;  4AWL C;  3X1V A;  5CPK A;  1KX5 A;  5FUG B;  1P3O C;  3KUY A;  5BNV B;  2RVQ C;  3MGP D;  3AZJ A;  5GT0 B;  3MGS A;  5BNX A;  5GSU C;  1S32 D;  3WAA A;  4KGC C;  3KXB A;  4QLC D;  3MNN C;  1M18 D;  3C1B D;  1P34 A;  3AZM C;  3WTP B;  1BFM A;  5AVB B;  3MGR D;  4YS3 D;  3AZI C;  5JA4 A;  3WKJ A;  5AV8 C;  3MGQ A;  1A7W A;  4KUD D;  1P3G D;  4J8W C;  4H9R A;  3W97 C;  4Z5T C;  5E5A D;  1M18 B;  3LZ1 D;  3AV2 A;  4J8X C;  2ARO A;  3O62 C;  4YM6 A;  1M1A C;  3VH6 A;  4J8V C;  4CSR A;  3W99 D;  3WA9 B;  3LEL C;  1WWS A;  3W98 C;  2NQB B;  4WU9 B;  1P3G B;  4H9P A;  4ZBJ B;  3AZN C;  1P3O A;  5E5A B;  1ID3 D;  5CP6 D;  4Z66 D;  5GSU A;  4EO5 B;  4KGC A;  1P3M D;  3X1T B;  3MNN A;  3LJA D;  3W99 B;  1S32 C;  3AZM A;  3AZE B;  5F99 B;  3AZI A;  3C1C C;  5GXQ B;  5AV8 A;  2HIO D;  4Z66 B;  2HUE B;  1P3F D;  3AZF D;  2F8N G;  4J8W A;  4YS3 C;  3W97 A;  1M19 D;  4Z5T A;  5DNM D;  1P3M B;  5B1M C;  5BS7 C;  4J8X A;  2F8N B;  2NZD D;  5B24 B;  2BYM A;  4J8V A;  2IO5 B;  3KUY D;  3LZ1 C;  1HQ3 D;  2HIO B;  1P3F B;  3AZJ D;  5B31 G;  3W96 B;  5B33 A;  3MGS D;  4XZQ C;  5AV6 B;  1M19 B;  4J8U A;  5G49 B;  5DNM B;  3WAA D;  1P3A B;  1P34 D;  5B0Z C;  3X1V B;  3AZK C;  1H3O A;  3MVD C;  5B32 C;  5CPK B;  1KX5 B;  3AZH B;  3AZL D;  3KUY B;  3WKJ D;  3MGQ D;  1S32 A;  3AZJ B;  3MGS B;  5BNX B;  1P3I D;  4QLC A;  3LJA C;  2FJ7 C;  3KXB B;  3C1C A;  1TAF B;  1P34 B;  5B2I D;  2BYK B;  3AV2 D;  4YS3 A;  4NE5 A;  2ARO D;  4YM6 D;  5DNN D;  3NQU A;  5B1M A;  5JA4 B;  3WKJ B;  3MGQ B;  5BS7 A;  1Q9C A;  1F66 D;  3B0C W;  4H9R B;  4LD9 B;  1P3O D;  5C3I B;  3LZ1 A;  2RVQ D;  4WNN A;  4XZQ A;  5GSU D;  2ARO B;  4YM6 B;  1HTA A;  4CSR B;  3MNN D;  2F8N K;  5B0Z A;  3AZK A;  3R45 A;  3MVD A;  5B32 A;  5AV9 C;  1P3K B;  1ID3 A;  4H9P B;  5CP6 A;  3AZI D;  1P3O B;  5AV8 D;  1P3L C;  4J8W D;  3W97 D;  3LJA A;  4X23 C;  4Z5T D;  4KGC B;  1N1J A;  4DRA A;  3MNN B;  3AZM B;  4J8X D;  3O62 D;  1M1A D;  4J8V D;  5B1L C;  5B2I C;  3AZI B;  3AZF A;  5AY8 C;  5AV8 B;  3AZG B;  4E44 A;  4R8P D;  3LEL D;  3W98 D;  5DNN C;  4G92 B;  4J8W B;  3W97 B;  4Z5T B;  3AZN D;  3A6N C;  1F66 C;  2NZD A;  3B6F C;  4H9N A;  2CV5 C;  2LY8 A;  4J8X B;  3REJ C;  1WWI A;  5AV5 C;  3NQJ A;  1HQ3 A;  2BYM B;  4J8V B;  5B0Y C;  3AV1 C;  1B67 A;  5B33 B;  5AV9 A;  4J8U B;  3C1C D;  1P3L A;  3KSY A;  3AZL A;  1H3O B;  2CWE A;  4X23 A;  3UTA D;  4XUJ C;  3REL C;  3MGP B;  3X1S C;  5B1M D;  4HGA C;  1P3I A;  1S32 B;  4QLC B;  4H9O A;  3C1B B;  5B2I A;  3C1C B;  3UTB C;  1KX4 C;  3WTP E;  5DNN A;  3MGR B;  3REH C;  4YS3 B;  4H9S C;  4XZQ D;  1EQZ C;  5B40 C;  3NQU B;  4R8P C;  4KUD B;  5BO0 A;  1F66 A;  4M6B A;  4CAY A;  3B6F A;  5B0Z D;  3AYW C;  1U35 C;  2CV5 A;  3AZK D;  3REJ A;  3MVD D;  5B32 D;  5AV5 A;  1P3P C;  5B0Y A;  3LZ1 B;  4JJN C;  4WNN B;  3AV1 A;  4XZQ B;  2FJ7 D;  4Z2M H;  5B0Z B;  1TZY C;  3R45 B;  5JRG C;  5B32 B;  3AZK B;  1ID3 B;  4XUJ A;  3REL A;  3X1S A;  5CP6 B;  1BH8 A;  5BT1 C;  3UTA C;  3UT9 C;  3LJA B;  1N1J B;  3UTB A;  3WTP C;  4H9Q B;  3O62 A;  5AVB C;  1M1A A;  4H9S A;  5B40 A;  4R8P A;  3LEL A;  3W98 A;  3AZF B;  4NE3 A;  5AVC D;  3AZN A;  1U35 A;  3VH5 T;  5AV9 D;  2NZD B;  1P3L D;  3WA9 C;  4WU8 C;  4X23 D;  3NQJ B;  1HQ3 B;  1B6W A;  4WU9 C;  3AFA D;  3WAA B;  1TZY A;  5JRG A;  5CHL B;  5CPI C;  1BH9 A;  5B1L D;  5AY8 D;  1P3L B;  3UTA A;  3AZL B;  3X1T C;  3UT9 A;  4X23 B;  5CPJ C;  3A6N D;  3WTP A;  3AZE C;  1P3I B;  3B6F D;  5F99 C;  2CV5 D;  2YFW A;  4KHA A;  3REJ D;  5GXQ C;  5AV5 D;  4H9O B;  1KU5 A;  5B2I B;  5B0Y D;  3AV2 B;  5DNN B;  3AV1 D;  3AN2 C;  4AWL B;  5AVC C;  5KDM A;  4ZUX C;  5BO0 B;  1F66 B;  4CAY B;  3B6F B;  3B0D C;  2CV5 B;  2IO5 C;  3REJ B;  5AV5 B;  4WU8 A;  4XUJ D;  3REL D;  3X1S D;  3W96 C;  5B0Y B;  5GSU B;  3AV1 B;  2FJ7 A;  1P3A C;  5CPI A;  3AFA C;  3UTB D;  5CPK C;  1KX4 D;  5B31 C;  3TU4 C;  4WZS B;  1KX5 C;  3AZH C;  1KX3 C;  1ZLA D;  3REH D;  1EQZ D;  5B40 D;  4XUJ B;  5CPJ A;  2PYO C;  3X1S B;  1BH8 B;  2YFV A;  3AZE A;  3B6G C;  5F99 A;  3AYW D;  1U35 D;  3KXB C;  3VH5 A;  1P3B C;  1P3P D;  3UTB B;  4JJN D;  5B2J C;  3O62 B;  5GT3 C;  1M1A B;  3AN2 A;  5B40 B;  4R8P B;  3LEL B;  5AVC A;  3W98 B;  4ZUX A;  4LD9 C;  3AZN B;  1U35 B;  1TZY D;  5JRG D;  3KWQ C;  5BT1 D;  3REK C;  5G49 A;  3LZ0 C;  3X1U C;  3UT9 D;  3REI C;  3V9R A;  3AFA A;  3WTP D;  1P3K C;  5B31 A;  5AVB D;  3TU4 A;  3AZH A;  1KX3 A;  1TZY B;  5JRG B;  5B1L A;  5AY8 A;  2PYO A;  1BH9 B;  1ZLA C;  1JFI A;  3B6G A;  3UTA B;  3A6N A;  1TAF A;  3UT9 B;  5B1M B;  1P3B A;  3VH6 W;  4DRB A;  2BYK A;  3B0B A;  5B2J A;  5GT3 A;  2YFW B;  4KHA B;  3WA9 D;  4WU8 D;  1AOI C;  3AZG C;  2NQB D;  5B32 G;  4NFT A;  4G92 C;  4WU9 D;  4LD9 A; 
#chains in the Genus database with same CATH topology
 4G91 C;  3KWQ A;  5CPI D;  5KDM B;  3REK A;  3MVD B;  3B0C T;  4E45 A;  3LZ0 A;  4WJ3 C;  3X1T D;  5GT0 C;  3X1U A;  2W8S A;  3REI A;  4WU8 B;  5CPJ D;  5B33 C;  3AZE D;  1P3K A;  5F99 D;  4J8U C;  2FJ7 B;  5GXQ D;  4Z2M G;  5CPI B;  1KX4 A;  2F8N H;  1ZLA A;  3REH A;  1EQZ A;  3MGP C;  3AN2 D;  2JSS A;  5CPJ B;  3AYW A;  2YFV B;  4ZUX D;  2F8N D;  4QLC C;  4WV4 B;  5B24 D;  2L5A A;  1M18 C;  3C1B C;  1P3P A;  1AOI A;  3AZG A;  4JJN A;  3W96 D;  3MGR C;  2ZY5 A;  4UUZ A;  4H9N B;  5AV6 D;  2XD1 A;  4KUD C;  2NQB C;  3AN2 B;  1P3A D;  1P3G C;  5FUG A;  4ZBJ C;  3X1V D;  3KFU G;  5AVC B;  5CPK D;  4ZUX B;  5BNV A;  5E5A C;  5B31 D;  5AV9 B;  3TU4 D;  1KX5 D;  3AZH D;  3B0D B;  1KX3 D;  5GT0 A;  2PYO D;  4EO5 C;  3W99 C;  3B6G D;  3EPK A;  3KXB D;  1P3B D;  3V9R B;  3AFA B;  5AVB A;  5B2J D;  5B31 B;  3TU4 B;  2VQR A;  1ID3 C;  5GT3 D;  5CP6 C;  2HUE C;  4Z66 C;  3MGP A;  1KX3 B;  5B1L B;  5AY8 B;  2PYO B;  1P3M C;  4LD9 D;  1M18 A;  1JFI B;  3B6G B;  3C1B A;  3A6N B;  3KWQ D;  1P3B B;  5B24 C;  3MGR A;  3REK D;  5B2J B;  3WA9 A;  2Y2H A;  2HIO C;  5GT3 B;  3LZ0 D;  1P3F C;  3AZF C;  3X1U D;  2NQB A;  3REI D;  4WU9 A;  1P3G A;  5AV6 C;  1M19 C;  5DNM C;  5E5A A;  1P3K D;  3X1V C;  3KWQ B;  2NZD C;  3VH6 T;  3REK B;  3KUY C;  3X1T A;  3W99 A;  1HQ3 C;  4KGC D;  3LZ0 B;  3REL B;  3AZJ C;  3X1U B;  3REI B;  3MGS C;  4HGA B;  3WAA C;  3AZM D;  3AL0 C;  1R4V A;  5GXQ A;  4Z66 A;  1F1E A;  1P34 C;  4KUD A;  1AOI D;  3AZG D;  1KX4 B;  3VH5 W;  3AZL C;  1P3M A;  1ZLA B;  3REH B;  1EQZ B;  3WKJ C;  3MGQ C;  4H9Q A;  4NE6 A;  1P3I C;  2FFF B;  2F8N A;  5B24 A;  3AYW B;  5C3I C;  2HIO A;  1P3F A;  5GT0 D;  3W96 A;  1P3P B;  3A1K A;  3AV2 C;  1AOI B;  5AV6 A;  2ARO C;  4JJN B;  1M19 A;  4YM6 C;  5DNM A;  1ULY A;  5B33 D;  4UUZ B;  1P3A A;  4J8U D;  4G91 B;  4AWL C;  3X1V A;  5CPK A;  1KX5 A;  5FUG B;  1P3O C;  3KUY A;  5BNV B;  2RVQ C;  3MGP D;  3AZJ A;  5GT0 B;  3MGS A;  5BNX A;  5GSU C;  1S32 D;  3WAA A;  4KGC C;  2DF4 C;  3KXB A;  4QLC D;  3MNN C;  1M18 D;  2UWX A;  3C1B D;  1P34 A;  3AZM C;  3WTP B;  1BFM A;  5AVB B;  3MGR D;  4YS3 D;  3AZI C;  5JA4 A;  3WKJ A;  5AV8 C;  3MGQ A;  1A7W A;  4KUD D;  1P3G D;  2ZY2 A;  4J8W C;  4H9R A;  3W97 C;  4Z5T C;  2G5I C;  5E5A D;  1M18 B;  2RIQ A;  3LZ1 D;  3AV2 A;  4J8X C;  2ARO A;  3O62 C;  4YM6 A;  1M1A C;  3VH6 A;  4J8V C;  4CSR A;  3W99 D;  3WA9 B;  3LEL C;  1WWS A;  3W98 C;  2NQB B;  4WU9 B;  1P3G B;  4H9P A;  4ZBJ B;  3AZN C;  1P3O A;  2DQN C;  5E5A B;  1ID3 D;  5CP6 D;  4Z66 D;  5GSU A;  4EO5 B;  4KGC A;  1P3M D;  3X1T B;  3MNN A;  3LJA D;  3W99 B;  1S32 C;  3F6T A;  3AZM A;  3AZE B;  5F99 B;  3AZI A;  2Y2G A;  2Y2O A;  3C1C C;  5GXQ B;  5AV8 A;  2HIO D;  4Z66 B;  2HUE B;  1P3F D;  3AZF D;  2F8N G;  4J8W A;  4YS3 C;  3W97 A;  1M19 D;  4Z5T A;  5DNM D;  1P3M B;  5B1M C;  5BS7 C;  4J8X A;  2F8N B;  2NZD D;  5B24 B;  2BYM A;  4J8V A;  2IO5 B;  3KUY D;  3LZ1 C;  1HQ3 D;  2HIO B;  1P3F B;  3AZJ D;  5B31 G;  3W96 B;  5B33 A;  3MGS D;  4XZQ C;  5AV6 B;  1M19 B;  4J8U A;  5G49 B;  5DNM B;  3WAA D;  1P3A B;  2Y2Q A;  1P34 D;  5B0Z C;  3X1V B;  3AZK C;  1H3O A;  3MVD C;  5B32 C;  5CPK B;  1KX5 B;  3AZH B;  3AZL D;  3KUY B;  3WKJ D;  3MGQ D;  1PZR A;  1S32 A;  3AZJ B;  2Y2L A;  5BNX B;  3MGS B;  1P3I D;  3IP4 C;  4QLC A;  3LJA C;  2FJ7 C;  3KXB B;  3C1C A;  2Y2M A;  1TAF B;  1P34 B;  5B2I D;  2BYK B;  3AV2 D;  4YS3 A;  4NE5 A;  2ARO D;  4YM6 D;  5DNN D;  3NQU A;  5B1M A;  5JA4 B;  3WKJ B;  3MGQ B;  3EPL A;  5BS7 A;  1Q9C A;  1F66 D;  3B0C W;  4H9R B;  4LD9 B;  1P3O D;  5C3I B;  3LZ1 A;  2RVQ D;  4WNN A;  4XZQ A;  5GSU D;  2ARO B;  4YM6 B;  2G5H C;  1HTA A;  4CSR B;  3MNN D;  2F8N K;  5B0Z A;  3AZK A;  3R45 A;  3MVD A;  5B32 A;  2F2A C;  2ZY4 A;  5AV9 C;  2Y2J A;  4H9P B;  1P3K B;  1ID3 A;  2JE5 A;  5CP6 A;  3AZI D;  1P3O B;  5AV8 D;  1P3L C;  4J8W D;  3W97 D;  3LJA A;  4X23 C;  4Z5T D;  4KGC B;  1N1J A;  3A1I A;  4DRA A;  3MNN B;  3FDD A;  3AZM B;  4J8X D;  3O62 D;  1M1A D;  4J8V D;  5B1L C;  5B2I C;  3AZI B;  3AZF A;  1T3U A;  5AY8 C;  5AV8 B;  3AZG B;  4E44 A;  4R8P D;  3LEL D;  3W98 D;  5DNN C;  4G92 B;  2Y2I A;  4J8W B;  3W97 B;  4Z5T B;  3AZN D;  3A6N C;  1F66 C;  2NZD A;  3B6F C;  4H9N A;  2CV5 C;  2LY8 A;  4J8X B;  3REJ C;  1WWI A;  5AV5 C;  3NQJ A;  1HQ3 A;  2BYM B;  4J8V B;  3P5J B;  5B0Y C;  3AV1 C;  1B67 A;  5B33 B;  5AV9 A;  4J8U B;  3C1C D;  1P3L A;  3KSY A;  3AZL A;  1H3O B;  2CWE A;  2ZY3 A;  4X23 A;  3UTA D;  4XUJ C;  3REL C;  3MGP B;  3X1S C;  5B1M D;  4HGA C;  1P3I A;  1S32 B;  4QLC B;  2Y2K A;  4H9O A;  5B2I A;  3C1B B;  3C1C B;  3UTB C;  1KX4 C;  3WTP E;  5DNN A;  3MGR B;  3REH C;  4YS3 B;  4H9S C;  4XZQ D;  1EQZ C;  2JCH A;  5B40 C;  3NQU B;  4R8P C;  4KUD B;  5BO0 A;  1F66 A;  4M6B A;  4CAY A;  3B6F A;  5B0Z D;  3AYW C;  1U35 C;  2CV5 A;  3AZK D;  3REJ A;  3MVD D;  5B32 D;  5AV5 A;  1P3P C;  4DQY B;  5B0Y A;  3LZ1 B;  2ZM5 A;  4JJN C;  4WNN B;  3H0R C;  3AV1 A;  4XZQ B;  2FJ7 D;  4Z2M H;  2Y2P A;  5B0Z B;  1TZY C;  3R45 B;  5JRG C;  5B32 B;  3AZK B;  1ID3 B;  4XUJ A;  3REL A;  5CP6 B;  3X1S A;  1BH8 A;  5BT1 C;  3UTA C;  3UT9 C;  3LJA B;  1N1J B;  3UTB A;  3WTP C;  4H9Q B;  1W2E A;  3O62 A;  5AVB C;  1M1A A;  4H9S A;  5B40 A;  4R8P A;  3LEL A;  3W98 A;  3AZF B;  2J8P A;  4NE3 A;  5AVC D;  3AZN A;  1U35 A;  3VH5 T;  5AV9 D;  2NZD B;  1P3L D;  2Y2N A;  3WA9 C;  3EPJ A;  4WU8 C;  4X23 D;  3NQJ B;  1HQ3 B;  1B6W A;  4WU9 C;  3AFA D;  3WAA B;  1TZY A;  5JRG A;  5CHL B;  5CPI C;  1BH9 A;  5B1L D;  5AY8 D;  1P3L B;  3UTA A;  3AZL B;  3X1T C;  3UT9 A;  1Z2C B;  4X23 B;  5CPJ C;  3A6N D;  3WTP A;  3AZE C;  1P3I B;  3H0M C;  3B6F D;  5F99 C;  2CV5 D;  2YFW A;  4KHA A;  3REJ D;  5GXQ C;  5AV5 D;  4H9O B;  1KU5 A;  5B2I B;  5B0Y D;  3AV2 B;  2BG1 A;  5DNN B;  3AV1 D;  3EPH A;  3AN2 C;  4AWL B;  5AVC C;  5KDM A;  4ZUX C;  5BO0 B;  1F66 B;  4CAY B;  3B6F B;  3B0D C;  2CV5 B;  2IO5 C;  3REJ B;  5AV5 B;  4WU8 A;  4XUJ D;  3REL D;  3X1S D;  3W96 C;  5B0Y B;  5GSU B;  3AV1 B;  2FJ7 A;  1P3A C;  5CPI A;  3AFA C;  3UTB D;  5CPK C;  1KX4 D;  5B31 C;  3TU4 C;  4WZS B;  1KX5 C;  3AZH C;  1KX3 C;  1ZLA D;  3REH D;  1EQZ D;  5B40 D;  4XUJ B;  5CPJ A;  2PYO C;  3X1S B;  1BH8 B;  2YFV A;  3AZE A;  3B6G C;  5F99 A;  3AYW D;  1U35 D;  3KXB C;  3VH5 A;  1P3B C;  1P3P D;  3UTB B;  4JJN D;  5B2J C;  3O62 B;  5GT3 C;  1M1A B;  3AN2 A;  5B40 B;  4R8P B;  3LEL B;  5AVC A;  3W98 B;  4ZUX A;  4LD9 C;  3AZN B;  1U35 B;  1TZY D;  5JRG D;  3KWQ C;  5BT1 D;  3REK C;  3EG5 B;  5G49 A;  3LZ0 C;  3X1U C;  3UT9 D;  3REI C;  3H0L C;  4UPK A;  3V9R A;  3AFA A;  3WTP D;  1P3K C;  5B31 A;  5AVB D;  3TU4 A;  3AZH A;  1KX3 A;  1TZY B;  5JRG B;  5B1L A;  5AY8 A;  2PYO A;  1BH9 B;  1ZLA C;  1JFI A;  3B6G A;  3UTA B;  3A6N A;  1TAF A;  3UT9 B;  5B1M B;  1P3B A;  3VH6 W;  4DRB A;  2BYK A;  3B0B A;  5B2J A;  5GT3 A;  2YFW B;  4KHA B;  3WA9 D;  4WU8 D;  1AOI C;  3AZG C;  2NQB D;  5B32 G;  4NFT A;  4G92 C;  4WU9 D;  2XD5 A;  4LD9 A; 
#chains in the Genus database with same CATH homology
 4G91 C;  3KWQ A;  5CPI D;  5KDM B;  3REK A;  3MVD B;  3B0C T;  4E45 A;  3LZ0 A;  4WJ3 C;  3X1T D;  5GT0 C;  3X1U A;  2W8S A;  3REI A;  4WU8 B;  5CPJ D;  5B33 C;  3AZE D;  1P3K A;  5F99 D;  4J8U C;  2FJ7 B;  5GXQ D;  4Z2M G;  5CPI B;  1KX4 A;  2F8N H;  1ZLA A;  3REH A;  1EQZ A;  3MGP C;  3AN2 D;  2JSS A;  5CPJ B;  3AYW A;  2YFV B;  4ZUX D;  2F8N D;  4QLC C;  4WV4 B;  5B24 D;  2L5A A;  1M18 C;  3C1B C;  1P3P A;  1AOI A;  3AZG A;  4JJN A;  3W96 D;  3MGR C;  2ZY5 A;  4UUZ A;  4H9N B;  5AV6 D;  2XD1 A;  4KUD C;  2NQB C;  3AN2 B;  1P3A D;  1P3G C;  5FUG A;  4ZBJ C;  3X1V D;  3KFU G;  5AVC B;  5CPK D;  4ZUX B;  5BNV A;  5E5A C;  5B31 D;  5AV9 B;  3TU4 D;  1KX5 D;  3AZH D;  3B0D B;  1KX3 D;  5GT0 A;  2PYO D;  4EO5 C;  3W99 C;  3B6G D;  3EPK A;  3KXB D;  1P3B D;  3V9R B;  3AFA B;  5AVB A;  5B2J D;  5B31 B;  3TU4 B;  2VQR A;  1ID3 C;  5GT3 D;  5CP6 C;  2HUE C;  4Z66 C;  3MGP A;  1KX3 B;  5B1L B;  5AY8 B;  2PYO B;  1P3M C;  4LD9 D;  1M18 A;  1JFI B;  3B6G B;  3C1B A;  3A6N B;  3KWQ D;  1P3B B;  5B24 C;  3MGR A;  3REK D;  5B2J B;  3WA9 A;  2Y2H A;  2HIO C;  5GT3 B;  3LZ0 D;  1P3F C;  3AZF C;  3X1U D;  2NQB A;  3REI D;  4WU9 A;  1P3G A;  5AV6 C;  1M19 C;  5DNM C;  5E5A A;  1P3K D;  3X1V C;  3KWQ B;  2NZD C;  3VH6 T;  3REK B;  3KUY C;  3X1T A;  3W99 A;  1HQ3 C;  4KGC D;  3LZ0 B;  3REL B;  3AZJ C;  3X1U B;  3REI B;  3MGS C;  4HGA B;  3WAA C;  3AZM D;  3AL0 C;  1R4V A;  5GXQ A;  4Z66 A;  1F1E A;  1P34 C;  4KUD A;  1AOI D;  3AZG D;  1KX4 B;  3VH5 W;  3AZL C;  1P3M A;  1ZLA B;  3REH B;  1EQZ B;  3WKJ C;  3MGQ C;  4H9Q A;  4NE6 A;  1P3I C;  2FFF B;  2F8N A;  5B24 A;  3AYW B;  5C3I C;  2HIO A;  1P3F A;  5GT0 D;  3W96 A;  1P3P B;  3A1K A;  3AV2 C;  1AOI B;  5AV6 A;  2ARO C;  4JJN B;  1M19 A;  4YM6 C;  5DNM A;  1ULY A;  5B33 D;  4UUZ B;  1P3A A;  4J8U D;  4G91 B;  4AWL C;  3X1V A;  5CPK A;  1KX5 A;  5FUG B;  1P3O C;  3KUY A;  5BNV B;  2RVQ C;  3MGP D;  3AZJ A;  5GT0 B;  3MGS A;  5BNX A;  5GSU C;  1S32 D;  3WAA A;  4KGC C;  2DF4 C;  3KXB A;  4QLC D;  3MNN C;  1M18 D;  2UWX A;  3C1B D;  1P34 A;  3AZM C;  3WTP B;  1BFM A;  5AVB B;  3MGR D;  4YS3 D;  3AZI C;  5JA4 A;  3WKJ A;  5AV8 C;  3MGQ A;  1A7W A;  4KUD D;  1P3G D;  2ZY2 A;  4J8W C;  4H9R A;  3W97 C;  4Z5T C;  2G5I C;  5E5A D;  1M18 B;  2RIQ A;  3LZ1 D;  3AV2 A;  4J8X C;  2ARO A;  3O62 C;  4YM6 A;  1M1A C;  3VH6 A;  4J8V C;  4CSR A;  3W99 D;  3WA9 B;  3LEL C;  1WWS A;  3W98 C;  2NQB B;  4WU9 B;  1P3G B;  4H9P A;  4ZBJ B;  3AZN C;  1P3O A;  2DQN C;  5E5A B;  1ID3 D;  5CP6 D;  4Z66 D;  5GSU A;  4EO5 B;  4KGC A;  1P3M D;  3X1T B;  3MNN A;  3LJA D;  3W99 B;  1S32 C;  3F6T A;  3AZM A;  3AZE B;  5F99 B;  3AZI A;  2Y2G A;  2Y2O A;  3C1C C;  5GXQ B;  5AV8 A;  2HIO D;  4Z66 B;  2HUE B;  1P3F D;  3AZF D;  2F8N G;  4J8W A;  4YS3 C;  3W97 A;  1M19 D;  4Z5T A;  5DNM D;  1P3M B;  5B1M C;  5BS7 C;  4J8X A;  2F8N B;  2NZD D;  5B24 B;  2BYM A;  4J8V A;  2IO5 B;  3KUY D;  3LZ1 C;  1HQ3 D;  2HIO B;  1P3F B;  3AZJ D;  5B31 G;  3W96 B;  5B33 A;  3MGS D;  4XZQ C;  5AV6 B;  1M19 B;  4J8U A;  5G49 B;  5DNM B;  3WAA D;  1P3A B;  2Y2Q A;  1P34 D;  5B0Z C;  3X1V B;  3AZK C;  1H3O A;  3MVD C;  5B32 C;  5CPK B;  1KX5 B;  3AZH B;  3AZL D;  3KUY B;  3WKJ D;  3MGQ D;  1PZR A;  1S32 A;  3AZJ B;  2Y2L A;  5BNX B;  3MGS B;  1P3I D;  3IP4 C;  4QLC A;  3LJA C;  2FJ7 C;  3KXB B;  3C1C A;  2Y2M A;  1TAF B;  1P34 B;  5B2I D;  2BYK B;  3AV2 D;  4YS3 A;  4NE5 A;  2ARO D;  4YM6 D;  5DNN D;  3NQU A;  5B1M A;  5JA4 B;  3WKJ B;  3MGQ B;  3EPL A;  5BS7 A;  1Q9C A;  1F66 D;  3B0C W;  4H9R B;  4LD9 B;  1P3O D;  5C3I B;  3LZ1 A;  2RVQ D;  4WNN A;  4XZQ A;  5GSU D;  2ARO B;  4YM6 B;  2G5H C;  1HTA A;  4CSR B;  3MNN D;  2F8N K;  5B0Z A;  3AZK A;  3R45 A;  3MVD A;  5B32 A;  2F2A C;  2ZY4 A;  5AV9 C;  2Y2J A;  4H9P B;  1P3K B;  1ID3 A;  2JE5 A;  5CP6 A;  3AZI D;  1P3O B;  5AV8 D;  1P3L C;  4J8W D;  3W97 D;  3LJA A;  4X23 C;  4Z5T D;  4KGC B;  1N1J A;  3A1I A;  4DRA A;  3MNN B;  3FDD A;  3AZM B;  4J8X D;  3O62 D;  1M1A D;  4J8V D;  5B1L C;  5B2I C;  3AZI B;  3AZF A;  1T3U A;  5AY8 C;  5AV8 B;  3AZG B;  4E44 A;  4R8P D;  3LEL D;  3W98 D;  5DNN C;  4G92 B;  2Y2I A;  4J8W B;  3W97 B;  4Z5T B;  3AZN D;  3A6N C;  1F66 C;  2NZD A;  3B6F C;  4H9N A;  2CV5 C;  2LY8 A;  4J8X B;  3REJ C;  1WWI A;  5AV5 C;  3NQJ A;  1HQ3 A;  2BYM B;  4J8V B;  3P5J B;  5B0Y C;  3AV1 C;  1B67 A;  5B33 B;  5AV9 A;  4J8U B;  3C1C D;  1P3L A;  3KSY A;  3AZL A;  1H3O B;  2CWE A;  2ZY3 A;  4X23 A;  3UTA D;  4XUJ C;  3REL C;  3MGP B;  3X1S C;  5B1M D;  4HGA C;  1P3I A;  1S32 B;  4QLC B;  2Y2K A;  4H9O A;  5B2I A;  3C1B B;  3C1C B;  3UTB C;  1KX4 C;  3WTP E;  5DNN A;  3MGR B;  3REH C;  4YS3 B;  4H9S C;  4XZQ D;  1EQZ C;  2JCH A;  5B40 C;  3NQU B;  4R8P C;  4KUD B;  5BO0 A;  1F66 A;  4M6B A;  4CAY A;  3B6F A;  5B0Z D;  3AYW C;  1U35 C;  2CV5 A;  3AZK D;  3REJ A;  3MVD D;  5B32 D;  5AV5 A;  1P3P C;  4DQY B;  5B0Y A;  3LZ1 B;  2ZM5 A;  4JJN C;  4WNN B;  3H0R C;  3AV1 A;  4XZQ B;  2FJ7 D;  4Z2M H;  2Y2P A;  5B0Z B;  1TZY C;  3R45 B;  5JRG C;  5B32 B;  3AZK B;  1ID3 B;  4XUJ A;  3REL A;  5CP6 B;  3X1S A;  1BH8 A;  5BT1 C;  3UTA C;  3UT9 C;  3LJA B;  1N1J B;  3UTB A;  3WTP C;  4H9Q B;  1W2E A;  3O62 A;  5AVB C;  1M1A A;  4H9S A;  5B40 A;  4R8P A;  3LEL A;  3W98 A;  3AZF B;  2J8P A;  4NE3 A;  5AVC D;  3AZN A;  1U35 A;  3VH5 T;  5AV9 D;  2NZD B;  1P3L D;  2Y2N A;  3WA9 C;  3EPJ A;  4WU8 C;  4X23 D;  3NQJ B;  1HQ3 B;  1B6W A;  4WU9 C;  3AFA D;  3WAA B;  1TZY A;  5JRG A;  5CHL B;  5CPI C;  1BH9 A;  5B1L D;  5AY8 D;  1P3L B;  3UTA A;  3AZL B;  3X1T C;  3UT9 A;  1Z2C B;  4X23 B;  5CPJ C;  3A6N D;  3WTP A;  3AZE C;  1P3I B;  3H0M C;  3B6F D;  5F99 C;  2CV5 D;  2YFW A;  4KHA A;  3REJ D;  5GXQ C;  5AV5 D;  4H9O B;  1KU5 A;  5B2I B;  5B0Y D;  3AV2 B;  2BG1 A;  5DNN B;  3AV1 D;  3EPH A;  3AN2 C;  4AWL B;  5AVC C;  5KDM A;  4ZUX C;  5BO0 B;  1F66 B;  4CAY B;  3B6F B;  3B0D C;  2CV5 B;  2IO5 C;  3REJ B;  5AV5 B;  4WU8 A;  4XUJ D;  3REL D;  3X1S D;  3W96 C;  5B0Y B;  5GSU B;  3AV1 B;  2FJ7 A;  1P3A C;  5CPI A;  3AFA C;  3UTB D;  5CPK C;  1KX4 D;  5B31 C;  3TU4 C;  4WZS B;  1KX5 C;  3AZH C;  1KX3 C;  1ZLA D;  3REH D;  1EQZ D;  5B40 D;  4XUJ B;  5CPJ A;  2PYO C;  3X1S B;  1BH8 B;  2YFV A;  3AZE A;  3B6G C;  5F99 A;  3AYW D;  1U35 D;  3KXB C;  3VH5 A;  1P3B C;  1P3P D;  3UTB B;  4JJN D;  5B2J C;  3O62 B;  5GT3 C;  1M1A B;  3AN2 A;  5B40 B;  4R8P B;  3LEL B;  5AVC A;  3W98 B;  4ZUX A;  4LD9 C;  3AZN B;  1U35 B;  1TZY D;  5JRG D;  3KWQ C;  5BT1 D;  3REK C;  3EG5 B;  5G49 A;  3LZ0 C;  3X1U C;  3UT9 D;  3REI C;  3H0L C;  4UPK A;  3V9R A;  3AFA A;  3WTP D;  1P3K C;  5B31 A;  5AVB D;  3TU4 A;  3AZH A;  1KX3 A;  1TZY B;  5JRG B;  5B1L A;  5AY8 A;  2PYO A;  1BH9 B;  1ZLA C;  1JFI A;  3B6G A;  3UTA B;  3A6N A;  1TAF A;  3UT9 B;  5B1M B;  1P3B A;  3VH6 W;  4DRB A;  2BYK A;  3B0B A;  5B2J A;  5GT3 A;  2YFW B;  4KHA B;  3WA9 D;  4WU8 D;  1AOI C;  3AZG C;  2NQB D;  5B32 G;  4NFT A;  4G92 C;  4WU9 D;  2XD5 A;  4LD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...