1M1FA

Kid toxin protein from e.coli plasmid r1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
107
Chain Sequence
MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of the Kid toxin protein from E.coli plasmid R1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Kid toxin protein
total genus 26
structure length 107
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1fA00
4OF1A 5CO7A 3JRZA 1X75C 4ME7A 5CKHA 5CKFA 4ELYC 5CR2A 5CKDA 5CCAA 4HKEA 4VUBA 3JSCA 3NFCA 4MZTA 5CK9A 1UB4A 5CKEA 2MF2A 2VUBA 5CQYA 5HKCA 5DLOA 2C06A 4MZPA 3VUBA 3G7ZA 4ELZC 1VUBA 1NE8A 3HPWA 1M1FA 5HK0A 4MZMA 5CKBA 4MDXA 3TCJA 5CQXA 2KMTA 5HK3A
chains in the Genus database with same CATH superfamily
3OYFA 1YJWA 3ME9A 1BKBA 2F1LA 1QVFP 1A0NB 1JJ2P 2BE9B 1K73U 1R77A 3MP1A 1UDLA 2K4YA 1VQ9Q 2NYSA 2XG8D 4JJCA 5FU6C 2O88A 1KQ1A 2EIFA 3X25B 3CCVA 5FLXE 3QJYA 4ME7A 1LVKA 2QGGA 3VS7A 4PJLA 4ESRA 4CRIA 4LN2A 1M9SA 1IREB 2AHJB 4X9CA 1NM7A 3MEWA 2KRSA 2XDPA 1I8FA 2DIGA 5LJ3g 2QQBA 1AWXA 1WHLA 1OOTA 3CCMQ 3D7SB 2AK5A 5EG2A 3M59A 3FJ5A 2W0ZA 3KFVA 3CPWS 1K9AA 4CC4B 4PJOG 3CCUT 2RH2A 5D6WA 4DA4A 1KC8U 3QKJA 1RI0A 2HQEA 3SEMA 1FMKA 4M7DB 1QP3A 3X20B 2CGHA 3I55Q 4JS4A 1WQ7A 4WCIA 1UEBA 2CP3A 1VQNT 1XTDA 1BCMA 3RKYA 3QG1A 4AMCA 3X24B 4MMKA 4MMLA 3CXCA 2QQRA 2LVMA 2YLBA 2OTJA 3CCUA 2FB7A 1M90R 1TUDA 2BKDN 4BB7A 3CCEA 1S72A 1X6GA 1VQOQ 1BK2A 4J6XA 1AT1B 1PRMC 5D6YA 4KH1B 4M7AB 3S3OA 1GBQA 1T0HA 3M0SA 1VQNQ 1MV3A 2K2MA 1TUCA 2HL3A 3PIOA 3M0QA 1QVGA 2W10A 2HEQA 3O5ZA 2DXUA 4C92E 3BE3A 2DAQA 1TOVA 3J80E 1SRLA 1IHWA 3EG1A 2KRMA 2A08A 1VQ7Q 2YXYA 4BI3A 5CR2A 2YUNA 4C8QB 2P0KA 4JJDA 2X4YA 2NUTA 2DFUA 2VB6A 3CCLQ 1BIBA 4M7AF 1N9RA 4R0KA 1NJIC 2BZXA 1VQ8Q 5HK0A 2EFIA 2IPOB 4PLLA 1GCQA 4J7FA 3HSBA 2QASA 4GBQA 5LJ3e 3HKSA 4CC7A 3I56A 3QO3A 2DTHA 2DRKA 1PM3A 1VQ6A 1WPYA 3UATA 2CP7A 2D0QB 1M8MA 1UGPB 4IIOA 3CCJT 4RTZA 5GAN8 3C4SA 3HPWA 1M3AA 2RJCA 2YSQA 4M75F 2FO0A 2DRMA 2EWNA 5KYYB 2MYSA 3FRNA 5CKBA 4M78D 1IO6A 3M57A 1MMGA 1Q81C 1VQMQ 2KRNA 3SD4A 1G5VA 1X75C 2OTLQ 3CCMT 3EGUA 2LX7A 2RNAA 3PFSA 4MZTA 2A37A 4LDVA 1SKUB 3X26B 2D1XA 1T0JA 2EJ9A 1QVGP 5AYFA 1AZGB 4RTYA 4JUVA 2DEUA 2KY9A 1BIAA 1JEGA 6AT1B 3UA6A 1RAFB 3L42A 3BY7A 3THKA 1QVFS 3TEEA 2RQTA 4LDUA 1KC8R 5IXFA 5GMKl 4CC3A 1J3TA 5FWCA 4M7DA 1PNJA 4B9WA 2EW3A 3VS3A 1KIKA 1WDXA 2MF2A 2QEXA 4KUIA 1ZHIA 2A28A 4LXCA 3CMAA 3HRTA 2GCXA 2EAYA 1PKTA 4AG2C 2K3XA 1ZA1B 1N6AA 5CKFA 1QWFA 2KAFA 4BDZA 2LRQA 4Y91A 2HDAA 3CMET 4ZTFA 3H0IA 2LTOA 4QW2A 3TSZA 1VQLT 3J7AF 1Q86U 1VQ7A 3MCAB 2QK0A 1Y57A 3JCMd 2K57A 3HRUA 4E47A 4OB0B 4J6WA 2XU8A 3DB3A 1ZSZC 1N27A 3RESA 2JUFA 1AD5A 1I4K1 1WJQA 1JB0E 2QA4A 2I0NA 1RLQC 1D0XA 5CVIA 4BD3A 1IHVA 3M55A 4XTXA 3V7RA 2DZCA 4IUTA 4C92B 3G6EA 4C5GA 2DERA 2PU9B 3SFMA 2D8JA 1M8VA 2X4XA 3E1SA 1SHGA 5EC7A 4F16A 3VS2A 1HJDA 4J6YA 1BI1A 2PTKA 3L2UA 3URGA 2HMAA 2EGEA 4RCBA 1SSHA 2XDDA 1TS9A 3EH2A 4FYWB 1I5OB 4M78B 3G7ZA 2QDYB 3H0HA 1VQOA 1WXUA 2NWMA 2COWA 1VQMA 1MMAA 2DJZA 4MZMA 3VYGA 4LD6A 4C0DC 1NPPA 2XK0A 3HFNA 2FHDA 1AVZC 2QI2A 1M3CA 2OX7A 2JS0A 2QQSA 2OTLT 2O9VA 4AFZC 2DPPB 1D0ZA 4C0DB 2PVGB 1U1TA 3V8LA 2ZPEB 1VQKT 3G71T 2QAZA 4ANJA 2V26A 1MV0B 4AFQC 3OYIA 1W1FA 2F2WA 4XTYA 3OYYA 4A4EA 2RK1A 3QSUA 2FYKA 2EYQA 1YWOA 4JRIA 1X6BA 2J6OA 3EFOA 4KRTA 2OTLA 2DBKA 3I5RA 2CKKA 4O5VA 3Q1JA 2JMCA 4XU2A 5CAIA 4F7UF 1KQSA 1V1CA 2X3WD 3LH0A 3UDCA 1I5LA 3WVDB 3OQ5A 1AHJB 2RQVA 3KXTA 2LDMA 2QEXT 1PCXA 2V1QA 2JTFA 3MO8A 4A63B 1NE8A 3LWIA 3C94A 1JBMA 2FVUA 3L2WA 4C0GA 1WHHA 2ABLA 5GMKe 3CXCP 1YIJT 1EX4A 2E41A 4BI8B 1U5SA 2CZ0B 3M0RA 1D0YA 1VQ4T 2EKHA 3OYBA 1BU1A 3CMEA 1PG5B 4E6RA 4M78C 3RUXA 2JT4A 1X6OA 1NLPC 3EHRA 2V8KA 2ZPBB 2ZPIB 3CC7A 2FZGB 4M7DF 3QYHB 5LJ5j 2K7AA 2YUPA 9ATCB 3OMCA 1M2VA 4EPCA 1WX6A 3A5ZB 2L3PA 1VQ8T 2G6FX 2M16A 4J9FA 2FEIA 1IGQA 2X3XD 3QDFA 4E7ZA 8AT1B 1I81A 4Y92A 2RJEA 2RPNA 3LW5E 5KE2A 4JLIA 5I2SA 4C92D 1K4US 4E2FB 2K3YA 3EFOB 4BY6C 3JRZA 2RA2A 3UT1A 3RMQA 3CBOA 2KK4A 1Y7XA 3PE0A 2RI2A 2K5IA 4B6MA 1W2BS 4M77C 4HXJA 4FIBA 2DYIA 1KFZA 1VUBA 2RK2A 2LQWA 1O75A 1D1CA 5GAN6 2E10A 1G3WA 2EQJA 2FG0A 1RL2A 5LJ3j 3JCMV 4ELYC 2RQRA 4PKCC 3VYHB 4IIMA 3C0CA 5GANh 4FU6A 4K11A 5HCKA 4LD9K 1ZUYA 1NBEB 4HVUA 3GNGA 3VUBA 4ZGDB 4M75B 3QIIA 3GP8A 3A8OB 2E64A 4QVCA 1FXXA 4QVZA 8ATCB 3FJPA 1VQKA 2DVEA 3P8HA 1SG5A 3HP9A 1FMWA 2L3QA 3PMTA 1KSWA 3OS1A 5CKHA 4FYXB 4OMOA 2HKNA 1BYMA 3CC7T 2XMFA 2OTJQ 2NUPB 4PL6A 3RKXA 2DKGA 5GAMg 1TUGB 4KGZB 2OAUA 4OMNA 1Q95G 1YJWT 4HCKA 5DM7R 4M78G 2CZ1B 4OGEA 1WXTA 3KUFA 2KMTA 4ZGJB 2SRCA 4QQGA 3OYJA 2QXFA 4NL3A 3VKIA 1VQLQ 4PFZA 2DVJA 3CBPA 3M9QA 2ZZDA 3OYDA 2CZ6B 3TSWA 1D3BB 4AT1B 4EMHA 4A4GA 5J3BA 3CC2A 4GLMA 2ECZA 2NUTB 3EG2A 4Z8AA 3S3NA 4ELZC 4RUGA 5KYWA 4NS5A 7AT1B 1D1AA 2KDSA 2JZ2A 3M58A 1AWWA 3CC4A 4DBQA 3CQTA 1YP5A 3CCQT 2KBTA 5L8RE 3JCMc 1ZA2B 2YWWA 3JAME 5C6SA 1QQJA 1C0MA 3G6EQ 1G3YA 4X9DA 1K0XA 3CCSQ 2HSPA 3EFRA 1Q7YC 1KC8C 2M9UA 1OEBA 4X1VA 3JB9I 3CPFA 2CH4A 2ESWA 3TCJA 4J9EA 2O01E 4QT7A 1ZUKA 4M7DC 1Q7YU 3CCQQ 5FW9A 1W2BA 2D9TA 3LGLA 3I55A 4P5NA 4JLGA 4BY6B 1XJWB 3NPFA 1K9MC 1YI2Q 4JZ3A 1UUEA 4M4ZA 3OBYA 3H6ZA 2LC4A 3CCVT 5C0MA 4PJOC 3CCLT 1VQ5Q 2NLUA 5GAOq 4LDYA 1D09B 5CQYA 2JVVA 5KYUB 5CIUA 4E7LA 2QQAA 3ZBDA 1GFCA 2K5LA 5GAOr 3EG9B 1RAIB 2CUDA 1ACMB 2COYA 1KG1A 3A8MB 4L5GA 3PIPA 5KE3A 4PJNA 4N4HA 2O9SA 2MIOA 1T3LA 4OMPA 3OW2P 3JCMe 5GAOn 3OYEA 2PZ1A 1OI1A 1YJWQ 2RQUA 4A4HA 1NEGA 3G71Q 4HCCA 4CI0C 1AOJA 1TH7A 1JXOA 4R55A 2DX1A 3HHTB 5D6XA 2RHUA 4E7IA 1ZSGA 1PD0A 3JCMg 2DZ9A 3J81E 4MDXA 1QMCA 4C8QE 5L23A 4J9BA 4PJOE 1TU0B 4DOVA 1VQOT 4OF1A 2MOXA 3OYMA 1I1JA 4WF2A 3JCMb 3VS4A 1BB9A 3CBMA 3OYLA 2KYBA 4M78A 2QTXA 2OJ2A 2XI9A 1PWTA 1KQSS 2KI7A 3MHXA 1YFNA 2K5FA 3TVTA 4E7SA 4M7AC 1LJOA 2QA4Q 3RNJA 4KH0B 2RHZA 1RUWA 4HT9A 5KYWB 3RMSA 5J26A 1UGQB 1FX7A 4HKEA 2KQWA 3OS2A 5LJ3d 4R56A 4WTOB 3RKWA 2KR3A 4C0FA 2VXEA 2BIVA 2FPFA 3QJ6A 4MZPA 1M27C 4F17A 2FZKB 3KBGA 4QVDA 2CUBA 1MMNA 3V8KA 2QG9B 3G6ET 5GJVB 2Y90A 4OMMA 1NG2A 3EG9A 2XIDA 1RAHB 2OTJT 2I2LA 1K8AR 2J7IA 1MMDA 3UWNA 3JSCA 4MDWA 3EAEA 1UJYA 2DTOA 4XU0A 5GMKm 2A0FB 3FLGA 2K6DA 1WHJA 1WXBA 2HQXA 1VQ6Q 1BCOA 1QKWA 2C0OA 1Q7YR 1G3SA 1YJ9T 4RG8A 1M1KU 3CC2T 4FSXA 4DQ2A 4BE1A 3EG0A 1UHCA 2O4XB 3A8GB 3QWYA 1Q86R 2GQIA 1ARKA 5IXBA 2WSEE 2ZPHB 3RBBB 1VQ6T 2FPEA 5FWBA 2DK3A 3JB9D 4JJNK 1R8OB 4XU1A 3L1AA 3ER0A 5M9OA 3EHQA 5CO7A 5FU6B 1HK9A 4XU3A 2ZGWA 2GNCA 4OMLA 2OAWA 2EJFA 2R57A 2JJ9A 2OI3A 2AIRB 1Q82R 2JW4A 1OU8A 2ROTA 4LUDA 4EMKA 2QEXQ 1RAEB 1QKXA 2DXTA 4F14A 3A1PA 2DD5A 2JM8A 3M54A 3EGXB 1LNXA 4OVAA 1M2OA 1UGSB 3CCRA 2J6FA 3CXCS 1I07A 5IHNA 3CD6A 4BE0A 2X35A 3GBQA 1VA7A 1TTHB 1M4ZA 1QCNA 1TG0A 1YJNA 2P4TA 1R0BG 3BDLA 3INZA 2DILA 4LUEA 2EQMA 1MUZA 1WIEA 2DXCA 4D8KA 4KGXB 3OY9A 3QZ9B 5DLOA 2M0OA 2XICA 2QQ9A 3TQ7P 2CS7A 4N4GA 2L2PA 2COZA 4M77A 3JCMf 4FT2A 2DNUA 1JQQA 1TWBA 2AKLA 4RTTA 4CC2A 4JPBW 2MAMA 5CK9A 1K0SA 2WSCE 1Q81R 5KYYA 4XTWA 3REAB 4J9CA 2VASA 4M77G 3PMIA 3TREA 1UE9A 3SDZA 1NLOC 1PKSA 3LYIA 1HD3A 1IGUA 3PT9A 4DBHA 1YN8A 4E7JA 2EGAA 1PHTA 2EKOA 4BE2A 1CKAA 1D1BA 4FSSA 3CC2Q 5GMKi 2LZ6B 4M75D 1PSFA 1YNZA 4J5YA 3BFMA 2NUPA 3BDUA 4IKFA 3GF5A 3HL8A 5IN1A 4F04B 2DIQA 1ZUUA 1ZX6A 2YHTA 3QPHA 1M90U 3DB4A 1WHKA 1Q86C 4OB1B 4Z89A 5GMKh 1UTIA 4IUUA 2DBMA 4EMKC 2JTMA 2YRCA 3HRSA 2KYMA 5DY9A 5GAN4 3GPLA 1VIFA 3MEUA 4PLIA 2B86A 3L2QA 1XQHA 2PNIA 3HFOA 1ABOA 1X01A 3A98A 2E6ZA 2RJFA 1RAGB 4II1A 1K73R 2Y4YA 4BDYA 4M77F 1YI2A 4E7HA 1SRMA 3NMZC 3LWHA 1GCQC 3OYKA 4FL6A 3JB9J 1K8AU 2MPXC 1GRIA 5GAMj 4BACA 3MP6A 1UHFA 2AZVA 4JRPA 2CT4A 3GNFB 1YITQ 1YJNQ 1HXDA 1HYOA 5GAOm 3BW1A 3NGPA 2CREA 2ED1A 4LDWA 3CCJA 1W6XA 1KK7A 4N4IA 2KVQG 5LJ3h 1O9SA 3SWNA 3VU3C 4DEYA 2GFUA 2RF0A 2RD1A 1U3OA 1NJIR 1YI2T 1PSEA 1SPKA 3M53A 5HY6A 1VQLA 5HKCA 5LJ5e 2RQWA 3EGXA 2E70A 2LMJA 2P0QA 1YBYA 1RACB 1NEBA 3CC4Q 4PJOA 2DTIA 5KYXB 2L3RA 5KYNA 2VWFA 3CC7Q 4J8OA 1OZ2A 4PFOA 1WQWA 1YCYA 1HSQA 1VYVA 1PC0A 3M0PA 4F7UA 4HCBA 3OA6A 4FT4A 2DMOA 2HBPA 3V8JA 3CPWA 1E6HA 3EGDA 5FRMA 4E7KA 3UA7A 1QVFA 1WZOA 4IUQA 2HL5C 3JB9H 1WGSA 5CQXA 4M7DG 3L2VA 2KSSA 4C0ZA 3I56T 4RTXA 2AT1B 1K8AC 4M7AE 3ULRB 2FPDA 2MI6A 2V1RA 2HZYA 3CPWP 4HT8A 1H3ZA 1YIJQ 1WFWA 4KUDK 1GFDA 1NYGA 2LX9A 4A4FA 4JRKA 2DF6A 3GIBA 3AHUA 1T3SA 1N9SA 1IB8A 2FRWA 4Q5WA 2CDTA 1VQ7T 1ZLMA 4DBRA 1JO8A 3QHSA 2DL7A 2L8DA 4C8QC 5GANd 1X2QA 2L3SA 3CCST 2CP6A 1AEYA 2VUBA 4M77D 2GTJA 1M90C 3OYCA 4M7AA 1WHMA 5IHKA 3MEAA 4KGVB 2LP5A 3CCRQ 3CMAT 1OQKA 3P8BB 1H3HA 4JZ4A 2EGCA 2KEAA 2P84A 3E9GA 3MEVA 3L2ZA 3OMGA 2EYWA 3WXMB 3NFCA 3QYGB 4F7UB 2BZ8A 1M5Q1 1C6VX 4DOWA 2D8HA 2CYZB 2EYYA 2A36A 3WVEB 4UC4A 1QP2A 2CP0A 4M77B 4X34A 2EQUA 3MJXA 3ASKA 1VQ9T 3S6WA 5LJ3f 2ENMA 1VQMT 4ZN3A 1D3BA 1K1ZA 5I22A 1W2BP 5FROA 4V2SA 4LNPA 5GAN5 4J9GA 2DLPA 2L0AA 4ZTJA 2RMOA 4JDSA 1WJSA 1UG1A 2LJ0A 2LT4A 2DETA 2A7YA 3A8LB 2AKKA 5GANj 2BZYA 1H92A 2JMAA 2VKNA 1M30A 2WSFE 1F1BB 2M02A 3AT1B 2GGRA 3M5AA 1M3BA 4PJOB 2RHXA 2V8JA 4J9IA 4Z88A 4AFUC 3EH1A 1RI9A 4QQ6A 4KULA 2E65A 3ZFJA 4M78E 2P4RA 4FCYA 2YUQA 1YHQQ 3C95A 1VQNA 5GANf 1Q82C 1MNDA 2CH4W 1SF9A 3VS5A 2Y4XA 2CP5A 1VIEA 4D8DA 1JRIA 2RHIA 5J39A 1G2BA 2ZCFB 2LNHB 2MWOA 2C0IA 4C92G 1K73C 3I55T 3R6NA 2VC8A 4C8QD 1MGQA 2O4XA 2LJ3A 2DL3A 2DO3A 4OP0A 3VRZA 1OU9A 3DLLA 2E5QA 2D0NA 2LQ8A 3OSVA 1SHFA 1B07A 4FYYB 3OB9A 4IUVA 5DLQE 2VV5A 3H41A 3SHWA 3GLXA 5LJ5h 5LL6S 2X4JA 1ZBXA 4M75A 1TSFA 2QYZA 1GBRA 4PFPA 1WI7A 3CC4T 1W4SA 4ORZA 1VYUA 3OYGA 4M7DD 4L59A 1AWJA 1M1FA 2R5MA 5FU7C 1OPKA 2D6FA 3RDVA 1GCPA 1FYNA 2GF7A 2M1HA 3TU4K 1KJWA 5GAN7 4FM4B 4XAXB 3L2RA 1Q82U 2CT3A 4RG2A 5FU7B 1VQ4Q 1OV3A 2MWPA 5GAN2 2F69A 1ZSZB 2V8IA 1MHNA 2KNBB 1EFNA 3VJPA 4C5HA 2DYBA 3PGGA 5IT9E 2FRYA 3FB9A 3RR6A 4C92C 1QVPA 4O6JA 1VQPQ 1X2KA 3FEOA 4M75G 2PUKB 5GMKj 2RM4A 1N8RU 5CKEA 2JXBA 3M4GA 1M1KR 1S72Q 3CCEQ 1WA7A 2VXFA 2JN0A 2YDLA 1N8RC 1BI3A 3V7CA 2CP2A 3CCJQ 1V29B 2DL4A 2KT1A 4NOYA 4XTUA 2JM9A 3R6OA 1YITT 2LJ1A 1YCSB 4PK4A 4M7DE 1NYFA 1VQ4A 2HAXA 3UF4A 2BTTA 1QVGS 3G4SQ 2LQKA 1VQ5A 5AT1B 2J05A 2E5KA 3OYNA 3I5SA 2F2VA 1WLPB 3MPUB 1E6GA 3EFSA 1M1KC 1H641 3H9NA 4EMGA 2EQIA 2E6NA 2DA9A 1PRLC 3A8HB 2MMPA 1WYXA 5KH6A 3VV0A 3ZL7C 3OW2S 1IRXA 4C92F 2IVWA 1KHIA 2K9GA 1K9MR 2XDBA 2EYZA 3G71A 1RLPC 1YITA 2KT8A 2QGFB 4RMOA 2LNVA 2EQKA 3O8VA 2LCSA 3JCMW 2M51A 3FC3A 5GANe 2ZAEA 2XD0A 3NHNA 2L5QA 3META 2E4HA 2KXDA 2GFAA 2HNIA 1B3QA 1UECA 3UPUA 2HBWA 3NTHA 2DE0X 4M77E 3T9NA 2DL5A 1JU5C 3OBWA 1KQSP 4TVRA 4JS5A 2DJQA 1X43A 1U1SA 2ZPFB 4PNOA 2JS2A 1LPLA 3QWXX 4OB2B 2EBPA 5GAMd 1WNLA 3OYHA 2ATCB 1AWOA 1SEMA 4Z02A 1JXMA 2P0PA 2H3EB 4RCCA 5CCAA 4C8QG 2HSEB 1IXDA 1CKBA 2YRDA 2KE9A 1NJIU 3FDRA 1S1NA 2DM1A 1OZ3A 1X69A 4ATOA 1OYXA 1XNIA 3SWNC 1SSFA 3EG3A 1B7TA 1JJ2A 5HK3A 1NZ9A 5A0DA 1K9MU 3SB2A 1Y0MA 3VUZA 2J06A 2R5AA 3SWNB 1KD1U 4GY5A 2WACA 5GAMh 2F5TX 5LJ5g 1M1GA 1RAAB 4PJMA 1VQ9A 3P8DA 2HQHA 2HCKA 3JCMX 2B8AA 1W70A 3JCMJ 1U8RA 1G83A 4J7IA 4BI4A 3CMEQ 1YJ9Q 3VS1A 1RABB 3MP8A 3VS6A 2Z0WA 1UB4A 2JOYA 2IIMA 2J6KA 2XKOC 3C12A 1KQ2A 2LCCA 4C8QA 5KCHA 1JJ2S 4YTLA 4OGCA 4J9HA 1ZQ1A 4M75C 1N8RR 4FW2A 2X51A 3OSSC 3QXEB 2E12A 1Y07A 2VYTA 4HVVA 1YHQT 2NUZA 4F7UG 2RHYA 3CMAQ 3CCRT 1IZ6A 5IAYA 2RI3A 3NTIA 2A3LA 1R0CB 4IURA 5GAOl 3OS0A 2RB6A 2LT1A 4XK8E 4EIKA 4ZN1A 4RTVA 1KD1C 4KBMB 1Q81U 4IUPA 2KGTA 2JTEA 2CSQA 1QCOA 1UGVA 2M0YA 4J9DA 3RIRA 3M56A 1UGRB 2K3BA 2EPDA 1QW1A 4GLKA 2E3HA 3PTAA 3PVQA 2VVKA 2BE7D 1RADB 1LCKA 1OPLA 3HTRA 3CEYA 3E19A 2ZPGB 4QQDA 5GAMe 3G1JA 2H3JA 3RERA 4VUBA 3VS0A 3JCMP 2C0TA 5KYXA 3OW2A 4J83A 3CCSA 4PJJA 4M75E 4FW1A 2PVOB 2X9HA 1G8XA 1VQKQ 4QKUA 2KXCA 2K79A 4DBFA 3LGFA 4XQ3A 4D6WA 2F5KA 2PVDB 3QUIA 2DD4A 1PD1A 3JV3A 2LCLA 2RJDA 2G3RA 3MKDA 4C8QF 1DJ7B 1B34B 5GAMf 3JCMh 1ABQA 2ED0A 4M7AD 1VQPT 5KYUA 1YJNT 1N5ZA 1QLYA 2DXBA 3CCVQ 2ROLA 3X28B 3LX7A 1E7OA 2RO0A 2CSIA 3GOXA 1VQ5T 1UFFA 2KROA 1OULA 2EVRA 2R58A 5I2MA 1YIJA 2CZ7B 2JNGA 4A53A 1EZZB 3N5BB 3REBB 4DEXA 3I9QA 5GANg 5GJWB 4EMKB 3OYAA 3OS5A 5CKDA 1Y96B 4NL2A 5A2QE 2L89A 4HCZA 5GAOp 1YHQA 5I21A 1CSKA 1LOJA 2EYXA 2E1HA 2FL7A 1ZBJA 3LLRA 3PNWC 3LH5A 2GQVA 4XTVA 2F2XA 2RI5A 3CCLA 2YT6A 3IQLA 3I35A 1KHCA 5LJ5f 4LDXA 4C5EA 4N0AC 4AG1C 4AFSC 2HKQB 1ZSZA 4A54A 3E2UA 3QZ5B 4PJOD 4JRQA 1YWPA 4ZGEB 4XTZA 3VRYA 2EJGA 2QA4T 3V7SA 5D7UA 1GXIE 1AZEA 4OMFB 2O2OA 3FIFA 1Z9ZA 3CD6T 1WJRA 2RN8A 2YLCA 1KD1R 2SEMA 4JJBA 2FZCB 4BUGA 1UJ0A 1G3TA 1YJ9A 1X27A 2PQWA 2HD0A 4EDUA 2MK5A 1BI2A 4HA8A 1BI0A 4L6V5 1U06A 4RKUE 4A4KA 3S3MA 2GTOA 1I0CA 3JCMQ 3CD6Q 2LQNA 3CCQA 4C5IA 4RTWA 1XOVA 1OX9A 1OX8A 1H8KA 1TXQA 4C92A 3CCUQ 2YUOA 3JB9G 5ECAA 3QBYA 2AZSA 3CCMA 4LE9A 5A0LA 3E9FA 1VYTA 4PJOF 5LJ5d 5GAN3 3DKMA 2QTVA 2PUOB 1M2VB 2YRVA 2MCNA 1VOMA 2DEQA 1S72T 3CCET 1BBZA 1EIFA 1VQPA 1B34A 1GL5A 3H8ZA 3M4YA 2O31A 2H8HA 2QDLA 2VGNA 1K76A 3H0FA 2DL8A 3M0TA 3NTKA 1MNEA 3U23A 3I56Q 2VGMA 5KCOA 4FYVB 3DLMA 5I11A 1Y96A 3G4ST 2IG0A 2K2VA 4KT0E 4M78F 2XHCA 4Y28E 4F7UE 1WHGA 1Y71A 2BUDA 4RTUA 1FMVA 1C1AA 2E3IA 1VQ8A 3PVLA 4B9XA 4ZNXA 4HVWA 5A0GA 1P92A 1Z9QA 1QCFA 3F70A 3ZEHA 2C06A 4M7AG 3JB9F 5FRNA 4OMQA 1QWEA 2GBQA 3G4SA 3EGDB 3M0UA 1FWZA 2X4WA 3QDRB 5IHIA 1NPRA 5IH2A 4N0AA 1V76A 4OB3B
chains in the Genus database with same CATH topology
3OYFA 4M77A 1YJWA 3ME9A 4FT2A 3JCMf 3A8HB 1BKBA 2MMPA 3OMCA 5KH6A 3VV0A 4EPCA 3OW2S 3A5ZB 4C92F 2IVWA 1KHIA 1VQ8T 1K73U 2MAMA 5CK9A 2M16A 2XDBA 3G71A 1YITA 3MP1A 2WSCE 4RMOA 2LNVA 4XTWA 1I81A 2EQKA 2K4YA 3O8VA 4M77G 2RJEA 2XG8D 3JCMW 3PMIA 5FU6C 3FC3A 3LW5E 5GANe 1KQ1A 3TREA 5KE2A 4JLIA 2L5QA 3META 5I2SA 3SDZA 2EIFA 3X25B 3LYIA 4C92D 3PT9A 3CCVA 2GFAA 2HNIA 2K3YA 4E7JA 4BY6C 5FLXE 3JRZA 2EKOA 2RA2A 3QJYA 4ME7A 3UT1A 3RMQA 4BE2A 3UPUA 3CBOA 3NTHA 2KK4A 1Y7XA 5GMKi 2RI2A 4M75D 4M77E 3T9NA 4CRIA 1PSFA 1M9SA 2K5IA 3OBWA 4M77C 1W2BS 1IREB 2AHJB 4X9CA 4J5YA 3BFMA 4FIBA 4TVRA 3BDUA 3MEWA 4JS5A 1U1SA 2ZPFB 4IKFA 2XDPA 1I8FA 4PNOA 1VUBA 3GF5A 3HL8A 2RK2A 4OB2B 5GAMd 1WNLA 2DIGA 5IN1A 3OYHA 5LJ3g 1O75A 5GAN6 2QQBA 2E10A 1G3WA 2EQJA 2DIQA 4Z02A 1RL2A 2YHTA 3QPHA 5LJ3j 2P0PA 5EG2A 3JCMV 3M59A 1M90U 4ELYC 3DB4A 4PKCC 3CPWS 4RCCA 5CCAA 1Q86C 4OB1B 3VYHB 4C8QG 5GMKh 5GANh 4IUUA 4PJOG 4FU6A 3CCUT 2RH2A 4EMKC 5D6WA 2JTMA 4DA4A 1NJIU 3FDRA 1KC8U 4LD9K 3HRSA 1OZ3A 5DY9A 3GPLA 5GAN4 3GNGA 1VIFA 3MEUA 3QKJA 4PLIA 3VUBA 4ZGDB 1RI0A 4M75B 3L2QA 3QIIA 2HQEA 3GP8A 1XQHA 3A8OB 4ATOA 1OYXA 1XNIA 3SWNC 1SSFA 2E64A 4QVCA 1FXXA 4QVZA 1JJ2A 3FJPA 1VQKA 3HFOA 1X01A 4M7DB 2DVEA 1QP3A 5HK3A 3P8HA 1NZ9A 2CGHA 2E6ZA 3X20B 2RJFA 3HP9A 5A0DA 3PMTA 4II1A 4JS4A 1WQ7A 5CKHA 2Y4YA 3OS1A 4BDYA 1K9MU 1UEBA 4M77F 3SB2A 1VQNT 1XTDA 3RKYA 3VUZA 3QG1A 1YI2A 3X24B 3CC7T 1BYMA 4E7HA 4PL6A 3RKXA 2DKGA 4MMKA 4MMLA 5GAMg 2R5AA 3CXCA 3SWNB 3LWHA 3OYKA 2OAUA 2QQRA 4FL6A 3JB9J 1K8AU 2LVMA 1KD1U 2YLBA 5GAMj 4BACA 3MP6A 4GY5A 2WACA 1YJWT 5DM7R 2OTJA 5GAMh 3CCUA 4M78G 2F5TX 5LJ5g 4JRPA 2FB7A 2CZ1B 1M1GA 3GNFB 2BKDN 4BB7A 3CCEA 1S72A 4OGEA 1HXDA 5GAOm 3KUFA 3BW1A 4J6XA 2KMTA 1VQ9A 4ZGJB 3P8DA 5D6YA 4M7AB 3S3OA 4LDWA 4QQGA 3JCMX 3CCJA 3OYJA 2B8AA 2QXFA 4NL3A 3VKIA 4N4IA 3JCMJ 1U8RA 2KVQG 5LJ3h 4J7IA 1O9SA 3SWNA 4BI4A 3PIOA 3VU3C 1QVGA 2GFUA 2RD1A 3CBPA 3M9QA 2ZZDA 3MP8A 3OYDA 1YI2T 2CZ6B 1PSEA 1D3BB 3M53A 5HY6A 1UB4A 2DXUA 1VQLA 4C92E 4EMHA 2DAQA 5HKCA 3J80E 4A4GA 2JOYA 5J3BA 5LJ5e 3CC2A 2E70A 2P0QA 3S3NA 1YBYA 4ELZC 2XKOC 3C12A 4NS5A 4PJOA 2DTIA 1KQ2A 2L3RA 2LCCA 4C8QA 5KCHA 2KDSA 1JJ2S 4YTLA 4OGCA 2JZ2A 4J8OA 3M58A 4BI3A 1OZ2A 1ZQ1A 1WQWA 1YCYA 4M75C 3CC4A 5CR2A 4F7UA 3CCQT 4C8QB 4HCBA 2P0KA 3OSSC 3QXEB 2E12A 5L8RE 3OA6A 1Y07A 2VYTA 1YHQT 3JCMc 4FT4A 2X4YA 3JAME 2HBPA 4F7UG 5C6SA 3V8JA 3CPWA 2RHYA 5FRMA 3CCRT 1IZ6A 1G3YA 1BIBA 4X9DA 5IAYA 4E7KA 4M7AF 1QVFA 3EFRA 1KC8C 1N9RA 2RI3A 2M9UA 1Q7YC 4IUQA 1NJIC 3NTIA 2A3LA 2EFIA 5HK0A 3JB9I 3CPFA 4PLLA 4IURA 3JB9H 1WGSA 5GAOl 3OS0A 3TCJA 2RB6A 5CQXA 2LT1A 2KSSA 3L2VA 4M7DG 4J7FA 4XK8E 4C0ZA 2O01E 3HSBA 4ZN1A 4M7DC 1Q7YU 1KD1C 4KBMB 5LJ3e 3I56T 3HKSA 1K8AC 4M7AE 1W2BA 1Q81U 3I56A 2MI6A 2D9TA 4IUPA 3LGLA 3QO3A 3I55A 4P5NA 4JLGA 2DTHA 4BY6B 4HT8A 1H3ZA 1K9MC 4KUDK 1VQ6A 1WPYA 3RIRA 3M56A 1UGRB 2D0QB 1UGPB 2LX9A 4A4FA 4JRKA 3CCJT 1QW1A 5GAN8 3GIBA 3C4SA 3HPWA 3AHUA 4GLKA 2RJCA 4M75F 2EWNA 1N9SA 3OBYA 3PTAA 3H6ZA 3FRNA 5CKBA 4M78D 4Q5WA 3M57A 2LC4A 3CEYA 1Q81C 3CCVT 3E19A 1VQ7T 2ZPGB 4QQDA 5GAMe 5C0MA 4PJOC 3SD4A 1G5VA 3QHSA 1X75C 2H3JA 2L8DA 4C8QC 5GANd 3CCMT 3RERA 3CCLT 4VUBA 3CCST 2NLUA 5GAOq 3PFSA 3JCMP 4MZTA 3OW2A 4J83A 4LDYA 3CCSA 4LDVA 2VUBA 5CQYA 1N8RC 4M77D 4M75E 2JVVA 2PVOB 3X26B 5CIUA 1M90C 2EJ9A 2QQAA 4E7LA 3OYCA 4M7AA 3ZBDA 3MEAA 5AYFA 2K5LA 4JUVA 2KY9A 1BIAA 3CMAT 5GAOr 3LGFA 3L42A 3P8BB 4XQ3A 4D6WA 1KG1A 3A8MB 3BY7A 4L5GA 3PIPA 2F5KA 5KE3A 1QVFS 2PVDB 3QUIA 2DD4A 4N4HA 3TEEA 4LDUA 3JCMe 3E9GA 2LCLA 2RJDA 3MEVA 5GMKl 5GAOn 3OYEA 1OI1A 4A4HA 2G3RA 3L2ZA 4HCCA 3OMGA 4CI0C 4M7DA 4B9WA 3WXMB 1TH7A 3NFCA 4C8QF 3QYGB 4F7UB 1DJ7B 4R55A 3HHTB 2MF2A 1B34B 1M5Q1 5D6XA 2QEXA 4KUIA 1ZHIA 2RHUA 3JCMh 4DOWA 5GAMf 2CYZB 4E7IA 4M7AD 3WVEB 1VQPT 4UC4A 1QP2A 4M77B 4X34A 2EQUA 3JCMg 3CMAA 2DZ9A 3J81E 3HRTA 4MDXA 2GCXA 2EAYA 4C8QE 2K3XA 1YJNT 4PJOE 3ASKA 4DOVA 1VQ9T 3S6WA 1VQOT 1N6AA 4OF1A 5LJ3f 3OYMA 5CKFA 2DXBA 2KAFA 4WF2A 3JCMb 4BDZA 1VQMT 4ZN3A 1D3BA 2LRQA 4Y91A 3X28B 3CBMA 3OYLA 5FROA 4V2SA 3LX7A 3CMET 4ZTFA 4M78A 2LTOA 5GAN5 2QTXA 2RO0A 4QW2A 1VQ5T 3GOXA 4ZTJA 1VQLT 3J7AF 4JDSA 2XI9A 1WJSA 1Q86U 2XD0A 1VQ7A 3MCAB 1KQSS 2LT4A 3MHXA 2A7YA 3A8LB 2R58A 5I2MA 1YIJA 3JCMd 2CZ7B 2K57A 2JNGA 3HRUA 2K5FA 4A53A 5GANj 3N5BB 4E47A 4M7AC 4OB0B 4J6WA 2XU8A 1LJOA 5GANg 2WSFE 3DB3A 4EMKB 1N27A 2RHZA 3RESA 2JUFA 4HT9A 3OYAA 3M5AA 3RMSA 3OS5A 5J26A 5CKDA 1UGQB 1I4K1 1FX7A 1WJQA 1Y96B 2RHXA 4NL2A 4HKEA 4PJOB 1JB0E 2KQWA 5A2QE 3OS2A 2V8JA 5LJ3d 2QA4A 2L89A 4R56A 4HCZA 5GAOp 1YHQA 3RKWA 1LOJA 4C0FA 5CVIA 4BD3A 5I21A 2VXEA 2BIVA 2E1HA 2E65A 2FL7A 3QJ6A 4KULA 3M55A 3LLRA 3PNWC 4XTXA 4MZPA 3V7RA 3ZFJA 4M78E 3KBGA 2GQVA 4QVDA 4XTVA 2DZCA 4IUTA 4C92B 2RI5A 3G6EA 3C95A 4C5GA 1VQNA 3V8KA 3CCLA 2PU9B 3SFMA 5GANf 1Q82C 3G6ET 1KHCA 5LJ5f 1M8VA 2X4XA 2Y90A 4LDXA 2Y4XA 3E1SA 1VIEA 4C5EA 2XIDA 1JRIA 4N0AC 2RHIA 2OTJT 2I2LA 5J39A 4J6YA 1BI1A 2ZCFB 3L2UA 2MWOA 3UWNA 3JSCA 3URGA 4RCBA 4MDWA 3EAEA 4C92G 2XDDA 1K73C 4XU0A 2DTOA 5GMKm 3I55T 2VC8A 3FLGA 4C8QD 4A54A 1MGQA 2O4XA 3QZ5B 4JRQA 4PJOD 4ZGEB 2DO3A 2HQXA 4M78B 4XTZA 3G7ZA 2QDYB 4OP0A 2EJGA 2QA4T 1VQOA 3V7SA 3DLLA 2E5QA 2LQ8A 3OSVA 1GXIE 4OMFB 1VQMA 2DJZA 1G3SA 3FIFA 4MZMA 3CD6T 1WJRA 1YJ9T 3VYGA 2YLCA 3OB9A 4RG8A 4LD6A 1M1KU 4BUGA 1G3TA 4IUVA 4C0DC 3CC2T 1NPPA 2XK0A 1YJ9A 5DLQE 4FSXA 4DQ2A 2VV5A 3HFNA 4BE1A 3GLXA 2PQWA 2HD0A 5LL6S 5LJ5h 2FHDA 2X4JA 2O4XB 4EDUA 1ZBXA 2QI2A 3A8GB 1BI2A 4HA8A 4M75A 1BI0A 2WSEE 2ZPHB 4L6V5 1VQ6T 2QQSA 2OTLT 2DPPB 4RKUE 3CC4T 1W4SA 4A4KA 3S3MA 2DK3A 3JB9D 4JJNK 3JCMQ 4C0DB 3OYGA 2PVGB 4M7DD 4L59A 1R8OB 1M1FA 4XU1A 1U1TA 3V8LA 2R5MA 2ZPEB 5FU7C 4C5IA 3CCQA 1VQKT 2D6FA 1XOVA 3L1AA 3G71T 4C92A 3ER0A 2GF7A 2M1HA 5M9OA 3TU4K 3JB9G 5CO7A 3QBYA 1HK9A 4XU3A 5FU6B 2ZGWA 5GAN7 3CCMA 4FM4B 3OYIA 4XAXB 4XTYA 3L2RA 5A0LA 1Q82U 3E9FA 3OYYA 2R57A 2EJFA 4PJOF 5LJ5d 4A4EA 4RG2A 3DKMA 5FU7B 5GAN3 2PUOB 2RK1A 2MWPA 5GAN2 4EMKA 2F69A 2YRVA 4QQ6A 2V8IA 1MHNA 2FYKA 2EYQA 3VJPA 4C5HA 3QSUA 4JRIA 2DXTA 2DEQA 1S72T 3CCET 1EIFA 2DD5A 1VQPA 2OTLA 1B34A 3M54A 3PGGA 2CKKA 3H8ZA 4O5VA 3Q1JA 5CAIA 1LNXA 3M4YA 4XU2A 5IT9E 4F7UF 4OVAA 1KQSA 3FB9A 1UGSB 4C92C 3CCRA 1QVPA 3LH0A 4O6JA 3FEOA 4M75G 2PUKB 3UDCA 1I5LA 2VGNA 3WVDB 3OQ5A 3CXCS 1AHJB 5GMKj 2RM4A 3KXTA 3NTKA 1N8RU 5CKEA 2VGMA 5KCOA 2LDMA 2QEXT 3CD6A 4BE0A 3M4GA 3DLMA 1Y96A 3G4ST 2IG0A 2X35A 2K2VA 2JTFA 2VXFA 4KT0E 3MO8A 2JN0A 1NE8A 4M78F 2XHCA 4Y28E 4F7UE 3LWIA 3C94A 1JBMA 2FVUA 1BI3A 3L2WA 1Y71A 2BUDA 3V7CA 4C0GA 5GMKe 1YIJT 1M4ZA 1V29B 2E41A 4BI8B 2CZ0B 1YJNA 1VQ8A 4NOYA 4XTUA 2P4TA 4B9XA 3BDLA 3R6OA 1VQ4T 3INZA 5A0GA 1YITT 3OYBA 1P92A 4M7DE 1VQ4A 2HAXA 2EQMA 2DXCA 3CMEA 3F70A 1QVGS 2LQKA 3OY9A 3QZ9B 4M78C 3RUXA 3ZEHA 1X6OA 2M0OA 5DLOA 1VQ5A 2C06A 4M7AG 2V8KA 3JB9F 2ZPBB 3OYNA 2XICA 2ZPIB 2QQ9A 5FRNA 2CS7A 3EFSA 3CC7A 1M1KC 3G4SA 1FWZA 1H641 2X4WA 3QDRB 1NPRA 4M7DF 4EMGA 4N0AA 3QYHB 4N4GA 5LJ5j 2E6NA 4OB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OF1 A;  5CO7 A;  3JRZ A;  1X75 C;  4ME7 A;  5CKH A;  5CKF A;  4ELY C;  5CR2 A;  5CKD A;  5CCA A;  4HKE A;  4VUB A;  3JSC A;  3NFC A;  4MZT A;  5CK9 A;  1UB4 A;  5CKE A;  2MF2 A;  2VUB A;  5CQY A;  5HKC A;  5DLO A;  2C06 A;  4MZP A;  3VUB A;  3G7Z A;  4ELZ C;  1VUB A;  1NE8 A;  3HPW A;  1M1F A;  5HK0 A;  4MZM A;  5CKB A;  4MDX A;  3TCJ A;  5CQX A;  2KMT A;  5HK3 A; 
#chains in the Genus database with same CATH topology
 3OYF A;  1YJW A;  3ME9 A;  1BKB A;  2F1L A;  1QVF P;  1A0N B;  1JJ2 P;  2BE9 B;  1K73 U;  1R77 A;  3MP1 A;  1UDL A;  2K4Y A;  1VQ9 Q;  2NYS A;  2XG8 D;  4JJC A;  5FU6 C;  2O88 A;  1KQ1 A;  2EIF A;  3X25 B;  3CCV A;  5FLX E;  3QJY A;  4ME7 A;  1LVK A;  2QGG A;  3VS7 A;  4PJL A;  4ESR A;  4CRI A;  4LN2 A;  1M9S A;  1IRE B;  2AHJ B;  4X9C A;  1NM7 A;  3MEW A;  2KRS A;  2XDP A;  1I8F A;  2DIG A;  5LJ3 g;  2QQB A;  1AWX A;  1WHL A;  1OOT A;  3CCM Q;  3D7S B;  2AK5 A;  5EG2 A;  3M59 A;  3FJ5 A;  2W0Z A;  3KFV A;  3CPW S;  1K9A A;  4CC4 B;  4PJO G;  3CCU T;  2RH2 A;  5D6W A;  4DA4 A;  1KC8 U;  3QKJ A;  1RI0 A;  2HQE A;  3SEM A;  1FMK A;  4M7D B;  1QP3 A;  3X20 B;  2CGH A;  3I55 Q;  4JS4 A;  1WQ7 A;  4WCI A;  1UEB A;  2CP3 A;  1VQN T;  1XTD A;  1BCM A;  3RKY A;  3QG1 A;  4AMC A;  3X24 B;  4MMK A;  4MML A;  3CXC A;  2QQR A;  2LVM A;  2YLB A;  2OTJ A;  3CCU A;  2FB7 A;  1M90 R;  1TUD A;  2BKD N;  4BB7 A;  3CCE A;  1S72 A;  1X6G A;  1VQO Q;  1BK2 A;  4J6X A;  1AT1 B;  1PRM C;  5D6Y A;  4KH1 B;  4M7A B;  3S3O A;  1GBQ A;  1T0H A;  3M0S A;  1VQN Q;  1MV3 A;  2K2M A;  1TUC A;  2HL3 A;  3PIO A;  3M0Q A;  1QVG A;  2W10 A;  2HEQ A;  3O5Z A;  2DXU A;  4C92 E;  3BE3 A;  2DAQ A;  1TOV A;  3J80 E;  1SRL A;  1IHW A;  3EG1 A;  2KRM A;  2A08 A;  1VQ7 Q;  2YXY A;  4BI3 A;  5CR2 A;  2YUN A;  4C8Q B;  2P0K A;  4JJD A;  2X4Y A;  2NUT A;  2DFU A;  2VB6 A;  3CCL Q;  1BIB A;  4M7A F;  1N9R A;  4R0K A;  1NJI C;  2BZX A;  1VQ8 Q;  5HK0 A;  2EFI A;  2IPO B;  4PLL A;  1GCQ A;  4J7F A;  3HSB A;  2QAS A;  4GBQ A;  5LJ3 e;  3HKS A;  4CC7 A;  3I56 A;  3QO3 A;  2DTH A;  2DRK A;  1PM3 A;  1VQ6 A;  1WPY A;  3UAT A;  2CP7 A;  2D0Q B;  1M8M A;  1UGP B;  4IIO A;  3CCJ T;  4RTZ A;  5GAN 8;  3C4S A;  3HPW A;  1M3A A;  2RJC A;  2YSQ A;  4M75 F;  2FO0 A;  2DRM A;  2EWN A;  5KYY B;  2MYS A;  3FRN A;  5CKB A;  4M78 D;  1IO6 A;  3M57 A;  1MMG A;  1Q81 C;  1VQM Q;  2KRN A;  3SD4 A;  1G5V A;  1X75 C;  2OTL Q;  3CCM T;  3EGU A;  2LX7 A;  2RNA A;  3PFS A;  4MZT A;  2A37 A;  4LDV A;  1SKU B;  3X26 B;  2D1X A;  1T0J A;  2EJ9 A;  1QVG P;  5AYF A;  1AZG B;  4RTY A;  4JUV A;  2DEU A;  2KY9 A;  1BIA A;  1JEG A;  6AT1 B;  3UA6 A;  1RAF B;  3L42 A;  3BY7 A;  3THK A;  1QVF S;  3TEE A;  2RQT A;  4LDU A;  1KC8 R;  5IXF A;  5GMK l;  4CC3 A;  1J3T A;  5FWC A;  4M7D A;  1PNJ A;  4B9W A;  2EW3 A;  3VS3 A;  1KIK A;  1WDX A;  2MF2 A;  2QEX A;  4KUI A;  1ZHI A;  2A28 A;  4LXC A;  3CMA A;  3HRT A;  2GCX A;  2EAY A;  1PKT A;  4AG2 C;  2K3X A;  1ZA1 B;  1N6A A;  5CKF A;  1QWF A;  2KAF A;  4BDZ A;  2LRQ A;  4Y91 A;  2HDA A;  3CME T;  4ZTF A;  3H0I A;  2LTO A;  4QW2 A;  3TSZ A;  1VQL T;  3J7A F;  1Q86 U;  1VQ7 A;  3MCA B;  2QK0 A;  1Y57 A;  3JCM d;  2K57 A;  3HRU A;  4E47 A;  4OB0 B;  4J6W A;  2XU8 A;  3DB3 A;  1ZSZ C;  1N27 A;  3RES A;  2JUF A;  1AD5 A;  1I4K 1;  1WJQ A;  1JB0 E;  2QA4 A;  2I0N A;  1RLQ C;  1D0X A;  5CVI A;  4BD3 A;  1IHV A;  3M55 A;  4XTX A;  3V7R A;  2DZC A;  4IUT A;  4C92 B;  3G6E A;  4C5G A;  2DER A;  2PU9 B;  3SFM A;  2D8J A;  1M8V A;  2X4X A;  3E1S A;  1SHG A;  5EC7 A;  4F16 A;  3VS2 A;  1HJD A;  4J6Y A;  1BI1 A;  2PTK A;  3L2U A;  3URG A;  2HMA A;  2EGE A;  4RCB A;  1SSH A;  2XDD A;  1TS9 A;  3EH2 A;  4FYW B;  1I5O B;  4M78 B;  3G7Z A;  2QDY B;  3H0H A;  1VQO A;  1WXU A;  2NWM A;  2COW A;  1VQM A;  1MMA A;  2DJZ A;  4MZM A;  3VYG A;  4LD6 A;  4C0D C;  1NPP A;  2XK0 A;  3HFN A;  2FHD A;  1AVZ C;  2QI2 A;  1M3C A;  2OX7 A;  2JS0 A;  2QQS A;  2OTL T;  2O9V A;  4AFZ C;  2DPP B;  1D0Z A;  4C0D B;  2PVG B;  1U1T A;  3V8L A;  2ZPE B;  1VQK T;  3G71 T;  2QAZ A;  4ANJ A;  2V26 A;  1MV0 B;  4AFQ C;  3OYI A;  1W1F A;  2F2W A;  4XTY A;  3OYY A;  4A4E A;  2RK1 A;  3QSU A;  2FYK A;  2EYQ A;  1YWO A;  4JRI A;  1X6B A;  2J6O A;  3EFO A;  4KRT A;  2OTL A;  2DBK A;  3I5R A;  2CKK A;  4O5V A;  3Q1J A;  2JMC A;  4XU2 A;  5CAI A;  4F7U F;  1KQS A;  1V1C A;  2X3W D;  3LH0 A;  3UDC A;  1I5L A;  3WVD B;  3OQ5 A;  1AHJ B;  2RQV A;  3KXT A;  2LDM A;  2QEX T;  1PCX A;  2V1Q A;  2JTF A;  3MO8 A;  4A63 B;  1NE8 A;  3LWI A;  3C94 A;  1JBM A;  2FVU A;  3L2W A;  4C0G A;  1WHH A;  2ABL A;  5GMK e;  3CXC P;  1YIJ T;  1EX4 A;  2E41 A;  4BI8 B;  1U5S A;  2CZ0 B;  3M0R A;  1D0Y A;  1VQ4 T;  2EKH A;  3OYB A;  1BU1 A;  3CME A;  1PG5 B;  4E6R A;  4M78 C;  3RUX A;  2JT4 A;  1X6O A;  1NLP C;  3EHR A;  2V8K A;  2ZPB B;  2ZPI B;  3CC7 A;  2FZG B;  4M7D F;  3QYH B;  5LJ5 j;  2K7A A;  2YUP A;  9ATC B;  3OMC A;  1M2V A;  4EPC A;  1WX6 A;  3A5Z B;  2L3P A;  1VQ8 T;  2G6F X;  2M16 A;  4J9F A;  2FEI A;  1IGQ A;  2X3X D;  3QDF A;  4E7Z A;  8AT1 B;  1I81 A;  4Y92 A;  2RJE A;  2RPN A;  3LW5 E;  5KE2 A;  4JLI A;  5I2S A;  4C92 D;  1K4U S;  4E2F B;  2K3Y A;  3EFO B;  4BY6 C;  3JRZ A;  2RA2 A;  3UT1 A;  3RMQ A;  3CBO A;  2KK4 A;  1Y7X A;  3PE0 A;  2RI2 A;  2K5I A;  4B6M A;  1W2B S;  4M77 C;  4HXJ A;  4FIB A;  2DYI A;  1KFZ A;  1VUB A;  2RK2 A;  2LQW A;  1O75 A;  1D1C A;  5GAN 6;  2E10 A;  1G3W A;  2EQJ A;  2FG0 A;  1RL2 A;  5LJ3 j;  3JCM V;  4ELY C;  2RQR A;  4PKC C;  3VYH B;  4IIM A;  3C0C A;  5GAN h;  4FU6 A;  4K11 A;  5HCK A;  4LD9 K;  1ZUY A;  1NBE B;  4HVU A;  3GNG A;  3VUB A;  4ZGD B;  4M75 B;  3QII A;  3GP8 A;  3A8O B;  2E64 A;  4QVC A;  1FXX A;  4QVZ A;  8ATC B;  3FJP A;  1VQK A;  2DVE A;  3P8H A;  1SG5 A;  3HP9 A;  1FMW A;  2L3Q A;  3PMT A;  1KSW A;  3OS1 A;  5CKH A;  4FYX B;  4OMO A;  2HKN A;  1BYM A;  3CC7 T;  2XMF A;  2OTJ Q;  2NUP B;  4PL6 A;  3RKX A;  2DKG A;  5GAM g;  1TUG B;  4KGZ B;  2OAU A;  4OMN A;  1Q95 G;  1YJW T;  4HCK A;  5DM7 R;  4M78 G;  2CZ1 B;  4OGE A;  1WXT A;  3KUF A;  2KMT A;  4ZGJ B;  2SRC A;  4QQG A;  3OYJ A;  2QXF A;  4NL3 A;  3VKI A;  1VQL Q;  4PFZ A;  2DVJ A;  3CBP A;  3M9Q A;  2ZZD A;  3OYD A;  2CZ6 B;  3TSW A;  1D3B B;  4AT1 B;  4EMH A;  4A4G A;  5J3B A;  3CC2 A;  4GLM A;  2ECZ A;  2NUT B;  3EG2 A;  4Z8A A;  3S3N A;  4ELZ C;  4RUG A;  5KYW A;  4NS5 A;  7AT1 B;  1D1A A;  2KDS A;  2JZ2 A;  3M58 A;  1AWW A;  3CC4 A;  4DBQ A;  3CQT A;  1YP5 A;  3CCQ T;  2KBT A;  5L8R E;  3JCM c;  1ZA2 B;  2YWW A;  3JAM E;  5C6S A;  1QQJ A;  1C0M A;  3G6E Q;  1G3Y A;  4X9D A;  1K0X A;  3CCS Q;  2HSP A;  3EFR A;  1Q7Y C;  1KC8 C;  2M9U A;  1OEB A;  4X1V A;  3JB9 I;  3CPF A;  2CH4 A;  2ESW A;  3TCJ A;  4J9E A;  2O01 E;  4QT7 A;  1ZUK A;  4M7D C;  1Q7Y U;  3CCQ Q;  5FW9 A;  1W2B A;  2D9T A;  3LGL A;  3I55 A;  4P5N A;  4JLG A;  4BY6 B;  1XJW B;  3NPF A;  1K9M C;  1YI2 Q;  4JZ3 A;  1UUE A;  4M4Z A;  3OBY A;  3H6Z A;  2LC4 A;  3CCV T;  5C0M A;  4PJO C;  3CCL T;  1VQ5 Q;  2NLU A;  5GAO q;  4LDY A;  1D09 B;  5CQY A;  2JVV A;  5KYU B;  5CIU A;  4E7L A;  2QQA A;  3ZBD A;  1GFC A;  2K5L A;  5GAO r;  3EG9 B;  1RAI B;  2CUD A;  1ACM B;  2COY A;  1KG1 A;  3A8M B;  4L5G A;  3PIP A;  5KE3 A;  4PJN A;  4N4H A;  2O9S A;  2MIO A;  1T3L A;  4OMP A;  3OW2 P;  3JCM e;  5GAO n;  3OYE A;  2PZ1 A;  1OI1 A;  1YJW Q;  2RQU A;  4A4H A;  1NEG A;  3G71 Q;  4HCC A;  4CI0 C;  1AOJ A;  1TH7 A;  1JXO A;  4R55 A;  2DX1 A;  3HHT B;  5D6X A;  2RHU A;  4E7I A;  1ZSG A;  1PD0 A;  3JCM g;  2DZ9 A;  3J81 E;  4MDX A;  1QMC A;  4C8Q E;  5L23 A;  4J9B A;  4PJO E;  1TU0 B;  4DOV A;  1VQO T;  4OF1 A;  2MOX A;  3OYM A;  1I1J A;  4WF2 A;  3JCM b;  3VS4 A;  1BB9 A;  3CBM A;  3OYL A;  2KYB A;  4M78 A;  2QTX A;  2OJ2 A;  2XI9 A;  1PWT A;  1KQS S;  2KI7 A;  3MHX A;  1YFN A;  2K5F A;  3TVT A;  4E7S A;  4M7A C;  1LJO A;  2QA4 Q;  3RNJ A;  4KH0 B;  2RHZ A;  1RUW A;  4HT9 A;  5KYW B;  3RMS A;  5J26 A;  1UGQ B;  1FX7 A;  4HKE A;  2KQW A;  3OS2 A;  5LJ3 d;  4R56 A;  4WTO B;  3RKW A;  2KR3 A;  4C0F A;  2VXE A;  2BIV A;  2FPF A;  3QJ6 A;  4MZP A;  1M27 C;  4F17 A;  2FZK B;  3KBG A;  4QVD A;  2CUB A;  1MMN A;  3V8K A;  2QG9 B;  3G6E T;  5GJV B;  2Y90 A;  4OMM A;  1NG2 A;  3EG9 A;  2XID A;  1RAH B;  2OTJ T;  2I2L A;  1K8A R;  2J7I A;  1MMD A;  3UWN A;  3JSC A;  4MDW A;  3EAE A;  1UJY A;  2DTO A;  4XU0 A;  5GMK m;  2A0F B;  3FLG A;  2K6D A;  1WHJ A;  1WXB A;  2HQX A;  1VQ6 Q;  1BCO A;  1QKW A;  2C0O A;  1Q7Y R;  1G3S A;  1YJ9 T;  4RG8 A;  1M1K U;  3CC2 T;  4FSX A;  4DQ2 A;  4BE1 A;  3EG0 A;  1UHC A;  2O4X B;  3A8G B;  3QWY A;  1Q86 R;  2GQI A;  1ARK A;  5IXB A;  2WSE E;  2ZPH B;  3RBB B;  1VQ6 T;  2FPE A;  5FWB A;  2DK3 A;  3JB9 D;  4JJN K;  1R8O B;  4XU1 A;  3L1A A;  3ER0 A;  5M9O A;  3EHQ A;  5CO7 A;  5FU6 B;  1HK9 A;  4XU3 A;  2ZGW A;  2GNC A;  4OML A;  2OAW A;  2EJF A;  2R57 A;  2JJ9 A;  2OI3 A;  2AIR B;  1Q82 R;  2JW4 A;  1OU8 A;  2ROT A;  4LUD A;  4EMK A;  2QEX Q;  1RAE B;  1QKX A;  2DXT A;  4F14 A;  3A1P A;  2DD5 A;  2JM8 A;  3M54 A;  3EGX B;  1LNX A;  4OVA A;  1M2O A;  1UGS B;  3CCR A;  2J6F A;  3CXC S;  1I07 A;  5IHN A;  3CD6 A;  4BE0 A;  2X35 A;  3GBQ A;  1VA7 A;  1TTH B;  1M4Z A;  1QCN A;  1TG0 A;  1YJN A;  2P4T A;  1R0B G;  3BDL A;  3INZ A;  2DIL A;  4LUE A;  2EQM A;  1MUZ A;  1WIE A;  2DXC A;  4D8K A;  4KGX B;  3OY9 A;  3QZ9 B;  5DLO A;  2M0O A;  2XIC A;  2QQ9 A;  3TQ7 P;  2CS7 A;  4N4G A;  2L2P A;  2COZ A;  4M77 A;  3JCM f;  4FT2 A;  2DNU A;  1JQQ A;  1TWB A;  2AKL A;  4RTT A;  4CC2 A;  4JPB W;  2MAM A;  5CK9 A;  1K0S A;  2WSC E;  1Q81 R;  5KYY A;  4XTW A;  3REA B;  4J9C A;  2VAS A;  4M77 G;  3PMI A;  3TRE A;  1UE9 A;  3SDZ A;  1NLO C;  1PKS A;  3LYI A;  1HD3 A;  1IGU A;  3PT9 A;  4DBH A;  1YN8 A;  4E7J A;  2EGA A;  1PHT A;  2EKO A;  4BE2 A;  1CKA A;  1D1B A;  4FSS A;  3CC2 Q;  5GMK i;  2LZ6 B;  4M75 D;  1PSF A;  1YNZ A;  4J5Y A;  3BFM A;  2NUP A;  3BDU A;  4IKF A;  3GF5 A;  3HL8 A;  5IN1 A;  4F04 B;  2DIQ A;  1ZUU A;  1ZX6 A;  2YHT A;  3QPH A;  1M90 U;  3DB4 A;  1WHK A;  1Q86 C;  4OB1 B;  4Z89 A;  5GMK h;  1UTI A;  4IUU A;  2DBM A;  4EMK C;  2JTM A;  2YRC A;  3HRS A;  2KYM A;  5DY9 A;  5GAN 4;  3GPL A;  1VIF A;  3MEU A;  4PLI A;  2B86 A;  3L2Q A;  1XQH A;  2PNI A;  3HFO A;  1ABO A;  1X01 A;  3A98 A;  2E6Z A;  2RJF A;  1RAG B;  4II1 A;  1K73 R;  2Y4Y A;  4BDY A;  4M77 F;  1YI2 A;  4E7H A;  1SRM A;  3NMZ C;  3LWH A;  1GCQ C;  3OYK A;  4FL6 A;  3JB9 J;  1K8A U;  2MPX C;  1GRI A;  5GAM j;  4BAC A;  3MP6 A;  1UHF A;  2AZV A;  4JRP A;  2CT4 A;  3GNF B;  1YIT Q;  1YJN Q;  1HXD A;  1HYO A;  5GAO m;  3BW1 A;  3NGP A;  2CRE A;  2ED1 A;  4LDW A;  3CCJ A;  1W6X A;  1KK7 A;  4N4I A;  2KVQ G;  5LJ3 h;  1O9S A;  3SWN A;  3VU3 C;  4DEY A;  2GFU A;  2RF0 A;  2RD1 A;  1U3O A;  1NJI R;  1YI2 T;  1PSE A;  1SPK A;  3M53 A;  5HY6 A;  1VQL A;  5HKC A;  5LJ5 e;  2RQW A;  3EGX A;  2E70 A;  2LMJ A;  2P0Q A;  1YBY A;  1RAC B;  1NEB A;  3CC4 Q;  4PJO A;  2DTI A;  5KYX B;  2L3R A;  5KYN A;  2VWF A;  3CC7 Q;  4J8O A;  1OZ2 A;  4PFO A;  1WQW A;  1YCY A;  1HSQ A;  1VYV A;  1PC0 A;  3M0P A;  4F7U A;  4HCB A;  3OA6 A;  4FT4 A;  2DMO A;  2HBP A;  3V8J A;  3CPW A;  1E6H A;  3EGD A;  5FRM A;  4E7K A;  3UA7 A;  1QVF A;  1WZO A;  4IUQ A;  2HL5 C;  3JB9 H;  1WGS A;  5CQX A;  4M7D G;  3L2V A;  2KSS A;  4C0Z A;  3I56 T;  4RTX A;  2AT1 B;  1K8A C;  4M7A E;  3ULR B;  2FPD A;  2MI6 A;  2V1R A;  2HZY A;  3CPW P;  4HT8 A;  1H3Z A;  1YIJ Q;  1WFW A;  4KUD K;  1GFD A;  1NYG A;  2LX9 A;  4A4F A;  4JRK A;  2DF6 A;  3GIB A;  3AHU A;  1T3S A;  1N9S A;  1IB8 A;  2FRW A;  4Q5W A;  2CDT A;  1VQ7 T;  1ZLM A;  4DBR A;  1JO8 A;  3QHS A;  2DL7 A;  2L8D A;  4C8Q C;  5GAN d;  1X2Q A;  2L3S A;  3CCS T;  2CP6 A;  1AEY A;  2VUB A;  4M77 D;  2GTJ A;  1M90 C;  3OYC A;  4M7A A;  1WHM A;  5IHK A;  3MEA A;  4KGV B;  2LP5 A;  3CCR Q;  3CMA T;  1OQK A;  3P8B B;  1H3H A;  4JZ4 A;  2EGC A;  2KEA A;  2P84 A;  3E9G A;  3MEV A;  3L2Z A;  3OMG A;  2EYW A;  3WXM B;  3NFC A;  3QYG B;  4F7U B;  2BZ8 A;  1M5Q 1;  1C6V X;  4DOW A;  2D8H A;  2CYZ B;  2EYY A;  2A36 A;  3WVE B;  4UC4 A;  1QP2 A;  2CP0 A;  4M77 B;  4X34 A;  2EQU A;  3MJX A;  3ASK A;  1VQ9 T;  3S6W A;  5LJ3 f;  2ENM A;  1VQM T;  4ZN3 A;  1D3B A;  1K1Z A;  5I22 A;  1W2B P;  5FRO A;  4V2S A;  4LNP A;  5GAN 5;  4J9G A;  2DLP A;  2L0A A;  4ZTJ A;  2RMO A;  4JDS A;  1WJS A;  1UG1 A;  2LJ0 A;  2LT4 A;  2DET A;  2A7Y A;  3A8L B;  2AKK A;  5GAN j;  2BZY A;  1H92 A;  2JMA A;  2VKN A;  1M30 A;  2WSF E;  1F1B B;  2M02 A;  3AT1 B;  2GGR A;  3M5A A;  1M3B A;  4PJO B;  2RHX A;  2V8J A;  4J9I A;  4Z88 A;  4AFU C;  3EH1 A;  1RI9 A;  4QQ6 A;  4KUL A;  2E65 A;  3ZFJ A;  4M78 E;  2P4R A;  4FCY A;  2YUQ A;  1YHQ Q;  3C95 A;  1VQN A;  5GAN f;  1Q82 C;  1MND A;  2CH4 W;  1SF9 A;  3VS5 A;  2Y4X A;  2CP5 A;  1VIE A;  4D8D A;  1JRI A;  2RHI A;  5J39 A;  1G2B A;  2ZCF B;  2LNH B;  2MWO A;  2C0I A;  4C92 G;  1K73 C;  3I55 T;  3R6N A;  2VC8 A;  4C8Q D;  1MGQ A;  2O4X A;  2LJ3 A;  2DL3 A;  2DO3 A;  4OP0 A;  3VRZ A;  1OU9 A;  3DLL A;  2E5Q A;  2D0N A;  2LQ8 A;  3OSV A;  1SHF A;  1B07 A;  4FYY B;  3OB9 A;  4IUV A;  5DLQ E;  2VV5 A;  3H41 A;  3SHW A;  3GLX A;  5LJ5 h;  5LL6 S;  2X4J A;  1ZBX A;  4M75 A;  1TSF A;  2QYZ A;  1GBR A;  4PFP A;  1WI7 A;  3CC4 T;  1W4S A;  4ORZ A;  1VYU A;  3OYG A;  4M7D D;  4L59 A;  1AWJ A;  1M1F A;  2R5M A;  5FU7 C;  1OPK A;  2D6F A;  3RDV A;  1GCP A;  1FYN A;  2GF7 A;  2M1H A;  3TU4 K;  1KJW A;  5GAN 7;  4FM4 B;  4XAX B;  3L2R A;  1Q82 U;  2CT3 A;  4RG2 A;  5FU7 B;  1VQ4 Q;  1OV3 A;  2MWP A;  5GAN 2;  2F69 A;  1ZSZ B;  2V8I A;  1MHN A;  2KNB B;  1EFN A;  3VJP A;  4C5H A;  2DYB A;  3PGG A;  5IT9 E;  2FRY A;  3FB9 A;  3RR6 A;  4C92 C;  1QVP A;  4O6J A;  1VQP Q;  1X2K A;  3FEO A;  4M75 G;  2PUK B;  5GMK j;  2RM4 A;  1N8R U;  5CKE A;  2JXB A;  3M4G A;  1M1K R;  1S72 Q;  3CCE Q;  1WA7 A;  2VXF A;  2JN0 A;  2YDL A;  1N8R C;  1BI3 A;  3V7C A;  2CP2 A;  3CCJ Q;  1V29 B;  2DL4 A;  2KT1 A;  4NOY A;  4XTU A;  2JM9 A;  3R6O A;  1YIT T;  2LJ1 A;  1YCS B;  4PK4 A;  4M7D E;  1NYF A;  1VQ4 A;  2HAX A;  3UF4 A;  2BTT A;  1QVG S;  3G4S Q;  2LQK A;  1VQ5 A;  5AT1 B;  2J05 A;  2E5K A;  3OYN A;  3I5S A;  2F2V A;  1WLP B;  3MPU B;  1E6G A;  3EFS A;  1M1K C;  1H64 1;  3H9N A;  4EMG A;  2EQI A;  2E6N A;  2DA9 A;  1PRL C;  3A8H B;  2MMP A;  1WYX A;  5KH6 A;  3VV0 A;  3ZL7 C;  3OW2 S;  1IRX A;  4C92 F;  2IVW A;  1KHI A;  2K9G A;  1K9M R;  2XDB A;  2EYZ A;  3G71 A;  1RLP C;  1YIT A;  2KT8 A;  2QGF B;  4RMO A;  2LNV A;  2EQK A;  3O8V A;  2LCS A;  3JCM W;  2M51 A;  3FC3 A;  5GAN e;  2ZAE A;  2XD0 A;  3NHN A;  2L5Q A;  3MET A;  2E4H A;  2KXD A;  2GFA A;  2HNI A;  1B3Q A;  1UEC A;  3UPU A;  2HBW A;  3NTH A;  2DE0 X;  4M77 E;  3T9N A;  2DL5 A;  1JU5 C;  3OBW A;  1KQS P;  4TVR A;  4JS5 A;  2DJQ A;  1X43 A;  1U1S A;  2ZPF B;  4PNO A;  2JS2 A;  1LPL A;  3QWX X;  4OB2 B;  2EBP A;  5GAM d;  1WNL A;  3OYH A;  2ATC B;  1AWO A;  1SEM A;  4Z02 A;  1JXM A;  2P0P A;  2H3E B;  4RCC A;  5CCA A;  4C8Q G;  2HSE B;  1IXD A;  1CKB A;  2YRD A;  2KE9 A;  1NJI U;  3FDR A;  1S1N A;  2DM1 A;  1OZ3 A;  1X69 A;  4ATO A;  1OYX A;  1XNI A;  3SWN C;  1SSF A;  3EG3 A;  1B7T A;  1JJ2 A;  5HK3 A;  1NZ9 A;  5A0D A;  1K9M U;  3SB2 A;  1Y0M A;  3VUZ A;  2J06 A;  2R5A A;  3SWN B;  1KD1 U;  4GY5 A;  2WAC A;  5GAM h;  2F5T X;  5LJ5 g;  1M1G A;  1RAA B;  4PJM A;  1VQ9 A;  3P8D A;  2HQH A;  2HCK A;  3JCM X;  2B8A A;  1W70 A;  3JCM J;  1U8R A;  1G83 A;  4J7I A;  4BI4 A;  3CME Q;  1YJ9 Q;  3VS1 A;  1RAB B;  3MP8 A;  3VS6 A;  2Z0W A;  1UB4 A;  2JOY A;  2IIM A;  2J6K A;  2XKO C;  3C12 A;  1KQ2 A;  2LCC A;  4C8Q A;  5KCH A;  1JJ2 S;  4YTL A;  4OGC A;  4J9H A;  1ZQ1 A;  4M75 C;  1N8R R;  4FW2 A;  2X51 A;  3OSS C;  3QXE B;  2E12 A;  1Y07 A;  2VYT A;  4HVV A;  1YHQ T;  2NUZ A;  4F7U G;  2RHY A;  3CMA Q;  3CCR T;  1IZ6 A;  5IAY A;  2RI3 A;  3NTI A;  2A3L A;  1R0C B;  4IUR A;  5GAO l;  3OS0 A;  2RB6 A;  2LT1 A;  4XK8 E;  4EIK A;  4ZN1 A;  4RTV A;  1KD1 C;  4KBM B;  1Q81 U;  4IUP A;  2KGT A;  2JTE A;  2CSQ A;  1QCO A;  1UGV A;  2M0Y A;  4J9D A;  3RIR A;  3M56 A;  1UGR B;  2K3B A;  2EPD A;  1QW1 A;  4GLK A;  2E3H A;  3PTA A;  3PVQ A;  2VVK A;  2BE7 D;  1RAD B;  1LCK A;  1OPL A;  3HTR A;  3CEY A;  3E19 A;  2ZPG B;  4QQD A;  5GAM e;  3G1J A;  2H3J A;  3RER A;  4VUB A;  3VS0 A;  3JCM P;  2C0T A;  5KYX A;  3OW2 A;  4J83 A;  3CCS A;  4PJJ A;  4M75 E;  4FW1 A;  2PVO B;  2X9H A;  1G8X A;  1VQK Q;  4QKU A;  2KXC A;  2K79 A;  4DBF A;  3LGF A;  4XQ3 A;  4D6W A;  2F5K A;  2PVD B;  3QUI A;  2DD4 A;  1PD1 A;  3JV3 A;  2LCL A;  2RJD A;  2G3R A;  3MKD A;  4C8Q F;  1DJ7 B;  1B34 B;  5GAM f;  3JCM h;  1ABQ A;  2ED0 A;  4M7A D;  1VQP T;  5KYU A;  1YJN T;  1N5Z A;  1QLY A;  2DXB A;  3CCV Q;  2ROL A;  3X28 B;  3LX7 A;  1E7O A;  2RO0 A;  2CSI A;  3GOX A;  1VQ5 T;  1UFF A;  2KRO A;  1OUL A;  2EVR A;  2R58 A;  5I2M A;  1YIJ A;  2CZ7 B;  2JNG A;  4A53 A;  1EZZ B;  3N5B B;  3REB B;  4DEX A;  3I9Q A;  5GAN g;  5GJW B;  4EMK B;  3OYA A;  3OS5 A;  5CKD A;  1Y96 B;  4NL2 A;  5A2Q E;  2L89 A;  4HCZ A;  5GAO p;  1YHQ A;  5I21 A;  1CSK A;  1LOJ A;  2EYX A;  2E1H A;  2FL7 A;  1ZBJ A;  3LLR A;  3PNW C;  3LH5 A;  2GQV A;  4XTV A;  2F2X A;  2RI5 A;  3CCL A;  2YT6 A;  3IQL A;  3I35 A;  1KHC A;  5LJ5 f;  4LDX A;  4C5E A;  4N0A C;  4AG1 C;  4AFS C;  2HKQ B;  1ZSZ A;  4A54 A;  3E2U A;  3QZ5 B;  4PJO D;  4JRQ A;  1YWP A;  4ZGE B;  4XTZ A;  3VRY A;  2EJG A;  2QA4 T;  3V7S A;  5D7U A;  1GXI E;  1AZE A;  4OMF B;  2O2O A;  3FIF A;  1Z9Z A;  3CD6 T;  1WJR A;  2RN8 A;  2YLC A;  1KD1 R;  2SEM A;  4JJB A;  2FZC B;  4BUG A;  1UJ0 A;  1G3T A;  1YJ9 A;  1X27 A;  2PQW A;  2HD0 A;  4EDU A;  2MK5 A;  1BI2 A;  4HA8 A;  1BI0 A;  4L6V 5;  1U06 A;  4RKU E;  4A4K A;  3S3M A;  2GTO A;  1I0C A;  3JCM Q;  3CD6 Q;  2LQN A;  3CCQ A;  4C5I A;  4RTW A;  1XOV A;  1OX9 A;  1OX8 A;  1H8K A;  1TXQ A;  4C92 A;  3CCU Q;  2YUO A;  3JB9 G;  5ECA A;  3QBY A;  2AZS A;  3CCM A;  4LE9 A;  5A0L A;  3E9F A;  1VYT A;  4PJO F;  5LJ5 d;  5GAN 3;  3DKM A;  2QTV A;  2PUO B;  1M2V B;  2YRV A;  2MCN A;  1VOM A;  2DEQ A;  1S72 T;  3CCE T;  1BBZ A;  1EIF A;  1VQP A;  1B34 A;  1GL5 A;  3H8Z A;  3M4Y A;  2O31 A;  2H8H A;  2QDL A;  2VGN A;  1K76 A;  3H0F A;  2DL8 A;  3M0T A;  3NTK A;  1MNE A;  3U23 A;  3I56 Q;  2VGM A;  5KCO A;  4FYV B;  3DLM A;  5I11 A;  1Y96 A;  3G4S T;  2IG0 A;  2K2V A;  4KT0 E;  4M78 F;  2XHC A;  4Y28 E;  4F7U E;  1WHG A;  1Y71 A;  2BUD A;  4RTU A;  1FMV A;  1C1A A;  2E3I A;  1VQ8 A;  3PVL A;  4B9X A;  4ZNX A;  4HVW A;  5A0G A;  1P92 A;  1Z9Q A;  1QCF A;  3F70 A;  3ZEH A;  2C06 A;  4M7A G;  3JB9 F;  5FRN A;  4OMQ A;  1QWE A;  2GBQ A;  3G4S A;  3EGD B;  3M0U A;  1FWZ A;  2X4W A;  3QDR B;  5IHI A;  1NPR A;  5IH2 A;  4N0A A;  1V76 A;  4OB3 B; 
#chains in the Genus database with same CATH homology
 3OYF A;  4M77 A;  1YJW A;  3ME9 A;  4FT2 A;  3JCM f;  3A8H B;  1BKB A;  2MMP A;  3OMC A;  5KH6 A;  3VV0 A;  4EPC A;  3OW2 S;  3A5Z B;  4C92 F;  2IVW A;  1KHI A;  1VQ8 T;  1K73 U;  2MAM A;  5CK9 A;  2M16 A;  2XDB A;  3G71 A;  1YIT A;  3MP1 A;  2WSC E;  4RMO A;  2LNV A;  4XTW A;  1I81 A;  2EQK A;  2K4Y A;  3O8V A;  4M77 G;  2RJE A;  2XG8 D;  3JCM W;  3PMI A;  5FU6 C;  3FC3 A;  3LW5 E;  5GAN e;  1KQ1 A;  3TRE A;  5KE2 A;  4JLI A;  2L5Q A;  3MET A;  5I2S A;  3SDZ A;  2EIF A;  3X25 B;  3LYI A;  4C92 D;  3PT9 A;  3CCV A;  2GFA A;  2HNI A;  2K3Y A;  4E7J A;  4BY6 C;  5FLX E;  3JRZ A;  2EKO A;  2RA2 A;  3QJY A;  4ME7 A;  3UT1 A;  3RMQ A;  4BE2 A;  3UPU A;  3CBO A;  3NTH A;  2KK4 A;  1Y7X A;  5GMK i;  2RI2 A;  4M75 D;  4M77 E;  3T9N A;  4CRI A;  1PSF A;  1M9S A;  2K5I A;  3OBW A;  4M77 C;  1W2B S;  1IRE B;  2AHJ B;  4X9C A;  4J5Y A;  3BFM A;  4FIB A;  4TVR A;  3BDU A;  3MEW A;  4JS5 A;  1U1S A;  2ZPF B;  4IKF A;  2XDP A;  1I8F A;  4PNO A;  1VUB A;  3GF5 A;  3HL8 A;  2RK2 A;  4OB2 B;  5GAM d;  1WNL A;  2DIG A;  5IN1 A;  3OYH A;  5LJ3 g;  1O75 A;  5GAN 6;  2QQB A;  2E10 A;  1G3W A;  2EQJ A;  2DIQ A;  4Z02 A;  1RL2 A;  2YHT A;  3QPH A;  5LJ3 j;  2P0P A;  5EG2 A;  3JCM V;  3M59 A;  1M90 U;  4ELY C;  3DB4 A;  4PKC C;  3CPW S;  4RCC A;  5CCA A;  1Q86 C;  4OB1 B;  3VYH B;  4C8Q G;  5GMK h;  5GAN h;  4IUU A;  4PJO G;  4FU6 A;  3CCU T;  2RH2 A;  4EMK C;  5D6W A;  2JTM A;  4DA4 A;  1NJI U;  3FDR A;  1KC8 U;  4LD9 K;  3HRS A;  1OZ3 A;  5DY9 A;  3GPL A;  5GAN 4;  3GNG A;  1VIF A;  3MEU A;  3QKJ A;  4PLI A;  3VUB A;  4ZGD B;  1RI0 A;  4M75 B;  3L2Q A;  3QII A;  2HQE A;  3GP8 A;  1XQH A;  3A8O B;  4ATO A;  1OYX A;  1XNI A;  3SWN C;  1SSF A;  2E64 A;  4QVC A;  1FXX A;  4QVZ A;  1JJ2 A;  3FJP A;  1VQK A;  3HFO A;  1X01 A;  4M7D B;  2DVE A;  1QP3 A;  5HK3 A;  3P8H A;  1NZ9 A;  2CGH A;  2E6Z A;  3X20 B;  2RJF A;  3HP9 A;  5A0D A;  3PMT A;  4II1 A;  4JS4 A;  1WQ7 A;  5CKH A;  2Y4Y A;  3OS1 A;  4BDY A;  1K9M U;  1UEB A;  4M77 F;  3SB2 A;  1VQN T;  1XTD A;  3RKY A;  3VUZ A;  3QG1 A;  1YI2 A;  3X24 B;  3CC7 T;  1BYM A;  4E7H A;  4PL6 A;  3RKX A;  2DKG A;  4MMK A;  4MML A;  5GAM g;  2R5A A;  3CXC A;  3SWN B;  3LWH A;  3OYK A;  2OAU A;  2QQR A;  4FL6 A;  3JB9 J;  1K8A U;  2LVM A;  1KD1 U;  2YLB A;  5GAM j;  4BAC A;  3MP6 A;  4GY5 A;  2WAC A;  1YJW T;  5DM7 R;  2OTJ A;  5GAM h;  3CCU A;  4M78 G;  2F5T X;  5LJ5 g;  4JRP A;  2FB7 A;  2CZ1 B;  1M1G A;  3GNF B;  2BKD N;  4BB7 A;  3CCE A;  1S72 A;  4OGE A;  1HXD A;  5GAO m;  3KUF A;  3BW1 A;  4J6X A;  2KMT A;  1VQ9 A;  4ZGJ B;  3P8D A;  5D6Y A;  4M7A B;  3S3O A;  4LDW A;  4QQG A;  3JCM X;  3CCJ A;  3OYJ A;  2B8A A;  2QXF A;  4NL3 A;  3VKI A;  4N4I A;  3JCM J;  1U8R A;  2KVQ G;  5LJ3 h;  4J7I A;  1O9S A;  3SWN A;  4BI4 A;  3PIO A;  3VU3 C;  1QVG A;  2GFU A;  2RD1 A;  3CBP A;  3M9Q A;  2ZZD A;  3MP8 A;  3OYD A;  1YI2 T;  2CZ6 B;  1PSE A;  1D3B B;  3M53 A;  5HY6 A;  1UB4 A;  2DXU A;  1VQL A;  4C92 E;  4EMH A;  2DAQ A;  5HKC A;  3J80 E;  4A4G A;  2JOY A;  5J3B A;  5LJ5 e;  3CC2 A;  2E70 A;  2P0Q A;  3S3N A;  1YBY A;  4ELZ C;  2XKO C;  3C12 A;  4NS5 A;  4PJO A;  2DTI A;  1KQ2 A;  2L3R A;  2LCC A;  4C8Q A;  5KCH A;  2KDS A;  1JJ2 S;  4YTL A;  4OGC A;  2JZ2 A;  4J8O A;  3M58 A;  4BI3 A;  1OZ2 A;  1ZQ1 A;  1WQW A;  1YCY A;  4M75 C;  3CC4 A;  5CR2 A;  4F7U A;  3CCQ T;  4C8Q B;  4HCB A;  2P0K A;  3OSS C;  3QXE B;  2E12 A;  5L8R E;  3OA6 A;  1Y07 A;  2VYT A;  1YHQ T;  3JCM c;  4FT4 A;  2X4Y A;  3JAM E;  2HBP A;  4F7U G;  5C6S A;  3V8J A;  3CPW A;  2RHY A;  5FRM A;  3CCR T;  1IZ6 A;  1G3Y A;  1BIB A;  4X9D A;  5IAY A;  4E7K A;  4M7A F;  1QVF A;  3EFR A;  1KC8 C;  1N9R A;  2RI3 A;  2M9U A;  1Q7Y C;  4IUQ A;  1NJI C;  3NTI A;  2A3L A;  2EFI A;  5HK0 A;  3JB9 I;  3CPF A;  4PLL A;  4IUR A;  3JB9 H;  1WGS A;  5GAO l;  3OS0 A;  3TCJ A;  2RB6 A;  5CQX A;  2LT1 A;  2KSS A;  3L2V A;  4M7D G;  4J7F A;  4XK8 E;  4C0Z A;  2O01 E;  3HSB A;  4ZN1 A;  4M7D C;  1Q7Y U;  1KD1 C;  4KBM B;  5LJ3 e;  3I56 T;  3HKS A;  1K8A C;  4M7A E;  1W2B A;  1Q81 U;  3I56 A;  2MI6 A;  2D9T A;  4IUP A;  3LGL A;  3QO3 A;  3I55 A;  4P5N A;  4JLG A;  2DTH A;  4BY6 B;  4HT8 A;  1H3Z A;  1K9M C;  4KUD K;  1VQ6 A;  1WPY A;  3RIR A;  3M56 A;  1UGR B;  2D0Q B;  1UGP B;  2LX9 A;  4A4F A;  4JRK A;  3CCJ T;  1QW1 A;  5GAN 8;  3GIB A;  3C4S A;  3HPW A;  3AHU A;  4GLK A;  2RJC A;  4M75 F;  2EWN A;  1N9S A;  3OBY A;  3PTA A;  3H6Z A;  3FRN A;  5CKB A;  4M78 D;  4Q5W A;  3M57 A;  2LC4 A;  3CEY A;  1Q81 C;  3CCV T;  3E19 A;  1VQ7 T;  2ZPG B;  4QQD A;  5GAM e;  5C0M A;  4PJO C;  3SD4 A;  1G5V A;  3QHS A;  1X75 C;  2H3J A;  2L8D A;  4C8Q C;  5GAN d;  3CCM T;  3RER A;  3CCL T;  4VUB A;  3CCS T;  2NLU A;  5GAO q;  3PFS A;  3JCM P;  4MZT A;  3OW2 A;  4J83 A;  4LDY A;  3CCS A;  4LDV A;  2VUB A;  5CQY A;  1N8R C;  4M77 D;  4M75 E;  2JVV A;  2PVO B;  3X26 B;  5CIU A;  1M90 C;  2EJ9 A;  2QQA A;  4E7L A;  3OYC A;  4M7A A;  3ZBD A;  3MEA A;  5AYF A;  2K5L A;  4JUV A;  2KY9 A;  1BIA A;  3CMA T;  5GAO r;  3LGF A;  3L42 A;  3P8B B;  4XQ3 A;  4D6W A;  1KG1 A;  3A8M B;  3BY7 A;  4L5G A;  3PIP A;  2F5K A;  5KE3 A;  1QVF S;  2PVD B;  3QUI A;  2DD4 A;  4N4H A;  3TEE A;  4LDU A;  3JCM e;  3E9G A;  2LCL A;  2RJD A;  3MEV A;  5GMK l;  5GAO n;  3OYE A;  1OI1 A;  4A4H A;  2G3R A;  3L2Z A;  4HCC A;  3OMG A;  4CI0 C;  4M7D A;  4B9W A;  3WXM B;  1TH7 A;  3NFC A;  4C8Q F;  3QYG B;  4F7U B;  1DJ7 B;  4R55 A;  3HHT B;  2MF2 A;  1B34 B;  1M5Q 1;  5D6X A;  2QEX A;  4KUI A;  1ZHI A;  2RHU A;  3JCM h;  4DOW A;  5GAM f;  2CYZ B;  4E7I A;  4M7A D;  3WVE B;  1VQP T;  4UC4 A;  1QP2 A;  4M77 B;  4X34 A;  2EQU A;  3JCM g;  3CMA A;  2DZ9 A;  3J81 E;  3HRT A;  4MDX A;  2GCX A;  2EAY A;  4C8Q E;  2K3X A;  1YJN T;  4PJO E;  3ASK A;  4DOV A;  1VQ9 T;  3S6W A;  1VQO T;  1N6A A;  4OF1 A;  5LJ3 f;  3OYM A;  5CKF A;  2DXB A;  2KAF A;  4WF2 A;  3JCM b;  4BDZ A;  1VQM T;  4ZN3 A;  1D3B A;  2LRQ A;  4Y91 A;  3X28 B;  3CBM A;  3OYL A;  5FRO A;  4V2S A;  3LX7 A;  3CME T;  4ZTF A;  4M78 A;  2LTO A;  5GAN 5;  2QTX A;  2RO0 A;  4QW2 A;  1VQ5 T;  3GOX A;  4ZTJ A;  1VQL T;  3J7A F;  4JDS A;  2XI9 A;  1WJS A;  1Q86 U;  2XD0 A;  1VQ7 A;  3MCA B;  1KQS S;  2LT4 A;  3MHX A;  2A7Y A;  3A8L B;  2R58 A;  5I2M A;  1YIJ A;  3JCM d;  2CZ7 B;  2K57 A;  2JNG A;  3HRU A;  2K5F A;  4A53 A;  5GAN j;  3N5B B;  4E47 A;  4M7A C;  4OB0 B;  4J6W A;  2XU8 A;  1LJO A;  5GAN g;  2WSF E;  3DB3 A;  4EMK B;  1N27 A;  2RHZ A;  3RES A;  2JUF A;  4HT9 A;  3OYA A;  3M5A A;  3RMS A;  3OS5 A;  5J26 A;  5CKD A;  1UGQ B;  1I4K 1;  1FX7 A;  1WJQ A;  1Y96 B;  2RHX A;  4NL2 A;  4HKE A;  4PJO B;  1JB0 E;  2KQW A;  5A2Q E;  3OS2 A;  2V8J A;  5LJ3 d;  2QA4 A;  2L89 A;  4R56 A;  4HCZ A;  5GAO p;  1YHQ A;  3RKW A;  1LOJ A;  4C0F A;  5CVI A;  4BD3 A;  5I21 A;  2VXE A;  2BIV A;  2E1H A;  2E65 A;  2FL7 A;  3QJ6 A;  4KUL A;  3M55 A;  3LLR A;  3PNW C;  4XTX A;  4MZP A;  3V7R A;  3ZFJ A;  4M78 E;  3KBG A;  2GQV A;  4QVD A;  4XTV A;  2DZC A;  4IUT A;  4C92 B;  2RI5 A;  3G6E A;  3C95 A;  4C5G A;  1VQN A;  3V8K A;  3CCL A;  2PU9 B;  3SFM A;  5GAN f;  1Q82 C;  3G6E T;  1KHC A;  5LJ5 f;  1M8V A;  2X4X A;  2Y90 A;  4LDX A;  2Y4X A;  3E1S A;  1VIE A;  4C5E A;  2XID A;  1JRI A;  4N0A C;  2RHI A;  2OTJ T;  2I2L A;  5J39 A;  4J6Y A;  1BI1 A;  2ZCF B;  3L2U A;  2MWO A;  3UWN A;  3JSC A;  3URG A;  4RCB A;  4MDW A;  3EAE A;  4C92 G;  2XDD A;  1K73 C;  4XU0 A;  2DTO A;  5GMK m;  3I55 T;  2VC8 A;  3FLG A;  4C8Q D;  4A54 A;  1MGQ A;  2O4X A;  3QZ5 B;  4JRQ A;  4PJO D;  4ZGE B;  2DO3 A;  2HQX A;  4M78 B;  4XTZ A;  3G7Z A;  2QDY B;  4OP0 A;  2EJG A;  2QA4 T;  1VQO A;  3V7S A;  3DLL A;  2E5Q A;  2LQ8 A;  3OSV A;  1GXI E;  4OMF B;  1VQM A;  2DJZ A;  1G3S A;  3FIF A;  4MZM A;  3CD6 T;  1WJR A;  1YJ9 T;  3VYG A;  2YLC A;  3OB9 A;  4RG8 A;  4LD6 A;  1M1K U;  4BUG A;  1G3T A;  4IUV A;  4C0D C;  3CC2 T;  1NPP A;  2XK0 A;  1YJ9 A;  5DLQ E;  4FSX A;  4DQ2 A;  2VV5 A;  3HFN A;  4BE1 A;  3GLX A;  2PQW A;  2HD0 A;  5LL6 S;  5LJ5 h;  2FHD A;  2X4J A;  2O4X B;  4EDU A;  1ZBX A;  2QI2 A;  3A8G B;  1BI2 A;  4HA8 A;  4M75 A;  1BI0 A;  2WSE E;  2ZPH B;  4L6V 5;  1VQ6 T;  2QQS A;  2OTL T;  2DPP B;  4RKU E;  3CC4 T;  1W4S A;  4A4K A;  3S3M A;  2DK3 A;  3JB9 D;  4JJN K;  3JCM Q;  4C0D B;  3OYG A;  2PVG B;  4M7D D;  4L59 A;  1R8O B;  1M1F A;  4XU1 A;  1U1T A;  3V8L A;  2R5M A;  2ZPE B;  5FU7 C;  4C5I A;  3CCQ A;  1VQK T;  2D6F A;  1XOV A;  3L1A A;  3G71 T;  4C92 A;  3ER0 A;  2GF7 A;  2M1H A;  5M9O A;  3TU4 K;  3JB9 G;  5CO7 A;  3QBY A;  1HK9 A;  4XU3 A;  5FU6 B;  2ZGW A;  5GAN 7;  3CCM A;  4FM4 B;  3OYI A;  4XAX B;  4XTY A;  3L2R A;  5A0L A;  1Q82 U;  3E9F A;  3OYY A;  2R57 A;  2EJF A;  4PJO F;  5LJ5 d;  4A4E A;  4RG2 A;  3DKM A;  5FU7 B;  5GAN 3;  2PUO B;  2RK1 A;  2MWP A;  5GAN 2;  4EMK A;  2F69 A;  2YRV A;  4QQ6 A;  2V8I A;  1MHN A;  2FYK A;  2EYQ A;  3VJP A;  4C5H A;  3QSU A;  4JRI A;  2DXT A;  2DEQ A;  1S72 T;  3CCE T;  1EIF A;  2DD5 A;  1VQP A;  2OTL A;  1B34 A;  3M54 A;  3PGG A;  2CKK A;  3H8Z A;  4O5V A;  3Q1J A;  5CAI A;  1LNX A;  3M4Y A;  4XU2 A;  5IT9 E;  4F7U F;  4OVA A;  1KQS A;  3FB9 A;  1UGS B;  4C92 C;  3CCR A;  1QVP A;  3LH0 A;  4O6J A;  3FEO A;  4M75 G;  2PUK B;  3UDC A;  1I5L A;  2VGN A;  3WVD B;  3OQ5 A;  3CXC S;  1AHJ B;  5GMK j;  2RM4 A;  3KXT A;  3NTK A;  1N8R U;  5CKE A;  2VGM A;  5KCO A;  2LDM A;  2QEX T;  3CD6 A;  4BE0 A;  3M4G A;  3DLM A;  1Y96 A;  3G4S T;  2IG0 A;  2X35 A;  2K2V A;  2JTF A;  2VXF A;  4KT0 E;  3MO8 A;  2JN0 A;  1NE8 A;  4M78 F;  2XHC A;  4Y28 E;  4F7U E;  3LWI A;  3C94 A;  1JBM A;  2FVU A;  1BI3 A;  3L2W A;  1Y71 A;  2BUD A;  3V7C A;  4C0G A;  5GMK e;  1YIJ T;  1M4Z A;  1V29 B;  2E41 A;  4BI8 B;  2CZ0 B;  1YJN A;  1VQ8 A;  4NOY A;  4XTU A;  2P4T A;  4B9X A;  3BDL A;  3R6O A;  1VQ4 T;  3INZ A;  5A0G A;  1YIT T;  3OYB A;  1P92 A;  4M7D E;  1VQ4 A;  2HAX A;  2EQM A;  2DXC A;  3CME A;  3F70 A;  1QVG S;  2LQK A;  3OY9 A;  3QZ9 B;  4M78 C;  3RUX A;  3ZEH A;  1X6O A;  2M0O A;  5DLO A;  1VQ5 A;  2C06 A;  4M7A G;  2V8K A;  3JB9 F;  2ZPB B;  3OYN A;  2XIC A;  2ZPI B;  2QQ9 A;  5FRN A;  2CS7 A;  3EFS A;  3CC7 A;  1M1K C;  3G4S A;  1FWZ A;  1H64 1;  2X4W A;  3QDR B;  1NPR A;  4M7D F;  4EMG A;  4N0A A;  3QYH B;  4N4G A;  5LJ5 j;  2E6N A;  4OB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...