1M1FA

Kid toxin protein from e.coli plasmid r1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
107
Chain Sequence
MERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kid toxin protein
publication title Structural and Functional Analysis of the Kid toxin protein from E.coli plasmid R1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 107
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1fA00
5CKDA 4ELZC 4HKEA 1UB4A 4MZPA 4ELYC 3JSCA 5CQXA 5CKBA 3VUBA 1M1FA 2MF2A 5HK0A 4MDXA 4MZMA 3NFCA 1NE8A 5DLOA 5CO7A 5HK3A 5CK9A 3JRZA 2C06A 3TCJA 2VUBA 4MZTA 5CKFA 4VUBA 5CQYA 4OF1A 5CKEA 5CKHA 5CR2A 3G7ZA 3HPWA 5HKCA 1VUBA 5CCAA 2KMTA 1X75C 4ME7A
chains in the Genus database with same CATH superfamily
2EW3A 4ORZA 1YI2A 4RTXA 2ZGWA 1GXIE 2LRQA 4MZMA 4ZTFA 4XTXA 1ZA2B 1UGPB 4HT8A 1UDLA 1I81A 4N0AC 2D6FA 1WIEA 1WI7A 3CCEA 3FC3A 4F17A 1KFZA 5GAMf 2J7IA 4N0AA 1VIEA 1PNJA 1V29B 3RERA 2OAUA 2RI5A 3VYHB 4D8DA 5CKBA 2DL3A 1OQKA 3OS1A 2ABLA 2RNAA 2D0QB 5A0DA 1WXUA 4IIOA 1VQPQ 1YP5A 4C8QC 4QW2A 2O88A 1KQSA 2D1XA 4PKCC 2KRMA 3DLLA 3V7CA 5CR2A 3JCMV 1BU1A 1JU5C 1YIJQ 1RAIB 2DIGA 1X6GA 3QJYA 1H92A 4BD3A 3HHTB 3JCMf 2P0KA 2RN8A 3X28B 3J7AF 2OI3A 2DERA 1ZBXA 1UFFA 2EQJA 1R0CB 1WLPB 1PKTA 5KYXA 2OX7A 4ZNXA 4KGZB 3O8VA 3EH1A 1NJIU 3EGDA 1HXDA 4JRKA 2EJFA 1AVZC 3CCLQ 1E7OA 2L3QA 3QDRB 1WPYA 5I2SA 3JCMb 1U3OA 2RJCA 4E7JA 2LZ6B 5GMKe 3M5AA 1W2BA 2RD1A 4FT2A 4N4HA 3A98A 1OU8A 2D8JA 1YBYA 1MMGA 2QQBA 1SF9A 3OYEA 2EGAA 3RIRA 2I0NA 4PNOA 2LP5A 5CIUA 4C0DB 5LJ5e 1VQ7Q 2K6DA 1V76A 1OPLA 5GAOm 3PVQA 2A3LA 5AYFA 5EC7A 1O75A 3M54A 2DLPA 2JJ9A 1YJNQ 2VB6A 2EWNA 3NTHA 2OTLT 4IUVA 2EQMA 4Y91A 3LGFA 5HY6A 4BE0A 5I21A 1I0CA 1MMAA 5KYWA 2FPFA 1EX4A 2ZPGB 5GANe 3OB9A 1IO6A 3MEWA 1Q86R 3BDLA 3CCVQ 5A0GA 3MJXA 2NUTB 4J7IA 2KR3A 1HK9A 3RKWA 4B9XA 4BY6C 1IRXA 4EMKB 4M78B 2OTLA 3HRUA 4C92C 2K3BA 1KK7A 1TUGB 4M78E 1M30A 3V8KA 4HVUA 1D0ZA 2FZCB 2EYYA 2L3SA 4FCYA 4RUGA 1VQ4Q 3CXCS 2Y4YA 4A4EA 2DTIA 4C8QD 2DRKA 4FSSA 3QZ9B 5GANd 4ANJA 2RA2A 1H3ZA 1OV3A 4J9FA 2DZCA 4PJOE 1YHQQ 3EH2A 5KE3A 3OYMA 1OPKA 4MDWA 1D3BA 1BI2A 1BI0A 2E6ZA 4GLMA 3OA6A 3OW2S 2RQTA 3A8MB 1W6XA 2ECZA 3M0UA 1GCPA 4PFPA 3QKJA 4RTTA 3CMAT 1KQSP 1RAEB 4L5GA 4FM4B 1WYXA 2KI7A 2B86A 3OYLA 2QA4T 4M7AF 4ESRA 5D6YA 2NUZA 1TTHB 2DRMA 3FRNA 3CMAA 4QVCA 5GMKj 2KE9A 2COYA 3JB9G 4M7DG 1VQ9Q 4BACA 2E41A 4X1VA 2QA4A 3E1SA 3SWNC 4J9EA 3CMEQ 2COWA 4MMLA 1JRIA 4C8QF 3H9NA 2FG0A 3V7RA 3CBOA 2HNIA 3SWNA 4J9CA 1W70A 1X2QA 1U8RA 3VS0A 2MAMA 3GP8A 3JB9I 2JN0A 1HJDA 5DLOA 1MNEA 1UG1A 2K2VA 1T0JA 3MO8A 1OU9A 5GAMh 1M90R 2ZPHB 1K9MR 1IGUA 5GANj 1M90C 3CXCA 3DB3A 4JRQA 1Q86U 4C92D 2CH4A 3OBYA 1KC8R 1OX8A 2CYZB 3TVTA 2VC8A 2EFIA 3GNFB 1WJSA 4B9WA 1NYGA 1D09B 2NWMA 2DX1A 4ZN1A 3JCMh 2FZKB 2JTEA 1YWOA 2W10A 4M75B 1JJ2A 3NMZC 1AT1B 4EMGA 4M75E 2LX9A 4J7FA 2J6OA 2QASA 3MCAB 3OYDA 3L42A 3LH0A 1CSKA 1TWBA 1Q81C 2X4JA 1IREB 1IZ6A 4OB3B 4FYWB 5D7UA 1MV0B 3H0IA 3QIIA 1VQPT 1M8MA 4F14A 4OMNA 5CQXA 2JVVA 4C92F 1RUWA 3BY7A 2ZPFB 4VUBA 2MYSA 2O4XA 3S3OA 1VQPA 2YUOA 5FU7B 3PVLA 2AZVA 2EYQA 2RM4A 2ESWA 4M7DC 4FYXB 5GAOl 3BDUA 1WNLA 2NUPB 4M7DA 3SFMA 3ASKA 1I4K1 3HFOA 2CKKA 7AT1B 3CCLT 3JCMP 4YTLA 4QT7A 5GAMg 2JMAA 3M53A 3ZEHA 1VYUA 2RK2A 3HFNA 4RG2A 3MPUB 3JAME 2LJ1A 5LJ3f 3CPWS 5GMKl 1PHTA 1MMDA 3T9NA 1M90U 3QDFA 4BE2A 3A8HB 2QEXQ 4FIBA 1K9MU 4PL6A 3CCLA 3MEVA 1AZGB 1K9AA 1VQ7T 3O5ZA 3VV0A 1UGVA 4ZGDB 2P4RA 5CO7A 1CKAA 4RTVA 5FW9A 3EHQA 1NPRA 1B34A 3EG1A 1K4US 1YJNT 4L59A 3G4SQ 3PFSA 3JCMg 3CXCP 3ER0A 1QQJA 1VQ7A 1H3HA 4HT9A 3ULRB 1FMKA 4DEXA 4OVAA 2J05A 2MF2A 2XG8D 3L2UA 1YJNA 3HP9A 2GQVA 1VQKQ 4PK4A 5CQYA 2QXFA 2L0AA 2KT8A 1GBRA 2AKLA 1SEMA 1Q81U 3EAEA 1VQ4T 4XU3A 4RTWA 3EFOA 1QVGA 3I5RA 1XOVA 3S3MA 1WJQA 4DBQA 1C1AA 5L8RE 2COZA 2VGNA 4J9DA 3JB9H 2ROTA 2CZ0B 5CKFA 4KRTA 3SHWA 1VQ4A 3X20B 1QCFA 2GGRA 2CP7A 2L3RA 2LTOA 3QHSA 1VUBA 4M7DD 3MP6A 2QQ9A 1X2KA 3CPWA 4JJDA 1WHKA 4RMOA 1QP2A 5GAOq 3BE3A 4PFZA 2O01E 2P0PA 2CP3A 2QYZA 2V8KA 4KH1B 1RAGB 2YRDA 3REAB 3GPLA 5DM7R 3LX7A 2BE9B 2DBKA 2LT1A 1UJYA 2OTJQ 2XU8A 2QAZA 3WXMB 3HKSA 3M0TA 1VQ9T 2E3IA 2OAWA 4EMHA 4A4GA 4AT1B 1VQOT 3KFVA 3CMET 2Z0WA 4M7AG 4AG2C 2OJ2A 2EKOA 4Z02A 5CK9A 2HQHA 4HCZA 5CKEA 2RI3A 2RQVA 3INZA 4F16A 1VQ9A 2FVUA 1RAHB 5CCAA 1BI1A 1X75C 1VQOA 3CMEA 4JRIA 2E5KA 4CRIA 1M2OA 5GAN7 4C8QG 2DETA 1YN8A 2EGEA 4C5GA 3JV3A 1QMCA 4ZN3A 1WXTA 4HVVA 2LCCA 3OYCA 1GCQC 3PGGA 2L2PA 2CP5A 2AHJB 1UJ0A 2BE7D 3QWYA 1FX7A 1JXOA 4EIKA 2DJZA 1LPLA 4JZ4A 2KGTA 4Z88A 2H3JA 2PVGB 3L2VA 1KQSS 2M02A 3OYBA 5A0LA 3EG3A 4KGXB 3RMQA 4TVRA 4GLKA 2L8DA 2DA9A 4R0KA 3M0RA 4XU2A 2X9HA 2LDMA 4XU0A 2XMFA 2GFAA 2PUOB 4C0DC 3UPUA 2RHZA 4A4HA 2VV5A 3CCJQ 2FRWA 2GQIA 5FRNA 5FRMA 3EG9A 3BFMA 5LJ3h 4HXJA 4NL2A 1WZOA 2FL7A 3UT1A 2ZZDA 1OI1A 4IUUA 4C0FA 4AFQC 3L1AA 3A8GB 1T3LA 1W2BS 4J8OA 5EG2A 1JB0E 3CPWP 4AFSC 2XDPA 2K3XA 2YUNA 1I07A 2PTKA 4EMKC 1HSQA 4M78C 4Q5WA 2NUTA 5DLQE 3RMSA 3TREA 2KYBA 2P4TA 1OEBA 4EMKA 3WVEB 4M78A 1QVPA 4C92G 4V2SA 3G71T 1ZA1B 4M7AC 3X26B 3G6EQ 2DXBA 2R5MA 4M7AA 2DILA 1WQWA 4JZ3A 3CCMT 2DXUA 1AWWA 2KROA 4KUIA 3G71A 2JT4A 2QEXT 2KQWA 1UHCA 4LD6A 2CZ6B 2XICA 3I9QA 2QDLA 1WQ7A 2CDTA 2PVDB 3NGPA 4C8QA 2RMOA 5KYYA 2LMJA 3CCMA 1M1GA 2CSQA 1YJ9Q 2QTXA 3QG1A 2QEXA 1NEGA 3G4ST 2HBWA 2M1HA 1OULA 2BZYA 2FB7A 2RHIA 4HCKA 5LJ5h 1KD1C 5KYUB 3H0HA 1N6AA 4MMKA 1ACMB 2LJ3A 1GFCA 1WHMA 2DYIA 3G4SA 1G3YA 1VQKT 3VYGA 1P92A 3FLGA 2AK5A 3OYKA 2ZPEB 2KK4A 2SRCA 4M77B 1RABB 4LN2A 1WGSA 4M77E 5IXFA 2BUDA 5FWBA 2J6FA 1XJWB 1B07A 1W1FA 4M4ZA 3EGXB 3H8ZA 4PJLA 2C0IA 2EQIA 1VQKA 2RI2A 2WSFE 2DJQA 3UA7A 2FHDA 2RJDA 2X51A 1BBZA 3NTKA 4FT4A 1AEYA 4KULA 5GAN4 4C0GA 3I55Q 4E7SA 5IH2A 2IG0A 3J81E 4DQ2A 1UGRB 1WXBA 2HZYA 1BI3A 3TSZA 4M78D 4F7UE 3CPFA 4PLLA 2M0YA 1VQNQ 1U5SA 2F2VA 1JEGA 4J9HA 5GMKm 3CCQQ 3M4YA 3CBMA 4RKUE 1RADB 4M7AD 5FROA 3IQLA 2DBMA 3PE0A 2K57A 5IAYA 4ELZC 2RPNA 5I11A 4C92A 2EKHA 2OTJT 1QKXA 1TUCA 1RAAB 4OGEA 1X69A 3LH5A 4HCBA 2QK0A 1SHGA 4M75C 1G2BA 2HL3A 2EYZA 5A2QE 2CGHA 2EJ9A 2YUQA 4PJOB 2F1LA 3QUIA 4OP0A 3OY9A 2OTJA 8ATCB 4J6WA 1LVKA 4MZPA 2HAXA 2LQ8A 2EYXA 3C94A 3EHRA 2CZ1B 4LDUA 1LJOA 3PIPA 1BCOA 4KH0B 2QI2A 2MOXA 1OZ3A 4M78F 1KD1U 4FL6A 2KXCA 1JJ2S 5IHNA 2W0ZA 3CC2Q 1Y0MA 1SRMA 5FU7C 2LNHB 2E10A 4XQ3A 3M58A 1UTIA 3M55A 2VGMA 2QTVA 1PD1A 3ZFJA 4II1A 1G5VA 2FEIA 4PJOF 3VS5A 2K5LA 3H0FA 1QLYA 1ZX6A 1JO8A 1Q7YC 4PJJA 1K73C 1UGSB 2LQNA 3FJPA 4IUTA 2DEQA 3JSCA 4LUEA 1YJWQ 4EPCA 3KXTA 1NM7A 1QP3A 3CC4Q 1W2BP 2DXCA 1M2VB 1NEBA 4FYYB 2MPXC 4BI8B 1YNZA 2KNBB 3SDZA 3UDCA 1YCSB 4X9CA 2MIOA 3DLMA 4D8KA 3HRTA 2HD0A 2HL5C 2DKGA 1W4SA 2LX7A 2XK0A 2CT3A 4JS4A 5GMKi 1PRMC 1X6OA 2QQAA 5KE2A 1NPPA 3TCJA 2EYWA 4M75D 4MZTA 2FRYA 4XTVA 4WTOB 5GAN6 1SPKA 5KYWB 1YWPA 4FU6A 1XTDA 4OMMA 2VXFA 2A7YA 1TUDA 3S6WA 1G3TA 4UC4A 3AHUA 2DD5A 4BY6B 3G6ET 2DNUA 3H6ZA 2JXBA 2KAFA 3KUFA 2K4YA 4E2FB 2RHUA 4J83A 2VUBA 4AMCA 5GAN8 4CI0C 2KT1A 2XIDA 5GAMe 3GNGA 2YSQA 1Q81R 1EFNA 4DOVA 2MCNA 2QQRA 2EGCA 3DB4A 4DBHA 2IVWA 3G6EA 1YITQ 1D0YA 2X3WD 1ABOA 4LDXA 1KHIA 1FYNA 1WHLA 1YJ9T 1YIJT 1NZ9A 2BKDN 2DF6A 2XI9A 5GAMd 1QVGS 4M75F 2IIMA 2YWWA 3EFRA 2R5AA 3JCMc 2L89A 4E6RA 4K11A 3JCMe 2FO0A 1Q7YU 3RBBB 1YJ9A 1YIJA 1Z9ZA 4A63B 4RCBA 1N8RC 1N9RA 3QO3A 1SKUB 1ZBJA 3GBQA 2DZ9A 1J3TA 1QW1A 2EPDA 4XU1A 3GIBA 3VJPA 4BB7A 3A1PA 3EG2A 2V8JA 3UWNA 4X9DA 3VU3C 5CVIA 1N9SA 3VS1A 1WJRA 2DVJA 4BI3A 1WHHA 2DXTA 2CP2A 5CKDA 3JCMd 1YCYA 2HKNA 2QQSA 2JS2A 3VS7A 3WVDB 3QPHA 1NG2A 4AFUC 1MGQA 4HVWA 1DJ7B 2RJFA 1WHGA 3I55T 1D1CA 3OQ5A 2F2WA 1S1NA 5CKHA 1UUEA 3FDRA 5AT1B 2KVQG 3P8DA 4ZTJA 2M0OA 1VQNT 4J9BA 2RJEA 5ECAA 1VQLQ 1VQ5Q 1D1BA 3RUXA 2WSCE 3CCQT 3CCVT 3I55A 1I5LA 4JRPA 2PNIA 1B7TA 2WACA 2VWFA 4JLGA 3GF5A 1RLQC 3QYHB 2HMAA 1VQNA 1OOTA 2GTJA 5GAMj 3CCQA 3CCVA 1FWZA 4OB1B 4XTWA 1B3QA 1E6GA 5C0MA 1JJ2P 3I56Q 5FU6B 1X27A 1Y7XA 1BCMA 1TU0B 3PIOA 1RAFB 1OX9A 3PMTA 4N4IA 4QVDA 1YHQT 3X25B 2LT4A 1M3BA 5LJ5f 5CAIA 2XDBA 3M59A 4F04B 2QGGA 1M1KC 1FXXA 2K2MA 1RI0A 2DL8A 3U23A 3JCMX 1TG0A 3CCUQ 1N8RU 2ZAEA 1YHQA 2QGFB 5HK3A 1K0XA 4PFOA 1K0SA 1N27A 1SSHA 5GANf 3CC2T 2JM8A 3RKYA 3G7ZA 5HKCA 2EAYA 4M78G 1SHFA 1A0NB 4ME7A 3V8JA 1UGQB 2GCXA 2KEAA 3UATA 2AZSA 2CUDA 3CC2A 3LW5E 1UE9A 2YRCA 2HQXA 2BIVA 4XK8E 1R8OB 1IHWA 4M7DE 2KSSA 2PQWA 4E7LA 1C0MA 1YJWT 3EGUA 1MHNA 2FYKA 5GAOp 2HKQB 3CC4T 4AG1C 4E7KA 4PJOG 1TH7A 1KG1A 2V1RA 3HL8A 4JLIA 2E3HA 4J9GA 2JTMA 3HRSA 2EJGA 1LCKA 1OZ2A 3QSUA 1YJWA 3CC4A 1R77A 1ZSZB 3AT1B 3GOXA 2X35A 1GCQA 2M51A 1M3AA 3CD6Q 1B34B 5FWCA 3JCMQ 2V26A 1BK2A 1NLOC 3CC7Q 2ZPIB 1M1FA 5KYUA 2F2XA 4J6YA 3M56A 1O9SA 4Z89A 1VYTA 4M77C 5KCOA 3FEOA 3JCMW 4OMLA 1RLPC 1Y96B 1K8AR 4M77A 1AD5A 2E64A 1PWTA 1QVFS 1M1KU 1K8AC 2CSIA 1QVGP 3QYGB 5GAN3 3SD4A 4QQ6A 1PG5B 4DBFA 4NL3A 2AIRB 2DEUA 1GRIA 2A36A 1YITT 1JQQA 1ZSGA 2F5KA 2YLBA 3OMCA 2RB6A 4KBMB 2E1HA 2DO3A 3E9FA 4JDSA 2GBQA 5D6WA 4BE1A 1R0BG 2AKKA 1PCXA 4O6JA 1YITA 1LOJA 4N4GA 2ZPBB 2KYMA 3GLXA 5J39A 3M0SA 3QWXX 2CH4W 2EQUA 2ED0A 1KSWA 1SG5A 1WHJA 4XTUA 1NLPC 2GFUA 1ZLMA 2E6NA 4IKFA 3RNJA 1M5Q1 1UEBA 4M75G 2K9GA 1MUZA 2DM1A 2X4XA 1IGQA 2LCSA 1Q82R 2A08A 2F5TX 4PJOC 2FZGB 3L2WA 2E5QA 3CCRQ 2O9VA 1MMNA 3V8LA 2JTFA 1Q82C 2Y4XA 3I5SA 4PJOA 2E70A 5LJ3e 2L5QA 5I2MA 4JUVA 2VASA 1PC0A 1XNIA 2J06A 5LL6S 2RHXA 3DKMA 4CC7A 5GMKh 2C0TA 2K3YA 4B6MA 2LCLA 1VQ8Q 3MEAA 1CKBA 4IIMA 1QVFA 2G6FX 2GTOA 1KD1R 1VA7A 2D0NA 1VQLT 2HSPA 2BZXA 4DBRA 1VQ5T 1UHFA 5LJ3d 4M77D 1JBMA 1I8FA 3VS3A 3QZ5B 4LDVA 1T3SA 6AT1B 1K8AU 2HEQA 1QKWA 1VQLA 1VQ5A 3E9GA 5C6SA 5GANh 5I22A 5LJ3g 4LNPA 4CC3A 3I56T 2E12A 5IT9E 3OSVA 4Y92A 3RDVA 9ATCB 1M2VA 2PU9B 1QCOA 2NYSA 4HA8A 2VKNA 3CCSQ 3FJ5A 4PJMA 3QJ6A 4F7UB 3S3NA 3H41A 3LLRA 3A8LB 2HCKA 1S72Q 2K79A 3I56A 4OMFB 3PMIA 2X4WA 5KH6A 5HCKA 3CCUT 3NHNA 3EG9B 4JPBW 3THKA 4M77F 2DIQA 2KRSA 2P0QA 4RG8A 4PJOD 3I35A 4KGVB 3CCUA 3EFSA 5IXBA 4JJNK 2RO0A 4IURA 1U1TA 1WDXA 1Q82U 1Q86C 4JJCA 4M75A 5LJ5d 3RKXA 3M4GA 1U1SA 5LJ3j 1WA7A 4F7UF 2DL5A 1Z9QA 1BYMA 2MWPA 3OBWA 2A37A 4M7AB 2DTHA 4M7AE 1Q95G 1ABQA 4GY5A 5LJ5g 3OYYA 1E6HA 1AWXA 4IUQA 3VS2A 8AT1B 2V1QA 5M9OA 2D9TA 4LD9K 3F70A 2ENMA 2CT4A 3MP8A 2RQUA 1IHVA 3ZL7C 4C8QB 2E4HA 2R57A 5KYYB 1FMVA 2IPOB 3KBGA 2JMCA 2BZ8A 4C8QE 3CBPA 4MDXA 5GANg 2L3PA 3CD6T 3MKDA 1QVFP 2CS7A 1LNXA 1JXMA 2D8HA 3CQTA 1I5OB 3CEYA 1HD3A 3CC7T 2NUPA 1Q7YR 1K73R 5KYXB 4PJNA 4J9IA 3C4SA 2H3EB 1G8XA 3EGDB 2H8HA 3CD6A 3OYIA 4OGCA 2JUFA 2CUBA 3OYGA 3CC7A 3PNWC 1BIBA 1ZHIA 2YLCA 1VQMQ 3L2ZA 1VQOQ 1GFDA 3R6NA 5LJ5j 2YUPA 4O5VA 3CCJT 2R58A 1X01A 3JCMJ 4XTYA 2JZ2A 1M3CA 2RQRA 2JS0A 4OB2B 5GJWB 4E7HA 3VS6A 2K7AA 4LE9A 3M57A 2GNCA 3SEMA 1PSFA 2ATCB 2HBPA 5KYNA 3CCJA 3M0QA 3L2RA 1BB9A 4WF2A 3UA6A 4JS5A 4X34A 2DL7A 4J6XA 1K9MC 4C5IA 1Y57A 1D0XA 4OMOA 3OYFA 3HSBA 4KT0E 3FB9A 1X6BA 3OS5A 3QXEB 1TSFA 1RL2A 2MWOA 1KC8C 5GAOr 4CC2A 4HCCA 3VRYA 4C92B 1RACB 4C92E 3NTIA 3OW2A 5FU6C 2DK3A 4Y28E 1AHJB 1Y07A 4C0ZA 3CCRT 3SB2A 1PM3A 2KRNA 2JM9A 2XKOC 3LGLA 2CREA 3C95A 1GBQA 1NYFA 4PLIA 2AT1B 3VUBA 1ARKA 3OYAA 1G3SA 1PD0A 2DPPB 1VQ6Q 4D6WA 2K5FA 2FPEA 1VIFA 3Q1JA 4BDZA 1AOJA 2HDAA 2ZCFB 3QBYA 3TEEA 2FPDA 3CCRA 1GL5A 1D3BB 3N5BB 5IN1A 3V7SA 1WFWA 2PZ1A 1VQ8T 2DVEA 1YI2Q 4OB0B 4RCCA 2J6KA 5L23A 1HYOA 1PKSA 3E2UA 1QWEA 1K73U 1N8RR 2CZ7B 3OSSC 1M27C 1QWFA 1H8KA 3A8OB 1MV3A 2O31A 4RTZA 3NFCA 2XHCA 3VS4A 2M16A 2KBTA 3CCEQ 3JRZA 2EIFA 1VQ8A 4OF1A 1YFNA 3M9QA 1PSEA 2ED1A 1G83A 5DY9A 2KY9A 4HKEA 3G71Q 4ELYC 2SEMA 1EIFA 5HK0A 3SWNB 1ZUKA 2LC4A 2VVKA 3A5ZB 3MEUA 3CCMQ 3CCST 1H641 3JB9J 2GF7A 1VOMA 1S72T 4OMPA 1FMWA 4NOYA 4BUGA 1ZSZC 1T0HA 4FSXA 3OYNA 4DOWA 1AWOA 4AFZC 1ZSZA 2YXYA 5IHIA 1KC8U 3CCSA 2JOYA 2MI6A 4KUDK 1WX6A 2QDYB 3LWIA 2CP0A 1S72A 4L6V5 5GAOn 3TSWA 3VUZA 3HTRA 2DTOA 1QCNA 2G3RA 4A53A 2CP6A 1ZUUA 1M9SA 4E7IA 1TXQA 4QQDA 4NS5A 3OYHA 1UB4A 2XDDA 4LDWA 5KCHA 2PVOB 4WCIA 2EBPA 2EQKA 3MHXA 4M77G 1Y96A 4E47A 5GAN2 2YT6A 3OW2P 1IB8A 1C6VX 2B8AA 4BI4A 1M1KR 1N5ZA 2EVRA 4A54A 3ME9A 3OMGA 1BIAA 4FYVB 1K76A 1M4ZA 3ZBDA 4F7UG 1KIKA 2X4YA 2WSEE 1VYVA 2KXDA 2LNVA 4XTZA 2A0FB 1U06A 3RR6A 2OTLQ 1D1AA 3E19A 2YHTA 3P8BB 3PT9A 2DMOA 3HPWA 3JB9D 2DYBA 2YDLA 4JJBA 2QG9B 1TOVA 4J5YA 5GJVB 4RTYA 4BDYA 3FIFA 2O4XB 2JNGA 2C0OA 2P84A 3URGA 4LUDA 4R55A 2JW4A 4DA4A 3BW1A 1MNDA 4CC4B 3OS0A 1AWJA 5J3BA 3TU4K 4A4FA 1ZUYA 4M7DB 5GAN5 2LQKA 2BTTA 2DD4A 2RK1A 3REBB 1BKBA 2VXEA 3R6OA 2LQWA 2MMPA 5FLXE 1AZEA 5D6XA 2HSEB 3C0CA 2NLUA 1V1CA 1VQMT 1EZZB 1NE8A 3D7SB 3L2QA 1XQHA 2HQEA 2LVMA 3PTAA 2Y90A 1TS9A 4QKUA 2MK5A 2RQWA 4LDYA 4LXCA 2A28A 1K1ZA 1VQMA 1G3WA 2RF0A 1NBEB 5IHKA 2PUKB 3C12A 3CMAQ 3JB9F 4M7DF 2ROLA 2I2LA 2O9SA 4FW1A 2RH2A 4OMQA 2E65A 1KQ2A 1RI9A 1SSFA 4A4KA 2QA4Q 3VKIA 3MP1A 3RESA 1IXDA 4DEYA 2XD0A 1Y71A 3G1JA 1KHCA 2V8IA 2KMTA 4GBQA 4R56A 3EG0A 1I1JA 1ZQ1A 2DE0X 2X3XD 3EGXA 3META 2F69A 3X24B 2DL4A 4RTUA 4XAXB 4C5HA 1NJIR 2K5IA 3EFOB 2VYTA 2KDSA 1M8VA 3M0PA 1NJIC 3J80E 5J26A 3OS2A 2O2OA 4ATOA 3TQ7P 1KJWA 1VQ6T 4FW2A 4F7UA 4ZGJB 3VRZA 3NPFA 4P5NA 4ZGEB 1UECA 4QQGA 2LJ0A 3LWHA 3OYJA 1X43A 2DAQA 2DFUA 4IUPA 3UF4A 1SRLA 4Z8AA 1OYXA 1YI2T 1F1BB 2C06A 1VQ6A 1KQ1A 2RHYA 2M9UA 4EDUA 4C5EA 2YRVA 3CCET 3P8HA 3LYIA 4QVZA 4E7ZA 1PRLC
chains in the Genus database with same CATH topology
1YI2A 4RMOA 2ZGWA 1GXIE 1QP2A 2LRQA 2MWPA 3OBWA 5GAOq 4MZMA 4M7AB 4LDXA 1KHIA 4ZTFA 2O01E 2DTHA 2P0PA 4XTXA 4M7AE 1UGPB 3CPWA 1YJ9T 1YIJT 4HT8A 2V8KA 4GY5A 1I81A 4N0AC 1NZ9A 5LJ5g 2D6FA 3GPLA 2BKDN 3OYYA 5DM7R 3CCEA 3FC3A 3LX7A 5GAMf 2XI9A 4N0AA 5GAMd 4IUQA 1QVGS 2LT1A 5M9OA 2D9TA 4M75F 1VIEA 3F70A 4LD9K 3EFRA 1V29B 2R5AA 2L89A 2XU8A 3JCMc 3RERA 3MP8A 3JCMe 3WXMB 1Q7YU 2OAUA 3HKSA 1VQ9T 2RI5A 4C8QB 3VYHB 1YJ9A 4EMHA 2R57A 1YIJA 3KBGA 5CKBA 4RCBA 1N8RC 1N9RA 4A4GA 3QO3A 3CBPA 4C8QE 3OS1A 1VQOT 3CMET 2D0QB 4MDXA 5GANg 4M7AG 5A0DA 2DZ9A 3CD6T 2EKOA 4Z02A 1QW1A 2CS7A 5CK9A 4XU1A 1LNXA 4HCZA 3VJPA 3CEYA 4C8QC 3GIBA 5CKEA 4QW2A 2RI3A 4BB7A 1KQSA 3CC7T 2V8JA 3INZA 4PKCC 4X9DA 3UWNA 3VU3C 3DLLA 3V7CA 5CR2A 5CVIA 1N9SA 1VQ9A 2FVUA 3JCMV 1WJRA 5CCAA 2DIGA 3C4SA 3QJYA 1BI1A 4BD3A 1X75C 4BI3A 1VQOA 3HHTB 2DXTA 3CMEA 4JRIA 3JCMf 2P0KA 4CRIA 5CKDA 3JCMd 3X28B 1YCYA 3OYIA 3CD6A 3J7AF 5GAN7 2QQSA 4C8QG 1ZBXA 4OGCA 2JUFA 2EQJA 3WVDB 3QPHA 4C5GA 3OYGA 3CC7A 1MGQA 3PNWC 1DJ7B 4ZN3A 2RJFA 1BIBA 1ZHIA 3I55T 2LCCA 3OQ5A 3OYCA 3O8VA 5CKHA 1NJIU 3PGGA 1HXDA 2YLCA 3L2ZA 4JRKA 2EJFA 3FDRA 5LJ5j 2KVQG 3P8DA 3QDRB 4O5VA 3CCJT 4ZTJA 2R58A 1X01A 2M0OA 2AHJB 3JCMJ 1VQNT 1WPYA 2RJEA 1FX7A 4XTYA 5I2SA 2DJZA 3JCMb 2JZ2A 2RJCA 3RUXA 4E7JA 2WSCE 4OB2B 3CCQT 5GMKe 3CCVT 3M5AA 4E7HA 3I55A 1W2BA 2H3JA 2PVGB 2RD1A 4FT2A 4JRPA 1I5LA 4N4HA 3M57A 3L2VA 1KQSS 2WACA 3OYBA 1BYMA 5A0LA 4JLGA 3GF5A 1YBYA 1PSFA 4TVRA 2QQBA 3RMQA 4GLKA 3OYEA 3QYHB 2HBPA 3RIRA 2L8DA 3CCJA 4PNOA 5CIUA 4XU2A 4C0DB 5LJ5e 4WF2A 3L2RA 4JS5A 1VQNA 1M90C 4X34A 2LDMA 4J6XA 4XU0A 5GAMj 5GAOm 1K9MC 3CCQA 3CCVA 1FWZA 4OB1B 4XTWA 4C5IA 2A3LA 5AYFA 3OYFA 1O75A 3HSBA 3M54A 4KT0E 2GFAA 3FB9A 2PUOB 3OS5A 2EWNA 3NTHA 3QXEB 4C0DC 3UPUA 1RL2A 4IUVA 2OTLT 2MWOA 5C0MA 2RHZA 4A4HA 2EQMA 5FU6B 4Y91A 3LGFA 5HY6A 4BE0A 5I21A 5GAOr 1KC8C 1Y7XA 2VV5A 4HCCA 3PIOA 2ZPGB 4C92B 5FRNA 5GANe 5FRMA 3OB9A 3BFMA 5LJ3h 3MEWA 4NL2A 3BDLA 3PMTA 4N4IA 4C92E 5A0GA 4QVDA 3NTIA 3OW2A 1YHQT 2FL7A 5FU6C 3UT1A 3X25B 2LT4A 1OI1A 2ZZDA 4J7IA 2DK3A 1HK9A 4IUUA 4Y28E 3RKWA 4B9XA 4BY6C 4C0FA 5CAIA 5LJ5f 2XDBA 3L1AA 1AHJB 4EMKB 3M59A 4M78B 1Y07A 3A8GB 3HRUA 4C0ZA 4C92C 3CCRT 1W2BS 1M1KC 1FXXA 3SB2A 2OTLA 4J8OA 4M78E 3V8KA 5EG2A 1JB0E 1RI0A 3JCMX 2XKOC 3LGLA 3C95A 4PLIA 2XDPA 2K3XA 3VUBA 3OYAA 1G3SA 2DPPB 4D6WA 2K5FA 4Q5WA 4M78C 1VIFA 3RMSA 5DLQE 3Q1JA 3TREA 4EMKC 1YHQA 4BDZA 1N8RU 2P4TA 5HK3A 3CXCS 2Y4YA 4A4EA 2DTIA 3WVEB 4M78A 4EMKA 1N27A 1QVPA 4C92G 2ZCFB 3QBYA 3TEEA 4C8QD 5GANf 4V2SA 5GANd 3QZ9B 3CC2T 3CCRA 3G71T 1D3BB 3N5BB 5IN1A 3V7SA 5GANj 2RA2A 1H3ZA 4M7AC 3RKYA 3X26B 3G7ZA 2DVEA 1VQ8T 2DXBA 5HKCA 2DZCA 2EAYA 2R5MA 4OB0B 4RCCA 4M78G 4M7AA 1WQWA 4ME7A 3V8JA 4PJOE 1UGQB 2GCXA 1K73U 2CZ7B 3OSSC 3CCMT 5KE3A 2DXUA 3OYMA 3A8OB 4MDWA 1D3BA 2XHCA 3NFCA 4KUIA 3CC2A 1BI2A 3LW5E 3G71A 1BI0A 2E6ZA 3OA6A 2M16A 3OW2S 3A8MB 3JRZA 2QEXT 2EIFA 2HQXA 2KQWA 2BIVA 1VQ8A 4XK8E 1R8OB 4OF1A 4LD6A 3M9QA 4M7DE 2KSSA 2CZ6B 2XICA 2PQWA 3QKJA 4E7LA 3CMAT 1PSEA 1WQ7A 2PVDB 1YJWT 5GAOp 1MHNA 2FYKA 4L5GA 4C8QA 4FM4B 3CC4T 3CCMA 1M1GA 4E7KA 4PJOG 5DY9A 3OYLA 2QTXA 1TH7A 2QA4T 4M7AF 3HL8A 1KG1A 2KY9A 3QG1A 4HKEA 4JLIA 4ELYC 2QEXA 5D6YA 1EIFA 2JTMA 3HRSA 5HK0A 3G4ST 2EJGA 3SWNB 3FRNA 2LC4A 3CMAA 4QVCA 2M1HA 5GMKj 1OZ2A 3QSUA 1YJWA 3A5ZB 3JB9G 4M7DG 3CC4A 2FB7A 2RHIA 3MEUA 5LJ5h 1KD1C 4BACA 2E41A 1N6AA 3CCST 2QA4A 4MMKA 1H641 3E1SA 3SWNC 2X35A 3GOXA 3JB9J 4MMLA 2GF7A 1JRIA 4C8QF 3V7RA 1S72T 1B34B 3CBOA 2HNIA 3SWNA 3G4SA 1G3YA 1U8RA 1VQKT 3JCMQ 3VYGA 4NOYA 2MAMA 4BUGA 1P92A 3FLGA 3GP8A 3JB9I 4FSXA 2JN0A 3OYKA 2ZPIB 2ZPEB 2KK4A 1M1FA 4DOWA 3OYNA 4M77B 5DLOA 1KC8U 1WGSA 3CCSA 2JOYA 4J6YA 2MI6A 2K2VA 4M77E 4KUDK 2BUDA 3MO8A 3M56A 5GAMh 1O9SA 2QDYB 3LWIA 1S72A 3H8ZA 4L6V5 2ZPHB 5GAOn 1VQKA 2RI2A 2WSFE 4M77C 3VUZA 5KCOA 2FHDA 2DTOA 2RJDA 3FEOA 3JCMW 3CXCA 2G3RA 4A53A 3DB3A 1Y96B 3NTKA 4FT4A 4M77A 4JRQA 1Q86U 4C92D 1M9SA 2E64A 4E7IA 4KULA 1QVFS 4QQDA 4NS5A 4C0GA 5GAN4 3OYHA 1K8AC 1M1KU 1UB4A 3OBYA 2XDDA 2IG0A 3J81E 4DQ2A 1UGRB 2CYZB 3QYGB 4LDWA 3SD4A 5GAN3 5KCHA 2PVOB 1BI3A 4M78D 4F7UE 2EQKA 2VC8A 3CPFA 3MHXA 4M77G 4PLLA 4QQ6A 4NL3A 2EFIA 3GNFB 1Y96A 1WJSA 1YITT 4E47A 4B9WA 5GAN2 5GMKm 2YLBA 2F5KA 3M4YA 2RB6A 3CBMA 3OMCA 4KBMB 4RKUE 2E1HA 2DO3A 3E9FA 4M7AD 2B8AA 5FROA 4BI4A 4ZN1A 4JDSA 3JCMh 4A54A 2K57A 3ME9A 3OMGA 5D6WA 5IAYA 4BE1A 1BIAA 4ELZC 4M75B 1JJ2A 4C92A 4O6JA 4EMGA 1M4ZA 4M75E 3ZBDA 1YITA 1LOJA 2LX9A 4J7FA 4F7UG 4N4GA 2ZPBB 3GLXA 2OTJT 3MCAB 5J39A 3OYDA 3L42A 4OGEA 2X4YA 3LH0A 4HCBA 2WSEE 4M75C 2EQUA 2LNVA 4XTZA 5A2QE 3E19A 2CGHA 4XTUA 2YHTA 3P8BB 1Q81C 2X4JA 2GFUA 3HPWA 1IREB 1IZ6A 3PT9A 4OB3B 3JB9D 2E6NA 2EJ9A 4J5YA 4BDYA 4PJOB 3FIFA 1VQPT 3QIIA 4IKFA 2O4XB 3QUIA 4OP0A 2JNGA 3OY9A 2OTJA 1M5Q1 1UEBA 3URGA 4J6WA 4R55A 4M75G 4MZPA 4DA4A 3BW1A 5CQXA 2JVVA 2HAXA 4C92F 2X4XA 2LQ8A 2F5TX 3OS0A 3C94A 5J3BA 3TU4K 4PJOC 2CZ1B 2E5QA 1LJOA 3BY7A 4LDUA 3PIPA 3L2WA 3V8LA 4A4FA 2JTFA 5GAN5 1Q82C 4M7DB 2LQKA 2ZPFB 2QI2A 2Y4XA 2DD4A 4VUBA 4PJOA 2E70A 5LJ3e 2O4XA 1OZ3A 2L5QA 2RK1A 4JUVA 4M78F 5I2MA 3S3OA 1BKBA 2VXEA 5FU7B 4FL6A 1VQPA 1KD1U 3R6OA 2EYQA 1JJ2S 2MMPA 5FLXE 2RM4A 4M7DC 5D6XA 1XNIA 5GAOl 5LL6S 2RHXA 3BDUA 1WNLA 3DKMA 4M7DA 5GMKh 3SFMA 5FU7C 2NLUA 2E10A 4XQ3A 1VQMT 3M58A 2K3YA 3ASKA 1I4K1 2LCLA 3HFOA 1NE8A 3M55A 3MEAA 2CKKA 2VGMA 3L2QA 3CCLT 1XQHA 3JCMP 1QVFA 4YTLA 2HQEA 2LVMA 3ZFJA 5GAMg 3PTAA 3M53A 3ZEHA 2Y90A 4II1A 2RK2A 1VQLT 1G5VA 1VQ5T 3HFNA 4RG2A 3JAME 4PJOF 3CPWS 5LJ3f 5LJ3d 4M77D 4LDYA 5GMKl 2K5LA 1JBMA 3T9NA 1M90U 1VQMA 4BE2A 1Q7YC 1I8FA 3A8HB 1G3WA 1UGSB 3QZ5B 4FIBA 4PL6A 1K73C 1K9MU 4LDVA 3CCLA 3MEVA 2PUKB 3FJPA 3C12A 2DEQA 4IUTA 1K8AU 3JSCA 3JB9F 4M7DF 1VQ7T 4EPCA 3VV0A 2I2LA 3KXTA 1VQLA 4ZGDB 1QP3A 3E9GA 1VQ5A 5CO7A 2DXCA 2RH2A 5C6SA 2E65A 1KQ2A 5GANh 5LJ3g 1SSFA 4A4KA 1NPRA 3VKIA 4BI8B 1B34A 3MP1A 3SDZA 3RESA 3UDCA 1YJNT 4L59A 3I56T 3PFSA 4X9CA 3JCMg 2E12A 1Y71A 3ER0A 5IT9E 2XD0A 3DLMA 1KHCA 2V8IA 3HRTA 3OSVA 2HD0A 2KMTA 2DKGA 1VQ7A 4HT9A 4R56A 1W4SA 2PU9B 4HA8A 2XK0A 1ZQ1A 4JS4A 4OVAA 2MF2A 2XG8D 3QJ6A 4F7UB 5GMKi 3X24B 3META 2F69A 3S3NA 3L2UA 1YJNA 4XAXB 4C5HA 1X6OA 2K5IA 2GQVA 2QQAA 3A8LB 3HP9A 3LLRA 2VYTA 4OMFB 5KE2A 1NPPA 3I56A 2KDSA 3TCJA 5CQYA 3PMIA 2X4WA 4M75D 4MZTA 1NJIC 1M8VA 2QXFA 3J80E 5J26A 4XTVA 5KH6A 5GAN6 3OS2A 4ATOA 3CCUT 1VQ6T 4FU6A 1XTDA 1Q81U 4F7UA 4ZGJB 3EAEA 1VQ4T 2VXFA 4XU3A 2A7YA 4P5NA 4ZGEB 4M77F 1QVGA 3S6WA 1G3TA 4QQGA 4UC4A 1XOVA 3LWHA 3S3MA 2DIQA 1WJQA 3OYJA 3AHUA 2DAQA 5L8RE 2DD5A 4IUPA 4BY6B 3G6ET 2P0QA 3H6ZA 2VGNA 3JB9H 2KAFA 1OYXA 2K4YA 3KUFA 2RHUA 4RG8A 1YI2T 4J83A 4PJOD 2CZ0B 3CCUA 3EFSA 2C06A 1VQ6A 2VUBA 2RO0A 4IURA 5CKFA 1KQ1A 1U1TA 2RHYA 5GAN8 4JJNK 4CI0C 1Q82U 1VQ4A 5GAMe 2XIDA 3X20B 3GNGA 2M9UA 4EDUA 1Q86C 4C5EA 4M75A 4DOVA 5LJ5d 2QQRA 2YRVA 3M4GA 3RKXA 1U1SA 5LJ3j 3DB4A 2L3RA 2LTOA 3QHSA 1VUBA 2IVWA 3CCET 3P8HA 3MP6A 3LYIA 4F7UF 4M7DD 4QVZA 2QQ9A 3G6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKD A;  4ELZ C;  4HKE A;  1UB4 A;  4MZP A;  4ELY C;  3JSC A;  5CQX A;  5CKB A;  3VUB A;  1M1F A;  2MF2 A;  5HK0 A;  4MDX A;  4MZM A;  3NFC A;  1NE8 A;  5DLO A;  5CO7 A;  5HK3 A;  5CK9 A;  3JRZ A;  2C06 A;  3TCJ A;  2VUB A;  4MZT A;  5CKF A;  4VUB A;  5CQY A;  4OF1 A;  5CKE A;  5CKH A;  5CR2 A;  3G7Z A;  3HPW A;  5HKC A;  1VUB A;  5CCA A;  2KMT A;  1X75 C;  4ME7 A; 
#chains in the Genus database with same CATH topology
 2EW3 A;  4ORZ A;  1YI2 A;  4RTX A;  2ZGW A;  1GXI E;  2LRQ A;  4MZM A;  4ZTF A;  4XTX A;  1ZA2 B;  1UGP B;  4HT8 A;  1UDL A;  1I81 A;  4N0A C;  2D6F A;  1WIE A;  1WI7 A;  3CCE A;  3FC3 A;  4F17 A;  1KFZ A;  5GAM f;  2J7I A;  4N0A A;  1VIE A;  1PNJ A;  1V29 B;  3RER A;  2OAU A;  2RI5 A;  3VYH B;  4D8D A;  5CKB A;  2DL3 A;  1OQK A;  3OS1 A;  2ABL A;  2RNA A;  2D0Q B;  5A0D A;  1WXU A;  4IIO A;  1VQP Q;  1YP5 A;  4C8Q C;  4QW2 A;  2O88 A;  1KQS A;  2D1X A;  4PKC C;  2KRM A;  3DLL A;  3V7C A;  5CR2 A;  3JCM V;  1BU1 A;  1JU5 C;  1YIJ Q;  1RAI B;  2DIG A;  1X6G A;  3QJY A;  1H92 A;  4BD3 A;  3HHT B;  3JCM f;  2P0K A;  2RN8 A;  3X28 B;  3J7A F;  2OI3 A;  2DER A;  1ZBX A;  1UFF A;  2EQJ A;  1R0C B;  1WLP B;  1PKT A;  5KYX A;  2OX7 A;  4ZNX A;  4KGZ B;  3O8V A;  3EH1 A;  1NJI U;  3EGD A;  1HXD A;  4JRK A;  2EJF A;  1AVZ C;  3CCL Q;  1E7O A;  2L3Q A;  3QDR B;  1WPY A;  5I2S A;  3JCM b;  1U3O A;  2RJC A;  4E7J A;  2LZ6 B;  5GMK e;  3M5A A;  1W2B A;  2RD1 A;  4FT2 A;  4N4H A;  3A98 A;  1OU8 A;  2D8J A;  1YBY A;  1MMG A;  2QQB A;  1SF9 A;  3OYE A;  2EGA A;  3RIR A;  2I0N A;  4PNO A;  2LP5 A;  5CIU A;  4C0D B;  5LJ5 e;  1VQ7 Q;  2K6D A;  1V76 A;  1OPL A;  5GAO m;  3PVQ A;  2A3L A;  5AYF A;  5EC7 A;  1O75 A;  3M54 A;  2DLP A;  2JJ9 A;  1YJN Q;  2VB6 A;  2EWN A;  3NTH A;  2OTL T;  4IUV A;  2EQM A;  4Y91 A;  3LGF A;  5HY6 A;  4BE0 A;  5I21 A;  1I0C A;  1MMA A;  5KYW A;  2FPF A;  1EX4 A;  2ZPG B;  5GAN e;  3OB9 A;  1IO6 A;  3MEW A;  1Q86 R;  3BDL A;  3CCV Q;  5A0G A;  3MJX A;  2NUT B;  4J7I A;  2KR3 A;  1HK9 A;  3RKW A;  4B9X A;  4BY6 C;  1IRX A;  4EMK B;  4M78 B;  2OTL A;  3HRU A;  4C92 C;  2K3B A;  1KK7 A;  1TUG B;  4M78 E;  1M30 A;  3V8K A;  4HVU A;  1D0Z A;  2FZC B;  2EYY A;  2L3S A;  4FCY A;  4RUG A;  1VQ4 Q;  3CXC S;  2Y4Y A;  4A4E A;  2DTI A;  4C8Q D;  2DRK A;  4FSS A;  3QZ9 B;  5GAN d;  4ANJ A;  2RA2 A;  1H3Z A;  1OV3 A;  4J9F A;  2DZC A;  4PJO E;  1YHQ Q;  3EH2 A;  5KE3 A;  3OYM A;  1OPK A;  4MDW A;  1D3B A;  1BI2 A;  1BI0 A;  2E6Z A;  4GLM A;  3OA6 A;  3OW2 S;  2RQT A;  3A8M B;  1W6X A;  2ECZ A;  3M0U A;  1GCP A;  4PFP A;  3QKJ A;  4RTT A;  3CMA T;  1KQS P;  1RAE B;  4L5G A;  4FM4 B;  1WYX A;  2KI7 A;  2B86 A;  3OYL A;  2QA4 T;  4M7A F;  4ESR A;  5D6Y A;  2NUZ A;  1TTH B;  2DRM A;  3FRN A;  3CMA A;  4QVC A;  5GMK j;  2KE9 A;  2COY A;  3JB9 G;  4M7D G;  1VQ9 Q;  4BAC A;  2E41 A;  4X1V A;  2QA4 A;  3E1S A;  3SWN C;  4J9E A;  3CME Q;  2COW A;  4MML A;  1JRI A;  4C8Q F;  3H9N A;  2FG0 A;  3V7R A;  3CBO A;  2HNI A;  3SWN A;  4J9C A;  1W70 A;  1X2Q A;  1U8R A;  3VS0 A;  2MAM A;  3GP8 A;  3JB9 I;  2JN0 A;  1HJD A;  5DLO A;  1MNE A;  1UG1 A;  2K2V A;  1T0J A;  3MO8 A;  1OU9 A;  5GAM h;  1M90 R;  2ZPH B;  1K9M R;  1IGU A;  5GAN j;  1M90 C;  3CXC A;  3DB3 A;  4JRQ A;  1Q86 U;  4C92 D;  2CH4 A;  3OBY A;  1KC8 R;  1OX8 A;  2CYZ B;  3TVT A;  2VC8 A;  2EFI A;  3GNF B;  1WJS A;  4B9W A;  1NYG A;  1D09 B;  2NWM A;  2DX1 A;  4ZN1 A;  3JCM h;  2FZK B;  2JTE A;  1YWO A;  2W10 A;  4M75 B;  1JJ2 A;  3NMZ C;  1AT1 B;  4EMG A;  4M75 E;  2LX9 A;  4J7F A;  2J6O A;  2QAS A;  3MCA B;  3OYD A;  3L42 A;  3LH0 A;  1CSK A;  1TWB A;  1Q81 C;  2X4J A;  1IRE B;  1IZ6 A;  4OB3 B;  4FYW B;  5D7U A;  1MV0 B;  3H0I A;  3QII A;  1VQP T;  1M8M A;  4F14 A;  4OMN A;  5CQX A;  2JVV A;  4C92 F;  1RUW A;  3BY7 A;  2ZPF B;  4VUB A;  2MYS A;  2O4X A;  3S3O A;  1VQP A;  2YUO A;  5FU7 B;  3PVL A;  2AZV A;  2EYQ A;  2RM4 A;  2ESW A;  4M7D C;  4FYX B;  5GAO l;  3BDU A;  1WNL A;  2NUP B;  4M7D A;  3SFM A;  3ASK A;  1I4K 1;  3HFO A;  2CKK A;  7AT1 B;  3CCL T;  3JCM P;  4YTL A;  4QT7 A;  5GAM g;  2JMA A;  3M53 A;  3ZEH A;  1VYU A;  2RK2 A;  3HFN A;  4RG2 A;  3MPU B;  3JAM E;  2LJ1 A;  5LJ3 f;  3CPW S;  5GMK l;  1PHT A;  1MMD A;  3T9N A;  1M90 U;  3QDF A;  4BE2 A;  3A8H B;  2QEX Q;  4FIB A;  1K9M U;  4PL6 A;  3CCL A;  3MEV A;  1AZG B;  1K9A A;  1VQ7 T;  3O5Z A;  3VV0 A;  1UGV A;  4ZGD B;  2P4R A;  5CO7 A;  1CKA A;  4RTV A;  5FW9 A;  3EHQ A;  1NPR A;  1B34 A;  3EG1 A;  1K4U S;  1YJN T;  4L59 A;  3G4S Q;  3PFS A;  3JCM g;  3CXC P;  3ER0 A;  1QQJ A;  1VQ7 A;  1H3H A;  4HT9 A;  3ULR B;  1FMK A;  4DEX A;  4OVA A;  2J05 A;  2MF2 A;  2XG8 D;  3L2U A;  1YJN A;  3HP9 A;  2GQV A;  1VQK Q;  4PK4 A;  5CQY A;  2QXF A;  2L0A A;  2KT8 A;  1GBR A;  2AKL A;  1SEM A;  1Q81 U;  3EAE A;  1VQ4 T;  4XU3 A;  4RTW A;  3EFO A;  1QVG A;  3I5R A;  1XOV A;  3S3M A;  1WJQ A;  4DBQ A;  1C1A A;  5L8R E;  2COZ A;  2VGN A;  4J9D A;  3JB9 H;  2ROT A;  2CZ0 B;  5CKF A;  4KRT A;  3SHW A;  1VQ4 A;  3X20 B;  1QCF A;  2GGR A;  2CP7 A;  2L3R A;  2LTO A;  3QHS A;  1VUB A;  4M7D D;  3MP6 A;  2QQ9 A;  1X2K A;  3CPW A;  4JJD A;  1WHK A;  4RMO A;  1QP2 A;  5GAO q;  3BE3 A;  4PFZ A;  2O01 E;  2P0P A;  2CP3 A;  2QYZ A;  2V8K A;  4KH1 B;  1RAG B;  2YRD A;  3REA B;  3GPL A;  5DM7 R;  3LX7 A;  2BE9 B;  2DBK A;  2LT1 A;  1UJY A;  2OTJ Q;  2XU8 A;  2QAZ A;  3WXM B;  3HKS A;  3M0T A;  1VQ9 T;  2E3I A;  2OAW A;  4EMH A;  4A4G A;  4AT1 B;  1VQO T;  3KFV A;  3CME T;  2Z0W A;  4M7A G;  4AG2 C;  2OJ2 A;  2EKO A;  4Z02 A;  5CK9 A;  2HQH A;  4HCZ A;  5CKE A;  2RI3 A;  2RQV A;  3INZ A;  4F16 A;  1VQ9 A;  2FVU A;  1RAH B;  5CCA A;  1BI1 A;  1X75 C;  1VQO A;  3CME A;  4JRI A;  2E5K A;  4CRI A;  1M2O A;  5GAN 7;  4C8Q G;  2DET A;  1YN8 A;  2EGE A;  4C5G A;  3JV3 A;  1QMC A;  4ZN3 A;  1WXT A;  4HVV A;  2LCC A;  3OYC A;  1GCQ C;  3PGG A;  2L2P A;  2CP5 A;  2AHJ B;  1UJ0 A;  2BE7 D;  3QWY A;  1FX7 A;  1JXO A;  4EIK A;  2DJZ A;  1LPL A;  4JZ4 A;  2KGT A;  4Z88 A;  2H3J A;  2PVG B;  3L2V A;  1KQS S;  2M02 A;  3OYB A;  5A0L A;  3EG3 A;  4KGX B;  3RMQ A;  4TVR A;  4GLK A;  2L8D A;  2DA9 A;  4R0K A;  3M0R A;  4XU2 A;  2X9H A;  2LDM A;  4XU0 A;  2XMF A;  2GFA A;  2PUO B;  4C0D C;  3UPU A;  2RHZ A;  4A4H A;  2VV5 A;  3CCJ Q;  2FRW A;  2GQI A;  5FRN A;  5FRM A;  3EG9 A;  3BFM A;  5LJ3 h;  4HXJ A;  4NL2 A;  1WZO A;  2FL7 A;  3UT1 A;  2ZZD A;  1OI1 A;  4IUU A;  4C0F A;  4AFQ C;  3L1A A;  3A8G B;  1T3L A;  1W2B S;  4J8O A;  5EG2 A;  1JB0 E;  3CPW P;  4AFS C;  2XDP A;  2K3X A;  2YUN A;  1I07 A;  2PTK A;  4EMK C;  1HSQ A;  4M78 C;  4Q5W A;  2NUT A;  5DLQ E;  3RMS A;  3TRE A;  2KYB A;  2P4T A;  1OEB A;  4EMK A;  3WVE B;  4M78 A;  1QVP A;  4C92 G;  4V2S A;  3G71 T;  1ZA1 B;  4M7A C;  3X26 B;  3G6E Q;  2DXB A;  2R5M A;  4M7A A;  2DIL A;  1WQW A;  4JZ3 A;  3CCM T;  2DXU A;  1AWW A;  2KRO A;  4KUI A;  3G71 A;  2JT4 A;  2QEX T;  2KQW A;  1UHC A;  4LD6 A;  2CZ6 B;  2XIC A;  3I9Q A;  2QDL A;  1WQ7 A;  2CDT A;  2PVD B;  3NGP A;  4C8Q A;  2RMO A;  5KYY A;  2LMJ A;  3CCM A;  1M1G A;  2CSQ A;  1YJ9 Q;  2QTX A;  3QG1 A;  2QEX A;  1NEG A;  3G4S T;  2HBW A;  2M1H A;  1OUL A;  2BZY A;  2FB7 A;  2RHI A;  4HCK A;  5LJ5 h;  1KD1 C;  5KYU B;  3H0H A;  1N6A A;  4MMK A;  1ACM B;  2LJ3 A;  1GFC A;  1WHM A;  2DYI A;  3G4S A;  1G3Y A;  1VQK T;  3VYG A;  1P92 A;  3FLG A;  2AK5 A;  3OYK A;  2ZPE B;  2KK4 A;  2SRC A;  4M77 B;  1RAB B;  4LN2 A;  1WGS A;  4M77 E;  5IXF A;  2BUD A;  5FWB A;  2J6F A;  1XJW B;  1B07 A;  1W1F A;  4M4Z A;  3EGX B;  3H8Z A;  4PJL A;  2C0I A;  2EQI A;  1VQK A;  2RI2 A;  2WSF E;  2DJQ A;  3UA7 A;  2FHD A;  2RJD A;  2X51 A;  1BBZ A;  3NTK A;  4FT4 A;  1AEY A;  4KUL A;  5GAN 4;  4C0G A;  3I55 Q;  4E7S A;  5IH2 A;  2IG0 A;  3J81 E;  4DQ2 A;  1UGR B;  1WXB A;  2HZY A;  1BI3 A;  3TSZ A;  4M78 D;  4F7U E;  3CPF A;  4PLL A;  2M0Y A;  1VQN Q;  1U5S A;  2F2V A;  1JEG A;  4J9H A;  5GMK m;  3CCQ Q;  3M4Y A;  3CBM A;  4RKU E;  1RAD B;  4M7A D;  5FRO A;  3IQL A;  2DBM A;  3PE0 A;  2K57 A;  5IAY A;  4ELZ C;  2RPN A;  5I11 A;  4C92 A;  2EKH A;  2OTJ T;  1QKX A;  1TUC A;  1RAA B;  4OGE A;  1X69 A;  3LH5 A;  4HCB A;  2QK0 A;  1SHG A;  4M75 C;  1G2B A;  2HL3 A;  2EYZ A;  5A2Q E;  2CGH A;  2EJ9 A;  2YUQ A;  4PJO B;  2F1L A;  3QUI A;  4OP0 A;  3OY9 A;  2OTJ A;  8ATC B;  4J6W A;  1LVK A;  4MZP A;  2HAX A;  2LQ8 A;  2EYX A;  3C94 A;  3EHR A;  2CZ1 B;  4LDU A;  1LJO A;  3PIP A;  1BCO A;  4KH0 B;  2QI2 A;  2MOX A;  1OZ3 A;  4M78 F;  1KD1 U;  4FL6 A;  2KXC A;  1JJ2 S;  5IHN A;  2W0Z A;  3CC2 Q;  1Y0M A;  1SRM A;  5FU7 C;  2LNH B;  2E10 A;  4XQ3 A;  3M58 A;  1UTI A;  3M55 A;  2VGM A;  2QTV A;  1PD1 A;  3ZFJ A;  4II1 A;  1G5V A;  2FEI A;  4PJO F;  3VS5 A;  2K5L A;  3H0F A;  1QLY A;  1ZX6 A;  1JO8 A;  1Q7Y C;  4PJJ A;  1K73 C;  1UGS B;  2LQN A;  3FJP A;  4IUT A;  2DEQ A;  3JSC A;  4LUE A;  1YJW Q;  4EPC A;  3KXT A;  1NM7 A;  1QP3 A;  3CC4 Q;  1W2B P;  2DXC A;  1M2V B;  1NEB A;  4FYY B;  2MPX C;  4BI8 B;  1YNZ A;  2KNB B;  3SDZ A;  3UDC A;  1YCS B;  4X9C A;  2MIO A;  3DLM A;  4D8K A;  3HRT A;  2HD0 A;  2HL5 C;  2DKG A;  1W4S A;  2LX7 A;  2XK0 A;  2CT3 A;  4JS4 A;  5GMK i;  1PRM C;  1X6O A;  2QQA A;  5KE2 A;  1NPP A;  3TCJ A;  2EYW A;  4M75 D;  4MZT A;  2FRY A;  4XTV A;  4WTO B;  5GAN 6;  1SPK A;  5KYW B;  1YWP A;  4FU6 A;  1XTD A;  4OMM A;  2VXF A;  2A7Y A;  1TUD A;  3S6W A;  1G3T A;  4UC4 A;  3AHU A;  2DD5 A;  4BY6 B;  3G6E T;  2DNU A;  3H6Z A;  2JXB A;  2KAF A;  3KUF A;  2K4Y A;  4E2F B;  2RHU A;  4J83 A;  2VUB A;  4AMC A;  5GAN 8;  4CI0 C;  2KT1 A;  2XID A;  5GAM e;  3GNG A;  2YSQ A;  1Q81 R;  1EFN A;  4DOV A;  2MCN A;  2QQR A;  2EGC A;  3DB4 A;  4DBH A;  2IVW A;  3G6E A;  1YIT Q;  1D0Y A;  2X3W D;  1ABO A;  4LDX A;  1KHI A;  1FYN A;  1WHL A;  1YJ9 T;  1YIJ T;  1NZ9 A;  2BKD N;  2DF6 A;  2XI9 A;  5GAM d;  1QVG S;  4M75 F;  2IIM A;  2YWW A;  3EFR A;  2R5A A;  3JCM c;  2L89 A;  4E6R A;  4K11 A;  3JCM e;  2FO0 A;  1Q7Y U;  3RBB B;  1YJ9 A;  1YIJ A;  1Z9Z A;  4A63 B;  4RCB A;  1N8R C;  1N9R A;  3QO3 A;  1SKU B;  1ZBJ A;  3GBQ A;  2DZ9 A;  1J3T A;  1QW1 A;  2EPD A;  4XU1 A;  3GIB A;  3VJP A;  4BB7 A;  3A1P A;  3EG2 A;  2V8J A;  3UWN A;  4X9D A;  3VU3 C;  5CVI A;  1N9S A;  3VS1 A;  1WJR A;  2DVJ A;  4BI3 A;  1WHH A;  2DXT A;  2CP2 A;  5CKD A;  3JCM d;  1YCY A;  2HKN A;  2QQS A;  2JS2 A;  3VS7 A;  3WVD B;  3QPH A;  1NG2 A;  4AFU C;  1MGQ A;  4HVW A;  1DJ7 B;  2RJF A;  1WHG A;  3I55 T;  1D1C A;  3OQ5 A;  2F2W A;  1S1N A;  5CKH A;  1UUE A;  3FDR A;  5AT1 B;  2KVQ G;  3P8D A;  4ZTJ A;  2M0O A;  1VQN T;  4J9B A;  2RJE A;  5ECA A;  1VQL Q;  1VQ5 Q;  1D1B A;  3RUX A;  2WSC E;  3CCQ T;  3CCV T;  3I55 A;  1I5L A;  4JRP A;  2PNI A;  1B7T A;  2WAC A;  2VWF A;  4JLG A;  3GF5 A;  1RLQ C;  3QYH B;  2HMA A;  1VQN A;  1OOT A;  2GTJ A;  5GAM j;  3CCQ A;  3CCV A;  1FWZ A;  4OB1 B;  4XTW A;  1B3Q A;  1E6G A;  5C0M A;  1JJ2 P;  3I56 Q;  5FU6 B;  1X27 A;  1Y7X A;  1BCM A;  1TU0 B;  3PIO A;  1RAF B;  1OX9 A;  3PMT A;  4N4I A;  4QVD A;  1YHQ T;  3X25 B;  2LT4 A;  1M3B A;  5LJ5 f;  5CAI A;  2XDB A;  3M59 A;  4F04 B;  2QGG A;  1M1K C;  1FXX A;  2K2M A;  1RI0 A;  2DL8 A;  3U23 A;  3JCM X;  1TG0 A;  3CCU Q;  1N8R U;  2ZAE A;  1YHQ A;  2QGF B;  5HK3 A;  1K0X A;  4PFO A;  1K0S A;  1N27 A;  1SSH A;  5GAN f;  3CC2 T;  2JM8 A;  3RKY A;  3G7Z A;  5HKC A;  2EAY A;  4M78 G;  1SHF A;  1A0N B;  4ME7 A;  3V8J A;  1UGQ B;  2GCX A;  2KEA A;  3UAT A;  2AZS A;  2CUD A;  3CC2 A;  3LW5 E;  1UE9 A;  2YRC A;  2HQX A;  2BIV A;  4XK8 E;  1R8O B;  1IHW A;  4M7D E;  2KSS A;  2PQW A;  4E7L A;  1C0M A;  1YJW T;  3EGU A;  1MHN A;  2FYK A;  5GAO p;  2HKQ B;  3CC4 T;  4AG1 C;  4E7K A;  4PJO G;  1TH7 A;  1KG1 A;  2V1R A;  3HL8 A;  4JLI A;  2E3H A;  4J9G A;  2JTM A;  3HRS A;  2EJG A;  1LCK A;  1OZ2 A;  3QSU A;  1YJW A;  3CC4 A;  1R77 A;  1ZSZ B;  3AT1 B;  3GOX A;  2X35 A;  1GCQ A;  2M51 A;  1M3A A;  3CD6 Q;  1B34 B;  5FWC A;  3JCM Q;  2V26 A;  1BK2 A;  1NLO C;  3CC7 Q;  2ZPI B;  1M1F A;  5KYU A;  2F2X A;  4J6Y A;  3M56 A;  1O9S A;  4Z89 A;  1VYT A;  4M77 C;  5KCO A;  3FEO A;  3JCM W;  4OML A;  1RLP C;  1Y96 B;  1K8A R;  4M77 A;  1AD5 A;  2E64 A;  1PWT A;  1QVF S;  1M1K U;  1K8A C;  2CSI A;  1QVG P;  3QYG B;  5GAN 3;  3SD4 A;  4QQ6 A;  1PG5 B;  4DBF A;  4NL3 A;  2AIR B;  2DEU A;  1GRI A;  2A36 A;  1YIT T;  1JQQ A;  1ZSG A;  2F5K A;  2YLB A;  3OMC A;  2RB6 A;  4KBM B;  2E1H A;  2DO3 A;  3E9F A;  4JDS A;  2GBQ A;  5D6W A;  4BE1 A;  1R0B G;  2AKK A;  1PCX A;  4O6J A;  1YIT A;  1LOJ A;  4N4G A;  2ZPB B;  2KYM A;  3GLX A;  5J39 A;  3M0S A;  3QWX X;  2CH4 W;  2EQU A;  2ED0 A;  1KSW A;  1SG5 A;  1WHJ A;  4XTU A;  1NLP C;  2GFU A;  1ZLM A;  2E6N A;  4IKF A;  3RNJ A;  1M5Q 1;  1UEB A;  4M75 G;  2K9G A;  1MUZ A;  2DM1 A;  2X4X A;  1IGQ A;  2LCS A;  1Q82 R;  2A08 A;  2F5T X;  4PJO C;  2FZG B;  3L2W A;  2E5Q A;  3CCR Q;  2O9V A;  1MMN A;  3V8L A;  2JTF A;  1Q82 C;  2Y4X A;  3I5S A;  4PJO A;  2E70 A;  5LJ3 e;  2L5Q A;  5I2M A;  4JUV A;  2VAS A;  1PC0 A;  1XNI A;  2J06 A;  5LL6 S;  2RHX A;  3DKM A;  4CC7 A;  5GMK h;  2C0T A;  2K3Y A;  4B6M A;  2LCL A;  1VQ8 Q;  3MEA A;  1CKB A;  4IIM A;  1QVF A;  2G6F X;  2GTO A;  1KD1 R;  1VA7 A;  2D0N A;  1VQL T;  2HSP A;  2BZX A;  4DBR A;  1VQ5 T;  1UHF A;  5LJ3 d;  4M77 D;  1JBM A;  1I8F A;  3VS3 A;  3QZ5 B;  4LDV A;  1T3S A;  6AT1 B;  1K8A U;  2HEQ A;  1QKW A;  1VQL A;  1VQ5 A;  3E9G A;  5C6S A;  5GAN h;  5I22 A;  5LJ3 g;  4LNP A;  4CC3 A;  3I56 T;  2E12 A;  5IT9 E;  3OSV A;  4Y92 A;  3RDV A;  9ATC B;  1M2V A;  2PU9 B;  1QCO A;  2NYS A;  4HA8 A;  2VKN A;  3CCS Q;  3FJ5 A;  4PJM A;  3QJ6 A;  4F7U B;  3S3N A;  3H41 A;  3LLR A;  3A8L B;  2HCK A;  1S72 Q;  2K79 A;  3I56 A;  4OMF B;  3PMI A;  2X4W A;  5KH6 A;  5HCK A;  3CCU T;  3NHN A;  3EG9 B;  4JPB W;  3THK A;  4M77 F;  2DIQ A;  2KRS A;  2P0Q A;  4RG8 A;  4PJO D;  3I35 A;  4KGV B;  3CCU A;  3EFS A;  5IXB A;  4JJN K;  2RO0 A;  4IUR A;  1U1T A;  1WDX A;  1Q82 U;  1Q86 C;  4JJC A;  4M75 A;  5LJ5 d;  3RKX A;  3M4G A;  1U1S A;  5LJ3 j;  1WA7 A;  4F7U F;  2DL5 A;  1Z9Q A;  1BYM A;  2MWP A;  3OBW A;  2A37 A;  4M7A B;  2DTH A;  4M7A E;  1Q95 G;  1ABQ A;  4GY5 A;  5LJ5 g;  3OYY A;  1E6H A;  1AWX A;  4IUQ A;  3VS2 A;  8AT1 B;  2V1Q A;  5M9O A;  2D9T A;  4LD9 K;  3F70 A;  2ENM A;  2CT4 A;  3MP8 A;  2RQU A;  1IHV A;  3ZL7 C;  4C8Q B;  2E4H A;  2R57 A;  5KYY B;  1FMV A;  2IPO B;  3KBG A;  2JMC A;  2BZ8 A;  4C8Q E;  3CBP A;  4MDX A;  5GAN g;  2L3P A;  3CD6 T;  3MKD A;  1QVF P;  2CS7 A;  1LNX A;  1JXM A;  2D8H A;  3CQT A;  1I5O B;  3CEY A;  1HD3 A;  3CC7 T;  2NUP A;  1Q7Y R;  1K73 R;  5KYX B;  4PJN A;  4J9I A;  3C4S A;  2H3E B;  1G8X A;  3EGD B;  2H8H A;  3CD6 A;  3OYI A;  4OGC A;  2JUF A;  2CUB A;  3OYG A;  3CC7 A;  3PNW C;  1BIB A;  1ZHI A;  2YLC A;  1VQM Q;  3L2Z A;  1VQO Q;  1GFD A;  3R6N A;  5LJ5 j;  2YUP A;  4O5V A;  3CCJ T;  2R58 A;  1X01 A;  3JCM J;  4XTY A;  2JZ2 A;  1M3C A;  2RQR A;  2JS0 A;  4OB2 B;  5GJW B;  4E7H A;  3VS6 A;  2K7A A;  4LE9 A;  3M57 A;  2GNC A;  3SEM A;  1PSF A;  2ATC B;  2HBP A;  5KYN A;  3CCJ A;  3M0Q A;  3L2R A;  1BB9 A;  4WF2 A;  3UA6 A;  4JS5 A;  4X34 A;  2DL7 A;  4J6X A;  1K9M C;  4C5I A;  1Y57 A;  1D0X A;  4OMO A;  3OYF A;  3HSB A;  4KT0 E;  3FB9 A;  1X6B A;  3OS5 A;  3QXE B;  1TSF A;  1RL2 A;  2MWO A;  1KC8 C;  5GAO r;  4CC2 A;  4HCC A;  3VRY A;  4C92 B;  1RAC B;  4C92 E;  3NTI A;  3OW2 A;  5FU6 C;  2DK3 A;  4Y28 E;  1AHJ B;  1Y07 A;  4C0Z A;  3CCR T;  3SB2 A;  1PM3 A;  2KRN A;  2JM9 A;  2XKO C;  3LGL A;  2CRE A;  3C95 A;  1GBQ A;  1NYF A;  4PLI A;  2AT1 B;  3VUB A;  1ARK A;  3OYA A;  1G3S A;  1PD0 A;  2DPP B;  1VQ6 Q;  4D6W A;  2K5F A;  2FPE A;  1VIF A;  3Q1J A;  4BDZ A;  1AOJ A;  2HDA A;  2ZCF B;  3QBY A;  3TEE A;  2FPD A;  3CCR A;  1GL5 A;  1D3B B;  3N5B B;  5IN1 A;  3V7S A;  1WFW A;  2PZ1 A;  1VQ8 T;  2DVE A;  1YI2 Q;  4OB0 B;  4RCC A;  2J6K A;  5L23 A;  1HYO A;  1PKS A;  3E2U A;  1QWE A;  1K73 U;  1N8R R;  2CZ7 B;  3OSS C;  1M27 C;  1QWF A;  1H8K A;  3A8O B;  1MV3 A;  2O31 A;  4RTZ A;  3NFC A;  2XHC A;  3VS4 A;  2M16 A;  2KBT A;  3CCE Q;  3JRZ A;  2EIF A;  1VQ8 A;  4OF1 A;  1YFN A;  3M9Q A;  1PSE A;  2ED1 A;  1G83 A;  5DY9 A;  2KY9 A;  4HKE A;  3G71 Q;  4ELY C;  2SEM A;  1EIF A;  5HK0 A;  3SWN B;  1ZUK A;  2LC4 A;  2VVK A;  3A5Z B;  3MEU A;  3CCM Q;  3CCS T;  1H64 1;  3JB9 J;  2GF7 A;  1VOM A;  1S72 T;  4OMP A;  1FMW A;  4NOY A;  4BUG A;  1ZSZ C;  1T0H A;  4FSX A;  3OYN A;  4DOW A;  1AWO A;  4AFZ C;  1ZSZ A;  2YXY A;  5IHI A;  1KC8 U;  3CCS A;  2JOY A;  2MI6 A;  4KUD K;  1WX6 A;  2QDY B;  3LWI A;  2CP0 A;  1S72 A;  4L6V 5;  5GAO n;  3TSW A;  3VUZ A;  3HTR A;  2DTO A;  1QCN A;  2G3R A;  4A53 A;  2CP6 A;  1ZUU A;  1M9S A;  4E7I A;  1TXQ A;  4QQD A;  4NS5 A;  3OYH A;  1UB4 A;  2XDD A;  4LDW A;  5KCH A;  2PVO B;  4WCI A;  2EBP A;  2EQK A;  3MHX A;  4M77 G;  1Y96 A;  4E47 A;  5GAN 2;  2YT6 A;  3OW2 P;  1IB8 A;  1C6V X;  2B8A A;  4BI4 A;  1M1K R;  1N5Z A;  2EVR A;  4A54 A;  3ME9 A;  3OMG A;  1BIA A;  4FYV B;  1K76 A;  1M4Z A;  3ZBD A;  4F7U G;  1KIK A;  2X4Y A;  2WSE E;  1VYV A;  2KXD A;  2LNV A;  4XTZ A;  2A0F B;  1U06 A;  3RR6 A;  2OTL Q;  1D1A A;  3E19 A;  2YHT A;  3P8B B;  3PT9 A;  2DMO A;  3HPW A;  3JB9 D;  2DYB A;  2YDL A;  4JJB A;  2QG9 B;  1TOV A;  4J5Y A;  5GJV B;  4RTY A;  4BDY A;  3FIF A;  2O4X B;  2JNG A;  2C0O A;  2P84 A;  3URG A;  4LUD A;  4R55 A;  2JW4 A;  4DA4 A;  3BW1 A;  1MND A;  4CC4 B;  3OS0 A;  1AWJ A;  5J3B A;  3TU4 K;  4A4F A;  1ZUY A;  4M7D B;  5GAN 5;  2LQK A;  2BTT A;  2DD4 A;  2RK1 A;  3REB B;  1BKB A;  2VXE A;  3R6O A;  2LQW A;  2MMP A;  5FLX E;  1AZE A;  5D6X A;  2HSE B;  3C0C A;  2NLU A;  1V1C A;  1VQM T;  1EZZ B;  1NE8 A;  3D7S B;  3L2Q A;  1XQH A;  2HQE A;  2LVM A;  3PTA A;  2Y90 A;  1TS9 A;  4QKU A;  2MK5 A;  2RQW A;  4LDY A;  4LXC A;  2A28 A;  1K1Z A;  1VQM A;  1G3W A;  2RF0 A;  1NBE B;  5IHK A;  2PUK B;  3C12 A;  3CMA Q;  3JB9 F;  4M7D F;  2ROL A;  2I2L A;  2O9S A;  4FW1 A;  2RH2 A;  4OMQ A;  2E65 A;  1KQ2 A;  1RI9 A;  1SSF A;  4A4K A;  2QA4 Q;  3VKI A;  3MP1 A;  3RES A;  1IXD A;  4DEY A;  2XD0 A;  1Y71 A;  3G1J A;  1KHC A;  2V8I A;  2KMT A;  4GBQ A;  4R56 A;  3EG0 A;  1I1J A;  1ZQ1 A;  2DE0 X;  2X3X D;  3EGX A;  3MET A;  2F69 A;  3X24 B;  2DL4 A;  4RTU A;  4XAX B;  4C5H A;  1NJI R;  2K5I A;  3EFO B;  2VYT A;  2KDS A;  1M8V A;  3M0P A;  1NJI C;  3J80 E;  5J26 A;  3OS2 A;  2O2O A;  4ATO A;  3TQ7 P;  1KJW A;  1VQ6 T;  4FW2 A;  4F7U A;  4ZGJ B;  3VRZ A;  3NPF A;  4P5N A;  4ZGE B;  1UEC A;  4QQG A;  2LJ0 A;  3LWH A;  3OYJ A;  1X43 A;  2DAQ A;  2DFU A;  4IUP A;  3UF4 A;  1SRL A;  4Z8A A;  1OYX A;  1YI2 T;  1F1B B;  2C06 A;  1VQ6 A;  1KQ1 A;  2RHY A;  2M9U A;  4EDU A;  4C5E A;  2YRV A;  3CCE T;  3P8H A;  3LYI A;  4QVZ A;  4E7Z A;  1PRL C; 
#chains in the Genus database with same CATH homology
 1YI2 A;  4RMO A;  2ZGW A;  1GXI E;  1QP2 A;  2LRQ A;  2MWP A;  3OBW A;  5GAO q;  4MZM A;  4M7A B;  4LDX A;  1KHI A;  4ZTF A;  2O01 E;  2DTH A;  2P0P A;  4XTX A;  4M7A E;  1UGP B;  3CPW A;  1YJ9 T;  1YIJ T;  4HT8 A;  2V8K A;  4GY5 A;  1I81 A;  4N0A C;  1NZ9 A;  5LJ5 g;  2D6F A;  3GPL A;  2BKD N;  3OYY A;  5DM7 R;  3CCE A;  3FC3 A;  3LX7 A;  5GAM f;  2XI9 A;  4N0A A;  5GAM d;  4IUQ A;  1QVG S;  2LT1 A;  5M9O A;  2D9T A;  4M75 F;  1VIE A;  3F70 A;  4LD9 K;  3EFR A;  1V29 B;  2R5A A;  2L89 A;  2XU8 A;  3JCM c;  3RER A;  3MP8 A;  3JCM e;  3WXM B;  1Q7Y U;  2OAU A;  3HKS A;  1VQ9 T;  2RI5 A;  4C8Q B;  3VYH B;  1YJ9 A;  4EMH A;  2R57 A;  1YIJ A;  3KBG A;  5CKB A;  4RCB A;  1N8R C;  1N9R A;  4A4G A;  3QO3 A;  3CBP A;  4C8Q E;  3OS1 A;  1VQO T;  3CME T;  2D0Q B;  4MDX A;  5GAN g;  4M7A G;  5A0D A;  2DZ9 A;  3CD6 T;  2EKO A;  4Z02 A;  1QW1 A;  2CS7 A;  5CK9 A;  4XU1 A;  1LNX A;  4HCZ A;  3VJP A;  3CEY A;  4C8Q C;  3GIB A;  5CKE A;  4QW2 A;  2RI3 A;  4BB7 A;  1KQS A;  3CC7 T;  2V8J A;  3INZ A;  4PKC C;  4X9D A;  3UWN A;  3VU3 C;  3DLL A;  3V7C A;  5CR2 A;  5CVI A;  1N9S A;  1VQ9 A;  2FVU A;  3JCM V;  1WJR A;  5CCA A;  2DIG A;  3C4S A;  3QJY A;  1BI1 A;  4BD3 A;  1X75 C;  4BI3 A;  1VQO A;  3HHT B;  2DXT A;  3CME A;  4JRI A;  3JCM f;  2P0K A;  4CRI A;  5CKD A;  3JCM d;  3X28 B;  1YCY A;  3OYI A;  3CD6 A;  3J7A F;  5GAN 7;  2QQS A;  4C8Q G;  1ZBX A;  4OGC A;  2JUF A;  2EQJ A;  3WVD B;  3QPH A;  4C5G A;  3OYG A;  3CC7 A;  1MGQ A;  3PNW C;  1DJ7 B;  4ZN3 A;  2RJF A;  1BIB A;  1ZHI A;  3I55 T;  2LCC A;  3OQ5 A;  3OYC A;  3O8V A;  5CKH A;  1NJI U;  3PGG A;  1HXD A;  2YLC A;  3L2Z A;  4JRK A;  2EJF A;  3FDR A;  5LJ5 j;  2KVQ G;  3P8D A;  3QDR B;  4O5V A;  3CCJ T;  4ZTJ A;  2R58 A;  1X01 A;  2M0O A;  2AHJ B;  3JCM J;  1VQN T;  1WPY A;  2RJE A;  1FX7 A;  4XTY A;  5I2S A;  2DJZ A;  3JCM b;  2JZ2 A;  2RJC A;  3RUX A;  4E7J A;  2WSC E;  4OB2 B;  3CCQ T;  5GMK e;  3CCV T;  3M5A A;  4E7H A;  3I55 A;  1W2B A;  2H3J A;  2PVG B;  2RD1 A;  4FT2 A;  4JRP A;  1I5L A;  4N4H A;  3M57 A;  3L2V A;  1KQS S;  2WAC A;  3OYB A;  1BYM A;  5A0L A;  4JLG A;  3GF5 A;  1YBY A;  1PSF A;  4TVR A;  2QQB A;  3RMQ A;  4GLK A;  3OYE A;  3QYH B;  2HBP A;  3RIR A;  2L8D A;  3CCJ A;  4PNO A;  5CIU A;  4XU2 A;  4C0D B;  5LJ5 e;  4WF2 A;  3L2R A;  4JS5 A;  1VQN A;  1M90 C;  4X34 A;  2LDM A;  4J6X A;  4XU0 A;  5GAM j;  5GAO m;  1K9M C;  3CCQ A;  3CCV A;  1FWZ A;  4OB1 B;  4XTW A;  4C5I A;  2A3L A;  5AYF A;  3OYF A;  1O75 A;  3HSB A;  3M54 A;  4KT0 E;  2GFA A;  3FB9 A;  2PUO B;  3OS5 A;  2EWN A;  3NTH A;  3QXE B;  4C0D C;  3UPU A;  1RL2 A;  4IUV A;  2OTL T;  2MWO A;  5C0M A;  2RHZ A;  4A4H A;  2EQM A;  5FU6 B;  4Y91 A;  3LGF A;  5HY6 A;  4BE0 A;  5I21 A;  5GAO r;  1KC8 C;  1Y7X A;  2VV5 A;  4HCC A;  3PIO A;  2ZPG B;  4C92 B;  5FRN A;  5GAN e;  5FRM A;  3OB9 A;  3BFM A;  5LJ3 h;  3MEW A;  4NL2 A;  3BDL A;  3PMT A;  4N4I A;  4C92 E;  5A0G A;  4QVD A;  3NTI A;  3OW2 A;  1YHQ T;  2FL7 A;  5FU6 C;  3UT1 A;  3X25 B;  2LT4 A;  1OI1 A;  2ZZD A;  4J7I A;  2DK3 A;  1HK9 A;  4IUU A;  4Y28 E;  3RKW A;  4B9X A;  4BY6 C;  4C0F A;  5CAI A;  5LJ5 f;  2XDB A;  3L1A A;  1AHJ B;  4EMK B;  3M59 A;  4M78 B;  1Y07 A;  3A8G B;  3HRU A;  4C0Z A;  4C92 C;  3CCR T;  1W2B S;  1M1K C;  1FXX A;  3SB2 A;  2OTL A;  4J8O A;  4M78 E;  3V8K A;  5EG2 A;  1JB0 E;  1RI0 A;  3JCM X;  2XKO C;  3LGL A;  3C95 A;  4PLI A;  2XDP A;  2K3X A;  3VUB A;  3OYA A;  1G3S A;  2DPP B;  4D6W A;  2K5F A;  4Q5W A;  4M78 C;  1VIF A;  3RMS A;  5DLQ E;  3Q1J A;  3TRE A;  4EMK C;  1YHQ A;  4BDZ A;  1N8R U;  2P4T A;  5HK3 A;  3CXC S;  2Y4Y A;  4A4E A;  2DTI A;  3WVE B;  4M78 A;  4EMK A;  1N27 A;  1QVP A;  4C92 G;  2ZCF B;  3QBY A;  3TEE A;  4C8Q D;  5GAN f;  4V2S A;  5GAN d;  3QZ9 B;  3CC2 T;  3CCR A;  3G71 T;  1D3B B;  3N5B B;  5IN1 A;  3V7S A;  5GAN j;  2RA2 A;  1H3Z A;  4M7A C;  3RKY A;  3X26 B;  3G7Z A;  2DVE A;  1VQ8 T;  2DXB A;  5HKC A;  2DZC A;  2EAY A;  2R5M A;  4OB0 B;  4RCC A;  4M78 G;  4M7A A;  1WQW A;  4ME7 A;  3V8J A;  4PJO E;  1UGQ B;  2GCX A;  1K73 U;  2CZ7 B;  3OSS C;  3CCM T;  5KE3 A;  2DXU A;  3OYM A;  3A8O B;  4MDW A;  1D3B A;  2XHC A;  3NFC A;  4KUI A;  3CC2 A;  1BI2 A;  3LW5 E;  3G71 A;  1BI0 A;  2E6Z A;  3OA6 A;  2M16 A;  3OW2 S;  3A8M B;  3JRZ A;  2QEX T;  2EIF A;  2HQX A;  2KQW A;  2BIV A;  1VQ8 A;  4XK8 E;  1R8O B;  4OF1 A;  4LD6 A;  3M9Q A;  4M7D E;  2KSS A;  2CZ6 B;  2XIC A;  2PQW A;  3QKJ A;  4E7L A;  3CMA T;  1PSE A;  1WQ7 A;  2PVD B;  1YJW T;  5GAO p;  1MHN A;  2FYK A;  4L5G A;  4C8Q A;  4FM4 B;  3CC4 T;  3CCM A;  1M1G A;  4E7K A;  4PJO G;  5DY9 A;  3OYL A;  2QTX A;  1TH7 A;  2QA4 T;  4M7A F;  3HL8 A;  1KG1 A;  2KY9 A;  3QG1 A;  4HKE A;  4JLI A;  4ELY C;  2QEX A;  5D6Y A;  1EIF A;  2JTM A;  3HRS A;  5HK0 A;  3G4S T;  2EJG A;  3SWN B;  3FRN A;  2LC4 A;  3CMA A;  4QVC A;  2M1H A;  5GMK j;  1OZ2 A;  3QSU A;  1YJW A;  3A5Z B;  3JB9 G;  4M7D G;  3CC4 A;  2FB7 A;  2RHI A;  3MEU A;  5LJ5 h;  1KD1 C;  4BAC A;  2E41 A;  1N6A A;  3CCS T;  2QA4 A;  4MMK A;  1H64 1;  3E1S A;  3SWN C;  2X35 A;  3GOX A;  3JB9 J;  4MML A;  2GF7 A;  1JRI A;  4C8Q F;  3V7R A;  1S72 T;  1B34 B;  3CBO A;  2HNI A;  3SWN A;  3G4S A;  1G3Y A;  1U8R A;  1VQK T;  3JCM Q;  3VYG A;  4NOY A;  2MAM A;  4BUG A;  1P92 A;  3FLG A;  3GP8 A;  3JB9 I;  4FSX A;  2JN0 A;  3OYK A;  2ZPI B;  2ZPE B;  2KK4 A;  1M1F A;  4DOW A;  3OYN A;  4M77 B;  5DLO A;  1KC8 U;  1WGS A;  3CCS A;  2JOY A;  4J6Y A;  2MI6 A;  2K2V A;  4M77 E;  4KUD K;  2BUD A;  3MO8 A;  3M56 A;  5GAM h;  1O9S A;  2QDY B;  3LWI A;  1S72 A;  3H8Z A;  4L6V 5;  2ZPH B;  5GAO n;  1VQK A;  2RI2 A;  2WSF E;  4M77 C;  3VUZ A;  5KCO A;  2FHD A;  2DTO A;  2RJD A;  3FEO A;  3JCM W;  3CXC A;  2G3R A;  4A53 A;  3DB3 A;  1Y96 B;  3NTK A;  4FT4 A;  4M77 A;  4JRQ A;  1Q86 U;  4C92 D;  1M9S A;  2E64 A;  4E7I A;  4KUL A;  1QVF S;  4QQD A;  4NS5 A;  4C0G A;  5GAN 4;  3OYH A;  1K8A C;  1M1K U;  1UB4 A;  3OBY A;  2XDD A;  2IG0 A;  3J81 E;  4DQ2 A;  1UGR B;  2CYZ B;  3QYG B;  4LDW A;  3SD4 A;  5GAN 3;  5KCH A;  2PVO B;  1BI3 A;  4M78 D;  4F7U E;  2EQK A;  2VC8 A;  3CPF A;  3MHX A;  4M77 G;  4PLL A;  4QQ6 A;  4NL3 A;  2EFI A;  3GNF B;  1Y96 A;  1WJS A;  1YIT T;  4E47 A;  4B9W A;  5GAN 2;  5GMK m;  2YLB A;  2F5K A;  3M4Y A;  2RB6 A;  3CBM A;  3OMC A;  4KBM B;  4RKU E;  2E1H A;  2DO3 A;  3E9F A;  4M7A D;  2B8A A;  5FRO A;  4BI4 A;  4ZN1 A;  4JDS A;  3JCM h;  4A54 A;  2K57 A;  3ME9 A;  3OMG A;  5D6W A;  5IAY A;  4BE1 A;  1BIA A;  4ELZ C;  4M75 B;  1JJ2 A;  4C92 A;  4O6J A;  4EMG A;  1M4Z A;  4M75 E;  3ZBD A;  1YIT A;  1LOJ A;  2LX9 A;  4J7F A;  4F7U G;  4N4G A;  2ZPB B;  3GLX A;  2OTJ T;  3MCA B;  5J39 A;  3OYD A;  3L42 A;  4OGE A;  2X4Y A;  3LH0 A;  4HCB A;  2WSE E;  4M75 C;  2EQU A;  2LNV A;  4XTZ A;  5A2Q E;  3E19 A;  2CGH A;  4XTU A;  2YHT A;  3P8B B;  1Q81 C;  2X4J A;  2GFU A;  3HPW A;  1IRE B;  1IZ6 A;  3PT9 A;  4OB3 B;  3JB9 D;  2E6N A;  2EJ9 A;  4J5Y A;  4BDY A;  4PJO B;  3FIF A;  1VQP T;  3QII A;  4IKF A;  2O4X B;  3QUI A;  4OP0 A;  2JNG A;  3OY9 A;  2OTJ A;  1M5Q 1;  1UEB A;  3URG A;  4J6W A;  4R55 A;  4M75 G;  4MZP A;  4DA4 A;  3BW1 A;  5CQX A;  2JVV A;  2HAX A;  4C92 F;  2X4X A;  2LQ8 A;  2F5T X;  3OS0 A;  3C94 A;  5J3B A;  3TU4 K;  4PJO C;  2CZ1 B;  2E5Q A;  1LJO A;  3BY7 A;  4LDU A;  3PIP A;  3L2W A;  3V8L A;  4A4F A;  2JTF A;  5GAN 5;  1Q82 C;  4M7D B;  2LQK A;  2ZPF B;  2QI2 A;  2Y4X A;  2DD4 A;  4VUB A;  4PJO A;  2E70 A;  5LJ3 e;  2O4X A;  1OZ3 A;  2L5Q A;  2RK1 A;  4JUV A;  4M78 F;  5I2M A;  3S3O A;  1BKB A;  2VXE A;  5FU7 B;  4FL6 A;  1VQP A;  1KD1 U;  3R6O A;  2EYQ A;  1JJ2 S;  2MMP A;  5FLX E;  2RM4 A;  4M7D C;  5D6X A;  1XNI A;  5GAO l;  5LL6 S;  2RHX A;  3BDU A;  1WNL A;  3DKM A;  4M7D A;  5GMK h;  3SFM A;  5FU7 C;  2NLU A;  2E10 A;  4XQ3 A;  1VQM T;  3M58 A;  2K3Y A;  3ASK A;  1I4K 1;  2LCL A;  3HFO A;  1NE8 A;  3M55 A;  3MEA A;  2CKK A;  2VGM A;  3L2Q A;  3CCL T;  1XQH A;  3JCM P;  1QVF A;  4YTL A;  2HQE A;  2LVM A;  3ZFJ A;  5GAM g;  3PTA A;  3M53 A;  3ZEH A;  2Y90 A;  4II1 A;  2RK2 A;  1VQL T;  1G5V A;  1VQ5 T;  3HFN A;  4RG2 A;  3JAM E;  4PJO F;  3CPW S;  5LJ3 f;  5LJ3 d;  4M77 D;  4LDY A;  5GMK l;  2K5L A;  1JBM A;  3T9N A;  1M90 U;  1VQM A;  4BE2 A;  1Q7Y C;  1I8F A;  3A8H B;  1G3W A;  1UGS B;  3QZ5 B;  4FIB A;  4PL6 A;  1K73 C;  1K9M U;  4LDV A;  3CCL A;  3MEV A;  2PUK B;  3FJP A;  3C12 A;  2DEQ A;  4IUT A;  1K8A U;  3JSC A;  3JB9 F;  4M7D F;  1VQ7 T;  4EPC A;  3VV0 A;  2I2L A;  3KXT A;  1VQL A;  4ZGD B;  1QP3 A;  3E9G A;  1VQ5 A;  5CO7 A;  2DXC A;  2RH2 A;  5C6S A;  2E65 A;  1KQ2 A;  5GAN h;  5LJ3 g;  1SSF A;  4A4K A;  1NPR A;  3VKI A;  4BI8 B;  1B34 A;  3MP1 A;  3SDZ A;  3RES A;  3UDC A;  1YJN T;  4L59 A;  3I56 T;  3PFS A;  4X9C A;  3JCM g;  2E12 A;  1Y71 A;  3ER0 A;  5IT9 E;  2XD0 A;  3DLM A;  1KHC A;  2V8I A;  3HRT A;  3OSV A;  2HD0 A;  2KMT A;  2DKG A;  1VQ7 A;  4HT9 A;  4R56 A;  1W4S A;  2PU9 B;  4HA8 A;  2XK0 A;  1ZQ1 A;  4JS4 A;  4OVA A;  2MF2 A;  2XG8 D;  3QJ6 A;  4F7U B;  5GMK i;  3X24 B;  3MET A;  2F69 A;  3S3N A;  3L2U A;  1YJN A;  4XAX B;  4C5H A;  1X6O A;  2K5I A;  2GQV A;  2QQA A;  3A8L B;  3HP9 A;  3LLR A;  2VYT A;  4OMF B;  5KE2 A;  1NPP A;  3I56 A;  2KDS A;  3TCJ A;  5CQY A;  3PMI A;  2X4W A;  4M75 D;  4MZT A;  1NJI C;  1M8V A;  2QXF A;  3J80 E;  5J26 A;  4XTV A;  5KH6 A;  5GAN 6;  3OS2 A;  4ATO A;  3CCU T;  1VQ6 T;  4FU6 A;  1XTD A;  1Q81 U;  4F7U A;  4ZGJ B;  3EAE A;  1VQ4 T;  2VXF A;  4XU3 A;  2A7Y A;  4P5N A;  4ZGE B;  4M77 F;  1QVG A;  3S6W A;  1G3T A;  4QQG A;  4UC4 A;  1XOV A;  3LWH A;  3S3M A;  2DIQ A;  1WJQ A;  3OYJ A;  3AHU A;  2DAQ A;  5L8R E;  2DD5 A;  4IUP A;  4BY6 B;  3G6E T;  2P0Q A;  3H6Z A;  2VGN A;  3JB9 H;  2KAF A;  1OYX A;  2K4Y A;  3KUF A;  2RHU A;  4RG8 A;  1YI2 T;  4J83 A;  4PJO D;  2CZ0 B;  3CCU A;  3EFS A;  2C06 A;  1VQ6 A;  2VUB A;  2RO0 A;  4IUR A;  5CKF A;  1KQ1 A;  1U1T A;  2RHY A;  5GAN 8;  4JJN K;  4CI0 C;  1Q82 U;  1VQ4 A;  5GAM e;  2XID A;  3X20 B;  3GNG A;  2M9U A;  4EDU A;  1Q86 C;  4C5E A;  4M75 A;  4DOV A;  5LJ5 d;  2QQR A;  2YRV A;  3M4G A;  3RKX A;  1U1S A;  5LJ3 j;  3DB4 A;  2L3R A;  2LTO A;  3QHS A;  1VUB A;  2IVW A;  3CCE T;  3P8H A;  3MP6 A;  3LYI A;  4F7U F;  4M7D D;  4QVZ A;  2QQ9 A;  3G6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...