1M1FA

Kid toxin protein from e.coli plasmid r1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
107
Chain Sequence
b'MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kid toxin protein
publication title Structural and Functional Analysis of the Kid toxin protein from E.coli plasmid R1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 107
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1fA00
5CCAA 1UB4A 3NFCA 4VUBA 3JSCA 4MZPA 4HKEA 5DLOA 1VUBA 2VUBA 4ELZC 1X75C 4MDXA 4MZTA 5CKDA 5CO7A 5CKHA 5HK0A 5HK3A 5CQXA 4ELYC 3JRZA 3VUBA 5CQYA 3TCJA 5HKCA 5CK9A 5CR2A 3HPWA 5CKBA 4MZMA 2MF2A 1M1FA 5CKFA 4ME7A 3G7ZA 1NE8A 2C06A 2KMTA 5CKEA 4OF1A
chains in the Genus database with same CATH superfamily
1RI0A 3OBYA 4EMKC 3TU4K 1AVZC 1WYXA 1WQ7A 5GAMg 5KE2A 1BB9A 2EQMA 2RNAA 4J5YA 4PJOE 1NG2A 4C0DC 3JCMX 3NTHA 3X26B 5GMKe 2RJCA 2DTOA 4LD9K 4C8QD 1S1NA 1D1AA 1QCFA 2BUDA 4FIBA 1KQSP 4HA8A 3URGA 2AHJB 5DLQE 2B86A 9ATCB 1M90U 2AKKA 1I0CA 2E41A 1KHIA 4EDUA 3QJ6A 1I4K1 3MEWA 2YUOA 2CP3A 4M75E 2X4JA 1H3HA 4M78D 3JCMg 5L23A 1GFCA 2DL7A 2DYIA 5GAOq 2CH4W 4JS4A 1VQ4T 5FRNA 3LLRA 1I81A 3OY9A 4C0GA 2CUBA 1X01A 2VVKA 2HQXA 2GBQA 1JQQA 2KYBA 2LQKA 3MHXA 3RDVA 2GTJA 2RQTA 4PL6A 2F5KA 4FT4A 2CT4A 2LQNA 4M7AC 2CUDA 4JZ4A 5CKFA 2EYWA 2HKQB 2DXBA 3TEEA 1SHFA 2P4RA 3JB9F 1B34A 1ZA1B 5L8RE 4M77F 1PCXA 4C92E 2CP5A 3JCMc 2ED0A 3UA7A 4J6WA 3OYGA 3JCMJ 3CCVT 4TVRA 2L89A 4N0AC 2YLBA 4RTZA 2QYZA 2CZ1B 3S3NA 3MEAA 1IB8A 2K5LA 3HFNA 4OF1A 3NTIA 4B9XA 1VQ4Q 2KGTA 5D6WA 4ZTJA 1NYFA 2LMJA 5AT1B 4BUGA 1O9SA 4DBRA 3M54A 1MV0B 2E3IA 1K9MC 1G2BA 1VQ8T 4HCKA 1PC0A 1Q7YU 2YWWA 3H0FA 2V8JA 3HPWA 2QG9B 1YIJA 4A54A 3I5SA 3PTAA 1VYTA 2KMTA 2HMAA 5LL6S 3CD6A 5D6YA 1YN8A 1HD3A 1NYGA 5CQXA 5A2QE 1YFNA 3QPHA 1UGRB 2A08A 2MAMA 3VRZA 4QVDA 2M0YA 3CCVQ 3CCRA 4JRPA 2DVJA 2HDAA 1G3SA 2RMOA 1XJWB 4OB2B 1X2KA 2J05A 2IVWA 2D0NA 1UG1A 2EFIA 4FSXA 3JCMV 3RMSA 2QDLA 1JRIA 4GBQA 3M58A 3CCLT 2W10A 1QP2A 1W6XA 1X69A 3TVTA 4PJOG 4A63B 3I55A 4R0KA 1ABOA 5IHNA 1VQ8Q 4M7DD 1N5ZA 4O6JA 2XDPA 3TREA 3EHQA 3QWYA 4F7UB 1OZ3A 3ULRB 1YITA 1WQWA 1TWBA 3GPLA 3REBB 3G1JA 3OSSC 2DE0X 1SPKA 2E4HA 2O31A 4LDWA 3OA6A 4QVZA 1AZGB 4Q5WA 4J7FA 2VXEA 4PJOA 2JJ9A 5GAN5 4M75G 4JZ3A 1YJ9A 3E9FA 4C8QC 5GANj 1YI2A 1Y71A 5GAMj 3UPUA 1Q86U 2FPDA 4KT0E 4J6YA 2V26A 4MMLA 1QMCA 3OMGA 2EQJA 3CPWP 4M75A 4M78C 4M77D 1GCQA 3VS1A 1V29B 3CCLQ 1NJIR 3DLMA 1Q81C 2J7IA 4KBMB 2EYYA 1M3AA 1M1FA 2DXCA 1KD1C 1NE8A 2A36A 2LCSA 3M0QA 2RHYA 4NL3A 1YJWA 3GBQA 1EX4A 4PJNA 4F7UG 3GIBA 1D1BA 4CRIA 1FXXA 4C92G 3PT9A 1IGQA 1YBYA 2LC4A 3WVEB 1H92A 2BZ8A 3MEVA 1CSKA 3VU3C 3CXCP 3MCAB 1IRXA 2KE9A 4RG2A 4F7UA 3OYAA 3CCSA 4ZN3A 2MPXC 3NHNA 2VUBA 1RACB 2O9VA 3GNGA 1VQ6A 1SEMA 2FZKB 2K79A 4ORZA 1XNIA 1ACMB 2QA4A 3OS2A 2PVDB 3A5ZB 5I21A 4M77E 2HZYA 1ARKA 1H3ZA 5GMKi 2DYBA 3VS2A 3CBPA 1K8AU 4QQ6A 2DM1A 2O2OA 1ZBJA 3VS3A 2QQSA 1TG0A 4KUDK 2Y4YA 4J8OA 2RHUA 1K9AA 3ASKA 4Z89A 5CKHA 1RAHB 2VGNA 3D7SB 1D0YA 4YTLA 4QVCA 1MNEA 1IGUA 1S72A 4F14A 4PLIA 2KQWA 4AT1B 3BE3A 3CCQT 4C5EA 1A0NB 2VASA 2D6FA 1M30A 4F04B 4LDVA 4IUUA 3CCUQ 1AWJA 5C6SA 3QZ5B 2MWOA 1NBEB 4E7JA 3CCMT 2W0ZA 1YJNT 2CT3A 4J9EA 3CMAT 2QEXT 3CQTA 1G8XA 4FU6A 1W1FA 1J3TA 3SHWA 1YJ9Q 2AT1B 2K57A 2L0AA 2DPPB 1KFZA 5LJ3g 2JMAA 2GFAA 2DXTA 2E5KA 2HAXA 1NEBA 3OYHA 2P84A 1B7TA 3U23A 1FMWA 1SHGA 4A4EA 2M0OA 2BE9B 4RCCA 2EYQA 4M7DC 1WGSA 2RQRA 1FMKA 2DIGA 3GNFB 3OS5A 3CCQQ 1F1BB 4CC4B 3Q1JA 2KROA 3CC7A 3M0UA 3L2VA 1JXOA 4LNPA 4JS5A 3L2ZA 5LJ5j 2JT4A 2K3XA 2QK0A 3CC2Q 3CCMQ 1YJNQ 3SDZA 4PJOF 3CMAQ 2QEXQ 2L3QA 4LXCA 2D0QB 1I5LA 5GAN6 3VYGA 2XDDA 3CMEA 4C0ZA 4L59A 4QQDA 3OS1A 4ZGEB 3OYKA 3WXMB 4CC3A 5KYYB 2QAZA 3QDFA 1ZSZC 2E10A 1AWOA 2WSEE 4M75F 3L42A 4GLKA 2H3EB 1T0JA 1WHJA 1IHVA 4ELYC 2L5QA 3LH0A 5FRMA 1Y96B 3M0RA 2J6FA 3RUXA 2EQKA 2WSFE 5D7UA 3SWNB 3QXEB 4FYXB 1QVGA 1QVFA 1K0XA 5GAN7 2EJ9A 1RUWA 2CP2A 2O88A 1WJRA 2OTLT 2OJ2A 4IKFA 1M90R 1QCOA 2RPNA 2OX7A 1G3WA 4BB7A 2K5FA 3C94A 3N5BB 5FU7C 4BDYA 1BIAA 2MMPA 4BI4A 3PFSA 1VQNA 1OV3A 3RNJA 2A0FB 4PFPA 3CCJT 2LTOA 4N4HA 5GAN4 4KRTA 4C92F 2BE7D 2I2LA 1VUBA 2VXFA 1C0MA 1H8KA 1AEYA 4RTUA 1GBQA 1D3BA 2ZPIB 4KUIA 3UDCA 3WVDB 1NLPC 3OW2S 2RHZA 2MYSA 1WHKA 1M4ZA 3G6EQ 2LT4A 2DILA 1U8RA 1N8RR 2YXYA 1NJIC 1B07A 5ECAA 1KC8U 2BTTA 2E1HA 4D8KA 5KYYA 2KDSA 2LZ6B 3UT1A 4FM4B 2DAQA 1VQ9T 4KGZB 5IN1A 1AD5A 2LJ0A 1Y96A 4J9CA 1VIEA 2CP7A 2CSQA 4J9HA 2HD0A 3VS7A 1YCYA 3JB9I 3CCJQ 2NUTB 3SWNA 1UHCA 7AT1B 4II1A 2K2MA 3JB9J 1WFWA 1AOJA 3UF4A 2D8HA 1VQOT 4AFQC 1T3LA 4PJOD 2G6FX 5GANe 2HBWA 5GAMe 3JCMW 4XU2A 2F69A 2HSPA 2FRYA 3M0TA 5AYFA 4JRQA 4HT9A 1WX6A 4OVAA 4BE2A 2HKNA 3OYBA 3H9NA 3C95A 4PJMA 1VQ4A 4F17A 5GANf 5GAMf 4BY6C 5KYUB 4FW2A 4M75D 5GAOp 5I22A 4FCYA 1K73R 1VQ9Q 4FYWB 3JV3A 4EMKB 1KG1A 4A53A 4AFUC 1ABQA 2J6KA 3QIIA 3JCMe 4JRKA 4XU1A 1AHJB 3BDLA 2IPOB 1ZSGA 2EGAA 1PSFA 3META 4OB1B 1M1KU 4C0DB 1TUGB 2ABLA 2V1RA 3VUBA 2M02A 2WACA 3V8JA 4IUPA 1VQNQ 4KGVB 4RUGA 2DO3A 1YNZA 3JCMf 2ROTA 5GANd 3BW1A 3QWXX 5GAMd 3MP1A 1SSHA 3QHSA 2KXCA 2DRKA 3QJYA 1RAGB 2RQUA 3CCVA 2BKDN 2CP6A 4IURA 3T9NA 1Y0MA 5I2SA 4WCIA 2F2XA 2NUTA 4C92D 2C0TA 1D09B 2XI9A 2COZA 2KT1A 2OTJT 3F70A 2KSSA 2LCCA 2D8JA 2NWMA 2OAUA 3EFOA 1VQ8A 4DOVA 4NOYA 2CZ7B 2QDYB 2C06A 5J3BA 2DFUA 4L6V5 5A0DA 2DZCA 3RKXA 1Q86R 2FO0A 1W2BP 3C4SA 4CI0C 2QASA 3JCMd 2GFUA 4D8DA 1YWPA 4M4ZA 3OYFA 2E3HA 2JOYA 1D1CA 3MEUA 5GMKl 1WJQA 1TS9A 4J9GA 4M7AB 3LH5A 2FZGB 1ZBXA 3M0SA 3CCET 3MKDA 5KYUA 1WXUA 1V1CA 2DRMA 1M5Q1 2DTHA 2DVEA 1U1SA 2NUZA 2FG0A 4EMKA 2A7YA 2NUPB 4GLMA 4F7UE 1X75C 4ZN1A 3OYYA 5FWBA 5GJVB 1I5OB 2LDMA 5GAN8 1XTDA 3CCLA 1R0CB 3HP9A 4OGEA 3EG9B 3P8HA 4V2SA 8ATCB 2DNUA 1X6GA 5KCOA 1KQ2A 2JS2A 2ESWA 4XQ3A 1LJOA 1MGQA 3OYJA 1PSEA 2QXFA 2X3WD 2YRVA 1PD1A 2GQIA 2RA2A 3QYGB 2RN8A 5CR2A 1JJ2P 5LJ5e 2KRSA 2JMCA 2JUFA 3CCEQ 3M56A 1M90C 4M7AG 2KT8A 2YUQA 4PNOA 4BD3A 1R8OB 4X34A 4KH1B 1EZZB 1T0HA 5LJ5f 3E19A 1KQSA 3A8OB 2DBMA 3M57A 4NS5A 1WA7A 1TSFA 4M7AA 2DK3A 1ZLMA 1BCOA 4X1VA 2CH4A 2ENMA 1OPKA 4J7IA 5CCAA 3X28B 3NPFA 2LNVA 1UE9A 2YUPA 2YT6A 1K1ZA 2EGCA 4FYYB 2NUPA 2DEUA 2DERA 2JTMA 2HL3A 5FW9A 1YP5A 4HVVA 1VIFA 1HYOA 1N8RC 1VQ5T 2K3YA 1QVGS 1QVFS 4N0AA 5HCKA 3H0IA 3GP8A 5IT9E 5LJ5d 2ZCFB 2ZPEB 3CCUA 1WNLA 3EG9A 2XD0A 2K5IA 4WF2A 3VRYA 1UGPB 4ELZC 2KAFA 4A4GA 3EFRA 1IXDA 3DB4A 5HK0A 3KBGA 4BI8B 4ATOA 2FVUA 5GAOl 5IXFA 2GF7A 1GBRA 3R6NA 2X4YA 4C8QB 4UC4A 4E47A 1LCKA 2X4WA 4OMLA 4RTTA 3ZBDA 4LUEA 4C92C 1SF9A 2K9GA 4M78B 4XTUA 5IHIA 2CKKA 1MV3A 3JB9D 1VQ7T 1R0BG 4E7IA 1PKTA 3QO3A 3QSUA 3VS4A 2LVMA 2DA9A 1K4US 1VQ5Q 1BKBA 1SRMA 3CCQA 1O75A 1QWEA 1SSFA 2WSCE 5IHKA 3NFCA 2RQWA 2ZAEA 2QTVA 3OYIA 3PVLA 1K73C 5GANh 2RK1A 1UGQB 4HT8A 3CC2A 3NMZC 3CCMA 1YJNA 3LWHA 1G5VA 2RJDA 3CMAA 2NLUA 2QEXA 3NGPA 3MP8A 2NYSA 1PG5B 5KYWB 3H8ZA 4Y91A 4MZMA 4C8QG 2XDBA 1MMNA 3CBMA 3VV0A 2KNBB 4LDXA 4J9FA 2YRDA 2ZGWA 4ESRA 4JUVA 3EGDB 1CKBA 2KEAA 5CQYA 3O8VA 1QWFA 1VQ7Q 2YDLA 4M78G 3THKA 2M1HA 4OMNA 3DKMA 1RI9A 3S3MA 4C8QA 4ME7A 1U5SA 2RO0A 4BE0A 1GFDA 1D0ZA 2LX9A 1M8VA 2F2VA 3M9QA 5LJ3e 2XMFA 2DJZA 4B6MA 2PZ1A 3J7AF 4C5IA 4NL2A 1UFFA 2BZXA 3QG1A 4M78A 4EPCA 2KYMA 4D6WA 5GMKh 2QQAA 1Q86C 3AT1B 1VA7A 3HL8A 2LP5A 3FDRA 3EG0A 3OYDA 1C6VX 3OSVA 1Q82R 3HTRA 2O4XB 5CAIA 4JRIA 1HK9A 2YHTA 2Y4XA 1OULA 2PVOB 1M8MA 4RTWA 1TUDA 1OOTA 4JJBA 3OQ5A 1UGSB 1KC8R 3FC3A 1UEBA 4DQ2A 1NEGA 3QZ9B 2I0NA 1B3QA 2FYKA 2XKOC 3BFMA 4M7AF 1YHQT 1YJWT 4QW2A 3MPUB 4EMGA 4JLGA 3CPWA 2VC8A 3G6EA 3H6ZA 2JTEA 2HNIA 2XHCA 3FJPA 5KYWA 4Z8AA 2HCKA 4JLIA 1VQKT 1VQPT 4M7DB 2DTIA 2JVVA 3LGFA 3EGDA 2FZCB 1Y07A 1AWWA 4Y28E 2KI7A 3ME9A 3CCST 2RH2A 4QT7A 5DM7R 1X43A 2KXDA 1WHMA 1MMAA 5FLXE 2L3SA 1T3SA 3VYHB 3CCJA 1OYXA 3LGLA 5CO7A 1K0SA 3CXCA 2RI3A 2JN0A 1TUCA 4RKUE 3RKYA 2HEQA 3I56T 1K8AC 3A8LB 3OMCA 1X6OA 1MNDA 1MMDA 1G83A 2AK5A 1YHQQ 1BYMA 4E7SA 2E5QA 4XTVA 1WLPB 1ZSZB 1SRLA 3QUIA 1QVPA 1OPLA 1N6AA 1BCMA 2O4XA 5IH2A 4XU3A 3SD4A 2HBPA 1M1KR 1VQKQ 4M77C 4X9CA 1VQPQ 3KUFA 4J83A 5LJ5h 4AFSC 5EC7A 1NLOC 3SFMA 4FT2A 4M7DG 3EH1A 1PKSA 3FIFA 1VQ9A 1BBZA 1KHCA 3PVQA 1KSWA 1VOMA 1Y57A 2H8HA 3CC4T 2ATCB 4HVUA 4E7HA 2D1XA 2AIRB 3UATA 3S3OA 1PNJA 2E12A 2FRWA 5FU7B 2COYA 2QTXA 5EG2A 2EQIA 5FROA 2QGGA 4HCZA 4M7DA 1E6GA 2PNIA 1ZA2B 3I56Q 1MHNA 4OB3B 1TTHB 1LPLA 1WHGA 2E70A 1W70A 2EWNA 2JTFA 4IUQA 1Z9ZA 2MCNA 2X35A 4F7UF 2R5MA 2XK0A 3EG3A 4RMOA 3ZEHA 2YSQA 1UUEA 3HRSA 1QW1A 2LNHB 2L3PA 1PD0A 4E6RA 3CC7T 1PRLC 1BI0A 1BI1A 4HVWA 1YCSB 4Z88A 4OMMA 4AG1C 1PRMC 2X3XD 2GGRA 2XICA 4E7KA 4MMKA 2F2WA 3CC4Q 2JM9A 2LJ3A 2F1LA 2DL3A 2JS0A 1ZSZA 2J6OA 2OTLQ 1N9RA 4M78F 5M9OA 4OMQA 1YWOA 1M2VB 3V8LA 3KXTA 3VS0A 4EIKA 2FB7A 4FYVB 4PLLA 2JNGA 4J9IA 3PMIA 2DEQA 3V7RA 2EJGA 3R6OA 3S6WA 2RB6A 3JCMP 2JW4A 1EFNA 4DBFA 4MDWA 2HQHA 1NM7A 1E6HA 4IIOA 1VQLT 1RLPC 2L8DA 2ZPFB 1Q7YR 1TU0B 1OU8A 3GLXA 3OYCA 2RK2A 3X20B 4XTWA 1IHWA 4M7AE 4C5HA 2EQUA 3HRUA 2SEMA 8AT1B 2HSEB 2DL5A 3GOXA 1VQMT 1FX7A 1M3BA 4BY6B 4BDZA 3FB9A 3M53A 3G4ST 1CKAA 4LE9A 3P8DA 2FPFA 3O5ZA 4A4FA 5LJ3j 1WZOA 3X25B 1UDLA 2EIFA 4ZGDB 1V76A 3CPFA 2O01E 2MK5A 2ROLA 4JJDA 1M3CA 2O9SA 3CCEA 3VS5A 4P5NA 2RQVA 4RTYA 4PFOA 3OBWA 3M5AA 1MMGA 5KYXB 2ZPBB 3JAME 2DL8A 1FYNA 4XTXA 3H0HA 1RL2A 1Q82C 4PFZA 5CK9A 1VQOQ 1VQLQ 2KRMA 3KFVA 2BZYA 4OMFB 2DKGA 3EHRA 1M2VA 1B34B 1ZX6A 3PNWC 1KC8C 3A8MB 5GAN2 2EKHA 2D9TA 5GANg 2BIVA 1VQMQ 5D6XA 2PQWA 3M4YA 2DX1A 3VUZA 3G4SQ 2E6NA 4JJNK 2RI5A 4QKUA 1K9MU 3QKJA 4E7ZA 4HXJA 2QGFB 2QI2A 1OEBA 4K11A 2KR3A 3BY7A 2X4XA 3OW2P 1BU1A 2FPEA 4ANJA 4JJCA 4MDXA 2KRNA 4FL6A 4L5GA 3HKSA 2EPDA 4M7DF 1KIKA 2KK4A 1U3OA 3IQLA 1WJSA 4LDUA 5KE3A 2YUNA 2LT1A 3JCMb 2DJQA 2M51A 1I07A 1UTIA 5GAOn 2C0IA 3L2QA 2ED1A 2CZ6B 2EGEA 2VKNA 1M27C 3G71T 1GXIE 1JXMA 2MOXA 5GAN3 1RADB 5J26A 1BI3A 1X6BA 5KYXA 1I1JA 1UGVA 3L1AA 3LX7A 1KK7A 2PU9B 2OTJQ 3CEYA 2XU8A 3CPWS 4C0FA 1G3YA 2RHIA 4C8QE 1N8RU 3A98A 1M1KC 1VQ5A 3A1PA 3JSCA 1RABB 5DLOA 1LOJA 1PM3A 1QLYA 3V7CA 2K6DA 2LX7A 1Z9QA 3H41A 4M78E 3EGUA 3UWNA 1NZ9A 2AZSA 4BI3A 2CYZB 1RAEB 1K8AR 1VYVA 2MIOA 3ZFJA 3HRTA 3GF5A 1NPPA 4PJOB 4DA4A 3CBOA 3CXCS 4OMOA 2R5AA 4PJOC 3G71Q 1JBMA 2P0KA 5CIUA 2ZZDA 3E1SA 2ZPGB 1TOVA 3OYLA 2H3JA 1VQ7A 1Q81U 4XU0A 1X27A 1RAFB 2CP0A 1WHHA 4M75B 1KD1U 3L2WA 4LDYA 1BI2A 2KBTA 3M55A 1H641 2P0PA 3JB9H 1W4SA 3EG2A 4LN2A 4M75C 2LJ1A 3J80E 1GCQC 3M4GA 1K73U 3DB3A 3OW2A 1W2BA 2DXUA 4IIMA 1XQHA 3PE0A 4R55A 2L3RA 4Y92A 2EYXA 5IAYA 5IXBA 1JB0E 2RJEA 2FHDA 3HHTB 1MUZA 1M1GA 5HK3A 5LJ5g 4OP0A 4JPBW 2X51A 4RCBA 1QCNA 4DOWA 1Q95G 2M9UA 3JCMQ 4HCCA 2PUOB 2GQVA 3VS6A 2FL7A 2OI3A 1UJYA 1RLQC 2CDTA 2V8IA 3EFSA 4C92B 2LQWA 4ZNXA 3MP6A 3RESA 2KVQG 4MZTA 1UECA 1Q7YC 4PK4A 4E2FB 5FU6B 1XOVA 1YIJT 1D0XA 2GNCA 2EVRA 3TSWA 1Y7XA 5FU6C 6AT1B 5I11A 3CD6T 3V7SA 3MO8A 1KQ1A 2K7AA 4B9WA 1AT1B 2Y90A 3E2UA 1VYUA 4RG8A 5GJWB 1JJ2A 1WXTA 5J39A 2AKLA 2CZ0B 5GAMh 2EKOA 5I2MA 4AG2C 3TCJA 3CCRT 2VGMA 1QQJA 4LD6A 4M7DE 5KCHA 3DLLA 2MF2A 3EG1A 4R56A 3EGXB 3G7ZA 2E6ZA 1YHQA 3OB9A 2RHXA 4N4GA 3PIOA 2RF0A 4J6XA 3RMQA 3I55T 1OZ2A 2QQRA 2QQ9A 1VQKA 1VQPA 1YITT 1YIJQ 2ECZA 4XK8E 3ER0A 2Z0WA 3CCUT 1ZQ1A 2V8KA 1C1AA 3JCMh 3VJPA 1WIEA 4F16A 3P8BB 4ZGJB 3CD6Q 4EMHA 1JEGA 5GAOr 5KH6A 2EAYA 5GMKj 4C92A 1ZUKA 2YRCA 2EYZA 5A0GA 3L2UA 1YJ9T 2LCLA 2DZ9A 1YI2T 1IREB 1QKXA 4X9DA 3INZA 4LUDA 3CCRQ 3OYEA 2MI6A 4DBHA 3I56A 1WI7A 1TH7A 2IIMA 4OMPA 5LJ3f 3MJXA 2LRQA 5CVIA 3VKIA 1N27A 4AMCA 4HKEA 3SEMA 1U1TA 3LYIA 3V8KA 1QVGP 3QBYA 1QVFP 1UJ0A 3I55Q 3FJ5A 3I9QA 2EJFA 3UA6A 4IUTA 2XG8D 1YITQ 2EW3A 2MWPA 4PJLA 3TQ7P 3PIPA 4KULA 4J9BA 3AHUA 1JO8A 3CC2T 2R58A 3RKWA 3EGXA 5GMKm 3CC4A 2CREA 4KH0B 3SB2A 2HL5C 2CSIA 2DMOA 2X9HA 2DBKA 5LJ3d 2DIQA 2OTLA 2KY9A 1PWTA 1EIFA 1YI2Q 2A28A 4XTZA 2JZ2A 1P92A 1I8FA 2JM8A 3OYMA 4BACA 1VQ6T 4VUBA 3TSZA 2QA4T 2OAWA 2L2PA 2RI2A 4FSSA 1U06A 1HJDA 1R77A 1GRIA 3PMTA 2PVGB 4E7LA 2DLPA 1YJWQ 4OGCA 4QQGA 2V1QA 1D3BB 4C5GA 2EBPA 2QQBA 3LWIA 3FEOA 1SG5A 1S72T 4M77B 2E65A 3C12A 2AZVA 2F5TX 4FW1A 4DEXA 3OS0A 1NJIU 2RM4A 2ZPHB 3C0CA 2M16A 3EAEA 5CKBA 2VB6A 1WHLA 4N4IA 1LNXA 3X24B 3CCSQ 2J06A 2A3LA 1UB4A 1BK2A 1LVKA 2IG0A 1VQ6Q 2GCXA 3I5RA 2DF6A 2E64A 2QA4Q 3M59A 2PTKA 1RAAB 3HFOA 4AFZC 2P4TA 4WTOB 1FMVA 1TXQA 3A8HB 2GTOA 3RERA 4RTVA 2K2VA 3G6ET 3L2RA 1VQOA 1JU5C 1VQLA 2CGHA 1K9MR 2PUKB 3SWNC 5FWCA 2HQEA 1GL5A 2YLCA 3FRNA 1S72Q 1ZHIA 3JB9G 4BE1A 2VWFA 1VQMA 1KQSS 4M77G 5HKCA 3G4SA 2XIDA 2K3BA 3ZL7C 4A4HA 4C8QF 1M9SA 2C0OA 4M7AD 3RIRA 1OX8A 3PGGA 3BDUA 1OX9A 2DD4A 2DETA 5GAOm 1ZUYA 3OYNA 1M2OA 1HXDA 4DEYA 1FWZA 4M77A 3J81E 1K76A 3CMET 1W2BS 2LQ8A 1IZ6A 2K4YA 5C0MA 4PJJA 1UHFA 1SKUB 3EH2A 1RAIB 2P0QA 1Q82U 4HCBA 1NPRA 2JXBA 4CC2A 3NTKA 1WDXA 3REAB 3RBBB 3QDRB 4CC7A 3I35A 4XTYA 2FEIA 1E7OA 3LW5E 4GY5A 2G3RA 1OQKA 1G3TA 2SRCA 3CC7Q 4O5VA 2B8AA 2CS7A 2RD1A 1WXBA 1QKWA 3E9GA 2OTJA 4MZPA 4IUVA 2DD5A 5A0LA 2RJFA 1ZUUA 1AWXA 1WPYA 1VQNT 3EFOB 2VYTA 5HY6A 4JDSA 2VV5A 3QYHB 3CMEQ 4A4KA 1KJWA 1PHTA 2A37A 1BIBA 5DY9A 1DJ7B 1GCPA 1HSQA 5CKEA 1Q81R 3RR6A 1JJ2S 1AZEA 2DL4A 1KD1R 2COWA 4Z02A 5CKDA 4PKCC 3M0PA 3HSBA 1X2QA 3JRZA 1OU9A 3A8GB 4ZTFA 1IO6A 4KGXB 3G71A 4RTXA 3FLGA 4DBQA 4OB0B 1N9SA 4XAXB 1QP3A 1OI1A 5KYNA 2R57A 4J9DA 5LJ3h
chains in the Genus database with same CATH topology
1RI0A 3OBYA 4EMKC 5GAN7 3TU4K 2EJ9A 2LX9A 1M8VA 4M75B 1KD1U 3M9QA 1WJRA 3L2WA 5LJ3e 4LDYA 2OTLT 1WQ7A 4IKFA 1BI2A 3M55A 2DJZA 5GAMg 1H641 2P0PA 5KE2A 3JB9H 1W4SA 3J7AF 4M75C 4C5IA 1G3WA 3J80E 4NL2A 2EQMA 4J5YA 3M4GA 2K5FA 3C94A 3N5BB 3QG1A 4M78A 5FU7C 4BB7A 4D6WA 4EPCA 4BDYA 4C0DC 5GMKh 3JCMX 3DB3A 3NTHA 1BIAA 2MMPA 2QQAA 3PFSA 2DXUA 4BI4A 3OW2A 1W2BA 1Q86C 1VQNA 3X26B 3HL8A 3FDRA 5GMKe 1XQHA 2RJCA 2DTOA 4R55A 2L3RA 3CCJT 4LD9K 3OYDA 3OSVA 4C8QD 5IAYA 2BUDA 2O4XB 4FIBA 4HA8A 2LTOA 4JRIA 1HK9A 2AHJB 2Y4XA 2YHTA 4N4HA 5DLQE 3URGA 1JB0E 5GAN4 2PVOB 2RJEA 4C92F 2FHDA 1M90U 2I2LA 1VUBA 2VXFA 3HHTB 2E41A 1KHIA 1M1GA 4EDUA 3OQ5A 1UGSB 5HK3A 3QJ6A 2ZPIB 1D3BA 1I4K1 1UEBA 4KUIA 4OP0A 3UDCA 4DQ2A 3FC3A 3MEWA 4RCBA 3WVDB 4M75E 2X4JA 3QZ9B 4DOWA 2M9UA 3OW2S 2FYKA 2XKOC 3BFMA 4M78D 3JCMQ 3JCMg 4HCCA 4M7AF 2PUOB 1YHQT 2RHZA 2GQVA 2FL7A 5GAOq 1YJWT 4JS4A 4QW2A 1M4ZA 2LT4A 2V8IA 3EFSA 3LLRA 4C92B 4JLGA 4EMGA 1VQ4T 3CPWA 1I81A 3OY9A 1U8RA 4C0GA 2VC8A 3G6EA 3H6ZA 1X01A 2HNIA 2XHCA 3FJPA 3MP6A 3RESA 1NJIC 2KVQG 2HQXA 4JLIA 1VQKT 4MZTA 1VQPT 1KC8U 4M7DB 1Q7YC 2DTIA 2LQKA 2E1HA 3MHXA 2KDSA 5FU6B 1XOVA 3UT1A 2JVVA 1YIJT 4FM4B 2DAQA 4PJOE 1VQ9T 3LGFA 4PL6A 2F5KA 1Y7XA 4FT4A 5IN1A 1Y07A 5FU6C 4M7AC 4Y28E 3ME9A 3CCST 2RH2A 3V7SA 5CKFA 3CD6T 1Y96A 1VIEA 5DM7R 2DXBA 2HD0A 3MO8A 3TEEA 1KQ1A 1YCYA 5FLXE 3JB9I 3VYHB 3SWNA 4B9WA 2Y90A 4II1A 3JB9F 3CCJA 1B34A 3JB9J 4RG8A 1OYXA 1JJ2A 5L8RE 3LGLA 4M77F 5CO7A 5J39A 4C92E 2CZ0B 3JCMc 5GAMh 2RI3A 3CXCA 2EKOA 1VQOT 2JN0A 5I2MA 4RKUE 3TCJA 3CCRT 2VGMA 3RKYA 3I56T 5GANe 4PJOD 1K8AC 3A8LB 3OMCA 4J6WA 1X6OA 4LD6A 5GAMe 3OYGA 3JCMW 4XU2A 3CCVT 3JCMJ 4M7DE 5KCHA 4TVRA 2L89A 2F69A 4N0AC 2YLBA 2MF2A 5AYFA 4JRQA 4HT9A 4R56A 1BYMA 3G7ZA 2CZ1B 4OVAA 3S3NA 3MEAA 2E5QA 2E6ZA 2K5LA 3HFNA 4OF1A 1YHQA 3NTIA 4XTVA 4B9XA 4BE2A 3OB9A 3OYBA 3QUIA 5D6WA 1QVPA 4ZTJA 2RHXA 4N4GA 3C95A 1N6AA 4BUGA 3PIOA 1VQ4A 2O4XA 4J6XA 1O9SA 3RMQA 3I55T 5GANf 4XU3A 3SD4A 2HBPA 1OZ2A 5GAMf 2QQRA 4M77C 4X9CA 3M54A 2QQ9A 3KUFA 4J83A 5LJ5h 1K9MC 4BY6C 4M75D 1VQ8T 1VQKA 1VQPA 1Q7YU 5GAOp 1YITT 3SFMA 4FT2A 2V8JA 3ER0A 4XK8E 4M7DG 3HPWA 1ZQ1A 2V8KA 3JCMh 3CCUT 1YIJA 4A54A 4EMKB 3FIFA 1KG1A 4A53A 3PTAA 1VQ9A 3VJPA 2KMTA 3P8BB 3QIIA 1KHCA 4ZGJB 4EMHA 3CC4T 3JCMe 4JRKA 5LL6S 4E7HA 3CD6A 4XU1A 5GAOr 1AHJB 5KH6A 2EAYA 5GMKj 4C92A 3BDLA 3S3OA 5D6YA 2E12A 1PSFA 3META 4OB1B 1M1KU 5FU7B 5A0GA 3L2UA 1YJ9T 2QTXA 4C0DB 5EG2A 5CQXA 5FROA 2LCLA 3VUBA 2WACA 3V8JA 4IUPA 5A2QE 4HCZA 4M7DA 2DZ9A 1YI2T 1IREB 4X9DA 3INZA 3QPHA 1MHNA 3OYEA 2OTJA 1UGRB 2MAMA 2DO3A 2MI6A 4OB3B 3JCMf 4QVDA 5GANd 4JRPA 3BW1A 3CCRA 3I56A 2E70A 1G3SA 2EWNA 2JTFA 3MP1A 3QHSA 3QJYA 4IUQA 5GAMd 3CCVA 2BKDN 1TH7A 2X35A 4IURA 5LJ3f 4F7UF 2LRQA 4OB2B 2R5MA 5CVIA 3T9NA 5CAIA 3VKIA 1N27A 4HKEA 1QVGA 2XK0A 1U1TA 2IVWA 4RMOA 3LYIA 3ZEHA 2EFIA 5I2SA 4FSXA 5LJ5g 3JCMV 3RMSA 3V8KA 4C92D 1JRIA 3HRSA 3M58A 1QW1A 3QBYA 3CCLT 2XI9A 1QP2A 3CC7T 2EJFA 4PJOG 4IUTA 3I55A 1BI0A 2OTJT 3F70A 1BI1A 2KSSA 2XG8D 4M7DD 2LCCA 2OAUA 2MWPA 4O6JA 1VQ8A 2XDPA 3TREA 4NOYA 4DOVA 4F7UB 1OZ3A 2CZ7B 2QDYB 1YITA 5J3BA 3PIPA 1WQWA 2C06A 4L6V5 4KULA 5A0DA 2DZCA 3GPLA 3AHUA 2XICA 4E7KA 4MMKA 3CC2T 2R58A 3RKWA 3RKXA 3OSSC 3C4SA 4CI0C 4LDWA 5GMKm 3JCMd 2GFUA 3OA6A 4QVZA 3CC4A 3OYFA 4Q5WA 3SB2A 1N9RA 4M78F 2JOYA 3MEUA 4J7FA 2VXEA 1WJQA 5M9OA 5GMKl 4PJOA 5LJ3d 2DIQA 4M7AB 5GAN5 2OTLA 2KY9A 4M75G 1ZBXA 3V8LA 3KXTA 1YJ9A 1EIFA 3CCET 2FB7A 4XTZA 3E9FA 4C8QC 2JZ2A 4PLLA 5GANj 1P92A 1YI2A 2JNGA 1I8FA 1Y71A 1M5Q1 3PMIA 5GAMj 2DEQA 3V7RA 3OYMA 4BACA 2DTHA 2DVEA 1U1SA 3UPUA 1Q86U 1VQ6T 4VUBA 4EMKA 4KT0E 2A7YA 2EJGA 3R6OA 3S6WA 4J6YA 2RB6A 2QA4T 3JCMP 4F7UE 1X75C 4ZN1A 4MMLA 3OYYA 2RI2A 3OMGA 4MDWA 2EQJA 2LDMA 4M75A 4M78C 4M77D 1V29B 1VQLT 3DLMA 1Q81C 2L8DA 5GAN8 2ZPFB 3PMTA 1XTDA 4KBMB 2PVGB 3CCLA 4E7LA 3GLXA 3OYCA 1M1FA 2RK2A 2DXCA 3X20B 1KD1C 1NE8A 3HP9A 4OGEA 4XTWA 4M7AE 4C5HA 2EQUA 3HRUA 3P8HA 4V2SA 4OGCA 2RHYA 4QQGA 4C5GA 1D3BB 5KCOA 2QQBA 3GOXA 4NL3A 3LWIA 3FEOA 1YJWA 1KQ2A 1VQMT 4XQ3A 1FX7A 1S72T 4M77B 2E65A 3C12A 2F5TX 4F7UG 3GIBA 4BY6B 1LJOA 4BDZA 3FB9A 1MGQA 3M53A 4CRIA 3OYJA 1PSEA 1FXXA 2QXFA 4C92G 3G4ST 3OS0A 3PT9A 1NJIU 3P8DA 2RM4A 2YRVA 2ZPHB 1YBYA 2LC4A 4A4FA 5LJ3j 2RA2A 3QYGB 3WVEB 2M16A 3EAEA 3X25B 3MEVA 5CR2A 2EIFA 5LJ5e 5CKBA 4ZGDB 3CPFA 2O01E 2JUFA 3VU3C 3MCAB 4N4IA 1LNXA 3M56A 3X24B 1M90C 4M7AG 3CCEA 2A3LA 1UB4A 4PNOA 2IG0A 4RG2A 4BD3A 1R8OB 4P5NA 4F7UA 4ZN3A 3OYAA 3CCSA 2GCXA 4X34A 2VUBA 3OBWA 3M5AA 2E64A 2ZPBB 3GNGA 3M59A 1VQ6A 3JAME 1XNIA 3HFOA 2P4TA 4XTXA 2QA4A 5LJ5f 3E19A 3OS2A 2PVDB 3A5ZB 3A8HB 1RL2A 5I21A 4M77E 1Q82C 1KQSA 5CK9A 3RERA 3A8OB 2K2VA 3M57A 4NS5A 4OMFB 2DKGA 3G6ET 3L2RA 1H3ZA 1VQOA 4M7AA 5GMKi 2DK3A 1VQLA 3CBPA 2CGHA 1B34B 1K8AU 4QQ6A 3PNWC 2PUKB 1KC8C 3A8MB 4J7IA 5CCAA 3SWNC 3X28B 2QQSA 5GAN2 2HQEA 2D9TA 4KUDK 2Y4YA 4J8OA 2LNVA 5GANg 2RHUA 3ASKA 2YLCA 2BIVA 3FRNA 5CKHA 2VGNA 1ZHIA 5D6XA 2PQWA 4YTLA 3JB9G 3M4YA 4QVCA 4BE1A 2JTMA 1VQMA 1S72A 3VUZA 1KQSS 2E6NA 4PLIA 4M77G 4JJNK 2RI5A 5HKCA 2KQWA 3G4SA 3CCQT 1VIFA 4C5EA 2XIDA 4A4HA 1N8RC 1VQ5T 2D6FA 4C8QF 1M9SA 5FRNA 2K3YA 1QVGS 1K9MU 3QKJA 4N0AA 1QVFS 4LDVA 3GP8A 5IT9E 4IUUA 4M7AD 2QI2A 5C6SA 3QZ5B 3RIRA 3PGGA 5LJ5d 2MWOA 2ZCFB 2ZPEB 3BDUA 4E7JA 3BY7A 3CCUA 2DD4A 2X4XA 3CCMT 1WNLA 1YJNT 2XD0A 2K5IA 4WF2A 1UGPB 3CMAT 4ELZC 2QEXT 4MDXA 5GAOm 2KAFA 4A4GA 3OYNA 3EFRA 3DB4A 4FL6A 5HK0A 3KBGA 4L5GA 3HKSA 4BI8B 1HXDA 1FWZA 4M7DF 2KK4A 4FU6A 4M77A 3J81E 4ATOA 2FVUA 5GAOl 2GF7A 3CMET 1W2BS 2LQ8A 1IZ6A 2X4YA 4C8QB 2K4YA 5C0MA 2K57A 1WJSA 4LDUA 5KE3A 2LT1A 4UC4A 2DPPB 2P0QA 1Q82U 4HCBA 3JCMb 4E47A 5LJ3g 1NPRA 2X4WA 2GFAA 2DXTA 2HAXA 3NTKA 5GAOn 3OYHA 3ZBDA 3L2QA 3QDRB 4C92C 2CZ6B 4A4EA 4M78B 4XTUA 4XTYA 2M0OA 2CKKA 4RCCA 3G71T 1GXIE 3JB9D 5GAN3 2EYQA 1VQ7T 5J26A 1BI3A 3LW5E 1WGSA 4GY5A 4E7IA 2G3RA 4M7DC 3QO3A 3QSUA 2DIGA 3GNFB 2LVMA 1G3TA 3L1AA 3LX7A 3OS5A 2PU9B 3Q1JA 3CEYA 2XU8A 2B8AA 2CS7A 2RD1A 4O5VA 4C0FA 3CPWS 3L2VA 3CC7A 1BKBA 1G3YA 3CCQA 2RHIA 1O75A 3E9GA 3L2ZA 1SSFA 2WSCE 4C8QE 5LJ5j 4JS5A 1N8RU 1K73U 1M1KC 1VQ5A 3NFCA 3JSCA 4MZPA 4IUVA 2DD5A 2K3XA 5DLOA 1LOJA 3OYIA 1K73C 5GANh 2RK1A 5A0LA 1UGQB 4PJOF 2RJFA 3SDZA 4HT8A 1WPYA 3CC2A 3CCMA 1YJNA 3V7CA 3LWHA 1VQNT 1G5VA 2RJDA 2VYTA 3CMAA 2NLUA 5HY6A 2QEXA 3MP8A 2D0QB 4JDSA 2VV5A 3QYHB 1I5LA 4M78E 5GAN6 3VYGA 3UWNA 2XDDA 4A4KA 1BIBA 3CMEA 5DY9A 1NZ9A 4C0ZA 4L59A 4BI3A 1DJ7B 2CYZB 3H8ZA 5CKEA 4MZMA 4Y91A 4C8QG 4QQDA 2XDBA 3CBMA 3OS1A 3ZFJA 4ZGEB 3HRTA 3OYKA 3GF5A 1NPPA 3VV0A 3WXMB 4DA4A 1JJ2S 4PJOB 3CBOA 3CXCS 2E10A 4LDXA 2WSEE 2ZGWA 4Z02A 4M75F 5CKDA 3L42A 4GLKA 4PKCC 4JUVA 2R5AA 3HSBA 4PJOC 4ELYC 2L5QA 3JRZA 3LH0A 5CQYA 3O8VA 1JBMA 5FRMA 2P0KA 3A8GB 2ZZDA 3E1SA 2ZPGB 5CIUA 1Y96B 3OYLA 4ZTFA 2H3JA 3G71A 4M78G 3FLGA 3RUXA 1VQ7A 2M1HA 2EQKA 2WSFE 4OB0B 3DKMA 3SWNB 3S3MA 1N9SA 4C8QA 4ME7A 4XAXB 1QP3A 1Q81U 1OI1A 4XU0A 2R57A 3QXEB 1QVFA 3DLLA 5LJ3h 2RO0A 4BE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  1UB4 A;  3NFC A;  4VUB A;  3JSC A;  4MZP A;  4HKE A;  5DLO A;  1VUB A;  2VUB A;  4ELZ C;  1X75 C;  4MDX A;  4MZT A;  5CKD A;  5CO7 A;  5CKH A;  5HK0 A;  5HK3 A;  5CQX A;  4ELY C;  3JRZ A;  3VUB A;  5CQY A;  3TCJ A;  5HKC A;  5CK9 A;  5CR2 A;  3HPW A;  5CKB A;  4MZM A;  2MF2 A;  1M1F A;  5CKF A;  4ME7 A;  3G7Z A;  1NE8 A;  2C06 A;  2KMT A;  5CKE A;  4OF1 A; 
#chains in the Genus database with same CATH topology
 1RI0 A;  3OBY A;  4EMK C;  3TU4 K;  1AVZ C;  1WYX A;  1WQ7 A;  5GAM g;  5KE2 A;  1BB9 A;  2EQM A;  2RNA A;  4J5Y A;  4PJO E;  1NG2 A;  4C0D C;  3JCM X;  3NTH A;  3X26 B;  5GMK e;  2RJC A;  2DTO A;  4LD9 K;  4C8Q D;  1S1N A;  1D1A A;  1QCF A;  2BUD A;  4FIB A;  1KQS P;  4HA8 A;  3URG A;  2AHJ B;  5DLQ E;  2B86 A;  9ATC B;  1M90 U;  2AKK A;  1I0C A;  2E41 A;  1KHI A;  4EDU A;  3QJ6 A;  1I4K 1;  3MEW A;  2YUO A;  2CP3 A;  4M75 E;  2X4J A;  1H3H A;  4M78 D;  3JCM g;  5L23 A;  1GFC A;  2DL7 A;  2DYI A;  5GAO q;  2CH4 W;  4JS4 A;  1VQ4 T;  5FRN A;  3LLR A;  1I81 A;  3OY9 A;  4C0G A;  2CUB A;  1X01 A;  2VVK A;  2HQX A;  2GBQ A;  1JQQ A;  2KYB A;  2LQK A;  3MHX A;  3RDV A;  2GTJ A;  2RQT A;  4PL6 A;  2F5K A;  4FT4 A;  2CT4 A;  2LQN A;  4M7A C;  2CUD A;  4JZ4 A;  5CKF A;  2EYW A;  2HKQ B;  2DXB A;  3TEE A;  1SHF A;  2P4R A;  3JB9 F;  1B34 A;  1ZA1 B;  5L8R E;  4M77 F;  1PCX A;  4C92 E;  2CP5 A;  3JCM c;  2ED0 A;  3UA7 A;  4J6W A;  3OYG A;  3JCM J;  3CCV T;  4TVR A;  2L89 A;  4N0A C;  2YLB A;  4RTZ A;  2QYZ A;  2CZ1 B;  3S3N A;  3MEA A;  1IB8 A;  2K5L A;  3HFN A;  4OF1 A;  3NTI A;  4B9X A;  1VQ4 Q;  2KGT A;  5D6W A;  4ZTJ A;  1NYF A;  2LMJ A;  5AT1 B;  4BUG A;  1O9S A;  4DBR A;  3M54 A;  1MV0 B;  2E3I A;  1K9M C;  1G2B A;  1VQ8 T;  4HCK A;  1PC0 A;  1Q7Y U;  2YWW A;  3H0F A;  2V8J A;  3HPW A;  2QG9 B;  1YIJ A;  4A54 A;  3I5S A;  3PTA A;  1VYT A;  2KMT A;  2HMA A;  5LL6 S;  3CD6 A;  5D6Y A;  1YN8 A;  1HD3 A;  1NYG A;  5CQX A;  5A2Q E;  1YFN A;  3QPH A;  1UGR B;  2A08 A;  2MAM A;  3VRZ A;  4QVD A;  2M0Y A;  3CCV Q;  3CCR A;  4JRP A;  2DVJ A;  2HDA A;  1G3S A;  2RMO A;  1XJW B;  4OB2 B;  1X2K A;  2J05 A;  2IVW A;  2D0N A;  1UG1 A;  2EFI A;  4FSX A;  3JCM V;  3RMS A;  2QDL A;  1JRI A;  4GBQ A;  3M58 A;  3CCL T;  2W10 A;  1QP2 A;  1W6X A;  1X69 A;  3TVT A;  4PJO G;  4A63 B;  3I55 A;  4R0K A;  1ABO A;  5IHN A;  1VQ8 Q;  4M7D D;  1N5Z A;  4O6J A;  2XDP A;  3TRE A;  3EHQ A;  3QWY A;  4F7U B;  1OZ3 A;  3ULR B;  1YIT A;  1WQW A;  1TWB A;  3GPL A;  3REB B;  3G1J A;  3OSS C;  2DE0 X;  1SPK A;  2E4H A;  2O31 A;  4LDW A;  3OA6 A;  4QVZ A;  1AZG B;  4Q5W A;  4J7F A;  2VXE A;  4PJO A;  2JJ9 A;  5GAN 5;  4M75 G;  4JZ3 A;  1YJ9 A;  3E9F A;  4C8Q C;  5GAN j;  1YI2 A;  1Y71 A;  5GAM j;  3UPU A;  1Q86 U;  2FPD A;  4KT0 E;  4J6Y A;  2V26 A;  4MML A;  1QMC A;  3OMG A;  2EQJ A;  3CPW P;  4M75 A;  4M78 C;  4M77 D;  1GCQ A;  3VS1 A;  1V29 B;  3CCL Q;  1NJI R;  3DLM A;  1Q81 C;  2J7I A;  4KBM B;  2EYY A;  1M3A A;  1M1F A;  2DXC A;  1KD1 C;  1NE8 A;  2A36 A;  2LCS A;  3M0Q A;  2RHY A;  4NL3 A;  1YJW A;  3GBQ A;  1EX4 A;  4PJN A;  4F7U G;  3GIB A;  1D1B A;  4CRI A;  1FXX A;  4C92 G;  3PT9 A;  1IGQ A;  1YBY A;  2LC4 A;  3WVE B;  1H92 A;  2BZ8 A;  3MEV A;  1CSK A;  3VU3 C;  3CXC P;  3MCA B;  1IRX A;  2KE9 A;  4RG2 A;  4F7U A;  3OYA A;  3CCS A;  4ZN3 A;  2MPX C;  3NHN A;  2VUB A;  1RAC B;  2O9V A;  3GNG A;  1VQ6 A;  1SEM A;  2FZK B;  2K79 A;  4ORZ A;  1XNI A;  1ACM B;  2QA4 A;  3OS2 A;  2PVD B;  3A5Z B;  5I21 A;  4M77 E;  2HZY A;  1ARK A;  1H3Z A;  5GMK i;  2DYB A;  3VS2 A;  3CBP A;  1K8A U;  4QQ6 A;  2DM1 A;  2O2O A;  1ZBJ A;  3VS3 A;  2QQS A;  1TG0 A;  4KUD K;  2Y4Y A;  4J8O A;  2RHU A;  1K9A A;  3ASK A;  4Z89 A;  5CKH A;  1RAH B;  2VGN A;  3D7S B;  1D0Y A;  4YTL A;  4QVC A;  1MNE A;  1IGU A;  1S72 A;  4F14 A;  4PLI A;  2KQW A;  4AT1 B;  3BE3 A;  3CCQ T;  4C5E A;  1A0N B;  2VAS A;  2D6F A;  1M30 A;  4F04 B;  4LDV A;  4IUU A;  3CCU Q;  1AWJ A;  5C6S A;  3QZ5 B;  2MWO A;  1NBE B;  4E7J A;  3CCM T;  2W0Z A;  1YJN T;  2CT3 A;  4J9E A;  3CMA T;  2QEX T;  3CQT A;  1G8X A;  4FU6 A;  1W1F A;  1J3T A;  3SHW A;  1YJ9 Q;  2AT1 B;  2K57 A;  2L0A A;  2DPP B;  1KFZ A;  5LJ3 g;  2JMA A;  2GFA A;  2DXT A;  2E5K A;  2HAX A;  1NEB A;  3OYH A;  2P84 A;  1B7T A;  3U23 A;  1FMW A;  1SHG A;  4A4E A;  2M0O A;  2BE9 B;  4RCC A;  2EYQ A;  4M7D C;  1WGS A;  2RQR A;  1FMK A;  2DIG A;  3GNF B;  3OS5 A;  3CCQ Q;  1F1B B;  4CC4 B;  3Q1J A;  2KRO A;  3CC7 A;  3M0U A;  3L2V A;  1JXO A;  4LNP A;  4JS5 A;  3L2Z A;  5LJ5 j;  2JT4 A;  2K3X A;  2QK0 A;  3CC2 Q;  3CCM Q;  1YJN Q;  3SDZ A;  4PJO F;  3CMA Q;  2QEX Q;  2L3Q A;  4LXC A;  2D0Q B;  1I5L A;  5GAN 6;  3VYG A;  2XDD A;  3CME A;  4C0Z A;  4L59 A;  4QQD A;  3OS1 A;  4ZGE B;  3OYK A;  3WXM B;  4CC3 A;  5KYY B;  2QAZ A;  3QDF A;  1ZSZ C;  2E10 A;  1AWO A;  2WSE E;  4M75 F;  3L42 A;  4GLK A;  2H3E B;  1T0J A;  1WHJ A;  1IHV A;  4ELY C;  2L5Q A;  3LH0 A;  5FRM A;  1Y96 B;  3M0R A;  2J6F A;  3RUX A;  2EQK A;  2WSF E;  5D7U A;  3SWN B;  3QXE B;  4FYX B;  1QVG A;  1QVF A;  1K0X A;  5GAN 7;  2EJ9 A;  1RUW A;  2CP2 A;  2O88 A;  1WJR A;  2OTL T;  2OJ2 A;  4IKF A;  1M90 R;  1QCO A;  2RPN A;  2OX7 A;  1G3W A;  4BB7 A;  2K5F A;  3C94 A;  3N5B B;  5FU7 C;  4BDY A;  1BIA A;  2MMP A;  4BI4 A;  3PFS A;  1VQN A;  1OV3 A;  3RNJ A;  2A0F B;  4PFP A;  3CCJ T;  2LTO A;  4N4H A;  5GAN 4;  4KRT A;  4C92 F;  2BE7 D;  2I2L A;  1VUB A;  2VXF A;  1C0M A;  1H8K A;  1AEY A;  4RTU A;  1GBQ A;  1D3B A;  2ZPI B;  4KUI A;  3UDC A;  3WVD B;  1NLP C;  3OW2 S;  2RHZ A;  2MYS A;  1WHK A;  1M4Z A;  3G6E Q;  2LT4 A;  2DIL A;  1U8R A;  1N8R R;  2YXY A;  1NJI C;  1B07 A;  5ECA A;  1KC8 U;  2BTT A;  2E1H A;  4D8K A;  5KYY A;  2KDS A;  2LZ6 B;  3UT1 A;  4FM4 B;  2DAQ A;  1VQ9 T;  4KGZ B;  5IN1 A;  1AD5 A;  2LJ0 A;  1Y96 A;  4J9C A;  1VIE A;  2CP7 A;  2CSQ A;  4J9H A;  2HD0 A;  3VS7 A;  1YCY A;  3JB9 I;  3CCJ Q;  2NUT B;  3SWN A;  1UHC A;  7AT1 B;  4II1 A;  2K2M A;  3JB9 J;  1WFW A;  1AOJ A;  3UF4 A;  2D8H A;  1VQO T;  4AFQ C;  1T3L A;  4PJO D;  2G6F X;  5GAN e;  2HBW A;  5GAM e;  3JCM W;  4XU2 A;  2F69 A;  2HSP A;  2FRY A;  3M0T A;  5AYF A;  4JRQ A;  4HT9 A;  1WX6 A;  4OVA A;  4BE2 A;  2HKN A;  3OYB A;  3H9N A;  3C95 A;  4PJM A;  1VQ4 A;  4F17 A;  5GAN f;  5GAM f;  4BY6 C;  5KYU B;  4FW2 A;  4M75 D;  5GAO p;  5I22 A;  4FCY A;  1K73 R;  1VQ9 Q;  4FYW B;  3JV3 A;  4EMK B;  1KG1 A;  4A53 A;  4AFU C;  1ABQ A;  2J6K A;  3QII A;  3JCM e;  4JRK A;  4XU1 A;  1AHJ B;  3BDL A;  2IPO B;  1ZSG A;  2EGA A;  1PSF A;  3MET A;  4OB1 B;  1M1K U;  4C0D B;  1TUG B;  2ABL A;  2V1R A;  3VUB A;  2M02 A;  2WAC A;  3V8J A;  4IUP A;  1VQN Q;  4KGV B;  4RUG A;  2DO3 A;  1YNZ A;  3JCM f;  2ROT A;  5GAN d;  3BW1 A;  3QWX X;  5GAM d;  3MP1 A;  1SSH A;  3QHS A;  2KXC A;  2DRK A;  3QJY A;  1RAG B;  2RQU A;  3CCV A;  2BKD N;  2CP6 A;  4IUR A;  3T9N A;  1Y0M A;  5I2S A;  4WCI A;  2F2X A;  2NUT A;  4C92 D;  2C0T A;  1D09 B;  2XI9 A;  2COZ A;  2KT1 A;  2OTJ T;  3F70 A;  2KSS A;  2LCC A;  2D8J A;  2NWM A;  2OAU A;  3EFO A;  1VQ8 A;  4DOV A;  4NOY A;  2CZ7 B;  2QDY B;  2C06 A;  5J3B A;  2DFU A;  4L6V 5;  5A0D A;  2DZC A;  3RKX A;  1Q86 R;  2FO0 A;  1W2B P;  3C4S A;  4CI0 C;  2QAS A;  3JCM d;  2GFU A;  4D8D A;  1YWP A;  4M4Z A;  3OYF A;  2E3H A;  2JOY A;  1D1C A;  3MEU A;  5GMK l;  1WJQ A;  1TS9 A;  4J9G A;  4M7A B;  3LH5 A;  2FZG B;  1ZBX A;  3M0S A;  3CCE T;  3MKD A;  5KYU A;  1WXU A;  1V1C A;  2DRM A;  1M5Q 1;  2DTH A;  2DVE A;  1U1S A;  2NUZ A;  2FG0 A;  4EMK A;  2A7Y A;  2NUP B;  4GLM A;  4F7U E;  1X75 C;  4ZN1 A;  3OYY A;  5FWB A;  5GJV B;  1I5O B;  2LDM A;  5GAN 8;  1XTD A;  3CCL A;  1R0C B;  3HP9 A;  4OGE A;  3EG9 B;  3P8H A;  4V2S A;  8ATC B;  2DNU A;  1X6G A;  5KCO A;  1KQ2 A;  2JS2 A;  2ESW A;  4XQ3 A;  1LJO A;  1MGQ A;  3OYJ A;  1PSE A;  2QXF A;  2X3W D;  2YRV A;  1PD1 A;  2GQI A;  2RA2 A;  3QYG B;  2RN8 A;  5CR2 A;  1JJ2 P;  5LJ5 e;  2KRS A;  2JMC A;  2JUF A;  3CCE Q;  3M56 A;  1M90 C;  4M7A G;  2KT8 A;  2YUQ A;  4PNO A;  4BD3 A;  1R8O B;  4X34 A;  4KH1 B;  1EZZ B;  1T0H A;  5LJ5 f;  3E19 A;  1KQS A;  3A8O B;  2DBM A;  3M57 A;  4NS5 A;  1WA7 A;  1TSF A;  4M7A A;  2DK3 A;  1ZLM A;  1BCO A;  4X1V A;  2CH4 A;  2ENM A;  1OPK A;  4J7I A;  5CCA A;  3X28 B;  3NPF A;  2LNV A;  1UE9 A;  2YUP A;  2YT6 A;  1K1Z A;  2EGC A;  4FYY B;  2NUP A;  2DEU A;  2DER A;  2JTM A;  2HL3 A;  5FW9 A;  1YP5 A;  4HVV A;  1VIF A;  1HYO A;  1N8R C;  1VQ5 T;  2K3Y A;  1QVG S;  1QVF S;  4N0A A;  5HCK A;  3H0I A;  3GP8 A;  5IT9 E;  5LJ5 d;  2ZCF B;  2ZPE B;  3CCU A;  1WNL A;  3EG9 A;  2XD0 A;  2K5I A;  4WF2 A;  3VRY A;  1UGP B;  4ELZ C;  2KAF A;  4A4G A;  3EFR A;  1IXD A;  3DB4 A;  5HK0 A;  3KBG A;  4BI8 B;  4ATO A;  2FVU A;  5GAO l;  5IXF A;  2GF7 A;  1GBR A;  3R6N A;  2X4Y A;  4C8Q B;  4UC4 A;  4E47 A;  1LCK A;  2X4W A;  4OML A;  4RTT A;  3ZBD A;  4LUE A;  4C92 C;  1SF9 A;  2K9G A;  4M78 B;  4XTU A;  5IHI A;  2CKK A;  1MV3 A;  3JB9 D;  1VQ7 T;  1R0B G;  4E7I A;  1PKT A;  3QO3 A;  3QSU A;  3VS4 A;  2LVM A;  2DA9 A;  1K4U S;  1VQ5 Q;  1BKB A;  1SRM A;  3CCQ A;  1O75 A;  1QWE A;  1SSF A;  2WSC E;  5IHK A;  3NFC A;  2RQW A;  2ZAE A;  2QTV A;  3OYI A;  3PVL A;  1K73 C;  5GAN h;  2RK1 A;  1UGQ B;  4HT8 A;  3CC2 A;  3NMZ C;  3CCM A;  1YJN A;  3LWH A;  1G5V A;  2RJD A;  3CMA A;  2NLU A;  2QEX A;  3NGP A;  3MP8 A;  2NYS A;  1PG5 B;  5KYW B;  3H8Z A;  4Y91 A;  4MZM A;  4C8Q G;  2XDB A;  1MMN A;  3CBM A;  3VV0 A;  2KNB B;  4LDX A;  4J9F A;  2YRD A;  2ZGW A;  4ESR A;  4JUV A;  3EGD B;  1CKB A;  2KEA A;  5CQY A;  3O8V A;  1QWF A;  1VQ7 Q;  2YDL A;  4M78 G;  3THK A;  2M1H A;  4OMN A;  3DKM A;  1RI9 A;  3S3M A;  4C8Q A;  4ME7 A;  1U5S A;  2RO0 A;  4BE0 A;  1GFD A;  1D0Z A;  2LX9 A;  1M8V A;  2F2V A;  3M9Q A;  5LJ3 e;  2XMF A;  2DJZ A;  4B6M A;  2PZ1 A;  3J7A F;  4C5I A;  4NL2 A;  1UFF A;  2BZX A;  3QG1 A;  4M78 A;  4EPC A;  2KYM A;  4D6W A;  5GMK h;  2QQA A;  1Q86 C;  3AT1 B;  1VA7 A;  3HL8 A;  2LP5 A;  3FDR A;  3EG0 A;  3OYD A;  1C6V X;  3OSV A;  1Q82 R;  3HTR A;  2O4X B;  5CAI A;  4JRI A;  1HK9 A;  2YHT A;  2Y4X A;  1OUL A;  2PVO B;  1M8M A;  4RTW A;  1TUD A;  1OOT A;  4JJB A;  3OQ5 A;  1UGS B;  1KC8 R;  3FC3 A;  1UEB A;  4DQ2 A;  1NEG A;  3QZ9 B;  2I0N A;  1B3Q A;  2FYK A;  2XKO C;  3BFM A;  4M7A F;  1YHQ T;  1YJW T;  4QW2 A;  3MPU B;  4EMG A;  4JLG A;  3CPW A;  2VC8 A;  3G6E A;  3H6Z A;  2JTE A;  2HNI A;  2XHC A;  3FJP A;  5KYW A;  4Z8A A;  2HCK A;  4JLI A;  1VQK T;  1VQP T;  4M7D B;  2DTI A;  2JVV A;  3LGF A;  3EGD A;  2FZC B;  1Y07 A;  1AWW A;  4Y28 E;  2KI7 A;  3ME9 A;  3CCS T;  2RH2 A;  4QT7 A;  5DM7 R;  1X43 A;  2KXD A;  1WHM A;  1MMA A;  5FLX E;  2L3S A;  1T3S A;  3VYH B;  3CCJ A;  1OYX A;  3LGL A;  5CO7 A;  1K0S A;  3CXC A;  2RI3 A;  2JN0 A;  1TUC A;  4RKU E;  3RKY A;  2HEQ A;  3I56 T;  1K8A C;  3A8L B;  3OMC A;  1X6O A;  1MND A;  1MMD A;  1G83 A;  2AK5 A;  1YHQ Q;  1BYM A;  4E7S A;  2E5Q A;  4XTV A;  1WLP B;  1ZSZ B;  1SRL A;  3QUI A;  1QVP A;  1OPL A;  1N6A A;  1BCM A;  2O4X A;  5IH2 A;  4XU3 A;  3SD4 A;  2HBP A;  1M1K R;  1VQK Q;  4M77 C;  4X9C A;  1VQP Q;  3KUF A;  4J83 A;  5LJ5 h;  4AFS C;  5EC7 A;  1NLO C;  3SFM A;  4FT2 A;  4M7D G;  3EH1 A;  1PKS A;  3FIF A;  1VQ9 A;  1BBZ A;  1KHC A;  3PVQ A;  1KSW A;  1VOM A;  1Y57 A;  2H8H A;  3CC4 T;  2ATC B;  4HVU A;  4E7H A;  2D1X A;  2AIR B;  3UAT A;  3S3O A;  1PNJ A;  2E12 A;  2FRW A;  5FU7 B;  2COY A;  2QTX A;  5EG2 A;  2EQI A;  5FRO A;  2QGG A;  4HCZ A;  4M7D A;  1E6G A;  2PNI A;  1ZA2 B;  3I56 Q;  1MHN A;  4OB3 B;  1TTH B;  1LPL A;  1WHG A;  2E70 A;  1W70 A;  2EWN A;  2JTF A;  4IUQ A;  1Z9Z A;  2MCN A;  2X35 A;  4F7U F;  2R5M A;  2XK0 A;  3EG3 A;  4RMO A;  3ZEH A;  2YSQ A;  1UUE A;  3HRS A;  1QW1 A;  2LNH B;  2L3P A;  1PD0 A;  4E6R A;  3CC7 T;  1PRL C;  1BI0 A;  1BI1 A;  4HVW A;  1YCS B;  4Z88 A;  4OMM A;  4AG1 C;  1PRM C;  2X3X D;  2GGR A;  2XIC A;  4E7K A;  4MMK A;  2F2W A;  3CC4 Q;  2JM9 A;  2LJ3 A;  2F1L A;  2DL3 A;  2JS0 A;  1ZSZ A;  2J6O A;  2OTL Q;  1N9R A;  4M78 F;  5M9O A;  4OMQ A;  1YWO A;  1M2V B;  3V8L A;  3KXT A;  3VS0 A;  4EIK A;  2FB7 A;  4FYV B;  4PLL A;  2JNG A;  4J9I A;  3PMI A;  2DEQ A;  3V7R A;  2EJG A;  3R6O A;  3S6W A;  2RB6 A;  3JCM P;  2JW4 A;  1EFN A;  4DBF A;  4MDW A;  2HQH A;  1NM7 A;  1E6H A;  4IIO A;  1VQL T;  1RLP C;  2L8D A;  2ZPF B;  1Q7Y R;  1TU0 B;  1OU8 A;  3GLX A;  3OYC A;  2RK2 A;  3X20 B;  4XTW A;  1IHW A;  4M7A E;  4C5H A;  2EQU A;  3HRU A;  2SEM A;  8AT1 B;  2HSE B;  2DL5 A;  3GOX A;  1VQM T;  1FX7 A;  1M3B A;  4BY6 B;  4BDZ A;  3FB9 A;  3M53 A;  3G4S T;  1CKA A;  4LE9 A;  3P8D A;  2FPF A;  3O5Z A;  4A4F A;  5LJ3 j;  1WZO A;  3X25 B;  1UDL A;  2EIF A;  4ZGD B;  1V76 A;  3CPF A;  2O01 E;  2MK5 A;  2ROL A;  4JJD A;  1M3C A;  2O9S A;  3CCE A;  3VS5 A;  4P5N A;  2RQV A;  4RTY A;  4PFO A;  3OBW A;  3M5A A;  1MMG A;  5KYX B;  2ZPB B;  3JAM E;  2DL8 A;  1FYN A;  4XTX A;  3H0H A;  1RL2 A;  1Q82 C;  4PFZ A;  5CK9 A;  1VQO Q;  1VQL Q;  2KRM A;  3KFV A;  2BZY A;  4OMF B;  2DKG A;  3EHR A;  1M2V A;  1B34 B;  1ZX6 A;  3PNW C;  1KC8 C;  3A8M B;  5GAN 2;  2EKH A;  2D9T A;  5GAN g;  2BIV A;  1VQM Q;  5D6X A;  2PQW A;  3M4Y A;  2DX1 A;  3VUZ A;  3G4S Q;  2E6N A;  4JJN K;  2RI5 A;  4QKU A;  1K9M U;  3QKJ A;  4E7Z A;  4HXJ A;  2QGF B;  2QI2 A;  1OEB A;  4K11 A;  2KR3 A;  3BY7 A;  2X4X A;  3OW2 P;  1BU1 A;  2FPE A;  4ANJ A;  4JJC A;  4MDX A;  2KRN A;  4FL6 A;  4L5G A;  3HKS A;  2EPD A;  4M7D F;  1KIK A;  2KK4 A;  1U3O A;  3IQL A;  1WJS A;  4LDU A;  5KE3 A;  2YUN A;  2LT1 A;  3JCM b;  2DJQ A;  2M51 A;  1I07 A;  1UTI A;  5GAO n;  2C0I A;  3L2Q A;  2ED1 A;  2CZ6 B;  2EGE A;  2VKN A;  1M27 C;  3G71 T;  1GXI E;  1JXM A;  2MOX A;  5GAN 3;  1RAD B;  5J26 A;  1BI3 A;  1X6B A;  5KYX A;  1I1J A;  1UGV A;  3L1A A;  3LX7 A;  1KK7 A;  2PU9 B;  2OTJ Q;  3CEY A;  2XU8 A;  3CPW S;  4C0F A;  1G3Y A;  2RHI A;  4C8Q E;  1N8R U;  3A98 A;  1M1K C;  1VQ5 A;  3A1P A;  3JSC A;  1RAB B;  5DLO A;  1LOJ A;  1PM3 A;  1QLY A;  3V7C A;  2K6D A;  2LX7 A;  1Z9Q A;  3H41 A;  4M78 E;  3EGU A;  3UWN A;  1NZ9 A;  2AZS A;  4BI3 A;  2CYZ B;  1RAE B;  1K8A R;  1VYV A;  2MIO A;  3ZFJ A;  3HRT A;  3GF5 A;  1NPP A;  4PJO B;  4DA4 A;  3CBO A;  3CXC S;  4OMO A;  2R5A A;  4PJO C;  3G71 Q;  1JBM A;  2P0K A;  5CIU A;  2ZZD A;  3E1S A;  2ZPG B;  1TOV A;  3OYL A;  2H3J A;  1VQ7 A;  1Q81 U;  4XU0 A;  1X27 A;  1RAF B;  2CP0 A;  1WHH A;  4M75 B;  1KD1 U;  3L2W A;  4LDY A;  1BI2 A;  2KBT A;  3M55 A;  1H64 1;  2P0P A;  3JB9 H;  1W4S A;  3EG2 A;  4LN2 A;  4M75 C;  2LJ1 A;  3J80 E;  1GCQ C;  3M4G A;  1K73 U;  3DB3 A;  3OW2 A;  1W2B A;  2DXU A;  4IIM A;  1XQH A;  3PE0 A;  4R55 A;  2L3R A;  4Y92 A;  2EYX A;  5IAY A;  5IXB A;  1JB0 E;  2RJE A;  2FHD A;  3HHT B;  1MUZ A;  1M1G A;  5HK3 A;  5LJ5 g;  4OP0 A;  4JPB W;  2X51 A;  4RCB A;  1QCN A;  4DOW A;  1Q95 G;  2M9U A;  3JCM Q;  4HCC A;  2PUO B;  2GQV A;  3VS6 A;  2FL7 A;  2OI3 A;  1UJY A;  1RLQ C;  2CDT A;  2V8I A;  3EFS A;  4C92 B;  2LQW A;  4ZNX A;  3MP6 A;  3RES A;  2KVQ G;  4MZT A;  1UEC A;  1Q7Y C;  4PK4 A;  4E2F B;  5FU6 B;  1XOV A;  1YIJ T;  1D0X A;  2GNC A;  2EVR A;  3TSW A;  1Y7X A;  5FU6 C;  6AT1 B;  5I11 A;  3CD6 T;  3V7S A;  3MO8 A;  1KQ1 A;  2K7A A;  4B9W A;  1AT1 B;  2Y90 A;  3E2U A;  1VYU A;  4RG8 A;  5GJW B;  1JJ2 A;  1WXT A;  5J39 A;  2AKL A;  2CZ0 B;  5GAM h;  2EKO A;  5I2M A;  4AG2 C;  3TCJ A;  3CCR T;  2VGM A;  1QQJ A;  4LD6 A;  4M7D E;  5KCH A;  3DLL A;  2MF2 A;  3EG1 A;  4R56 A;  3EGX B;  3G7Z A;  2E6Z A;  1YHQ A;  3OB9 A;  2RHX A;  4N4G A;  3PIO A;  2RF0 A;  4J6X A;  3RMQ A;  3I55 T;  1OZ2 A;  2QQR A;  2QQ9 A;  1VQK A;  1VQP A;  1YIT T;  1YIJ Q;  2ECZ A;  4XK8 E;  3ER0 A;  2Z0W A;  3CCU T;  1ZQ1 A;  2V8K A;  1C1A A;  3JCM h;  3VJP A;  1WIE A;  4F16 A;  3P8B B;  4ZGJ B;  3CD6 Q;  4EMH A;  1JEG A;  5GAO r;  5KH6 A;  2EAY A;  5GMK j;  4C92 A;  1ZUK A;  2YRC A;  2EYZ A;  5A0G A;  3L2U A;  1YJ9 T;  2LCL A;  2DZ9 A;  1YI2 T;  1IRE B;  1QKX A;  4X9D A;  3INZ A;  4LUD A;  3CCR Q;  3OYE A;  2MI6 A;  4DBH A;  3I56 A;  1WI7 A;  1TH7 A;  2IIM A;  4OMP A;  5LJ3 f;  3MJX A;  2LRQ A;  5CVI A;  3VKI A;  1N27 A;  4AMC A;  4HKE A;  3SEM A;  1U1T A;  3LYI A;  3V8K A;  1QVG P;  3QBY A;  1QVF P;  1UJ0 A;  3I55 Q;  3FJ5 A;  3I9Q A;  2EJF A;  3UA6 A;  4IUT A;  2XG8 D;  1YIT Q;  2EW3 A;  2MWP A;  4PJL A;  3TQ7 P;  3PIP A;  4KUL A;  4J9B A;  3AHU A;  1JO8 A;  3CC2 T;  2R58 A;  3RKW A;  3EGX A;  5GMK m;  3CC4 A;  2CRE A;  4KH0 B;  3SB2 A;  2HL5 C;  2CSI A;  2DMO A;  2X9H A;  2DBK A;  5LJ3 d;  2DIQ A;  2OTL A;  2KY9 A;  1PWT A;  1EIF A;  1YI2 Q;  2A28 A;  4XTZ A;  2JZ2 A;  1P92 A;  1I8F A;  2JM8 A;  3OYM A;  4BAC A;  1VQ6 T;  4VUB A;  3TSZ A;  2QA4 T;  2OAW A;  2L2P A;  2RI2 A;  4FSS A;  1U06 A;  1HJD A;  1R77 A;  1GRI A;  3PMT A;  2PVG B;  4E7L A;  2DLP A;  1YJW Q;  4OGC A;  4QQG A;  2V1Q A;  1D3B B;  4C5G A;  2EBP A;  2QQB A;  3LWI A;  3FEO A;  1SG5 A;  1S72 T;  4M77 B;  2E65 A;  3C12 A;  2AZV A;  2F5T X;  4FW1 A;  4DEX A;  3OS0 A;  1NJI U;  2RM4 A;  2ZPH B;  3C0C A;  2M16 A;  3EAE A;  5CKB A;  2VB6 A;  1WHL A;  4N4I A;  1LNX A;  3X24 B;  3CCS Q;  2J06 A;  2A3L A;  1UB4 A;  1BK2 A;  1LVK A;  2IG0 A;  1VQ6 Q;  2GCX A;  3I5R A;  2DF6 A;  2E64 A;  2QA4 Q;  3M59 A;  2PTK A;  1RAA B;  3HFO A;  4AFZ C;  2P4T A;  4WTO B;  1FMV A;  1TXQ A;  3A8H B;  2GTO A;  3RER A;  4RTV A;  2K2V A;  3G6E T;  3L2R A;  1VQO A;  1JU5 C;  1VQL A;  2CGH A;  1K9M R;  2PUK B;  3SWN C;  5FWC A;  2HQE A;  1GL5 A;  2YLC A;  3FRN A;  1S72 Q;  1ZHI A;  3JB9 G;  4BE1 A;  2VWF A;  1VQM A;  1KQS S;  4M77 G;  5HKC A;  3G4S A;  2XID A;  2K3B A;  3ZL7 C;  4A4H A;  4C8Q F;  1M9S A;  2C0O A;  4M7A D;  3RIR A;  1OX8 A;  3PGG A;  3BDU A;  1OX9 A;  2DD4 A;  2DET A;  5GAO m;  1ZUY A;  3OYN A;  1M2O A;  1HXD A;  4DEY A;  1FWZ A;  4M77 A;  3J81 E;  1K76 A;  3CME T;  1W2B S;  2LQ8 A;  1IZ6 A;  2K4Y A;  5C0M A;  4PJJ A;  1UHF A;  1SKU B;  3EH2 A;  1RAI B;  2P0Q A;  1Q82 U;  4HCB A;  1NPR A;  2JXB A;  4CC2 A;  3NTK A;  1WDX A;  3REA B;  3RBB B;  3QDR B;  4CC7 A;  3I35 A;  4XTY A;  2FEI A;  1E7O A;  3LW5 E;  4GY5 A;  2G3R A;  1OQK A;  1G3T A;  2SRC A;  3CC7 Q;  4O5V A;  2B8A A;  2CS7 A;  2RD1 A;  1WXB A;  1QKW A;  3E9G A;  2OTJ A;  4MZP A;  4IUV A;  2DD5 A;  5A0L A;  2RJF A;  1ZUU A;  1AWX A;  1WPY A;  1VQN T;  3EFO B;  2VYT A;  5HY6 A;  4JDS A;  2VV5 A;  3QYH B;  3CME Q;  4A4K A;  1KJW A;  1PHT A;  2A37 A;  1BIB A;  5DY9 A;  1DJ7 B;  1GCP A;  1HSQ A;  5CKE A;  1Q81 R;  3RR6 A;  1JJ2 S;  1AZE A;  2DL4 A;  1KD1 R;  2COW A;  4Z02 A;  5CKD A;  4PKC C;  3M0P A;  3HSB A;  1X2Q A;  3JRZ A;  1OU9 A;  3A8G B;  4ZTF A;  1IO6 A;  4KGX B;  3G71 A;  4RTX A;  3FLG A;  4DBQ A;  4OB0 B;  1N9S A;  4XAX B;  1QP3 A;  1OI1 A;  5KYN A;  2R57 A;  4J9D A;  5LJ3 h; 
#chains in the Genus database with same CATH homology
 1RI0 A;  3OBY A;  4EMK C;  5GAN 7;  3TU4 K;  2EJ9 A;  2LX9 A;  1M8V A;  4M75 B;  1KD1 U;  3M9Q A;  1WJR A;  3L2W A;  5LJ3 e;  4LDY A;  2OTL T;  1WQ7 A;  4IKF A;  1BI2 A;  3M55 A;  2DJZ A;  5GAM g;  1H64 1;  2P0P A;  5KE2 A;  3JB9 H;  1W4S A;  3J7A F;  4M75 C;  4C5I A;  1G3W A;  3J80 E;  4NL2 A;  2EQM A;  4J5Y A;  3M4G A;  2K5F A;  3C94 A;  3N5B B;  3QG1 A;  4M78 A;  5FU7 C;  4BB7 A;  4D6W A;  4EPC A;  4BDY A;  4C0D C;  5GMK h;  3JCM X;  3DB3 A;  3NTH A;  1BIA A;  2MMP A;  2QQA A;  3PFS A;  2DXU A;  4BI4 A;  3OW2 A;  1W2B A;  1Q86 C;  1VQN A;  3X26 B;  3HL8 A;  3FDR A;  5GMK e;  1XQH A;  2RJC A;  2DTO A;  4R55 A;  2L3R A;  3CCJ T;  4LD9 K;  3OYD A;  3OSV A;  4C8Q D;  5IAY A;  2BUD A;  2O4X B;  4FIB A;  4HA8 A;  2LTO A;  4JRI A;  1HK9 A;  2AHJ B;  2Y4X A;  2YHT A;  4N4H A;  5DLQ E;  3URG A;  1JB0 E;  5GAN 4;  2PVO B;  2RJE A;  4C92 F;  2FHD A;  1M90 U;  2I2L A;  1VUB A;  2VXF A;  3HHT B;  2E41 A;  1KHI A;  1M1G A;  4EDU A;  3OQ5 A;  1UGS B;  5HK3 A;  3QJ6 A;  2ZPI B;  1D3B A;  1I4K 1;  1UEB A;  4KUI A;  4OP0 A;  3UDC A;  4DQ2 A;  3FC3 A;  3MEW A;  4RCB A;  3WVD B;  4M75 E;  2X4J A;  3QZ9 B;  4DOW A;  2M9U A;  3OW2 S;  2FYK A;  2XKO C;  3BFM A;  4M78 D;  3JCM Q;  3JCM g;  4HCC A;  4M7A F;  2PUO B;  1YHQ T;  2RHZ A;  2GQV A;  2FL7 A;  5GAO q;  1YJW T;  4JS4 A;  4QW2 A;  1M4Z A;  2LT4 A;  2V8I A;  3EFS A;  3LLR A;  4C92 B;  4JLG A;  4EMG A;  1VQ4 T;  3CPW A;  1I81 A;  3OY9 A;  1U8R A;  4C0G A;  2VC8 A;  3G6E A;  3H6Z A;  1X01 A;  2HNI A;  2XHC A;  3FJP A;  3MP6 A;  3RES A;  1NJI C;  2KVQ G;  2HQX A;  4JLI A;  1VQK T;  4MZT A;  1VQP T;  1KC8 U;  4M7D B;  1Q7Y C;  2DTI A;  2LQK A;  2E1H A;  3MHX A;  2KDS A;  5FU6 B;  1XOV A;  3UT1 A;  2JVV A;  1YIJ T;  4FM4 B;  2DAQ A;  4PJO E;  1VQ9 T;  3LGF A;  4PL6 A;  2F5K A;  1Y7X A;  4FT4 A;  5IN1 A;  1Y07 A;  5FU6 C;  4M7A C;  4Y28 E;  3ME9 A;  3CCS T;  2RH2 A;  3V7S A;  5CKF A;  3CD6 T;  1Y96 A;  1VIE A;  5DM7 R;  2DXB A;  2HD0 A;  3MO8 A;  3TEE A;  1KQ1 A;  1YCY A;  5FLX E;  3JB9 I;  3VYH B;  3SWN A;  4B9W A;  2Y90 A;  4II1 A;  3JB9 F;  3CCJ A;  1B34 A;  3JB9 J;  4RG8 A;  1OYX A;  1JJ2 A;  5L8R E;  3LGL A;  4M77 F;  5CO7 A;  5J39 A;  4C92 E;  2CZ0 B;  3JCM c;  5GAM h;  2RI3 A;  3CXC A;  2EKO A;  1VQO T;  2JN0 A;  5I2M A;  4RKU E;  3TCJ A;  3CCR T;  2VGM A;  3RKY A;  3I56 T;  5GAN e;  4PJO D;  1K8A C;  3A8L B;  3OMC A;  4J6W A;  1X6O A;  4LD6 A;  5GAM e;  3OYG A;  3JCM W;  4XU2 A;  3CCV T;  3JCM J;  4M7D E;  5KCH A;  4TVR A;  2L89 A;  2F69 A;  4N0A C;  2YLB A;  2MF2 A;  5AYF A;  4JRQ A;  4HT9 A;  4R56 A;  1BYM A;  3G7Z A;  2CZ1 B;  4OVA A;  3S3N A;  3MEA A;  2E5Q A;  2E6Z A;  2K5L A;  3HFN A;  4OF1 A;  1YHQ A;  3NTI A;  4XTV A;  4B9X A;  4BE2 A;  3OB9 A;  3OYB A;  3QUI A;  5D6W A;  1QVP A;  4ZTJ A;  2RHX A;  4N4G A;  3C95 A;  1N6A A;  4BUG A;  3PIO A;  1VQ4 A;  2O4X A;  4J6X A;  1O9S A;  3RMQ A;  3I55 T;  5GAN f;  4XU3 A;  3SD4 A;  2HBP A;  1OZ2 A;  5GAM f;  2QQR A;  4M77 C;  4X9C A;  3M54 A;  2QQ9 A;  3KUF A;  4J83 A;  5LJ5 h;  1K9M C;  4BY6 C;  4M75 D;  1VQ8 T;  1VQK A;  1VQP A;  1Q7Y U;  5GAO p;  1YIT T;  3SFM A;  4FT2 A;  2V8J A;  3ER0 A;  4XK8 E;  4M7D G;  3HPW A;  1ZQ1 A;  2V8K A;  3JCM h;  3CCU T;  1YIJ A;  4A54 A;  4EMK B;  3FIF A;  1KG1 A;  4A53 A;  3PTA A;  1VQ9 A;  3VJP A;  2KMT A;  3P8B B;  3QII A;  1KHC A;  4ZGJ B;  4EMH A;  3CC4 T;  3JCM e;  4JRK A;  5LL6 S;  4E7H A;  3CD6 A;  4XU1 A;  5GAO r;  1AHJ B;  5KH6 A;  2EAY A;  5GMK j;  4C92 A;  3BDL A;  3S3O A;  5D6Y A;  2E12 A;  1PSF A;  3MET A;  4OB1 B;  1M1K U;  5FU7 B;  5A0G A;  3L2U A;  1YJ9 T;  2QTX A;  4C0D B;  5EG2 A;  5CQX A;  5FRO A;  2LCL A;  3VUB A;  2WAC A;  3V8J A;  4IUP A;  5A2Q E;  4HCZ A;  4M7D A;  2DZ9 A;  1YI2 T;  1IRE B;  4X9D A;  3INZ A;  3QPH A;  1MHN A;  3OYE A;  2OTJ A;  1UGR B;  2MAM A;  2DO3 A;  2MI6 A;  4OB3 B;  3JCM f;  4QVD A;  5GAN d;  4JRP A;  3BW1 A;  3CCR A;  3I56 A;  2E70 A;  1G3S A;  2EWN A;  2JTF A;  3MP1 A;  3QHS A;  3QJY A;  4IUQ A;  5GAM d;  3CCV A;  2BKD N;  1TH7 A;  2X35 A;  4IUR A;  5LJ3 f;  4F7U F;  2LRQ A;  4OB2 B;  2R5M A;  5CVI A;  3T9N A;  5CAI A;  3VKI A;  1N27 A;  4HKE A;  1QVG A;  2XK0 A;  1U1T A;  2IVW A;  4RMO A;  3LYI A;  3ZEH A;  2EFI A;  5I2S A;  4FSX A;  5LJ5 g;  3JCM V;  3RMS A;  3V8K A;  4C92 D;  1JRI A;  3HRS A;  3M58 A;  1QW1 A;  3QBY A;  3CCL T;  2XI9 A;  1QP2 A;  3CC7 T;  2EJF A;  4PJO G;  4IUT A;  3I55 A;  1BI0 A;  2OTJ T;  3F70 A;  1BI1 A;  2KSS A;  2XG8 D;  4M7D D;  2LCC A;  2OAU A;  2MWP A;  4O6J A;  1VQ8 A;  2XDP A;  3TRE A;  4NOY A;  4DOV A;  4F7U B;  1OZ3 A;  2CZ7 B;  2QDY B;  1YIT A;  5J3B A;  3PIP A;  1WQW A;  2C06 A;  4L6V 5;  4KUL A;  5A0D A;  2DZC A;  3GPL A;  3AHU A;  2XIC A;  4E7K A;  4MMK A;  3CC2 T;  2R58 A;  3RKW A;  3RKX A;  3OSS C;  3C4S A;  4CI0 C;  4LDW A;  5GMK m;  3JCM d;  2GFU A;  3OA6 A;  4QVZ A;  3CC4 A;  3OYF A;  4Q5W A;  3SB2 A;  1N9R A;  4M78 F;  2JOY A;  3MEU A;  4J7F A;  2VXE A;  1WJQ A;  5M9O A;  5GMK l;  4PJO A;  5LJ3 d;  2DIQ A;  4M7A B;  5GAN 5;  2OTL A;  2KY9 A;  4M75 G;  1ZBX A;  3V8L A;  3KXT A;  1YJ9 A;  1EIF A;  3CCE T;  2FB7 A;  4XTZ A;  3E9F A;  4C8Q C;  2JZ2 A;  4PLL A;  5GAN j;  1P92 A;  1YI2 A;  2JNG A;  1I8F A;  1Y71 A;  1M5Q 1;  3PMI A;  5GAM j;  2DEQ A;  3V7R A;  3OYM A;  4BAC A;  2DTH A;  2DVE A;  1U1S A;  3UPU A;  1Q86 U;  1VQ6 T;  4VUB A;  4EMK A;  4KT0 E;  2A7Y A;  2EJG A;  3R6O A;  3S6W A;  4J6Y A;  2RB6 A;  2QA4 T;  3JCM P;  4F7U E;  1X75 C;  4ZN1 A;  4MML A;  3OYY A;  2RI2 A;  3OMG A;  4MDW A;  2EQJ A;  2LDM A;  4M75 A;  4M78 C;  4M77 D;  1V29 B;  1VQL T;  3DLM A;  1Q81 C;  2L8D A;  5GAN 8;  2ZPF B;  3PMT A;  1XTD A;  4KBM B;  2PVG B;  3CCL A;  4E7L A;  3GLX A;  3OYC A;  1M1F A;  2RK2 A;  2DXC A;  3X20 B;  1KD1 C;  1NE8 A;  3HP9 A;  4OGE A;  4XTW A;  4M7A E;  4C5H A;  2EQU A;  3HRU A;  3P8H A;  4V2S A;  4OGC A;  2RHY A;  4QQG A;  4C5G A;  1D3B B;  5KCO A;  2QQB A;  3GOX A;  4NL3 A;  3LWI A;  3FEO A;  1YJW A;  1KQ2 A;  1VQM T;  4XQ3 A;  1FX7 A;  1S72 T;  4M77 B;  2E65 A;  3C12 A;  2F5T X;  4F7U G;  3GIB A;  4BY6 B;  1LJO A;  4BDZ A;  3FB9 A;  1MGQ A;  3M53 A;  4CRI A;  3OYJ A;  1PSE A;  1FXX A;  2QXF A;  4C92 G;  3G4S T;  3OS0 A;  3PT9 A;  1NJI U;  3P8D A;  2RM4 A;  2YRV A;  2ZPH B;  1YBY A;  2LC4 A;  4A4F A;  5LJ3 j;  2RA2 A;  3QYG B;  3WVE B;  2M16 A;  3EAE A;  3X25 B;  3MEV A;  5CR2 A;  2EIF A;  5LJ5 e;  5CKB A;  4ZGD B;  3CPF A;  2O01 E;  2JUF A;  3VU3 C;  3MCA B;  4N4I A;  1LNX A;  3M56 A;  3X24 B;  1M90 C;  4M7A G;  3CCE A;  2A3L A;  1UB4 A;  4PNO A;  2IG0 A;  4RG2 A;  4BD3 A;  1R8O B;  4P5N A;  4F7U A;  4ZN3 A;  3OYA A;  3CCS A;  2GCX A;  4X34 A;  2VUB A;  3OBW A;  3M5A A;  2E64 A;  2ZPB B;  3GNG A;  3M59 A;  1VQ6 A;  3JAM E;  1XNI A;  3HFO A;  2P4T A;  4XTX A;  2QA4 A;  5LJ5 f;  3E19 A;  3OS2 A;  2PVD B;  3A5Z B;  3A8H B;  1RL2 A;  5I21 A;  4M77 E;  1Q82 C;  1KQS A;  5CK9 A;  3RER A;  3A8O B;  2K2V A;  3M57 A;  4NS5 A;  4OMF B;  2DKG A;  3G6E T;  3L2R A;  1H3Z A;  1VQO A;  4M7A A;  5GMK i;  2DK3 A;  1VQL A;  3CBP A;  2CGH A;  1B34 B;  1K8A U;  4QQ6 A;  3PNW C;  2PUK B;  1KC8 C;  3A8M B;  4J7I A;  5CCA A;  3SWN C;  3X28 B;  2QQS A;  5GAN 2;  2HQE A;  2D9T A;  4KUD K;  2Y4Y A;  4J8O A;  2LNV A;  5GAN g;  2RHU A;  3ASK A;  2YLC A;  2BIV A;  3FRN A;  5CKH A;  2VGN A;  1ZHI A;  5D6X A;  2PQW A;  4YTL A;  3JB9 G;  3M4Y A;  4QVC A;  4BE1 A;  2JTM A;  1VQM A;  1S72 A;  3VUZ A;  1KQS S;  2E6N A;  4PLI A;  4M77 G;  4JJN K;  2RI5 A;  5HKC A;  2KQW A;  3G4S A;  3CCQ T;  1VIF A;  4C5E A;  2XID A;  4A4H A;  1N8R C;  1VQ5 T;  2D6F A;  4C8Q F;  1M9S A;  5FRN A;  2K3Y A;  1QVG S;  1K9M U;  3QKJ A;  4N0A A;  1QVF S;  4LDV A;  3GP8 A;  5IT9 E;  4IUU A;  4M7A D;  2QI2 A;  5C6S A;  3QZ5 B;  3RIR A;  3PGG A;  5LJ5 d;  2MWO A;  2ZCF B;  2ZPE B;  3BDU A;  4E7J A;  3BY7 A;  3CCU A;  2DD4 A;  2X4X A;  3CCM T;  1WNL A;  1YJN T;  2XD0 A;  2K5I A;  4WF2 A;  1UGP B;  3CMA T;  4ELZ C;  2QEX T;  4MDX A;  5GAO m;  2KAF A;  4A4G A;  3OYN A;  3EFR A;  3DB4 A;  4FL6 A;  5HK0 A;  3KBG A;  4L5G A;  3HKS A;  4BI8 B;  1HXD A;  1FWZ A;  4M7D F;  2KK4 A;  4FU6 A;  4M77 A;  3J81 E;  4ATO A;  2FVU A;  5GAO l;  2GF7 A;  3CME T;  1W2B S;  2LQ8 A;  1IZ6 A;  2X4Y A;  4C8Q B;  2K4Y A;  5C0M A;  2K57 A;  1WJS A;  4LDU A;  5KE3 A;  2LT1 A;  4UC4 A;  2DPP B;  2P0Q A;  1Q82 U;  4HCB A;  3JCM b;  4E47 A;  5LJ3 g;  1NPR A;  2X4W A;  2GFA A;  2DXT A;  2HAX A;  3NTK A;  5GAO n;  3OYH A;  3ZBD A;  3L2Q A;  3QDR B;  4C92 C;  2CZ6 B;  4A4E A;  4M78 B;  4XTU A;  4XTY A;  2M0O A;  2CKK A;  4RCC A;  3G71 T;  1GXI E;  3JB9 D;  5GAN 3;  2EYQ A;  1VQ7 T;  5J26 A;  1BI3 A;  3LW5 E;  1WGS A;  4GY5 A;  4E7I A;  2G3R A;  4M7D C;  3QO3 A;  3QSU A;  2DIG A;  3GNF B;  2LVM A;  1G3T A;  3L1A A;  3LX7 A;  3OS5 A;  2PU9 B;  3Q1J A;  3CEY A;  2XU8 A;  2B8A A;  2CS7 A;  2RD1 A;  4O5V A;  4C0F A;  3CPW S;  3L2V A;  3CC7 A;  1BKB A;  1G3Y A;  3CCQ A;  2RHI A;  1O75 A;  3E9G A;  3L2Z A;  1SSF A;  2WSC E;  4C8Q E;  5LJ5 j;  4JS5 A;  1N8R U;  1K73 U;  1M1K C;  1VQ5 A;  3NFC A;  3JSC A;  4MZP A;  4IUV A;  2DD5 A;  2K3X A;  5DLO A;  1LOJ A;  3OYI A;  1K73 C;  5GAN h;  2RK1 A;  5A0L A;  1UGQ B;  4PJO F;  2RJF A;  3SDZ A;  4HT8 A;  1WPY A;  3CC2 A;  3CCM A;  1YJN A;  3V7C A;  3LWH A;  1VQN T;  1G5V A;  2RJD A;  2VYT A;  3CMA A;  2NLU A;  5HY6 A;  2QEX A;  3MP8 A;  2D0Q B;  4JDS A;  2VV5 A;  3QYH B;  1I5L A;  4M78 E;  5GAN 6;  3VYG A;  3UWN A;  2XDD A;  4A4K A;  1BIB A;  3CME A;  5DY9 A;  1NZ9 A;  4C0Z A;  4L59 A;  4BI3 A;  1DJ7 B;  2CYZ B;  3H8Z A;  5CKE A;  4MZM A;  4Y91 A;  4C8Q G;  4QQD A;  2XDB A;  3CBM A;  3OS1 A;  3ZFJ A;  4ZGE B;  3HRT A;  3OYK A;  3GF5 A;  1NPP A;  3VV0 A;  3WXM B;  4DA4 A;  1JJ2 S;  4PJO B;  3CBO A;  3CXC S;  2E10 A;  4LDX A;  2WSE E;  2ZGW A;  4Z02 A;  4M75 F;  5CKD A;  3L42 A;  4GLK A;  4PKC C;  4JUV A;  2R5A A;  3HSB A;  4PJO C;  4ELY C;  2L5Q A;  3JRZ A;  3LH0 A;  5CQY A;  3O8V A;  1JBM A;  5FRM A;  2P0K A;  3A8G B;  2ZZD A;  3E1S A;  2ZPG B;  5CIU A;  1Y96 B;  3OYL A;  4ZTF A;  2H3J A;  3G71 A;  4M78 G;  3FLG A;  3RUX A;  1VQ7 A;  2M1H A;  2EQK A;  2WSF E;  4OB0 B;  3DKM A;  3SWN B;  3S3M A;  1N9S A;  4C8Q A;  4ME7 A;  4XAX B;  1QP3 A;  1Q81 U;  1OI1 A;  4XU0 A;  2R57 A;  3QXE B;  1QVF A;  3DLL A;  5LJ3 h;  2RO0 A;  4BE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...