1M1EB

Beta-catenin armadillo repeat domain bound to icat
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
65
Chain Sequence
KSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQIDQGAEDVVMAFSRSETED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-catenin
publication title ICAT inhibits Beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 19
structure length 65
sequence length 70
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06384 ICAT Beta-catenin-interacting protein ICAT
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Beta-catenin-interacting ICAT 1m1eB01
1LUJB 1M1EB 1T08B
chains in the Genus database with same CATH superfamily
3WTWC 1MSFC 2JA5J 3R61A 2GXBA 1ETKA 2RNJA 1IO2A 2X6YA 3RCOA 1BI1A 1U6GA 4Y52J 1Y56A 3CUOA 2YU3A 1QA6A 3S1NJ 4C30A 1Q1VA 2QQ9A 5EDNA 4YRVA 2X6OA 1YFHA 3ABLH 4Q4ZF 5AIPA 4NB5A 2HTSA 1N25A 4P5OA 3SZTA 2XAQA 2EPFA 2EFWA 2BXYA 5DTDA 3F8MA 4B43A 3WU0A 4U7DA 2FBKA 3K70C 2R5ZA 2Q1ZB 4EMSA 2IS2A 3VODA 3ZQGA 3L2WA 5FROA 2BW3A 2HZTA 1OCTC 2A69F 2ZJPF 3V7RA 2EFPA 1ZGJA 2L5QA 1V3FA 4B1RA 2PJRB 1GV5A 3VYSB 4BXXJ 5EGOB 1FBQA 1MBHA 2PMZN 2DA6A 1K78A 4HLYA 2P5VA 4BNCA 2V9VA 3TOBA 3DTIA 2Z2SB 1SFUA 2VPRA 3GTJJ 1ZGAA 3BTLA 3FHNA 5HDGA 4P55A 4RBOA 1BR2A 3CMAI 3RKWA 2ZFUA 4DBQA 3OYCA 1PP8F 3MZ8A 3J80K 4MGRA 5CLSA 4PGHA 4XLHA 2QUFA 3L00A 5JLXA 1VTNC 1LE8A 1EH8A 5FLMJ 3EETA 4UB6C 1RKWA 2Y9YA 4NC7A 3V42A 4OIQF 4PSWA 4L5IA 1G2HA 4H4KC 2FUG2 3M07A 1MBJA 2GZWA 2EV5A 1PUEE 2JUCA 2OV7A 5J6XA 3ROUA 3GZ6A 1G3YA 3FXUA 1H89C 3TBIA 1Z0XA 1NHAA 3BR6A 4S05A 3VYTB 4IRHA 3J81Z 3HOUJ 2GQQA 2VBZA 1W7PA 3JSPA 3G71I 3TO9A 3DKYA 3KP2A 4MHGA 2W7NA 1O7FA 1ZARA 1B4AA 1TT0A 3E5UA 2NS0A 4GYIA 3ECOA 4XRFA 5B5EC 3OYHA 1DPUA 3GFJA 4BH9A 4LLLA 4YFXF 4I99C 2P8TA 1REPC 1RKTA 1XMKA 3C18A 2DDAA 1OYYA 1YO5C 2BBYA 5DM6F 4R8HA 3PSIA 1YIJI 2XGDA 2HR3A 3TEDA 4CCKA 4XOPA 4CYCB 2WV0A 2MH2A 1J5YA 3ZMZA 3BPVA 1FJLA 2XGXA 3FDYA 4ZDPA 2QBYA 3F0CA 3PQJA 2DA1A 2DMQA 2L01A 4DNCA 2JTVA 4RDUA 2DTRA 5K7FA 2A61A 2XGEA 3GFLA 2YU9J 2BXZA 1YITI 3PL8A 2HPMA 3SDGA 1FEXA 4CO8A 3KP7A 4XKWA 2R7ZJ 1TQIA 1USSA 5DCMB 3QQAA 1MMSA 1ON2A 2CFOA 1KU3A 3B6CA 3R0JA 3F8NA 1B72A 3I0TA 1G4DA 2YS9A 1RPWA 3S1MJ 3PJRA 2KLOA 3CDHA 3HHGA 5K7ZA 2NS7A 1IXSB 1E3OC 2E1MC 4AYBN 3L2UA 2VKDA 2CJJA 4M73A 2VLAA 3JW4A 2XV4S 2JA7J 2ZC2A 1BI0A 2BY2A 1XCBA 4I09A 4AYBA 1ZHFA 4RLQA 1K61A 1VNDA 2UZKA 3CLQA 2ZJRF 1XC5A 3WHBA 2ISZA 4KN4X 3HGYA 1JHFA 4MFEA 2QSHX 4XIDA 1MIJA 1A35A 2GM4A 4FHTA 3WGHA 2VPLA 3BZCA 2G7UA 5EF6A 2Q0OA 5E18F 3JTGA 1FIPA 1F4KA 3CUQC 2DT6A 2G9WA 3FK6A 2LY9A 5E79C 1ZH5A 3RKYA 3U21A 3WGIA 1VQ8I 4ENJA 3I3LA 2CQXA 5BNGA 1T38A 3NARA 3G6EI 4XSXF 4BY1J 2IS4A 4IHSA 3TDUC 1IW7F 4IL6C 2IGMA 2O9LA 5DYMA 4XORA 1EF4A 2DT7B 3CCUI 4KFCA 3V8KA 2BYVE 2VQLA 1BOAA 1Y0UA 2CRGA 3CMYA 1YJWI 3IHUA 3S32A 1X1DA 2LKXA 3E6CC 2AXTC 1YG2A 3S2WA 5LLQA 1H9GA 4U0YA 1JGGA 1WPKA 3X2QH 5LFAA 1W5TA 2BGCA 4HZFA 1QGPA 5A2QK 2XAUA 3RYRA 4N9HA 2BY0A 5ILUA 4RB0A 3G3ZA 4YFNF 1F9NA 5E17F 1RR8C 1TWHJ 3CUQA 3T0YA 3MN2A 4YEJA 4EGYA 4UUVA 2ZBKA 2QWWA 4ZYHA 3ZQCA 3HG9A 1TWAJ 2DXIA 5FKNA 2RAEA 3ZMDA 1R5HA 3N05A 2E19A 1WRJA 2XROA 3HJEA 4Z2YA 1I6HJ 2JK3A 3DEWA 4RA2A 2F5CA 5J8CA 5EJCA 3H3UA 1K4SA 4AM3A 2M4KA 3K6GA 4UVBA 1I6XA 2D45A 2QQ8A 2K7LA 2FEZA 2VBXA 4BGDA 3HDDA 4KDPA 2HVSA 4BEHB 2JN6A 1IAWA 1SVLA 2R92J 1STZA 1PUFB 4XLAA 4ESJA 5CPRB 1ODDA 4ZYEA 3L7WA 5LHGA 3ZQFA 2CQ7A 1XCVA 3JRHA 1ZGWA 4KT6A 1J9IA 1SFEA 5KAFC 1M1EB 4BE1A 1X2MA 2RVCA 4MO7A 2MABA 3IH4A 1POGA 3O6BB 3H0DA 2K85A 1X3ZB 3DP7A 3SFIA 3PUFA 1FSEA 4FT8A 5LRSA 4BJ6C 2HEOA 4BE2A 3J80Z 3OYIA 2ADUA 1BBYA 1JKPC 2ID3A 4AUXA 3BP8A 2KKOA 3PNYA 2QQAA 1QZZA 3HKZA 5IP6A 3UKGA 5K5RA 2HOSA 3DBLB 2R93J 3RJPA 1Y1VJ 3I56I 4UNOA 2IXSA 1T98A 2CFXA 2HNHA 5BS6A 1NH3A 1VF9A 4D7NA 3KCCA 3VFZA 3CCQI 3G1OA 1WH7A 1OKRA 3S93A 4I98B 2PBIA 2R3SA 4I2OA 1AKHB 3IWFA 3O3KA 3HPHA 1XB4A 4A3IJ 3AAFA 2VI6A 2EQRA 3S3NA 5L3EA 2VXDA 4PZJA 4PFPA 4XL9A 1S3JA 1LFPA 4GGGA 1LEBA 4LIUA 3OYLA 1QU3A 1OR7C 1WJBA 3R6SA 2CS3A 2QLZA 3T8TA 4PDKA 2COBA 1H88C 3NWTA 5LGTA 1Y6IA 2DJNA 1D5YA 3TMOA 5D6FA 1YW8A 2X6WA 5IP7J 4R79A 4RAZA 1IGNA 5M3FJ 3F9KA 3S1RJ 3CF5F 1IUFA 1FX7A 3CCSI 1K7AA 1X58A 3JRAA 2EILH 4PSXA 4M71A 2Z33A 3EUHC 2W1OA 2L9VA 3QYEA 4AC0A 5F1RA 1YE9A 2UXNA 4LMYA 4HBLA 4WX9A 1MH4A 2L7FP 1MMNA 2UUZA 1HKSA 4GYGA 1V4RA 2KISA 4BQNA 1D1AA 2Y69H 3CJTB 3FKIJ 4E70A 1NG6A 3BR5A 4MIMA 1W0UA 5IYBJ 3LQQA 3Q0WA 1A31A 5E3MA 1W36D 1IN8A 1GUUA 2L7ZA 3JRBA 1OR7A 5K7HA 3OOPA 2WBMA 3OYMA 5FB2A 3HOWJ 3HPGA 2LP0A 2HTJA 3F8BA 2Z99A 3RKQA 4HDUA 1U8RA 3GFMA 2DOFA 3VDXA 2R5YA 1FY7A 2R7OA 3E6MA 2YX4A 4L5JA 2WAFA 3Q3SA 2PQ8A 3EUHA 3H36A 2FA5A 5ED4A 5GAHJ 1GXPA 1FTZA 3LA3A 4D5CA 1SC7A 2DYSH 2HXOA 5FKKA 1ZRDA 5F1JA 5DS9A 5B66C 2L9SA 1HDDC 2K02A 3PNTA 3PFYA 1O3SA 4RB1A 5KVRA 1J0RA 2DA3A 1HW1A 2FBHA 3BC8A 3LSIA 3ZMVA 3VB2A 3WU1B 5FKLA 4F55A 3MWMA 4C9YA 2XPVA 2BVLA 2W4SA 2Y75A 3VYRB 5L3FA 1OCPA 2BHZA 1FTTA 1ETXA 1MW7A 4OOIA 2OTJI 2F6CA 2ICWG 3KZIC 2EZIA 1VQNI 4YIIA 3SQNA 2EA4A 2W85A 1OCCH 2LH9A 3H9QA 3F6OA 4KICA 1JUPA 4CUGA 4W97A 5AIQA 4UHTA 3ZQ7A 2YUSA 5D6EA 3ISPA 2VL8A 1Z7UA 4MEYF 1FLIA 3I54A 2XAGA 1ERDA 3ZN0A 4XLEA 3LSJA 4XOTA 2KL4A 2EIKH 2VONA 1JT6A 3PQKA 1IXCA 3F8FA 5F27A 4I02A 2X0LA 3L2CA 2VKEA 4FE7A 4XRSA 2IGOA 5A2QZ 3GYHX 1RNLA 3ERED 3K70D 1OISA 3S1QJ 5GADJ 4XICA 1ZRCA 5J4VA 2E2JJ 2ZXWH 3MAJA 3GWZA 1Z7LA 2EH3A 3NRVA 2LOOA 4MFDA 2YSRA 5E1WA 3QAHA 4G9YA 2QVOA 5JFRA 4EM2A 2CW0F 2DODA 4I0AA 4DZPA 1BW5A 1IUYA 2MH9A 4GXOA 4CCNA 3QPSA 1OLTA 3K1PA 2L54A 1AA7A 5BMZA 2L0KA 1X3UA 1XMXA 3MVPA 1EH7A 3UNGC 1N78A 3BTIA 3P9IA 3FF5A 1LJ9A 1QQIA 2Y48A 3Q5FA 2R7TA 2FD5A 3SYTA 3VSLA 2KZGA 3SZPA 2JPCA 4A3FJ 1UZCA 2HOEA 2RGVA 4IQJA 4FX0A 2PJRA 1U8BA 2M9HA 3F8CA 1WJAA 5EGOA 1UMQA 1R4MB 4NBQA 1VQ6I 3LWFA 3BY6A 2R7QA 2CQNA 5ICGA 3GTMJ 5LEJA 5BOXA 4BKXA 3GO5A 4V2FA 1SMTA 1KA8A 2O5RA 3L9FA 5IOZA 1USTA 4O5VA 3EQLF 5IOYA 3DTKA 1WZ2A 3H3ZA 2V6CA 1D3YA 3QOPA 5IT9K 4NDLA 2K9SA 1JJ6C 1X1BA 3ZQIA 1F43A 3E97A 3JREA 1P4WA 4BDYA 4G6TB 2DK8A 1D8KA 3LSHA 4PGGA 5HNFA 1HXDA 2QF7A 3HOVJ 4YG2F 4IVNA 3BG7A 2M8EA 2IA0A 2K5CA 4KN7X 2CO5A 4QSHA 2Y31A 4ZDOA 2EZHA 3FIWA 2R7RA 3K9TA 3W6KB 3QRFF 3F3XA 3K4NA 2HYJA 3OV8A 5BQTA 1WI9A 1NK2P 4WF2A 5C44J 3K4LA 2HVQA 3FK7A 3A1YA 3QYFA 2LF7A 3FMRA 1YHQI 2O3FA 5FKOA 2CV0A 3ZGKA 5DD8A 5DEQA 2CH0A 2LTPA 2IA1A 2XASA 2OUMA 3AL0B 4DJAA 1WWXA 2G0EA 2MC4A 4FE4A 2NRAC 3K4MA 2EJRA 4F52A 4LLGF 1SFKA 2K4BA 3FMSA 3HUGB 2MYSA 4PCQA 1W36C 2RQPA 1MNDA 2XRLA 2CQKA 2FXAA 3W6JB 2O0YA 4EJWA 3COAC 5E3LA 3GMEA 2NVXJ 5DCFA 4HOBA 1E17A 1JUSA 2L4MA 1VZ0A 3GLXA 4MLOA 4BJ5C 5CVIA 4C2UA 2QEXI 4AIHA 3VWBA 1ZLJA 4LJZF 4B3AA 3CLOA 3SDBA 3DLAA 1GV2A 2B7EA 3HZJA 2MD0A 3HSFA 2Y2ZA 2XB5A 1BOBA 3SHFA 4ITVA 1B6AA 2GWRA 3K4KA 3OSFA 4ZYDA 2XUBA 4KMFA 4EEFG 3E7LA 5JI6A 4B3XA 3RZDJ 3M8FA 3OYGA 2OQRA 1R4NB 3GF2A 4A5MA 3H5NA 2Z16A 2F5DA 3CCMI 2FX0A 4ZC3A 4KISA 3P7NA 1WKMA 4RMNA 1XMAA 1S7AA 3I5UA 5DCMA 3HM5A 4KA4A 2EV0A 3FXRA 3CC2I 4EM0B 3PNVA 4A93J 4WXCA 4CZZA 3IRQA 1PP7U 5FRMA 1HQCA 2BV6A 2ZSIB 3M7GA 4G6QA 3OYAA 4XNFA 1IRFA 3W2VA 4KYWA 2OA4A 4EV0A 2OC6A 3PO3J 1K83J 3OYDA 2I10A 3I59B 2PI0A 2A6EF 2WY7Q 3OS1A 4XLFA 2VBWA 2VC0A 1ZG1A 4U7BA 3N97A 4BU2A 1TZLA 1B9MA 2E7WA 1SAUA 2H1LA 3WTYC 1ZR4A 1I5ZA 1HSJA 4D5FA 4M6YA 1NK3P 3H3VK 3U9GA 3A01B 5HODA 4EATA 4A3MJ 2OD5A 2EINH 4HW0A 2GOMA 1OCRH 2R7DA 5HS8A 3F23A 3DCFA 3RSNA 3TGNA 2M5WA 5B1AH 2PG4A 1DU6A 1QO0D 4FASD 3GTOJ 4XLNF 3G2BA 2DFIA 2CUJA 4DIQA 3LOCA 2DYRH 3E5XA 2LKSA 5DUKA 1YS7A 4U0VA 2PMZA 1TTYA 4QTRA 2JA6J 4L9JA 3KFWX 1FZPB 5DM7F 4KNYA 2L7KA 4XLPF 2O8XA 2ISYA 3JRFA 1D1BA 1R71A 3HEFA 4M3FA 2UV1A 2MSYA 5B1BH 3CQZJ 5L3BA 1YJNI 5EZHA 1MNMC 2EZKA 5LHIA 1UB9A 1YW7A 3G4SI 5JVGF 4S04A 5CQGA 3EPZA 2JWTA 2D1HA 1ZQ3P 1UELB 1YX5A 3B73A 3H9JA 4HX8A 5E3OA 4PJMA 1Z05A 1XS9A 2ZFWA 2F5FA 4IHTA 3E5QA 2LF8A 1PDNC 1TNSA 2V7FA 1QHHD 2HYGD 2LVSA 2VODA 3BJOA 5B3SH 2RREA 1ZRFA 1Z3XA 2ZNYA 4A3KJ 2XVCA 2FNAA 3JCUC 3BROA 3S16J 1FYLA 4AD9A 1GDTA 1B59A 2ZJ2A 3HXLA 2LLKA 2JJ7A 5J8FA 3LAPA 1A6QA 3S2DJ 1PUFA 1U5TB 1JE8A 1S7OA 1DDNA 3F72A 1A36A 1I1SA 2NAZA 4BHBA 1X3WB 1CF7B 3OR2C 3CCEI 3CO6C 3DU5A 4Z6YA 2LKPA 2HDWA 5CVVA 4HA8A 3QP5A 2K3PA 1BN5A 1X1AA 5F08A 5IT9Z 1LDJA 1OYWA 3MMYB 2HQAA 2MC3A 3PSFA 1YQAA 2JRTA 4CDGA 1SMYF 5FKMA 1XGOA 1QPIA 5CQEA 2OCEA 1KU9A 3R60A 1JTXA 4X6AJ 4NUBA 3BG6A 3C2BA 4IKFA 1DP3A 4XKBA 3HRUA 2HFHA 3P5JA 4A6EA 4BUPA 4DYCA 5HNHA 4IOAF 3OMYA 2IP2A 1BJZA 4UUSB 4CCMA 4MTEA 3CP2A 4C3HJ 1KYWA 4E7SA 3GW2A 4OWRB 1RI7A 2XGCA 1R22A 4EJVA 1S7EA 3DPLC 3BZ6A 4AVZA 4IHYA 1LPQA 1MDMB 3L2VA 1ETVA 3HTUA 2LYCA 5KNLA 1B8IA 1FP2A 3DXJF 4HSRA 5HS7A 1D0YA 2M0CA 5EEGA 2ECCA 1TT5B 5FLVA 2R7VA 5E1ZB 1WSUA 3JTHA 4A3JJ 3ZQLA 4LG3A 2OPTA 3MZYA 5LBQA 2PX9A 3MKWB 1ZREA 4UB8C 4X1EA 9ANTA 4HAMA 1D1CA 3KLOA 2QYOA 3NWSA 3ZQHA 5HVQC 4L0ZB 1V54H 3QPLA 5E8GA 3FM3A 3I4MJ 1JTYA 2QCOA 1IF1A 2HOTA 4HDVA 2K9MA 2A07F 2EBIA 3OIOA 5D8KB 3TW6A 4EJOA 4GDFA 5CKTA 4S0HB 2KZVA 4B47A 2XC7A 1ZAOA 1TL8A 5GPAA 4D7MA 2IS1A 1EKEA 4IEJA 1Y1WJ 4M74A 4EJUA 1JI8A 1R1VA 3SEZA 3WE3A 1MJ9A 3S3MA 1YIOA 3LSRA 1K78B 1TC3C 4U87A 2P6SA 2PN6A 2HS5A 3HRMA 3ZQQA 2V1UA 3KETA 4IF4A 3RZOJ 4A3CJ 3PM1A 3ABMH 2Y0SN 3DWLE 1JGSA 2V1NA 4F93B 1AU7A 5KCMA 2FE3A 3V4GA 2Z1DA 1U9OA 1FOYA 1V5EA 2W82A 2ELHA 2EWNA 4M3EA 2DPDA 4RGRA 4IHXA 2NXNB 3M1CA 4M9SA 4CCJA 4J01A 4AIDA 5IYDJ 2Y0SA 2GIVA 3LSKA 1IN4A 5KAIC 3GTGJ 4XKVA 3FISA 3VSKA 1SEUA 2L7MP 3QPHA 1UHMA 3FXMA 1WJFA 4ZZLA 1GVJA 1D0XA 5HS9A 2MW8A 1QVTA 4IX7A 4OINF 2VIXA 2DMUA 5IT3A 2MA3A 2FQ4A 2MGQA 1O7LA 3JAMK 2VOPA 2CW7A 3OR1C 2DU9A 3GZ5A 2D1VA 4YIRX 3IWZA 3I58A 1ETQA 3K10A 5JHFA 3WE2A 2LSOA 3A03A 4ZJZA 3BWGA 1BM9A 2VC1A 3BR0A 1OJLA 3BJ6A 4MQ9F 4NNJA 2FU4A 2WAQN 2W25A 4Y15A 2DLLA 2VKVA 3LMMA 2QM3A 1P7IA 3CCRI 1R5GA 3K2AA 2K9LA 4KIBA 3PO2J 1V55H 1W1WE 3IV5A 3LQRA 4Y33A 1A6IA 1XSDA 2WAQA 3ESWB 4XRMA 2A6TA 5F04A 5GPCA 1MH3A 4BBRJ 1FT9A 1ZG5A 1CGPA 3D0SA 3MKYB 2RQQA 4LOCA 1AOYA 1I3AA 1K4TA 5F64A 3MFKA 2QBYB 2AQEA 2FF4A 5FRNA 4ON0A 2IW5A 1XDUA 3H35A 1D0ZA 4OAYA 5CVUA 1XN7A 1Z3YA 2XAJA 1JKRC 1FNNA 2ZMEC 4XR6A 1I3QJ 1RESA 2E1NA 2VUMJ 4MEXF 2LRDA 1ZTRA 2JRMA 1S5LC 1S6LA 1YTYA 2UXXA 4RS8A 3FXLA 5ILVA 1MBEA 4CA0A 2EK5A 3SJMA 4HYEA 2LK2A 3CD6I 1ZKGA 4IOCF 1S9HA 2V9PA 4LK0F 1GXQA 2FOKA 2ZKZA 4BAYA 4DOZA 3E1SA 4L0YB 4E7HA 1TLHB 1TWFJ 2CWEA 2CV2A 5J1YA 1XX5A 5HLGA 3LFUA 4HNTA 4WCGA 4LD5A 1FMVA 3KYLA 1AHDP 4B09A 1T95A 3JRCA 1NTCA 3NAUA 1WJCA 2ZXJA 3ELKA 3GUDA 2KIQA 4ZYAA 5ERIA 3AL0C 1P6RA 2IVMA 2CW8A 5F6FA 2QA4I 3H0GJ 4D9JA 1JKQC 1R1TA 1R7JA 1WJ5A 4P96A 4Y4RA 3KZYA 4CXFA 3ONQA 3IL2A 2ZMEA 1VI0A 1QZYA 1YW9A 2A6HF 1F5TA 5JLWA 4PJLA 4PFOA 3WTUC 4BXFA 1E3HA 3GVAA 1E2XA 1IZ1A 4G7OF 1SD4A 1FIAA 2VASA 3MKZA 3HOTA 4CH7A 4PJ0C 2F2EA 2A5WA 2P0WA 1OCOH 2KRFA 3K1MA 3R4KA 1HCRA 2DQRA 2M30A 4LITA 4F91B 2VQHA 4XQFA 3G1LA 1MSEC 3NEUA 1MZBA 2DTZA 5HLTA 2E1CA 3GXOA 1ZR2A 4XONA 2IRFG 5CVJA 5LD2C 4ZTFA 1JJ8C 2VJ5A 3EDPA 3S3OA 3PFIA 1P92A 2A5YB 1O3QA 1CQTA 2DMTA 3H5RA 2EZLA 4YELA 3OY9A 3CO7C 3MD2A 3RPQA 4JX5A 4EQQA 1IRGA 1KU2A 2VB6A 4ASNA 3DFGA 1EA3A 4B44A 1G3SA 3CUQB 4L9NA 3KP6A 3DLLF 2Q2EB 3WTTC 4HX4A 3CZ6A 4B8XA 1QPMA 5LGNA 2VT3A 3ABTA 5BPDA 2ELKA 3TP0A 5TJJA 1LUJB 2R4GA 3TW7A 4I01A 3CCVI 5J3LA 4IO9F 3F22A 1VQMI 1TQPA 3FM5A 4G8XA 3DPTA 2J5OA 2WA0A 1XSXA 2H09A 2DCEA 4RLFA 4MTDA 1LVAA 1SANA 1ULYA 2DK5A 4A6DA 3I71A 2X85A 5IPAA 1E0EA 5KK1A 2P5LC 2O7OA 2ZO4A 3DBRB 2QQBA 5CJ9A 5EG0A 1VQLI 2E1OA 2E71A 4XRSG 3BCBA 3EYYA 4XK4A 4A69C 2DT5A 1DGRM 1MMGA 1TWCJ 1Z77A 3QU6A 4AWXB 3IC7A 2RC4A 2Y9ZA 1BL0A 3ZP5A 1G3WA 4QLCU 3EUKL 1SD5A 2XKPA 2Q8KA 4YFKF 1K6OA 2DDBA 2M4GA 2EA2A 3U1DA 3IAS2 4NC6A 3DKWA 2EFNA 2ACJA 2O6GE 2EFQA 2R7FA 4E6KG 1HSTA 3DPUA 2M7BA 4JQFA 3GTLJ 2DAOA 3J7AY 2HVRA 2HKXA 2CUEA 1ZK8A 3J7AO 4JX4A 2JA2A 2TRTA 2DBBA 3H9GA 2DFEA 1IDZA 2H8RA 5M3MJ 3KP5A 1HBXG 1JXSA 1XGNA 2XRNA 3KEYA 5F0FA 4CSWA 3LL7A 5IY5H 1UFMA 2CUZA 1WVRA 4RAYA 1LFUP 3L2RA 3QP6A 4JBAA 2A05A 4UVAA 3I4NJ 1YS6A 3M4OJ 3JAMZ 5M5WJ 2JT1A 3KYDB 4FISA 2IGNA 2FNPA 4HQMA 4WXHA 5F0HA 1G6NA 1T56A 3D5LA 3SFZA 4B48A 1O4XA 2GA2A 1LNWA 1R58A 3RKXA 1JUMA 2KRCA 1X1CA 3OS2A 5DD4A 4OIPF 3M8JA 4FX4A 4N0BA 4OIOF 1PJRA 4FETA 2JQ7A 1C0WA 2HQRA 5D4SA 1MBGA 2VJJA 4CCLA 4F7ZA 4GCVA 2RN7A 3HTSB 1ZLKA 4DW6A 5LRRA 3GTQJ 2LBFB 2HDDA 2PEXA 1DQUA 3Q0UA 4G7HF 4I76A 1U5TC 3FMQA 4XN3A 1IRZA 1YRNB 3OYEA 2RNGA 4UV9A 4QWQA 4A5NA 2A68F 2I8DA 5FO5A 4M72A 3LNQA 2X51A 2Z5UA 5TISC 2X1EA 5FFXA 1OQYA 5L3CA 3BQYA 1Z91A 5AONA 4GO1A 3P9CA 2KP6A 4E7KA 2VE8A 2E7XA 1G59A 3WU2C 3TP3A 2STWA 1ETYA 2DFFA 2P81A 2NVUB 4OIRF 4ZDLA 5H6RA 1PVEA 2IA2A 2H8WA 3CP8A 3MCZA 2P5KA 2H1KA 3F21A 2R5YB 2FMLA 4L18B 1N75A 2MG4A 3WG7H 2ID6A 3E6DA 2XDVA 3OIQA 1SFOJ 4I0BA 2VXZA 5BPIA 1U5TA 3GTPJ 2XAHA 2OF7A 2HPIA 3CTAA 2ZNZA 1EJ9A 2XF5A 2E5ZA 2OZ6A 1CF7A 4FQGA 2CG4A 4CYCA 4O6JA 3V7SA 3Q0VA 1ETOA 2KDZA 3JRGA 4LB5A 1LKXA 4NC8A 1JHHA 4G7ZF 2BZTA 3CJQB 3V8JA 4AIKA 2IEKA 5D5VB 4C3IJ 2H27A 2XAFA 4BS9A 2GIZA 3FBIB 1VQPI 1KONA 1S29A 3C3WA 2UWMA 1G3TA 2E34A 1J59A 1WJEA 3L09A 4UV8A 1OMIA 3W2AA 3CCLI 1DUXC 3I64A 3ZXSA 3DF8A 4RGSA 2AXLA 2HDCA 2ZCWA 4DQ2A 2DOEA 2V26A 1YX3A 4KITB 3OL4A 1E3PA 2JZYA 4UUSA 4UXNA 3ZR8X 1W4MA 2VN2A 2MLKA 4KJZA 5HLHA 3WODF 1WI3A 2NNNA 3W2WA 1S8NA 4WXDA 4XM3A 2B9SA 1MDMA 2AHQA 2DA7A 5J40A 1MJBA 3OYFA 4Y7NJ 1BIAA 1HA8A 3TOAA 4A3BJ 4IXAA 3HOSA 4EGZA 2JA8J 1SD7A 1FOKA 1HOMA 4KIFA 1FYKA 3V7CA 4A0ZA 2COMA 1QHGA 3IKTA 5FLXK 1A5JA 3O2PE 1B9NA 4ZZDA 3I4PA 1MMAA 3U1KA 2K9NA 1BI2A 4J00A 3TQNA 2EFOA 3ERMA 2B0LA 2G7HA 1Z1DA 3REOA 2F4MB 2KJCA 1KYZA 4TV7A 4Y3OA 2YPRA 3R0AA 1R5ID 2RDPA 2GXGA 2ELJA 3GX4X 4HNUA 2DMNA 2NNYA 4E7JA 2GBYA 2NVTJ 3DTEA 3K4CA 3HSRA 3G73A 4HLXA 3TO7A 1JT0A 1BR4A 2KMUA 3KYCB 4A2UA 2V6EA 2M45A 2QSGX 1HC8A 4BHPA 1U78A 5J1UA 4HX7A 4CZCA 1EH6A 1W0TA 1GT0C 4NQWB 1YI2I 4HV6A 1WGXA 2K3FA 4BE0A 2J5PA 4IRIA 4C2MJ 2IT0A 4KUMA 1U9NA 1IV6A 3A4CA 2IAIA 3CCYA 1I50J 3CMMA 3TDZC 1TBXA 4E7ZA 2CQQA 2P7VB 4ETSA 3CCJI 2JPBA 3IUOA 2Z3YA 5FJ8J 1MD0A 2BEOA 3C1DA 1J2XA 3VEPA 3CF2A 3UR3C 1LFBA 2QKMB 1XTAA 1J75A 3OYNA 2N8GA 4II2A 2BY3A 3OOUA 4LFUA 4XMYA 4E7IA 2R7UA 2H6BA 1QNTA 1WH5A 2WY8Q 3T8RA 1BC7C 1TWGJ 2P6TA 2XPWA 5C3EJ 3BQZA 5M5YJ 4BEHA 2QGUA 3MKLA 3QPTA 3K4BA 2V4JC 1HDPA 3HGGA 2PJPA 4LK1F 1RRJA 3B02A 4XSZF 3KLNA 3TKYA 4Q48A 3I9V2 3TO6A 3M3YJ 1GHCA 1T08B 1DU0A 2R7WA 2RV8A 3IRRA 1V5GA 1P4XA 4U88A 1U2WA 2AQFA 4ZYGA 2X4HA 5D8LB 3BOQA 3K69A 4EM1A 1H0MA 2L9NA 2XHKA 1OYIA 1T0FC 3SZGA 1WFXA 2FMYA 2LY2A 2DMPA 5E8IA 4A3EJ 2JSPA 3K0LA 3ZPLA 1VQ5I 4BBSJ 2H94A 3SEQA 4ENMA 2FSWA 3E3VA 2DPUA 4F92B 2OCCH 1JKOC 4EJTA 4V19K 3AG4H 1Y0NA 2W84A 3QOEA 3D1NI 1WHUA 1FMWA 1MNEA 1FP1D 1Z21A 2H6CA 4LG0B 1K6YA 3O8HA 2XSDC 1HF0A 3FKJA 1T33A 3HYIA 3RQ4A 3HSEA 4L5EA 1AKHA 4AIJA 1VQ4I 1UCRA 2IBDA 3QU3A 4UY8I 2MLGA 2DA5A 1QZEA 1T6SA 1H9TA 3OYBA 4IZZA 5DUIA 4BQAA 3H1CA 5JVTA 2LY1A 4CCOA 1XGMA 2W48A 3BPXA 1T0FA 1IV8A 4XN0A 5H6QA 3LFKA 4CICA 4N9IA 1Y8QB 3DEEA 3C2GA 1QBJA 2IJLA 2RKHA 3FX3A 2JVHA 5KHDA 4M3BA 2V9KA 4OU0A 3ZMSA 1HLVA 3TL4X 5J4YA 1FWZA 3KE2A 4D0PA 4HSTA 3S15J 3CMEI 3J7YJ 2WWYA 2OTLI 4A3DJ 3LSTA 1O3TA 3ZRGA 3OL3A 1W5CC 2M1BA 4CGZA 4IPAA 5GAGJ 1ZN2A 1J09A 3WHCA 2FBIA 3BG5A 1MGTA 3S2HJ 4A0XA 2R5ZB 1SVOA 2F5EA 2BOLA 3K1NA 4BHCA 3AG3H 1YYVA 2BW3B 2TCTA 5IYCJ 3K7AJ 3JRIA 1RIOH 1UHSA 1ON1A 3LSMA 3ML6A 4MQVA 1UJ8A 1GLNA 3HIFA 4JOMA 5J47A 3IH2A 2HKOA 4E4HA 1F36A 1ORKA 5C4JJ 3CC4I 2K40A 2XF6A 1X2NA 3ZN1A 1KQ8A 3HRSA 3QWLA 2CU7A 3LA2A 1ZG3A 1FPQA 2F5VA 2E60A 4WK8F 2DN0A 1HKTA 4PK4A 5FFZA 1R6RA 2FOWA 3BJAA 1Q1HA 3A02A 1IN6A 3HB9A 4BXUA 2DO7A 5D5UB 2VKHA 2WV1A 2NOGA 1F1ZA 1KQ9A 1LE8B 1IRXA 2M8GX 2E2IJ 2LDUA 2QZ8A 1W5SA 2F4OB 2R7SA 4K2EA 4M3GA 6PAXA 2YX7A 1OCZH 1FSHA 5CVRA 2Q2EA 4KMUX 2K4JA 2HU9A 4M6XA 5FLXZ 5ICCA 5DDGA 3VYUB 3BR2A 3RPUD 1ITYA 1BW6A 1X4OA 2PMHA 2WB1N 2W00A 4L9TA 3OS0A 5K5QA 2P7CB 4ABZA 3CC7I 3DQVC 2HWVA 3FXQA 3RTRA 4RAFA 1YJ9I 4DGWB 3JR9A 1W7PB 1XD7A 2DOAA 3J7ZI 2M7AA 2WB1A 5HOOA 1KQ0A 2LREA 4G94A 2D5VA 5EEAA 1HW2A 1WCMJ 2NOJB 1T39A 3CESA 3ZOBA 5H20A 3M9AA 3KPHA 2FJ1A 3BZKA 3KP3A 4C3JJ 3VPRA 3GLLA 4M3DA 2O03A 1XG1A 3VOEA 4RAGA 1LDKB 2KDOA 3H92A 2QSFX 2EV6A 3BLYA 4BDZA 2K86A 1LDDA 2I5UA 3ZMTA 4ENNA 2B63J 2L3DA 4BQQA 3WTSC 4F3QA 1FBSA 3M8EA 3OWTA 2CMPA 4HRIA 2E5NA 2CUFA 2Z9OA 2ESNA 2ZJQF 4JX6A 2V79A 3ECHA 3HKZN 2XKOA 4U0WA 2VT2A 2EIMH 4ESFA 1FBUA 4II3A 2X1CA 2LG4A 1A04A 4H0EA 2OJED 4BQOA 2Y30A 2O61A 1B72B 3KX2A 1FOWA 1VQOI 3P9KA 1GVDA 5K5OA 4D1QA 4IRGA 3FXJA 5GTHC 3CJNA 1BIBA 4R1HA 5J1RA 2DW4A 2DA2A 2M34A 3E0JB 4CHUA 1IC8A 3HC7A 5LHHA 4LLNA 1KZHA 4JP0A 4LIVA 1VFCA 1ACIA 2NYXA 3FZVA 5EYRA 1RUNA 2EIJH 4M9ZA 4PJJA 5ICEA 1UAAA 3CJRB 2HQ5A 3IP4B 2BHYA 5LEKA 1LQ1A 1APLC 2JVGA 4Q47A 4C2TA 2DA4A 2NVYJ 1KU7A 4BJTA 3JSOA 2L4AA 3SXYA 1B8IB 1XDSA 2R0QC 3EYIA 3C2HA 1B1BA 3MZHA 2FRHA 5C4XJ 3BT9A 3PUBA 5JR3A 5CYVA 4ENKA 2HOAA 4N4OB 5GAEJ 4B4CA 2HZDA 3BDDA 1D8JA 1X19A 3DEUA 2VJIA 2O8KA 1SD6A 1SAXA 2LBFA 3Q9VA 3BCAA 2VQCA 1L0OC 3N4MA 2Y0MA 3EUAA 3ZCOA 4ANJA 2E1MB 1YRNA 2M3AA 2HQNA 1K79A 4RGUA 3DKXA 3V8LA 4I7HA 2EB7A 5D5XB 1QRYA 2XF7A 4G6DA 5TRDA 4AU7A 4BYYA 1SVMA 1R36A 2JMWA 4OMZA 2AS5F 4IJAA 4Y13A 2CSOA 2OBPA 3AKZA 3GBGA 1UHWA 4NHJA 2ZSHB 4IHWA 3GCMA 1BA5A 3HUGA 1X1PA 2QENA 3FWEA 2XB0X 1SFXA 3FXKA 2PMUA 2X48A 1QVUA 4IHVA 4HF0A 2DJIA 1RC9A 1LVKA 1L3LA 1FYMA 2GOXB 5HDNA 3RQIA 1DP7P 1P4AA 2X6XA 4P1WA 4E7LA 1Y39A 4UUTA 1VQ9I 1AWCA 4XBFA 4DBRA 5LGUA 2X1DA 2KPMA 3KZZA 1WQ2A 1J7KA 5ILSA 3DBHB 1BC8C 2XIGA 3KEQA 4PJNA 4ZH4F 5IP9J 2YR2A 3L2QA 1IJWC 4EVIA 5DV5A 2E36A 2M2EA 2OAZA 2CYYA 1TW2A 2D2WA 3AFHA 2OQGA 3DU6A 4OMYA 4QIWN 4HEA2 1VQ7I 4LGWA 1WJDA 3F6VA 4XKCA 2CV1A 1RETA 2CGPA 2PLYA 2WAEA 3IKVA 5K1YA 2IS6A 4HF2A 2KIFA 1Y8RB 2OU2A 2ESHA 2JSCA 2BY1A 2E2HJ 5E1XA 4G12A 4A0YA 3WG9A 3NQOA 4UVCA 4HNVA 4HG2A 3PIPF 2MFZA 4O3MA 4LB6B 4BY7J 4RM2A 3JRDA 2JUGA 1P7JA 2OZUA 2ZB9A 1DGWY 3MQ0A 3H5AA 4Q5SF 4PUSA 4N4NB 5D5WB 1BI3A 2K9QA 2WTEA 3AG2H 3I59A 4BL0B 4X0GA 1Z9CA 3KIOA 2LR8A 3A2KA 2KHMA 2HGCA 3IH3A 4DYRA 4KT5C 3HL2A 3S14J 2NS8A 3WTXC 4I6ZA 1NG7A 3T1BA 2HI3A 3W3CA 1Z6TA 1N77A 1BJAA 5L3DA 3ULQB 2F4IA 3RPUA 3A01A 3D5RC 4HV5A 1XSVA 2GXAA 3I53A 1Z6RA 3QYBA 1ZELA 2K27A 4A12A 1I39A 3J81K 3BR3A 4M6VA 3LA7A 5FD5A 1U3EM 1V5FA 4GFBA 1W7PD 4RB2C 3W6VA 1MBKA 1UG2A 5FD6A 4RM3A 4DYQA 1X4PA 1ETWA 1OPCA 3C7JA 3HOYJ 2WC2A 1RZ4A 3FXOA 4MNUA 5JHUA 2P4WA 4HF1A 3BG9A 5GP9A 5L3GA 2ME0A 3WTVC 5HDKA 5EEHA 3OIPA 5H2FC 5F0CA 1R49A 3ZMUA 3ABKH 3BR1A 3RDIA 2LMDA 2KRHA 1RR7A 1MMDA 5HLIA 3ASNH 3S8PA 3BTCA 4NQWA 3DV8A 4M9XA 5E3NA 1R9TJ 1G8XA 4P9FA 2WADA 1BR1A 3K2ZA 1IN7A 3ABUA 1OFCX 3LAJA 3GFIA 1YLFA 2ZXIA 4DZJA 2ETHA 2X9DA 1MKMA 1P2FA 4RGXA 1T8IA 1XPXA 5ICFA 4HQEA 5FGMA 2ZMEB 4XLCA 2KFDA 2HXIA 2BVMA 3AG1H 1IN5A 4FCYA 2BE5F 4GRIA 3QODA 4W1UA 3KEOA 4IQ4A 4KIGA 2ZXHA 3RI4A 4WWCA 1U0JA 2L9RA 2VQGA 2M87A 4Y17A 1LEAA 4ZTJA 2FQ3A 4QPOA 3HOZJ 2KIMA 2TDXA 1YOVB 2LC2A 2V1DA 2IPQX 2KJBA 2LD5A 2XSJC 3D5SC 4HPQA 1TP4A 2DQLA 1HKQA 4JK1X 4P9UA 3Q9SA 4RB3C 1RUOA 2KIUA 3KP4A 2VBYA 1D5VA 1MJAA 1R1UA 1R00A 2LFBA 1IDYA 5TGTA 3HRTA 3M1EA 3OYKA 3K4JA 4A3LJ 2XPUA 5E20A 1I27A 4YIFA 4L9VA 4QPQA 3A0HC 1IXRC 2L02A 2LNBA 3CDIA 3LSGA 2KQRA 3A0BC 3OSGA 1VQKI 2HYFA 5M5XJ 3GEZA 2GLOA 2VJ4A 2GAUA 1H8AC 2STTA 1R23A 2DFHA 1PYVA 2W57A 1HW5A 3HBLA 2R7XA 2QKLB 2GA1A 1MBFA 3WGGA 1FC3A 2KT0A 2IGKA 3HOXJ 3ASOH 4CYDA 1TQMA 2NVQJ 3FHZA 3FBNB 3BTJA 1ENHA 4LG0A 1ONVA 1EV7A 1P9QC 1T2KA 1KGSA 3RYPA 3U2RA 2A3SA 1Z67A 5D4RA 3GZNB 5EG0B 2V1XA 2W24A 3MEXA 3O8GA 2PFBA 3HHHA 1IG7A 2MBFA 3B6AA 2DI3A 2C6YA 4JYKA 4ESBA 3GTKJ 2E35A 4A3GJ 1LB2A 2VE9A 1FOXA 2VOOA 1XGSA 2ME6A 2L2OA 5GTIC 4J19A 3T5XA 3OYJA 1I1GA 3PIOF 2MD5A 1TW3A 4BACA 5EZGA 2ECBA 3I55I 2M0MA 4AVPA 1ZYRF 3IAM2 3BG3A 1S72I 3LSPA 3WTZA 3L1PA 3CDLA 3E6BA 2F48A 2AO9A 1UG0A 4OAZA 4FTHA 1TNTA 3RIRA 1O57A 3G1MA 1O3RA 3S17J 1DPRA 4V2GA
chains in the Genus database with same CATH topology
1LUJB 1M1EB 1T08B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUJ B;  1M1E B;  1T08 B; 
#chains in the Genus database with same CATH topology
 3WTW C;  1MSF C;  2JA5 J;  3R61 A;  2GXB A;  1ETK A;  2RNJ A;  1IO2 A;  2X6Y A;  3RCO A;  1BI1 A;  1U6G A;  4Y52 J;  1Y56 A;  3CUO A;  2YU3 A;  1QA6 A;  3S1N J;  4C30 A;  1Q1V A;  2QQ9 A;  5EDN A;  4YRV A;  2X6O A;  1YFH A;  3ABL H;  4Q4Z F;  5AIP A;  4NB5 A;  2HTS A;  1N25 A;  4P5O A;  3SZT A;  2XAQ A;  2EPF A;  2EFW A;  2BXY A;  5DTD A;  3F8M A;  4B43 A;  3WU0 A;  4U7D A;  2FBK A;  3K70 C;  2R5Z A;  2Q1Z B;  4EMS A;  2IS2 A;  3VOD A;  3ZQG A;  3L2W A;  5FRO A;  2BW3 A;  2HZT A;  1OCT C;  2A69 F;  2ZJP F;  3V7R A;  2EFP A;  1ZGJ A;  2L5Q A;  1V3F A;  4B1R A;  2PJR B;  1GV5 A;  3VYS B;  4BXX J;  5EGO B;  1FBQ A;  1MBH A;  2PMZ N;  2DA6 A;  1K78 A;  4HLY A;  2P5V A;  4BNC A;  2V9V A;  3TOB A;  3DTI A;  2Z2S B;  1SFU A;  2VPR A;  3GTJ J;  1ZGA A;  3BTL A;  3FHN A;  5HDG A;  4P55 A;  4RBO A;  1BR2 A;  3CMA I;  3RKW A;  2ZFU A;  4DBQ A;  3OYC A;  1PP8 F;  3MZ8 A;  3J80 K;  4MGR A;  5CLS A;  4PGH A;  4XLH A;  2QUF A;  3L00 A;  5JLX A;  1VTN C;  1LE8 A;  1EH8 A;  5FLM J;  3EET A;  4UB6 C;  1RKW A;  2Y9Y A;  4NC7 A;  3V42 A;  4OIQ F;  4PSW A;  4L5I A;  1G2H A;  4H4K C;  2FUG 2;  3M07 A;  1MBJ A;  2GZW A;  2EV5 A;  1PUE E;  2JUC A;  2OV7 A;  5J6X A;  3ROU A;  3GZ6 A;  1G3Y A;  3FXU A;  1H89 C;  3TBI A;  1Z0X A;  1NHA A;  3BR6 A;  4S05 A;  3VYT B;  4IRH A;  3J81 Z;  3HOU J;  2GQQ A;  2VBZ A;  1W7P A;  3JSP A;  3G71 I;  3TO9 A;  3DKY A;  3KP2 A;  4MHG A;  2W7N A;  1O7F A;  1ZAR A;  1B4A A;  1TT0 A;  3E5U A;  2NS0 A;  4GYI A;  3ECO A;  4XRF A;  5B5E C;  3OYH A;  1DPU A;  3GFJ A;  4BH9 A;  4LLL A;  4YFX F;  4I99 C;  2P8T A;  1REP C;  1RKT A;  1XMK A;  3C18 A;  2DDA A;  1OYY A;  1YO5 C;  2BBY A;  5DM6 F;  4R8H A;  3PSI A;  1YIJ I;  2XGD A;  2HR3 A;  3TED A;  4CCK A;  4XOP A;  4CYC B;  2WV0 A;  2MH2 A;  1J5Y A;  3ZMZ A;  3BPV A;  1FJL A;  2XGX A;  3FDY A;  4ZDP A;  2QBY A;  3F0C A;  3PQJ A;  2DA1 A;  2DMQ A;  2L01 A;  4DNC A;  2JTV A;  4RDU A;  2DTR A;  5K7F A;  2A61 A;  2XGE A;  3GFL A;  2YU9 J;  2BXZ A;  1YIT I;  3PL8 A;  2HPM A;  3SDG A;  1FEX A;  4CO8 A;  3KP7 A;  4XKW A;  2R7Z J;  1TQI A;  1USS A;  5DCM B;  3QQA A;  1MMS A;  1ON2 A;  2CFO A;  1KU3 A;  3B6C A;  3R0J A;  3F8N A;  1B72 A;  3I0T A;  1G4D A;  2YS9 A;  1RPW A;  3S1M J;  3PJR A;  2KLO A;  3CDH A;  3HHG A;  5K7Z A;  2NS7 A;  1IXS B;  1E3O C;  2E1M C;  4AYB N;  3L2U A;  2VKD A;  2CJJ A;  4M73 A;  2VLA A;  3JW4 A;  2XV4 S;  2JA7 J;  2ZC2 A;  1BI0 A;  2BY2 A;  1XCB A;  4I09 A;  4AYB A;  1ZHF A;  4RLQ A;  1K61 A;  1VND A;  2UZK A;  3CLQ A;  2ZJR F;  1XC5 A;  3WHB A;  2ISZ A;  4KN4 X;  3HGY A;  1JHF A;  4MFE A;  2QSH X;  4XID A;  1MIJ A;  1A35 A;  2GM4 A;  4FHT A;  3WGH A;  2VPL A;  3BZC A;  2G7U A;  5EF6 A;  2Q0O A;  5E18 F;  3JTG A;  1FIP A;  1F4K A;  3CUQ C;  2DT6 A;  2G9W A;  3FK6 A;  2LY9 A;  5E79 C;  1ZH5 A;  3RKY A;  3U21 A;  3WGI A;  1VQ8 I;  4ENJ A;  3I3L A;  2CQX A;  5BNG A;  1T38 A;  3NAR A;  3G6E I;  4XSX F;  4BY1 J;  2IS4 A;  4IHS A;  3TDU C;  1IW7 F;  4IL6 C;  2IGM A;  2O9L A;  5DYM A;  4XOR A;  1EF4 A;  2DT7 B;  3CCU I;  4KFC A;  3V8K A;  2BYV E;  2VQL A;  1BOA A;  1Y0U A;  2CRG A;  3CMY A;  1YJW I;  3IHU A;  3S32 A;  1X1D A;  2LKX A;  3E6C C;  2AXT C;  1YG2 A;  3S2W A;  5LLQ A;  1H9G A;  4U0Y A;  1JGG A;  1WPK A;  3X2Q H;  5LFA A;  1W5T A;  2BGC A;  4HZF A;  1QGP A;  5A2Q K;  2XAU A;  3RYR A;  4N9H A;  2BY0 A;  5ILU A;  4RB0 A;  3G3Z A;  4YFN F;  1F9N A;  5E17 F;  1RR8 C;  1TWH J;  3CUQ A;  3T0Y A;  3MN2 A;  4YEJ A;  4EGY A;  4UUV A;  2ZBK A;  2QWW A;  4ZYH A;  3ZQC A;  3HG9 A;  1TWA J;  2DXI A;  5FKN A;  2RAE A;  3ZMD A;  1R5H A;  3N05 A;  2E19 A;  1WRJ A;  2XRO A;  3HJE A;  4Z2Y A;  1I6H J;  2JK3 A;  3DEW A;  4RA2 A;  2F5C A;  5J8C A;  5EJC A;  3H3U A;  1K4S A;  4AM3 A;  2M4K A;  3K6G A;  4UVB A;  1I6X A;  2D45 A;  2QQ8 A;  2K7L A;  2FEZ A;  2VBX A;  4BGD A;  3HDD A;  4KDP A;  2HVS A;  4BEH B;  2JN6 A;  1IAW A;  1SVL A;  2R92 J;  1STZ A;  1PUF B;  4XLA A;  4ESJ A;  5CPR B;  1ODD A;  4ZYE A;  3L7W A;  5LHG A;  3ZQF A;  2CQ7 A;  1XCV A;  3JRH A;  1ZGW A;  4KT6 A;  1J9I A;  1SFE A;  5KAF C;  1M1E B;  4BE1 A;  1X2M A;  2RVC A;  4MO7 A;  2MAB A;  3IH4 A;  1POG A;  3O6B B;  3H0D A;  2K85 A;  1X3Z B;  3DP7 A;  3SFI A;  3PUF A;  1FSE A;  4FT8 A;  5LRS A;  4BJ6 C;  2HEO A;  4BE2 A;  3J80 Z;  3OYI A;  2ADU A;  1BBY A;  1JKP C;  2ID3 A;  4AUX A;  3BP8 A;  2KKO A;  3PNY A;  2QQA A;  1QZZ A;  3HKZ A;  5IP6 A;  3UKG A;  5K5R A;  2HOS A;  3DBL B;  2R93 J;  3RJP A;  1Y1V J;  3I56 I;  4UNO A;  2IXS A;  1T98 A;  2CFX A;  2HNH A;  5BS6 A;  1NH3 A;  1VF9 A;  4D7N A;  3KCC A;  3VFZ A;  3CCQ I;  3G1O A;  1WH7 A;  1OKR A;  3S93 A;  4I98 B;  2PBI A;  2R3S A;  4I2O A;  1AKH B;  3IWF A;  3O3K A;  3HPH A;  1XB4 A;  4A3I J;  3AAF A;  2VI6 A;  2EQR A;  3S3N A;  5L3E A;  2VXD A;  4PZJ A;  4PFP A;  4XL9 A;  1S3J A;  1LFP A;  4GGG A;  1LEB A;  4LIU A;  3OYL A;  1QU3 A;  1OR7 C;  1WJB A;  3R6S A;  2CS3 A;  2QLZ A;  3T8T A;  4PDK A;  2COB A;  1H88 C;  3NWT A;  5LGT A;  1Y6I A;  2DJN A;  1D5Y A;  3TMO A;  5D6F A;  1YW8 A;  2X6W A;  5IP7 J;  4R79 A;  4RAZ A;  1IGN A;  5M3F J;  3F9K A;  3S1R J;  3CF5 F;  1IUF A;  1FX7 A;  3CCS I;  1K7A A;  1X58 A;  3JRA A;  2EIL H;  4PSX A;  4M71 A;  2Z33 A;  3EUH C;  2W1O A;  2L9V A;  3QYE A;  4AC0 A;  5F1R A;  1YE9 A;  2UXN A;  4LMY A;  4HBL A;  4WX9 A;  1MH4 A;  2L7F P;  1MMN A;  2UUZ A;  1HKS A;  4GYG A;  1V4R A;  2KIS A;  4BQN A;  1D1A A;  2Y69 H;  3CJT B;  3FKI J;  4E70 A;  1NG6 A;  3BR5 A;  4MIM A;  1W0U A;  5IYB J;  3LQQ A;  3Q0W A;  1A31 A;  5E3M A;  1W36 D;  1IN8 A;  1GUU A;  2L7Z A;  3JRB A;  1OR7 A;  5K7H A;  3OOP A;  2WBM A;  3OYM A;  5FB2 A;  3HOW J;  3HPG A;  2LP0 A;  2HTJ A;  3F8B A;  2Z99 A;  3RKQ A;  4HDU A;  1U8R A;  3GFM A;  2DOF A;  3VDX A;  2R5Y A;  1FY7 A;  2R7O A;  3E6M A;  2YX4 A;  4L5J A;  2WAF A;  3Q3S A;  2PQ8 A;  3EUH A;  3H36 A;  2FA5 A;  5ED4 A;  5GAH J;  1GXP A;  1FTZ A;  3LA3 A;  4D5C A;  1SC7 A;  2DYS H;  2HXO A;  5FKK A;  1ZRD A;  5F1J A;  5DS9 A;  5B66 C;  2L9S A;  1HDD C;  2K02 A;  3PNT A;  3PFY A;  1O3S A;  4RB1 A;  5KVR A;  1J0R A;  2DA3 A;  1HW1 A;  2FBH A;  3BC8 A;  3LSI A;  3ZMV A;  3VB2 A;  3WU1 B;  5FKL A;  4F55 A;  3MWM A;  4C9Y A;  2XPV A;  2BVL A;  2W4S A;  2Y75 A;  3VYR B;  5L3F A;  1OCP A;  2BHZ A;  1FTT A;  1ETX A;  1MW7 A;  4OOI A;  2OTJ I;  2F6C A;  2ICW G;  3KZI C;  2EZI A;  1VQN I;  4YII A;  3SQN A;  2EA4 A;  2W85 A;  1OCC H;  2LH9 A;  3H9Q A;  3F6O A;  4KIC A;  1JUP A;  4CUG A;  4W97 A;  5AIQ A;  4UHT A;  3ZQ7 A;  2YUS A;  5D6E A;  3ISP A;  2VL8 A;  1Z7U A;  4MEY F;  1FLI A;  3I54 A;  2XAG A;  1ERD A;  3ZN0 A;  4XLE A;  3LSJ A;  4XOT A;  2KL4 A;  2EIK H;  2VON A;  1JT6 A;  3PQK A;  1IXC A;  3F8F A;  5F27 A;  4I02 A;  2X0L A;  3L2C A;  2VKE A;  4FE7 A;  4XRS A;  2IGO A;  5A2Q Z;  3GYH X;  1RNL A;  3ERE D;  3K70 D;  1OIS A;  3S1Q J;  5GAD J;  4XIC A;  1ZRC A;  5J4V A;  2E2J J;  2ZXW H;  3MAJ A;  3GWZ A;  1Z7L A;  2EH3 A;  3NRV A;  2LOO A;  4MFD A;  2YSR A;  5E1W A;  3QAH A;  4G9Y A;  2QVO A;  5JFR A;  4EM2 A;  2CW0 F;  2DOD A;  4I0A A;  4DZP A;  1BW5 A;  1IUY A;  2MH9 A;  4GXO A;  4CCN A;  3QPS A;  1OLT A;  3K1P A;  2L54 A;  1AA7 A;  5BMZ A;  2L0K A;  1X3U A;  1XMX A;  3MVP A;  1EH7 A;  3UNG C;  1N78 A;  3BTI A;  3P9I A;  3FF5 A;  1LJ9 A;  1QQI A;  2Y48 A;  3Q5F A;  2R7T A;  2FD5 A;  3SYT A;  3VSL A;  2KZG A;  3SZP A;  2JPC A;  4A3F J;  1UZC A;  2HOE A;  2RGV A;  4IQJ A;  4FX0 A;  2PJR A;  1U8B A;  2M9H A;  3F8C A;  1WJA A;  5EGO A;  1UMQ A;  1R4M B;  4NBQ A;  1VQ6 I;  3LWF A;  3BY6 A;  2R7Q A;  2CQN A;  5ICG A;  3GTM J;  5LEJ A;  5BOX A;  4BKX A;  3GO5 A;  4V2F A;  1SMT A;  1KA8 A;  2O5R A;  3L9F A;  5IOZ A;  1UST A;  4O5V A;  3EQL F;  5IOY A;  3DTK A;  1WZ2 A;  3H3Z A;  2V6C A;  1D3Y A;  3QOP A;  5IT9 K;  4NDL A;  2K9S A;  1JJ6 C;  1X1B A;  3ZQI A;  1F43 A;  3E97 A;  3JRE A;  1P4W A;  4BDY A;  4G6T B;  2DK8 A;  1D8K A;  3LSH A;  4PGG A;  5HNF A;  1HXD A;  2QF7 A;  3HOV J;  4YG2 F;  4IVN A;  3BG7 A;  2M8E A;  2IA0 A;  2K5C A;  4KN7 X;  2CO5 A;  4QSH A;  2Y31 A;  4ZDO A;  2EZH A;  3FIW A;  2R7R A;  3K9T A;  3W6K B;  3QRF F;  3F3X A;  3K4N A;  2HYJ A;  3OV8 A;  5BQT A;  1WI9 A;  1NK2 P;  4WF2 A;  5C44 J;  3K4L A;  2HVQ A;  3FK7 A;  3A1Y A;  3QYF A;  2LF7 A;  3FMR A;  1YHQ I;  2O3F A;  5FKO A;  2CV0 A;  3ZGK A;  5DD8 A;  5DEQ A;  2CH0 A;  2LTP A;  2IA1 A;  2XAS A;  2OUM A;  3AL0 B;  4DJA A;  1WWX A;  2G0E A;  2MC4 A;  4FE4 A;  2NRA C;  3K4M A;  2EJR A;  4F52 A;  4LLG F;  1SFK A;  2K4B A;  3FMS A;  3HUG B;  2MYS A;  4PCQ A;  1W36 C;  2RQP A;  1MND A;  2XRL A;  2CQK A;  2FXA A;  3W6J B;  2O0Y A;  4EJW A;  3COA C;  5E3L A;  3GME A;  2NVX J;  5DCF A;  4HOB A;  1E17 A;  1JUS A;  2L4M A;  1VZ0 A;  3GLX A;  4MLO A;  4BJ5 C;  5CVI A;  4C2U A;  2QEX I;  4AIH A;  3VWB A;  1ZLJ A;  4LJZ F;  4B3A A;  3CLO A;  3SDB A;  3DLA A;  1GV2 A;  2B7E A;  3HZJ A;  2MD0 A;  3HSF A;  2Y2Z A;  2XB5 A;  1BOB A;  3SHF A;  4ITV A;  1B6A A;  2GWR A;  3K4K A;  3OSF A;  4ZYD A;  2XUB A;  4KMF A;  4EEF G;  3E7L A;  5JI6 A;  4B3X A;  3RZD J;  3M8F A;  3OYG A;  2OQR A;  1R4N B;  3GF2 A;  4A5M A;  3H5N A;  2Z16 A;  2F5D A;  3CCM I;  2FX0 A;  4ZC3 A;  4KIS A;  3P7N A;  1WKM A;  4RMN A;  1XMA A;  1S7A A;  3I5U A;  5DCM A;  3HM5 A;  4KA4 A;  2EV0 A;  3FXR A;  3CC2 I;  4EM0 B;  3PNV A;  4A93 J;  4WXC A;  4CZZ A;  3IRQ A;  1PP7 U;  5FRM A;  1HQC A;  2BV6 A;  2ZSI B;  3M7G A;  4G6Q A;  3OYA A;  4XNF A;  1IRF A;  3W2V A;  4KYW A;  2OA4 A;  4EV0 A;  2OC6 A;  3PO3 J;  1K83 J;  3OYD A;  2I10 A;  3I59 B;  2PI0 A;  2A6E F;  2WY7 Q;  3OS1 A;  4XLF A;  2VBW A;  2VC0 A;  1ZG1 A;  4U7B A;  3N97 A;  4BU2 A;  1TZL A;  1B9M A;  2E7W A;  1SAU A;  2H1L A;  3WTY C;  1ZR4 A;  1I5Z A;  1HSJ A;  4D5F A;  4M6Y A;  1NK3 P;  3H3V K;  3U9G A;  3A01 B;  5HOD A;  4EAT A;  4A3M J;  2OD5 A;  2EIN H;  4HW0 A;  2GOM A;  1OCR H;  2R7D A;  5HS8 A;  3F23 A;  3DCF A;  3RSN A;  3TGN A;  2M5W A;  5B1A H;  2PG4 A;  1DU6 A;  1QO0 D;  4FAS D;  3GTO J;  4XLN F;  3G2B A;  2DFI A;  2CUJ A;  4DIQ A;  3LOC A;  2DYR H;  3E5X A;  2LKS A;  5DUK A;  1YS7 A;  4U0V A;  2PMZ A;  1TTY A;  4QTR A;  2JA6 J;  4L9J A;  3KFW X;  1FZP B;  5DM7 F;  4KNY A;  2L7K A;  4XLP F;  2O8X A;  2ISY A;  3JRF A;  1D1B A;  1R71 A;  3HEF A;  4M3F A;  2UV1 A;  2MSY A;  5B1B H;  3CQZ J;  5L3B A;  1YJN I;  5EZH A;  1MNM C;  2EZK A;  5LHI A;  1UB9 A;  1YW7 A;  3G4S I;  5JVG F;  4S04 A;  5CQG A;  3EPZ A;  2JWT A;  2D1H A;  1ZQ3 P;  1UEL B;  1YX5 A;  3B73 A;  3H9J A;  4HX8 A;  5E3O A;  4PJM A;  1Z05 A;  1XS9 A;  2ZFW A;  2F5F A;  4IHT A;  3E5Q A;  2LF8 A;  1PDN C;  1TNS A;  2V7F A;  1QHH D;  2HYG D;  2LVS A;  2VOD A;  3BJO A;  5B3S H;  2RRE A;  1ZRF A;  1Z3X A;  2ZNY A;  4A3K J;  2XVC A;  2FNA A;  3JCU C;  3BRO A;  3S16 J;  1FYL A;  4AD9 A;  1GDT A;  1B59 A;  2ZJ2 A;  3HXL A;  2LLK A;  2JJ7 A;  5J8F A;  3LAP A;  1A6Q A;  3S2D J;  1PUF A;  1U5T B;  1JE8 A;  1S7O A;  1DDN A;  3F72 A;  1A36 A;  1I1S A;  2NAZ A;  4BHB A;  1X3W B;  1CF7 B;  3OR2 C;  3CCE I;  3CO6 C;  3DU5 A;  4Z6Y A;  2LKP A;  2HDW A;  5CVV A;  4HA8 A;  3QP5 A;  2K3P A;  1BN5 A;  1X1A A;  5F08 A;  5IT9 Z;  1LDJ A;  1OYW A;  3MMY B;  2HQA A;  2MC3 A;  3PSF A;  1YQA A;  2JRT A;  4CDG A;  1SMY F;  5FKM A;  1XGO A;  1QPI A;  5CQE A;  2OCE A;  1KU9 A;  3R60 A;  1JTX A;  4X6A J;  4NUB A;  3BG6 A;  3C2B A;  4IKF A;  1DP3 A;  4XKB A;  3HRU A;  2HFH A;  3P5J A;  4A6E A;  4BUP A;  4DYC A;  5HNH A;  4IOA F;  3OMY A;  2IP2 A;  1BJZ A;  4UUS B;  4CCM A;  4MTE A;  3CP2 A;  4C3H J;  1KYW A;  4E7S A;  3GW2 A;  4OWR B;  1RI7 A;  2XGC A;  1R22 A;  4EJV A;  1S7E A;  3DPL C;  3BZ6 A;  4AVZ A;  4IHY A;  1LPQ A;  1MDM B;  3L2V A;  1ETV A;  3HTU A;  2LYC A;  5KNL A;  1B8I A;  1FP2 A;  3DXJ F;  4HSR A;  5HS7 A;  1D0Y A;  2M0C A;  5EEG A;  2ECC A;  1TT5 B;  5FLV A;  2R7V A;  5E1Z B;  1WSU A;  3JTH A;  4A3J J;  3ZQL A;  4LG3 A;  2OPT A;  3MZY A;  5LBQ A;  2PX9 A;  3MKW B;  1ZRE A;  4UB8 C;  4X1E A;  9ANT A;  4HAM A;  1D1C A;  3KLO A;  2QYO A;  3NWS A;  3ZQH A;  5HVQ C;  4L0Z B;  1V54 H;  3QPL A;  5E8G A;  3FM3 A;  3I4M J;  1JTY A;  2QCO A;  1IF1 A;  2HOT A;  4HDV A;  2K9M A;  2A07 F;  2EBI A;  3OIO A;  5D8K B;  3TW6 A;  4EJO A;  4GDF A;  5CKT A;  4S0H B;  2KZV A;  4B47 A;  2XC7 A;  1ZAO A;  1TL8 A;  5GPA A;  4D7M A;  2IS1 A;  1EKE A;  4IEJ A;  1Y1W J;  4M74 A;  4EJU A;  1JI8 A;  1R1V A;  3SEZ A;  3WE3 A;  1MJ9 A;  3S3M A;  1YIO A;  3LSR A;  1K78 B;  1TC3 C;  4U87 A;  2P6S A;  2PN6 A;  2HS5 A;  3HRM A;  3ZQQ A;  2V1U A;  3KET A;  4IF4 A;  3RZO J;  4A3C J;  3PM1 A;  3ABM H;  2Y0S N;  3DWL E;  1JGS A;  2V1N A;  4F93 B;  1AU7 A;  5KCM A;  2FE3 A;  3V4G A;  2Z1D A;  1U9O A;  1FOY A;  1V5E A;  2W82 A;  2ELH A;  2EWN A;  4M3E A;  2DPD A;  4RGR A;  4IHX A;  2NXN B;  3M1C A;  4M9S A;  4CCJ A;  4J01 A;  4AID A;  5IYD J;  2Y0S A;  2GIV A;  3LSK A;  1IN4 A;  5KAI C;  3GTG J;  4XKV A;  3FIS A;  3VSK A;  1SEU A;  2L7M P;  3QPH A;  1UHM A;  3FXM A;  1WJF A;  4ZZL A;  1GVJ A;  1D0X A;  5HS9 A;  2MW8 A;  1QVT A;  4IX7 A;  4OIN F;  2VIX A;  2DMU A;  5IT3 A;  2MA3 A;  2FQ4 A;  2MGQ A;  1O7L A;  3JAM K;  2VOP A;  2CW7 A;  3OR1 C;  2DU9 A;  3GZ5 A;  2D1V A;  4YIR X;  3IWZ A;  3I58 A;  1ETQ A;  3K10 A;  5JHF A;  3WE2 A;  2LSO A;  3A03 A;  4ZJZ A;  3BWG A;  1BM9 A;  2VC1 A;  3BR0 A;  1OJL A;  3BJ6 A;  4MQ9 F;  4NNJ A;  2FU4 A;  2WAQ N;  2W25 A;  4Y15 A;  2DLL A;  2VKV A;  3LMM A;  2QM3 A;  1P7I A;  3CCR I;  1R5G A;  3K2A A;  2K9L A;  4KIB A;  3PO2 J;  1V55 H;  1W1W E;  3IV5 A;  3LQR A;  4Y33 A;  1A6I A;  1XSD A;  2WAQ A;  3ESW B;  4XRM A;  2A6T A;  5F04 A;  5GPC A;  1MH3 A;  4BBR J;  1FT9 A;  1ZG5 A;  1CGP A;  3D0S A;  3MKY B;  2RQQ A;  4LOC A;  1AOY A;  1I3A A;  1K4T A;  5F64 A;  3MFK A;  2QBY B;  2AQE A;  2FF4 A;  5FRN A;  4ON0 A;  2IW5 A;  1XDU A;  3H35 A;  1D0Z A;  4OAY A;  5CVU A;  1XN7 A;  1Z3Y A;  2XAJ A;  1JKR C;  1FNN A;  2ZME C;  4XR6 A;  1I3Q J;  1RES A;  2E1N A;  2VUM J;  4MEX F;  2LRD A;  1ZTR A;  2JRM A;  1S5L C;  1S6L A;  1YTY A;  2UXX A;  4RS8 A;  3FXL A;  5ILV A;  1MBE A;  4CA0 A;  2EK5 A;  3SJM A;  4HYE A;  2LK2 A;  3CD6 I;  1ZKG A;  4IOC F;  1S9H A;  2V9P A;  4LK0 F;  1GXQ A;  2FOK A;  2ZKZ A;  4BAY A;  4DOZ A;  3E1S A;  4L0Y B;  4E7H A;  1TLH B;  1TWF J;  2CWE A;  2CV2 A;  5J1Y A;  1XX5 A;  5HLG A;  3LFU A;  4HNT A;  4WCG A;  4LD5 A;  1FMV A;  3KYL A;  1AHD P;  4B09 A;  1T95 A;  3JRC A;  1NTC A;  3NAU A;  1WJC A;  2ZXJ A;  3ELK A;  3GUD A;  2KIQ A;  4ZYA A;  5ERI A;  3AL0 C;  1P6R A;  2IVM A;  2CW8 A;  5F6F A;  2QA4 I;  3H0G J;  4D9J A;  1JKQ C;  1R1T A;  1R7J A;  1WJ5 A;  4P96 A;  4Y4R A;  3KZY A;  4CXF A;  3ONQ A;  3IL2 A;  2ZME A;  1VI0 A;  1QZY A;  1YW9 A;  2A6H F;  1F5T A;  5JLW A;  4PJL A;  4PFO A;  3WTU C;  4BXF A;  1E3H A;  3GVA A;  1E2X A;  1IZ1 A;  4G7O F;  1SD4 A;  1FIA A;  2VAS A;  3MKZ A;  3HOT A;  4CH7 A;  4PJ0 C;  2F2E A;  2A5W A;  2P0W A;  1OCO H;  2KRF A;  3K1M A;  3R4K A;  1HCR A;  2DQR A;  2M30 A;  4LIT A;  4F91 B;  2VQH A;  4XQF A;  3G1L A;  1MSE C;  3NEU A;  1MZB A;  2DTZ A;  5HLT A;  2E1C A;  3GXO A;  1ZR2 A;  4XON A;  2IRF G;  5CVJ A;  5LD2 C;  4ZTF A;  1JJ8 C;  2VJ5 A;  3EDP A;  3S3O A;  3PFI A;  1P92 A;  2A5Y B;  1O3Q A;  1CQT A;  2DMT A;  3H5R A;  2EZL A;  4YEL A;  3OY9 A;  3CO7 C;  3MD2 A;  3RPQ A;  4JX5 A;  4EQQ A;  1IRG A;  1KU2 A;  2VB6 A;  4ASN A;  3DFG A;  1EA3 A;  4B44 A;  1G3S A;  3CUQ B;  4L9N A;  3KP6 A;  3DLL F;  2Q2E B;  3WTT C;  4HX4 A;  3CZ6 A;  4B8X A;  1QPM A;  5LGN A;  2VT3 A;  3ABT A;  5BPD A;  2ELK A;  3TP0 A;  5TJJ A;  1LUJ B;  2R4G A;  3TW7 A;  4I01 A;  3CCV I;  5J3L A;  4IO9 F;  3F22 A;  1VQM I;  1TQP A;  3FM5 A;  4G8X A;  3DPT A;  2J5O A;  2WA0 A;  1XSX A;  2H09 A;  2DCE A;  4RLF A;  4MTD A;  1LVA A;  1SAN A;  1ULY A;  2DK5 A;  4A6D A;  3I71 A;  2X85 A;  5IPA A;  1E0E A;  5KK1 A;  2P5L C;  2O7O A;  2ZO4 A;  3DBR B;  2QQB A;  5CJ9 A;  5EG0 A;  1VQL I;  2E1O A;  2E71 A;  4XRS G;  3BCB A;  3EYY A;  4XK4 A;  4A69 C;  2DT5 A;  1DGR M;  1MMG A;  1TWC J;  1Z77 A;  3QU6 A;  4AWX B;  3IC7 A;  2RC4 A;  2Y9Z A;  1BL0 A;  3ZP5 A;  1G3W A;  4QLC U;  3EUK L;  1SD5 A;  2XKP A;  2Q8K A;  4YFK F;  1K6O A;  2DDB A;  2M4G A;  2EA2 A;  3U1D A;  3IAS 2;  4NC6 A;  3DKW A;  2EFN A;  2ACJ A;  2O6G E;  2EFQ A;  2R7F A;  4E6K G;  1HST A;  3DPU A;  2M7B A;  4JQF A;  3GTL J;  2DAO A;  3J7A Y;  2HVR A;  2HKX A;  2CUE A;  1ZK8 A;  3J7A O;  4JX4 A;  2JA2 A;  2TRT A;  2DBB A;  3H9G A;  2DFE A;  1IDZ A;  2H8R A;  5M3M J;  3KP5 A;  1HBX G;  1JXS A;  1XGN A;  2XRN A;  3KEY A;  5F0F A;  4CSW A;  3LL7 A;  5IY5 H;  1UFM A;  2CUZ A;  1WVR A;  4RAY A;  1LFU P;  3L2R A;  3QP6 A;  4JBA A;  2A05 A;  4UVA A;  3I4N J;  1YS6 A;  3M4O J;  3JAM Z;  5M5W J;  2JT1 A;  3KYD B;  4FIS A;  2IGN A;  2FNP A;  4HQM A;  4WXH A;  5F0H A;  1G6N A;  1T56 A;  3D5L A;  3SFZ A;  4B48 A;  1O4X A;  2GA2 A;  1LNW A;  1R58 A;  3RKX A;  1JUM A;  2KRC A;  1X1C A;  3OS2 A;  5DD4 A;  4OIP F;  3M8J A;  4FX4 A;  4N0B A;  4OIO F;  1PJR A;  4FET A;  2JQ7 A;  1C0W A;  2HQR A;  5D4S A;  1MBG A;  2VJJ A;  4CCL A;  4F7Z A;  4GCV A;  2RN7 A;  3HTS B;  1ZLK A;  4DW6 A;  5LRR A;  3GTQ J;  2LBF B;  2HDD A;  2PEX A;  1DQU A;  3Q0U A;  4G7H F;  4I76 A;  1U5T C;  3FMQ A;  4XN3 A;  1IRZ A;  1YRN B;  3OYE A;  2RNG A;  4UV9 A;  4QWQ A;  4A5N A;  2A68 F;  2I8D A;  5FO5 A;  4M72 A;  3LNQ A;  2X51 A;  2Z5U A;  5TIS C;  2X1E A;  5FFX A;  1OQY A;  5L3C A;  3BQY A;  1Z91 A;  5AON A;  4GO1 A;  3P9C A;  2KP6 A;  4E7K A;  2VE8 A;  2E7X A;  1G59 A;  3WU2 C;  3TP3 A;  2STW A;  1ETY A;  2DFF A;  2P81 A;  2NVU B;  4OIR F;  4ZDL A;  5H6R A;  1PVE A;  2IA2 A;  2H8W A;  3CP8 A;  3MCZ A;  2P5K A;  2H1K A;  3F21 A;  2R5Y B;  2FML A;  4L18 B;  1N75 A;  2MG4 A;  3WG7 H;  2ID6 A;  3E6D A;  2XDV A;  3OIQ A;  1SFO J;  4I0B A;  2VXZ A;  5BPI A;  1U5T A;  3GTP J;  2XAH A;  2OF7 A;  2HPI A;  3CTA A;  2ZNZ A;  1EJ9 A;  2XF5 A;  2E5Z A;  2OZ6 A;  1CF7 A;  4FQG A;  2CG4 A;  4CYC A;  4O6J A;  3V7S A;  3Q0V A;  1ETO A;  2KDZ A;  3JRG A;  4LB5 A;  1LKX A;  4NC8 A;  1JHH A;  4G7Z F;  2BZT A;  3CJQ B;  3V8J A;  4AIK A;  2IEK A;  5D5V B;  4C3I J;  2H27 A;  2XAF A;  4BS9 A;  2GIZ A;  3FBI B;  1VQP I;  1KON A;  1S29 A;  3C3W A;  2UWM A;  1G3T A;  2E34 A;  1J59 A;  1WJE A;  3L09 A;  4UV8 A;  1OMI A;  3W2A A;  3CCL I;  1DUX C;  3I64 A;  3ZXS A;  3DF8 A;  4RGS A;  2AXL A;  2HDC A;  2ZCW A;  4DQ2 A;  2DOE A;  2V26 A;  1YX3 A;  4KIT B;  3OL4 A;  1E3P A;  2JZY A;  4UUS A;  4UXN A;  3ZR8 X;  1W4M A;  2VN2 A;  2MLK A;  4KJZ A;  5HLH A;  3WOD F;  1WI3 A;  2NNN A;  3W2W A;  1S8N A;  4WXD A;  4XM3 A;  2B9S A;  1MDM A;  2AHQ A;  2DA7 A;  5J40 A;  1MJB A;  3OYF A;  4Y7N J;  1BIA A;  1HA8 A;  3TOA A;  4A3B J;  4IXA A;  3HOS A;  4EGZ A;  2JA8 J;  1SD7 A;  1FOK A;  1HOM A;  4KIF A;  1FYK A;  3V7C A;  4A0Z A;  2COM A;  1QHG A;  3IKT A;  5FLX K;  1A5J A;  3O2P E;  1B9N A;  4ZZD A;  3I4P A;  1MMA A;  3U1K A;  2K9N A;  1BI2 A;  4J00 A;  3TQN A;  2EFO A;  3ERM A;  2B0L A;  2G7H A;  1Z1D A;  3REO A;  2F4M B;  2KJC A;  1KYZ A;  4TV7 A;  4Y3O A;  2YPR A;  3R0A A;  1R5I D;  2RDP A;  2GXG A;  2ELJ A;  3GX4 X;  4HNU A;  2DMN A;  2NNY A;  4E7J A;  2GBY A;  2NVT J;  3DTE A;  3K4C A;  3HSR A;  3G73 A;  4HLX A;  3TO7 A;  1JT0 A;  1BR4 A;  2KMU A;  3KYC B;  4A2U A;  2V6E A;  2M45 A;  2QSG X;  1HC8 A;  4BHP A;  1U78 A;  5J1U A;  4HX7 A;  4CZC A;  1EH6 A;  1W0T A;  1GT0 C;  4NQW B;  1YI2 I;  4HV6 A;  1WGX A;  2K3F A;  4BE0 A;  2J5P A;  4IRI A;  4C2M J;  2IT0 A;  4KUM A;  1U9N A;  1IV6 A;  3A4C A;  2IAI A;  3CCY A;  1I50 J;  3CMM A;  3TDZ C;  1TBX A;  4E7Z A;  2CQQ A;  2P7V B;  4ETS A;  3CCJ I;  2JPB A;  3IUO A;  2Z3Y A;  5FJ8 J;  1MD0 A;  2BEO A;  3C1D A;  1J2X A;  3VEP A;  3CF2 A;  3UR3 C;  1LFB A;  2QKM B;  1XTA A;  1J75 A;  3OYN A;  2N8G A;  4II2 A;  2BY3 A;  3OOU A;  4LFU A;  4XMY A;  4E7I A;  2R7U A;  2H6B A;  1QNT A;  1WH5 A;  2WY8 Q;  3T8R A;  1BC7 C;  1TWG J;  2P6T A;  2XPW A;  5C3E J;  3BQZ A;  5M5Y J;  4BEH A;  2QGU A;  3MKL A;  3QPT A;  3K4B A;  2V4J C;  1HDP A;  3HGG A;  2PJP A;  4LK1 F;  1RRJ A;  3B02 A;  4XSZ F;  3KLN A;  3TKY A;  4Q48 A;  3I9V 2;  3TO6 A;  3M3Y J;  1GHC A;  1T08 B;  1DU0 A;  2R7W A;  2RV8 A;  3IRR A;  1V5G A;  1P4X A;  4U88 A;  1U2W A;  2AQF A;  4ZYG A;  2X4H A;  5D8L B;  3BOQ A;  3K69 A;  4EM1 A;  1H0M A;  2L9N A;  2XHK A;  1OYI A;  1T0F C;  3SZG A;  1WFX A;  2FMY A;  2LY2 A;  2DMP A;  5E8I A;  4A3E J;  2JSP A;  3K0L A;  3ZPL A;  1VQ5 I;  4BBS J;  2H94 A;  3SEQ A;  4ENM A;  2FSW A;  3E3V A;  2DPU A;  4F92 B;  2OCC H;  1JKO C;  4EJT A;  4V19 K;  3AG4 H;  1Y0N A;  2W84 A;  3QOE A;  3D1N I;  1WHU A;  1FMW A;  1MNE A;  1FP1 D;  1Z21 A;  2H6C A;  4LG0 B;  1K6Y A;  3O8H A;  2XSD C;  1HF0 A;  3FKJ A;  1T33 A;  3HYI A;  3RQ4 A;  3HSE A;  4L5E A;  1AKH A;  4AIJ A;  1VQ4 I;  1UCR A;  2IBD A;  3QU3 A;  4UY8 I;  2MLG A;  2DA5 A;  1QZE A;  1T6S A;  1H9T A;  3OYB A;  4IZZ A;  5DUI A;  4BQA A;  3H1C A;  5JVT A;  2LY1 A;  4CCO A;  1XGM A;  2W48 A;  3BPX A;  1T0F A;  1IV8 A;  4XN0 A;  5H6Q A;  3LFK A;  4CIC A;  4N9I A;  1Y8Q B;  3DEE A;  3C2G A;  1QBJ A;  2IJL A;  2RKH A;  3FX3 A;  2JVH A;  5KHD A;  4M3B A;  2V9K A;  4OU0 A;  3ZMS A;  1HLV A;  3TL4 X;  5J4Y A;  1FWZ A;  3KE2 A;  4D0P A;  4HST A;  3S15 J;  3CME I;  3J7Y J;  2WWY A;  2OTL I;  4A3D J;  3LST A;  1O3T A;  3ZRG A;  3OL3 A;  1W5C C;  2M1B A;  4CGZ A;  4IPA A;  5GAG J;  1ZN2 A;  1J09 A;  3WHC A;  2FBI A;  3BG5 A;  1MGT A;  3S2H J;  4A0X A;  2R5Z B;  1SVO A;  2F5E A;  2BOL A;  3K1N A;  4BHC A;  3AG3 H;  1YYV A;  2BW3 B;  2TCT A;  5IYC J;  3K7A J;  3JRI A;  1RIO H;  1UHS A;  1ON1 A;  3LSM A;  3ML6 A;  4MQV A;  1UJ8 A;  1GLN A;  3HIF A;  4JOM A;  5J47 A;  3IH2 A;  2HKO A;  4E4H A;  1F36 A;  1ORK A;  5C4J J;  3CC4 I;  2K40 A;  2XF6 A;  1X2N A;  3ZN1 A;  1KQ8 A;  3HRS A;  3QWL A;  2CU7 A;  3LA2 A;  1ZG3 A;  1FPQ A;  2F5V A;  2E60 A;  4WK8 F;  2DN0 A;  1HKT A;  4PK4 A;  5FFZ A;  1R6R A;  2FOW A;  3BJA A;  1Q1H A;  3A02 A;  1IN6 A;  3HB9 A;  4BXU A;  2DO7 A;  5D5U B;  2VKH A;  2WV1 A;  2NOG A;  1F1Z A;  1KQ9 A;  1LE8 B;  1IRX A;  2M8G X;  2E2I J;  2LDU A;  2QZ8 A;  1W5S A;  2F4O B;  2R7S A;  4K2E A;  4M3G A;  6PAX A;  2YX7 A;  1OCZ H;  1FSH A;  5CVR A;  2Q2E A;  4KMU X;  2K4J A;  2HU9 A;  4M6X A;  5FLX Z;  5ICC A;  5DDG A;  3VYU B;  3BR2 A;  3RPU D;  1ITY A;  1BW6 A;  1X4O A;  2PMH A;  2WB1 N;  2W00 A;  4L9T A;  3OS0 A;  5K5Q A;  2P7C B;  4ABZ A;  3CC7 I;  3DQV C;  2HWV A;  3FXQ A;  3RTR A;  4RAF A;  1YJ9 I;  4DGW B;  3JR9 A;  1W7P B;  1XD7 A;  2DOA A;  3J7Z I;  2M7A A;  2WB1 A;  5HOO A;  1KQ0 A;  2LRE A;  4G94 A;  2D5V A;  5EEA A;  1HW2 A;  1WCM J;  2NOJ B;  1T39 A;  3CES A;  3ZOB A;  5H20 A;  3M9A A;  3KPH A;  2FJ1 A;  3BZK A;  3KP3 A;  4C3J J;  3VPR A;  3GLL A;  4M3D A;  2O03 A;  1XG1 A;  3VOE A;  4RAG A;  1LDK B;  2KDO A;  3H92 A;  2QSF X;  2EV6 A;  3BLY A;  4BDZ A;  2K86 A;  1LDD A;  2I5U A;  3ZMT A;  4ENN A;  2B63 J;  2L3D A;  4BQQ A;  3WTS C;  4F3Q A;  1FBS A;  3M8E A;  3OWT A;  2CMP A;  4HRI A;  2E5N A;  2CUF A;  2Z9O A;  2ESN A;  2ZJQ F;  4JX6 A;  2V79 A;  3ECH A;  3HKZ N;  2XKO A;  4U0W A;  2VT2 A;  2EIM H;  4ESF A;  1FBU A;  4II3 A;  2X1C A;  2LG4 A;  1A04 A;  4H0E A;  2OJE D;  4BQO A;  2Y30 A;  2O61 A;  1B72 B;  3KX2 A;  1FOW A;  1VQO I;  3P9K A;  1GVD A;  5K5O A;  4D1Q A;  4IRG A;  3FXJ A;  5GTH C;  3CJN A;  1BIB A;  4R1H A;  5J1R A;  2DW4 A;  2DA2 A;  2M34 A;  3E0J B;  4CHU A;  1IC8 A;  3HC7 A;  5LHH A;  4LLN A;  1KZH A;  4JP0 A;  4LIV A;  1VFC A;  1ACI A;  2NYX A;  3FZV A;  5EYR A;  1RUN A;  2EIJ H;  4M9Z A;  4PJJ A;  5ICE A;  1UAA A;  3CJR B;  2HQ5 A;  3IP4 B;  2BHY A;  5LEK A;  1LQ1 A;  1APL C;  2JVG A;  4Q47 A;  4C2T A;  2DA4 A;  2NVY J;  1KU7 A;  4BJT A;  3JSO A;  2L4A A;  3SXY A;  1B8I B;  1XDS A;  2R0Q C;  3EYI A;  3C2H A;  1B1B A;  3MZH A;  2FRH A;  5C4X J;  3BT9 A;  3PUB A;  5JR3 A;  5CYV A;  4ENK A;  2HOA A;  4N4O B;  5GAE J;  4B4C A;  2HZD A;  3BDD A;  1D8J A;  1X19 A;  3DEU A;  2VJI A;  2O8K A;  1SD6 A;  1SAX A;  2LBF A;  3Q9V A;  3BCA A;  2VQC A;  1L0O C;  3N4M A;  2Y0M A;  3EUA A;  3ZCO A;  4ANJ A;  2E1M B;  1YRN A;  2M3A A;  2HQN A;  1K79 A;  4RGU A;  3DKX A;  3V8L A;  4I7H A;  2EB7 A;  5D5X B;  1QRY A;  2XF7 A;  4G6D A;  5TRD A;  4AU7 A;  4BYY A;  1SVM A;  1R36 A;  2JMW A;  4OMZ A;  2AS5 F;  4IJA A;  4Y13 A;  2CSO A;  2OBP A;  3AKZ A;  3GBG A;  1UHW A;  4NHJ A;  2ZSH B;  4IHW A;  3GCM A;  1BA5 A;  3HUG A;  1X1P A;  2QEN A;  3FWE A;  2XB0 X;  1SFX A;  3FXK A;  2PMU A;  2X48 A;  1QVU A;  4IHV A;  4HF0 A;  2DJI A;  1RC9 A;  1LVK A;  1L3L A;  1FYM A;  2GOX B;  5HDN A;  3RQI A;  1DP7 P;  1P4A A;  2X6X A;  4P1W A;  4E7L A;  1Y39 A;  4UUT A;  1VQ9 I;  1AWC A;  4XBF A;  4DBR A;  5LGU A;  2X1D A;  2KPM A;  3KZZ A;  1WQ2 A;  1J7K A;  5ILS A;  3DBH B;  1BC8 C;  2XIG A;  3KEQ A;  4PJN A;  4ZH4 F;  5IP9 J;  2YR2 A;  3L2Q A;  1IJW C;  4EVI A;  5DV5 A;  2E36 A;  2M2E A;  2OAZ A;  2CYY A;  1TW2 A;  2D2W A;  3AFH A;  2OQG A;  3DU6 A;  4OMY A;  4QIW N;  4HEA 2;  1VQ7 I;  4LGW A;  1WJD A;  3F6V A;  4XKC A;  2CV1 A;  1RET A;  2CGP A;  2PLY A;  2WAE A;  3IKV A;  5K1Y A;  2IS6 A;  4HF2 A;  2KIF A;  1Y8R B;  2OU2 A;  2ESH A;  2JSC A;  2BY1 A;  2E2H J;  5E1X A;  4G12 A;  4A0Y A;  3WG9 A;  3NQO A;  4UVC A;  4HNV A;  4HG2 A;  3PIP F;  2MFZ A;  4O3M A;  4LB6 B;  4BY7 J;  4RM2 A;  3JRD A;  2JUG A;  1P7J A;  2OZU A;  2ZB9 A;  1DGW Y;  3MQ0 A;  3H5A A;  4Q5S F;  4PUS A;  4N4N B;  5D5W B;  1BI3 A;  2K9Q A;  2WTE A;  3AG2 H;  3I59 A;  4BL0 B;  4X0G A;  1Z9C A;  3KIO A;  2LR8 A;  3A2K A;  2KHM A;  2HGC A;  3IH3 A;  4DYR A;  4KT5 C;  3HL2 A;  3S14 J;  2NS8 A;  3WTX C;  4I6Z A;  1NG7 A;  3T1B A;  2HI3 A;  3W3C A;  1Z6T A;  1N77 A;  1BJA A;  5L3D A;  3ULQ B;  2F4I A;  3RPU A;  3A01 A;  3D5R C;  4HV5 A;  1XSV A;  2GXA A;  3I53 A;  1Z6R A;  3QYB A;  1ZEL A;  2K27 A;  4A12 A;  1I39 A;  3J81 K;  3BR3 A;  4M6V A;  3LA7 A;  5FD5 A;  1U3E M;  1V5F A;  4GFB A;  1W7P D;  4RB2 C;  3W6V A;  1MBK A;  1UG2 A;  5FD6 A;  4RM3 A;  4DYQ A;  1X4P A;  1ETW A;  1OPC A;  3C7J A;  3HOY J;  2WC2 A;  1RZ4 A;  3FXO A;  4MNU A;  5JHU A;  2P4W A;  4HF1 A;  3BG9 A;  5GP9 A;  5L3G A;  2ME0 A;  3WTV C;  5HDK A;  5EEH A;  3OIP A;  5H2F C;  5F0C A;  1R49 A;  3ZMU A;  3ABK H;  3BR1 A;  3RDI A;  2LMD A;  2KRH A;  1RR7 A;  1MMD A;  5HLI A;  3ASN H;  3S8P A;  3BTC A;  4NQW A;  3DV8 A;  4M9X A;  5E3N A;  1R9T J;  1G8X A;  4P9F A;  2WAD A;  1BR1 A;  3K2Z A;  1IN7 A;  3ABU A;  1OFC X;  3LAJ A;  3GFI A;  1YLF A;  2ZXI A;  4DZJ A;  2ETH A;  2X9D A;  1MKM A;  1P2F A;  4RGX A;  1T8I A;  1XPX A;  5ICF A;  4HQE A;  5FGM A;  2ZME B;  4XLC A;  2KFD A;  2HXI A;  2BVM A;  3AG1 H;  1IN5 A;  4FCY A;  2BE5 F;  4GRI A;  3QOD A;  4W1U A;  3KEO A;  4IQ4 A;  4KIG A;  2ZXH A;  3RI4 A;  4WWC A;  1U0J A;  2L9R A;  2VQG A;  2M87 A;  4Y17 A;  1LEA A;  4ZTJ A;  2FQ3 A;  4QPO A;  3HOZ J;  2KIM A;  2TDX A;  1YOV B;  2LC2 A;  2V1D A;  2IPQ X;  2KJB A;  2LD5 A;  2XSJ C;  3D5S C;  4HPQ A;  1TP4 A;  2DQL A;  1HKQ A;  4JK1 X;  4P9U A;  3Q9S A;  4RB3 C;  1RUO A;  2KIU A;  3KP4 A;  2VBY A;  1D5V A;  1MJA A;  1R1U A;  1R00 A;  2LFB A;  1IDY A;  5TGT A;  3HRT A;  3M1E A;  3OYK A;  3K4J A;  4A3L J;  2XPU A;  5E20 A;  1I27 A;  4YIF A;  4L9V A;  4QPQ A;  3A0H C;  1IXR C;  2L02 A;  2LNB A;  3CDI A;  3LSG A;  2KQR A;  3A0B C;  3OSG A;  1VQK I;  2HYF A;  5M5X J;  3GEZ A;  2GLO A;  2VJ4 A;  2GAU A;  1H8A C;  2STT A;  1R23 A;  2DFH A;  1PYV A;  2W57 A;  1HW5 A;  3HBL A;  2R7X A;  2QKL B;  2GA1 A;  1MBF A;  3WGG A;  1FC3 A;  2KT0 A;  2IGK A;  3HOX J;  3ASO H;  4CYD A;  1TQM A;  2NVQ J;  3FHZ A;  3FBN B;  3BTJ A;  1ENH A;  4LG0 A;  1ONV A;  1EV7 A;  1P9Q C;  1T2K A;  1KGS A;  3RYP A;  3U2R A;  2A3S A;  1Z67 A;  5D4R A;  3GZN B;  5EG0 B;  2V1X A;  2W24 A;  3MEX A;  3O8G A;  2PFB A;  3HHH A;  1IG7 A;  2MBF A;  3B6A A;  2DI3 A;  2C6Y A;  4JYK A;  4ESB A;  3GTK J;  2E35 A;  4A3G J;  1LB2 A;  2VE9 A;  1FOX A;  2VOO A;  1XGS A;  2ME6 A;  2L2O A;  5GTI C;  4J19 A;  3T5X A;  3OYJ A;  1I1G A;  3PIO F;  2MD5 A;  1TW3 A;  4BAC A;  5EZG A;  2ECB A;  3I55 I;  2M0M A;  4AVP A;  1ZYR F;  3IAM 2;  3BG3 A;  1S72 I;  3LSP A;  3WTZ A;  3L1P A;  3CDL A;  3E6B A;  2F48 A;  2AO9 A;  1UG0 A;  4OAZ A;  4FTH A;  1TNT A;  3RIR A;  1O57 A;  3G1M A;  1O3R A;  3S17 J;  1DPR A;  4V2G A; 
#chains in the Genus database with same CATH homology
 1LUJ B;  1M1E B;  1T08 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...